5GOVA

Crystal structure of mcr-1, a phosphoethanolamine transferase, extracellular domain
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
Knots found
sequence length
323
structure length
321
Chain Sequence
DTIYHAKDAVQATKPMRKPRLVVFVVGETARADHVSFNGYERDTFPQLAKIDGVTNFSNVTSCGTSAYSVPCMFSYLGADEYDVDTAKYQENVLDTLDRLGVSILWRDNNSDSKGVMDKLPKAQFADYKSATNNAICNTNPYNECRDVGMLVGLDDFVAANNGKDMLIMLHQMGNHGPAYFKRYDEKFAKFTPVCEGNELAKCEHQSLINAYDNALLATDDFIAQSIQWLQTHSNAYDVSMLYVSDHGESLGENGVYLHGMPNAFAPKEQRSVPAFFWTDKQTGITPMATDTVLTHDAITPTLLKLFDVTADKVKDRTAFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable phosphatidylethanolamine transferase Mcr-1
publication title Crystal Structure of Escherichia coli originated MCR-1, a phosphoethanolamine transferase for Colistin Resistance
doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 117
structure length 321
sequence length 323
chains with identical sequence B
other databases KnotProt 2.0: S +31
ec nomenclature ec 2.7.-.-:
pdb deposition date 2016-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00884 Sulfatase Sulfatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 5govA00
2W5VA 2IFYA 4ZG9A 3M7VA 1K7HA 1O98A 4B56A 2ANHA 4UPKA 1P49A 4CYRA 1KHJA 1KH9A 3IDDA 1Y7AA 5TJ3A 1SHQA 3UN5A 4ZG6A 1E33P 4CYSA 3WAXA 5L0EA 3CMRA 3WBHA 1KHKA 3T01A 1KH5A 4UORA 4QAXA 5L0BA 4LQYA 4GTZA 3NVLA 3WAVA 3Q3QA 4UPLA 1AJCA 2W5TA 3BDFA 4KM4A 1ALJA 1EW8A 3B5QA 1ZEDA 4MY4A 1EW2A 2W5RA 1ED8A 4LR7A 1EI6A 4LREA 2GLQA 1E3CP 2GA3A 3BDGB 1ALIA 2X98A 2VQRA 3NKQA 3IGYB 4TN0A 4NWJA 4MIVA 4MHXA 2GSNA 4GTWA 1EW9A 1ELZA 1HQAA 2W5WA 1AUKA 3BDGA 1ALKA 3UNYA 2XR9A 1FSUA 2W5QA 3SZYA 1ED9A 2XRGA 3ED4A 4FDJA 5DLWA 4KAYA 3OT9A 5KXAA 2GSUA 3NKOA 3M8ZA 3TG0A 5EGHA 5GRRA 3NKPA 2ZKTA 5IJSA 5DLVA 3WAWA 4UOPA 1E2SP 2RH6A 3BDHA 3DYCA 2QZUA 3M8YA 5LRMA 3KD8A 1Y6VA 1AJAA 5HRTA 4LRCA 3WAYA 4LRBA 2W5XA 5GOVA 1KHLA 4CXKA 3NKRA 3A52A 3T02A 5LRNA 3UO0A 3M8WA 4LR2A 1KH7A 4YR1A 1ELXA 3MK2A 2G9YA 1URBA 4UPHA 4NWXA 2W5SA 4CXSA 5K4PA 1O99A 5IJQA 1HDHA 1KH4A 3TWZA 3MK1A 1ELYA 4LR8A 4ZGAA 4LRFA 1B8JA 4UOOA 2IUCB 3E2DA 1ZEFA 5LQQA 4FDIA 4KJGA 4LR9A 5DLTA 4LRAA 3UN3A 2W8DA 2GSOA 2W8SA 4UPIA 5AJ9A 1ANIA 5L0KA 3DPCA 3IGZB 1KHNA 3SZZA 2IUCA 3NKMA 3MK0A 1EJJA 1URAA 5C66A 1AJBA 1HJKA 1N2KA 3UN2A 4GTXA 4KJDA 4GTYA 1ZEBA 1ANJA 1N2LA 5INHA 4CXUA 3NKNA 4LRDA 1AJDA 4ZG7A 1E1ZP 3TX0A 1EQJA 4KAVA 3LXQA 4N7TA 1ALHA 5EGEA 3T00A 2D1GA 5LIAA 1SHNA
