5GOVA

Crystal structure of mcr-1, a phosphoethanolamine transferase, extracellular domain
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
Knots found
sequence length
323
structure length
321
Chain Sequence
DTIYHAKDAVQATKPMRKPRLVVFVVGETARADHVSFNGYERDTFPQLAKIDGVTNFSNVTSCGTSAYSVPCMFSYLGADEYDVDTAKYQENVLDTLDRLGVSILWRDNNSDSKGVMDKLPKAQFADYKSATNNAICNTNPYNECRDVGMLVGLDDFVAANNGKDMLIMLHQMGNHGPAYFKRYDEKFAKFTPVCEGNELAKCEHQSLINAYDNALLATDDFIAQSIQWLQTHSNAYDVSMLYVSDHGESLGENGVYLHGMPNAFAPKEQRSVPAFFWTDKQTGITPMATDTVLTHDAITPTLLKLFDVTADKVKDRTAFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Probable phosphatidylethanolamine transferase Mcr-1
publication title Crystal Structure of Escherichia coli originated MCR-1, a phosphoethanolamine transferase for Colistin Resistance
doi rcsb
source organism Escherichia coli
total genus 117
structure length 321
sequence length 323
chains with identical sequence B
other databases KnotProt 2.0: S +31
ec nomenclature ec 2.7.-.-:
pdb deposition date 2016-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00884 Sulfatase Sulfatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 5govA00
3M8ZA 1EW9A 2GSNA 1E1ZP 3NKPA 1ALJA 1N2KA 4ZG7A 4CXUA 4LRDA 3B5QA 3NKNA 1SHQA 3LXQA 4UPIA 4KAVA 5EGHA 4LRAA 1ZEDA 1KHNA 1Y7AA 2GSUA 3NKQA 2W5XA 3NKMA 3Q3QA 3WBHA 3WAYA 3BDGB 3TWZA 3NKRA 2GLQA 1E3CP 5AJ9A 5GRRA 1ANJA 5INHA 3TX0A 5C66A 2XRGA 3MK1A 3E2DA 1KH9A 2G9YA 1O99A 3M7VA 2W5RA 4UOPA 3IGYB 4NWJA 4LR9A 3BDHA 3UNYA 4LRBA 5K4PA 1B8JA 3M8WA 4N7TA 1ALKA 3IGZB 2VQRA 3UN5A 5DLVA 4CYRA 5IJQA 1AJDA 4LR8A 3UN3A 1EW2A 2GA3A 4TN0A 2IUCA 1URBA 4UPKA 1ELXA 3UN2A 5L0BA 5LQQA 3A52A 4ZGAA 1E2SP 1KHKA 5LRMA 1EI6A 3T02A 3DYCA 3MK0A 5TJ3A 5IJSA 1HJKA 3M8YA 3NVLA 4UOOA 1ANIA 1KH4A 4UPHA 4GTXA 1Y6VA 1KH7A 4LREA 5LIAA 1N2LA 3WAXA 4KM4A 4UPLA 4LR2A 2W5WA 4LRFA 1ALHA 1ED8A 4YR1A 3IDDA 3WAWA 5L0EA 4CXSA 1AUKA 3MK2A 2W8SA 4LQYA 1AJBA 3NKOA 2X98A 3BDGA 3CMRA 1ELYA 1EQJA 5HRTA 1KHLA 1ED9A 4FDJA 4MHXA 4CYSA 4ZG6A 5KXAA 4FDIA 3OT9A 3SZYA 4LR7A 2W5TA 2GSOA 3ED4A 1ZEBA 5EGEA 4MY4A 2W8DA 5GOVA 1EW8A 4MIVA 4CXKA 1O98A 2XR9A 4KJGA 5DLWA 1KH5A 3T01A 1ALIA 4KAYA 1EJJA 1SHNA 4LRCA 3BDFA 5LRNA 4GTYA 5DLTA 2RH6A 1HDHA 4ZG9A 2D1GA 4KJDA 3SZZA 1P49A 1HQAA 4GTWA 1AJCA 4QAXA 4UORA 2QZUA 3UO0A 4B56A 3TG0A 1K7HA 3T00A 5L0KA 2W5VA 1KHJA 2ZKTA 4GTZA 3WAVA 1FSUA 2ANHA 1ELZA 2IUCB 2W5QA 1AJAA 3KD8A 1ZEFA 2IFYA 2W5SA 4NWXA 1E33P 3DPCA 1URAA