chains in the Genus database with same CATH superfamily
2W5VA 2IFYA 4ZG9A 3M7VA 1K7HA 1O98A 4B56A 2ANHA 4UPKA 1P49A 4CYRA 1KHJA 1KH9A 3IDDA 1Y7AA 5TJ3A 1SHQA 3UN5A 4ZG6A 1E33P 4CYSA 3WAXA 5L0EA 3CMRA 3WBHA 1KHKA 3T01A 1KH5A 4UORA 4QAXA 5L0BA 4LQYA 4GTZA 3NVLA 3WAVA 3Q3QA 4UPLA 1AJCA 2W5TA 3BDFA 4KM4A 1ALJA 1EW8A 3B5QA 1ZEDA 4MY4A 1EW2A 2W5RA 1ED8A 4LR7A 1EI6A 4LREA 2GLQA 1E3CP 2GA3A 3BDGB 1ALIA 2X98A 2VQRA 3NKQA 3IGYB 4TN0A 4NWJA 4MIVA 4MHXA 2GSNA 4GTWA 1EW9A 1ELZA 1HQAA 2W5WA 1AUKA 3BDGA 1ALKA 3UNYA 2XR9A 1FSUA 2W5QA 3SZYA 1ED9A 2XRGA 3ED4A 4FDJA 5DLWA 4KAYA 3OT9A 5KXAA 2GSUA 3NKOA 3M8ZA 3TG0A 5EGHA 5GRRA 3NKPA 2ZKTA 5IJSA 5DLVA 3WAWA 4UOPA 1E2SP 2RH6A 3BDHA 3DYCA 2QZUA 3M8YA 5LRMA 3KD8A 1Y6VA 1AJAA 5HRTA 4LRCA 3WAYA 4LRBA 2W5XA 5GOVA 1KHLA 4CXKA 3NKRA 3A52A 3T02A 5LRNA 3UO0A 3M8WA 4LR2A 1KH7A 4YR1A 1ELXA 3MK2A 2G9YA 1URBA 4UPHA 4NWXA 2W5SA 4CXSA 5K4PA 1O99A 5IJQA 1HDHA 1KH4A 3TWZA 3MK1A 1ELYA 4LR8A 4ZGAA 4LRFA 1B8JA 4UOOA 2IUCB 3E2DA 1ZEFA 5LQQA 4FDIA 4KJGA 4LR9A 5DLTA 4LRAA 3UN3A 2W8DA 2GSOA 2W8SA 4UPIA 5AJ9A 1ANIA 5L0KA 3DPCA 3IGZB 1KHNA 3SZZA 2IUCA 3NKMA 3MK0A 1EJJA 1URAA 5C66A 1AJBA 1HJKA 1N2KA 3UN2A 4GTXA 4KJDA 4GTYA 1ZEBA 1ANJA 1N2LA 5INHA 4CXUA 3NKNA 4LRDA 1AJDA 4ZG7A 1E1ZP 3TX0A 1EQJA 4KAVA 3LXQA 4N7TA 1ALHA 5EGEA 3T00A 2D1GA 5LIAA 1SHNA
chains in the Genus database with same CATH topology
2W5VA 2IFYA 4ZG9A 3M7VA 1K7HA 1O98A 4B56A 2ANHA 4UPKA 1P49A 4CYRA 1KHJA 1KH9A 3IDDA 1Y7AA 5TJ3A 1SHQA 3UN5A 4ZG6A 1E33P 4CYSA 3WAXA 5L0EA 3CMRA 3WBHA 1KHKA 3T01A 1KH5A 4UORA 4QAXA 5L0BA 4LQYA 4GTZA 3NVLA 3WAVA 3Q3QA 4UPLA 1AJCA 2W5TA 3BDFA 4KM4A 1ALJA 1EW8A 3B5QA 1ZEDA 4MY4A 1EW2A 2W5RA 1ED8A 4LR7A 1EI6A 4LREA 2GLQA 1E3CP 2GA3A 3BDGB 1ALIA 2X98A 2VQRA 3NKQA 3IGYB 4TN0A 4NWJA 4MIVA 4MHXA 2GSNA 4GTWA 1EW9A 1ELZA 1HQAA 2W5WA 1AUKA 3BDGA 1ALKA 3UNYA 2XR9A 1FSUA 2W5QA 3SZYA 1ED9A 2XRGA 3ED4A 4FDJA 5DLWA 4KAYA 3OT9A 5KXAA 2GSUA 3NKOA 3M8ZA 3TG0A 5EGHA 5GRRA 3NKPA 2ZKTA 5IJSA 5DLVA 3WAWA 4UOPA 1E2SP 2RH6A 3BDHA 3DYCA 2QZUA 3M8YA 5LRMA 3KD8A 1Y6VA 1AJAA 5HRTA 4LRCA 3WAYA 4LRBA 2W5XA 5GOVA 1KHLA 4CXKA 3NKRA 3A52A 3T02A 5LRNA 3UO0A 3M8WA 4LR2A 1KH7A 4YR1A 1ELXA 3MK2A 2G9YA 1URBA 4UPHA 4NWXA 2W5SA 4CXSA 5K4PA 1O99A 5IJQA 1HDHA 1KH4A 3TWZA 3MK1A 1ELYA 4LR8A 4ZGAA 4LRFA 1B8JA 4UOOA 2IUCB 3E2DA 1ZEFA 5LQQA 4FDIA 4KJGA 4LR9A 5DLTA 4LRAA 3UN3A 2W8DA 2GSOA 2W8SA 4UPIA 5AJ9A 1ANIA 5L0KA 3DPCA 3IGZB 1KHNA 3SZZA 2IUCA 3NKMA 3MK0A 1EJJA 1URAA 5C66A 1AJBA 1HJKA 1N2KA 3UN2A 4GTXA 4KJDA 4GTYA 1ZEBA 1ANJA 1N2LA 5INHA 4CXUA 3NKNA 4LRDA 1AJDA 4ZG7A 1E1ZP 3TX0A 1EQJA 4KAVA 3LXQA 4N7TA 1ALHA 5EGEA 3T00A 2D1GA 5LIAA 1SHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W5V A;  2IFY A;  4ZG9 A;  3M7V A;  1K7H A;  1O98 A;  4B56 A;  2ANH A;  4UPK A;  1P49 A;  4CYR A;  1KHJ A;  1KH9 A;  3IDD A;  1Y7A A;  5TJ3 A;  1SHQ A;  3UN5 A;  4ZG6 A;  1E33 P;  4CYS A;  3WAX A;  5L0E A;  3CMR A;  3WBH A;  1KHK A;  3T01 A;  1KH5 A;  4UOR A;  4QAX A;  5L0B A;  4LQY A;  4GTZ A;  3NVL A;  3WAV A;  3Q3Q A;  4UPL A;  1AJC A;  2W5T A;  3BDF A;  4KM4 A;  1ALJ A;  1EW8 A;  3B5Q A;  1ZED A;  4MY4 A;  1EW2 A;  2W5R A;  1ED8 A;  4LR7 A;  1EI6 A;  4LRE A;  2GLQ A;  1E3C P;  2GA3 A;  3BDG B;  1ALI A;  2X98 A;  2VQR A;  3NKQ A;  3IGY B;  4TN0 A;  4NWJ A;  4MIV A;  4MHX A;  2GSN A;  4GTW A;  1EW9 A;  1ELZ A;  1HQA A;  2W5W A;  1AUK A;  3BDG A;  1ALK A;  3UNY A;  2XR9 A;  1FSU A;  2W5Q A;  3SZY A;  1ED9 A;  2XRG A;  3ED4 A;  4FDJ A;  5DLW A;  4KAY A;  3OT9 A;  5KXA A;  2GSU A;  3NKO A;  3M8Z A;  3TG0 A;  5EGH A;  5GRR A;  3NKP A;  2ZKT A;  5IJS A;  5DLV A;  3WAW A;  4UOP A;  1E2S P;  2RH6 A;  3BDH A;  3DYC A;  2QZU A;  3M8Y A;  5LRM A;  3KD8 A;  1Y6V A;  1AJA A;  5HRT A;  4LRC A;  3WAY A;  4LRB A;  2W5X A;  5GOV A;  1KHL A;  4CXK A;  3NKR A;  3A52 A;  3T02 A;  5LRN A;  3UO0 A;  3M8W A;  4LR2 A;  1KH7 A;  4YR1 A;  1ELX A;  3MK2 A;  2G9Y A;  1URB A;  4UPH A;  4NWX A;  2W5S A;  4CXS A;  5K4P A;  1O99 A;  5IJQ A;  1HDH A;  1KH4 A;  3TWZ A;  3MK1 A;  1ELY A;  4LR8 A;  4ZGA A;  4LRF A;  1B8J A;  4UOO A;  2IUC B;  3E2D A;  1ZEF A;  5LQQ A;  4FDI A;  4KJG A;  4LR9 A;  5DLT A;  4LRA