chains in the Genus database with same CATH superfamily
3M8ZA 1EW9A 2GSNA 1E1ZP 3NKPA 1ALJA 1N2KA 4ZG7A 4CXUA 4LRDA 3B5QA 3NKNA 1SHQA 3LXQA 4UPIA 4KAVA 5EGHA 4LRAA 1ZEDA 1KHNA 1Y7AA 2GSUA 3NKQA 2W5XA 3NKMA 3Q3QA 3WBHA 3WAYA 3BDGB 3TWZA 3NKRA 2GLQA 1E3CP 5AJ9A 5GRRA 1ANJA 5INHA 3TX0A 5C66A 2XRGA 3MK1A 3E2DA 1KH9A 2G9YA 1O99A 3M7VA 2W5RA 4UOPA 3IGYB 4NWJA 4LR9A 3BDHA 3UNYA 4LRBA 5K4PA 1B8JA 3M8WA 4N7TA 1ALKA 3IGZB 2VQRA 3UN5A 5DLVA 4CYRA 5IJQA 1AJDA 4LR8A 3UN3A 1EW2A 2GA3A 4TN0A 2IUCA 1URBA 4UPKA 1ELXA 3UN2A 5L0BA 5LQQA 3A52A 4ZGAA 1E2SP 1KHKA 5LRMA 1EI6A 3T02A 3DYCA 3MK0A 5TJ3A 5IJSA 1HJKA 3M8YA 3NVLA 4UOOA 1ANIA 1KH4A 4UPHA 4GTXA 1Y6VA 1KH7A 4LREA 5LIAA 1N2LA 3WAXA 4KM4A 4UPLA 4LR2A 2W5WA 4LRFA 1ALHA 1ED8A 4YR1A 3IDDA 3WAWA 5L0EA 4CXSA 1AUKA 3MK2A 2W8SA 4LQYA 1AJBA 3NKOA 2X98A 3BDGA 3CMRA 1ELYA 1EQJA 5HRTA 1KHLA 1ED9A 4FDJA 4MHXA 4CYSA 4ZG6A 5KXAA 4FDIA 3OT9A 3SZYA 4LR7A 2W5TA 2GSOA 3ED4A 1ZEBA 5EGEA 4MY4A 2W8DA 5GOVA 1EW8A 4MIVA 4CXKA 1O98A 2XR9A 4KJGA 5DLWA 1KH5A 3T01A 1ALIA 4KAYA 1EJJA 1SHNA 4LRCA 3BDFA 5LRNA 4GTYA 5DLTA 2RH6A 1HDHA 4ZG9A 2D1GA 4KJDA 3SZZA 1P49A 1HQAA 4GTWA 1AJCA 4QAXA 4UORA 2QZUA 3UO0A 4B56A 3TG0A 1K7HA 3T00A 5L0KA 2W5VA 1KHJA 2ZKTA 4GTZA 3WAVA 1FSUA 2ANHA 1ELZA 2IUCB 2W5QA 1AJAA 3KD8A 1ZEFA 2IFYA 2W5SA 4NWXA 1E33P 3DPCA 1URAA
chains in the Genus database with same CATH topology
3M8ZA 1EW9A 2GSNA 1E1ZP 3NKPA 1ALJA 1N2KA 4ZG7A 4CXUA 4LRDA 3B5QA 3NKNA 1SHQA 3LXQA 4UPIA 4KAVA 5EGHA 4LRAA 1ZEDA 1KHNA 1Y7AA 2GSUA 3NKQA 2W5XA 3NKMA 3Q3QA 3WBHA 3WAYA 3BDGB 3TWZA 3NKRA 2GLQA 1E3CP 5AJ9A 5GRRA 1ANJA 5INHA 3TX0A 5C66A 2XRGA 3MK1A 3E2DA 1KH9A 2G9YA 1O99A 3M7VA 2W5RA 4UOPA 3IGYB 4NWJA 4LR9A 3BDHA 3UNYA 4LRBA 5K4PA 1B8JA 3M8WA 4N7TA 1ALKA 3IGZB 2VQRA 3UN5A 5DLVA 4CYRA 5IJQA 1AJDA 4LR8A 3UN3A 1EW2A 2GA3A 4TN0A 2IUCA 1URBA 4UPKA 1ELXA 3UN2A 5L0BA 5LQQA 3A52A 4ZGAA 1E2SP 1KHKA 5LRMA 1EI6A 3T02A 3DYCA 3MK0A 5TJ3A 5IJSA 1HJKA 3M8YA 3NVLA 4UOOA 1ANIA 1KH4A 4UPHA 4GTXA 1Y6VA 1KH7A 4LREA 5LIAA 1N2LA 3WAXA 4KM4A 4UPLA 4LR2A 2W5WA 4LRFA 1ALHA 1ED8A 4YR1A 3IDDA 3WAWA 5L0EA 4CXSA 1AUKA 3MK2A 2W8SA 4LQYA 1AJBA 3NKOA 2X98A 3BDGA 3CMRA 1ELYA 1EQJA 5HRTA 1KHLA 1ED9A 4FDJA 4MHXA 4CYSA 4ZG6A 5KXAA 4FDIA 3OT9A 3SZYA 4LR7A 2W5TA 2GSOA 3ED4A 1ZEBA 5EGEA 4MY4A 2W8DA 5GOVA 1EW8A 4MIVA 4CXKA 1O98A 2XR9A 4KJGA 5DLWA 1KH5A 3T01A 1ALIA 4KAYA 1EJJA 1SHNA 4LRCA 3BDFA 5LRNA 4GTYA 5DLTA 2RH6A 1HDHA 4ZG9A 2D1GA 4KJDA 3SZZA 1P49A 1HQAA 4GTWA 1AJCA 4QAXA 4UORA 2QZUA 3UO0A 4B56A 3TG0A 1K7HA 3T00A 5L0KA 2W5VA 1KHJA 2ZKTA 4GTZA 3WAVA 1FSUA 2ANHA 1ELZA 2IUCB 2W5QA 1AJAA 3KD8A 1ZEFA 2IFYA 2W5SA 4NWXA 1E33P 3DPCA 1URAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M8Z A;  1EW9 A;  2GSN A;  1E1Z P;  3NKP A;  1ALJ A;  1N2K A;  4ZG7 A;  4CXU A;  4LRD A;  3B5Q A;  3NKN A;  1SHQ A;  3LXQ A;  4UPI A;  4KAV A;  5EGH A;  4LRA A;  1ZED A;  1KHN A;  1Y7A A;  2GSU A;  3NKQ A;  2W5X A;  3NKM A;  3Q3Q A;  3WBH A;  3WAY A;  3BDG B;  3TWZ A;  3NKR A;  2GLQ A;  1E3C P;  5AJ9 A;  5GRR A;  1ANJ A;  5INH A;  3TX0 A;  5C66 A;  2XRG A;  3MK1 A;  3E2D A;  1KH9 A;  2G9Y A;  1O99 A;  3M7V A;  2W5R A;  4UOP A;  3IGY B;  4NWJ A;  4LR9 A;  3BDH A;  3UNY A;  4LRB A;  5K4P A;  1B8J A;  3M8W A;  4N7T A;  1ALK A;  3IGZ B;  2VQR A;  3UN5 A;  5DLV A;  4CYR A;  5IJQ A;  1AJD A;  4LR8 A;  3UN3 A;  1EW2 A;  2GA3 A;  4TN0 A;  2IUC A;  1URB A;  4UPK A;  1ELX A;  3UN2 A;  5L0B A;  5LQQ A;  3A52 A;  4ZGA A;  1E2S P;  1KHK A;  5LRM A;  1EI6 A;  3T02 A;  3DYC A;  3MK0 A;  5TJ3 A;  5IJS A;  1HJK A;  3M8Y A;  3NVL A;  4UOO A;  1ANI A;  1KH4 A;  4UPH A;  4GTX A;  1Y6V A;  1KH7 A;  4LRE A;  5LIA A;  1N2L A;  3WAX A;  4KM4 A;  4UPL A;  4LR2 A;  2W5W A;  4LRF A;  1ALH A;  1ED8 A;  4YR1 A;  3IDD A;  3WAW A;  5L0E A;  4CXS A;  1AUK A;  3MK2 A;  2W8S A;  4LQY A;  1AJB A;  3NKO A;  2X98 A;  3BDG A;  3CMR A;  1ELY A;  1EQJ A;  5HRT A;  1KHL A;  1ED9 A;  4FDJ A;  4MHX A;  4CYS A;  4ZG6 A;  5KXA A;  4FDI A;  3OT9 A;  3SZY A;  4LR7 A;  2W5T A;  2GSO A;  3ED4 A;  1ZEB A;  5EGE A;  