A;  3UN3 A;  2W8D A;  2GSO A;  2W8S A;  4UPI A;  5AJ9 A;  1ANI A;  5L0K A;  3DPC A;  3IGZ B;  1KHN A;  3SZZ A;  2IUC A;  3NKM A;  3MK0 A;  1EJJ A;  1URA A;  5C66 A;  1AJB A;  1HJK A;  1N2K A;  3UN2 A;  4GTX A;  4KJD A;  4GTY A;  1ZEB A;  1ANJ A;  1N2L A;  5INH A;  4CXU A;  3NKN A;  4LRD A;  1AJD A;  4ZG7 A;  1E1Z P;  3TX0 A;  1EQJ A;  4KAV A;  3LXQ A;  4N7T A;  1ALH A;  5EGE A;  3T00 A;  2D1G A;  5LIA A;  1SHN A; 
#chains in the Genus database with same CATH topology
 2W5V A;  2IFY A;  4ZG9 A;  3M7V A;  1K7H A;  1O98 A;  4B56 A;  2ANH A;  4UPK A;  1P49 A;  4CYR A;  1KHJ A;  1KH9 A;  3IDD A;  1Y7A A;  5TJ3 A;  1SHQ A;  3UN5 A;  4ZG6 A;  1E33 P;  4CYS A;  3WAX A;  5L0E A;  3CMR A;  3WBH A;  1KHK A;  3T01 A;  1KH5 A;  4UOR A;  4QAX A;  5L0B A;  4LQY A;  4GTZ A;  3NVL A;  3WAV A;  3Q3Q A;  4UPL A;  1AJC A;  2W5T A;  3BDF A;  4KM4 A;  1ALJ A;  1EW8 A;  3B5Q A;  1ZED A;  4MY4 A;  1EW2 A;  2W5R A;  1ED8 A;  4LR7 A;  1EI6 A;  4LRE A;  2GLQ A;  1E3C P;  2GA3 A;  3BDG B;  1ALI A;  2X98 A;  2VQR A;  3NKQ A;  3IGY B;  4TN0 A;  4NWJ A;  4MIV A;  4MHX A;  2GSN A;  4GTW A;  1EW9 A;  1ELZ A;  1HQA A;  2W5W A;  1AUK A;  3BDG A;  1ALK A;  3UNY A;  2XR9 A;  1FSU A;  2W5Q A;  3SZY A;  1ED9 A;  2XRG A;  3ED4 A;  4FDJ A;  5DLW A;  4KAY A;  3OT9 A;  5KXA A;  2GSU A;  3NKO A;  3M8Z A;  3TG0 A;  5EGH A;  5GRR A;  3NKP A;  2ZKT A;  5IJS A;  5DLV A;  3WAW A;  4UOP A;  1E2S P;  2RH6 A;  3BDH A;  3DYC A;  2QZU A;  3M8Y A;  5LRM A;  3KD8 A;  1Y6V A;  1AJA A;  5HRT A;  4LRC A;  3WAY A;  4LRB A;  2W5X A;  5GOV A;  1KHL A;  4CXK A;  3NKR A;  3A52 A;  3T02 A;  5LRN A;  3UO0 A;  3M8W A;  4LR2 A;  1KH7 A;  4YR1 A;  1ELX A;  3MK2 A;  2G9Y A;  1URB A;  4UPH A;  4NWX A;  2W5S A;  4CXS A;  5K4P A;  1O99 A;  5IJQ A;  1HDH A;  1KH4 A;  3TWZ A;  3MK1 A;  1ELY A;  4LR8 A;  4ZGA A;  4LRF A;  1B8J A;  4UOO A;  2IUC B;  3E2D A;  1ZEF A;  5LQQ A;  4FDI A;  4KJG A;  4LR9 A;  5DLT A;  4LRA A;  3UN3 A;  2W8D A;  2GSO A;  2W8S A;  4UPI A;  5AJ9 A;  1ANI A;  5L0K A;  3DPC A;  3IGZ B;  1KHN A;  3SZZ A;  2IUC A;  3NKM A;  3MK0 A;  1EJJ A;  1URA A;  5C66 A;  1AJB A;  1HJK A;  1N2K A;  3UN2 A;  4GTX A;  4KJD A;  4GTY A;  1ZEB A;  1ANJ A;  1N2L A;  5INH A;  4CXU A;  3NKN A;  4LRD A;  1AJD A;  4ZG7 A;  1E1Z P;  3TX0 A;  1EQJ A;  4KAV A;  3LXQ A;  4N7T A;  1ALH A;  5EGE A;  3T00 A;  2D1G A;  5LIA A;  1SHN A; 
#chains in the Genus database with same CATH homology
 2W5V A;  2IFY A;  4ZG9 A;  3M7V A;  1K7H A;  1O98 A;  4B56 A;  2ANH A;  4UPK A;  1P49 A;  4CYR A;  1KHJ A;  1KH9 A;  3IDD A;  1Y7A A;  5TJ3 A;  1SHQ A;  3UN5 A;  4ZG6 A;  1E33 P;  4CYS A;  3WAX A;  5L0E A;  3CMR A;  3WBH A;  1KHK A;  3T01 A;  1KH5 A;  4UOR A;  4QAX A;  5L0B A;  4LQY A;  4GTZ A;  3NVL A;  3WAV A;  3Q3Q A;  4UPL A;  1AJC A;  2W5T A;  3BDF A;  4KM4 A;  1ALJ A;  1EW8 A;  3B5Q A;  1ZED A;  4MY4 A;  1EW2 A;  2W5R A;  1ED8 A;  4LR7 A;  1EI6 A;  4LRE A;  2GLQ A;  1E3C P;  2GA3 A;  3BDG B;  1ALI A;  2X98 A;  2VQR A;  3NKQ A;  3IGY B;  4TN0 A;  4NWJ A;  4MIV A;  4MHX A;  2GSN A;  4GTW A;  1EW9 A;  1ELZ A;  1HQA A;  2W5W A;  1AUK A;  3BDG A;  1ALK A;  3UNY A;  2XR9 A;  1FSU A;  2W5Q A;  3SZY A;  1ED9 A;  2XRG A;  3ED4 A;  4FDJ A;  5DLW A;  4KAY A;  3OT9 A;  5KXA A;  2GSU A;  3NKO A;  3M8Z A;  3TG0 A;  5EGH A;  5GRR A;  3NKP A;  2ZKT A;  5IJS A;  5DLV A;  3WAW A;  4UOP A;  1E2S P;  2RH6 A;  3BDH A;  3DYC A;  2QZU A;  3M8Y A;  5LRM A;  3KD8 A;  1Y6V A;  1AJA A;  5HRT A;  4LRC A;  3WAY A;  4LRB A;  2W5X A;  5GOV A;  1KHL A;  4CXK A;  3NKR A;  3A52 A;  3T02 A;  5LRN A;  3UO0 A;  3M8W A;  4LR2 A;  1KH7 A;  4YR1 A;  1ELX A;  3MK2 A;  2G9Y A;  1URB A;  4UPH A;  4NWX A;  2W5S A;  4CXS A;  5K4P A;  1O99 A;  5IJQ A;  1HDH A;  1KH4 A;  3TWZ A;  3MK1 A;  1ELY A;  4LR8 A;  4ZGA A;  4LRF A;  1B8J A;  4UOO A;  2IUC B;  3E2D A;  1ZEF A;  5LQQ A;  4FDI A;  4KJG A;  4LR9 A;  5DLT A;  4LRA A;  3UN3 A;  2W8D A;  2GSO A;  2W8S A;  4UPI A;  5AJ9 A;  1ANI A;  5L0K A;  3DPC A;  3IGZ B;  1KHN A;  3SZZ A;  2IUC A;  3NKM A;  3MK0 A;  1EJJ A;  1URA A;  5C66 A;  1AJB A;  1HJK A;  1N2K A;  3UN2 A;  4GTX A;  4KJD A;  4GTY A;  1ZEB A;  1ANJ A;  1N2L A;  5INH A;  4CXU A;  3NKN A;  4LRD A;  1AJD A;  4ZG7 A;  1E1Z P;  3TX0 A;  1EQJ A;  4KAV A;  3LXQ A;  4N7T A;  1ALH A;  5EGE A;  3T00 A;  2D1G A;  5LIA A;  1SHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...