4MY4 A;  2W8D A;  5GOV A;  1EW8 A;  4MIV A;  4CXK A;  1O98 A;  2XR9 A;  4KJG A;  5DLW A;  1KH5 A;  3T01 A;  1ALI A;  4KAY A;  1EJJ A;  1SHN A;  4LRC A;  3BDF A;  5LRN A;  4GTY A;  5DLT A;  2RH6 A;  1HDH A;  4ZG9 A;  2D1G A;  4KJD A;  3SZZ A;  1P49 A;  1HQA A;  4GTW A;  1AJC A;  4QAX A;  4UOR A;  2QZU A;  3UO0 A;  4B56 A;  3TG0 A;  1K7H A;  3T00 A;  5L0K A;  2W5V A;  1KHJ A;  2ZKT A;  4GTZ A;  3WAV A;  1FSU A;  2ANH A;  1ELZ A;  2IUC B;  2W5Q A;  1AJA A;  3KD8 A;  1ZEF A;  2IFY A;  2W5S A;  4NWX A;  1E33 P;  3DPC A;  1URA A; 
#chains in the Genus database with same CATH topology
 3M8Z A;  1EW9 A;  2GSN A;  1E1Z P;  3NKP A;  1ALJ A;  1N2K A;  4ZG7 A;  4CXU A;  4LRD A;  3B5Q A;  3NKN A;  1SHQ A;  3LXQ A;  4UPI A;  4KAV A;  5EGH A;  4LRA A;  1ZED A;  1KHN A;  1Y7A A;  2GSU A;  3NKQ A;  2W5X A;  3NKM A;  3Q3Q A;  3WBH A;  3WAY A;  3BDG B;  3TWZ A;  3NKR A;  2GLQ A;  1E3C P;  5AJ9 A;  5GRR A;  1ANJ A;  5INH A;  3TX0 A;  5C66 A;  2XRG A;  3MK1 A;  3E2D A;  1KH9 A;  2G9Y A;  1O99 A;  3M7V A;  2W5R A;  4UOP A;  3IGY B;  4NWJ A;  4LR9 A;  3BDH A;  3UNY A;  4LRB A;  5K4P A;  1B8J A;  3M8W A;  4N7T A;  1ALK A;  3IGZ B;  2VQR A;  3UN5 A;  5DLV A;  4CYR A;  5IJQ A;  1AJD A;  4LR8 A;  3UN3 A;  1EW2 A;  2GA3 A;  4TN0 A;  2IUC A;  1URB A;  4UPK A;  1ELX A;  3UN2 A;  5L0B A;  5LQQ A;  3A52 A;  4ZGA A;  1E2S P;  1KHK A;  5LRM A;  1EI6 A;  3T02 A;  3DYC A;  3MK0 A;  5TJ3 A;  5IJS A;  1HJK A;  3M8Y A;  3NVL A;  4UOO A;  1ANI A;  1KH4 A;  4UPH A;  4GTX A;  1Y6V A;  1KH7 A;  4LRE A;  5LIA A;  1N2L A;  3WAX A;  4KM4 A;  4UPL A;  4LR2 A;  2W5W A;  4LRF A;  1ALH A;  1ED8 A;  4YR1 A;  3IDD A;  3WAW A;  5L0E A;  4CXS A;  1AUK A;  3MK2 A;  2W8S A;  4LQY A;  1AJB A;  3NKO A;  2X98 A;  3BDG A;  3CMR A;  1ELY A;  1EQJ A;  5HRT A;  1KHL A;  1ED9 A;  4FDJ A;  4MHX A;  4CYS A;  4ZG6 A;  5KXA A;  4FDI A;  3OT9 A;  3SZY A;  4LR7 A;  2W5T A;  2GSO A;  3ED4 A;  1ZEB A;  5EGE A;  4MY4 A;  2W8D A;  5GOV A;  1EW8 A;  4MIV A;  4CXK A;  1O98 A;  2XR9 A;  4KJG A;  5DLW A;  1KH5 A;  3T01 A;  1ALI A;  4KAY A;  1EJJ A;  1SHN A;  4LRC A;  3BDF A;  5LRN A;  4GTY A;  5DLT A;  2RH6 A;  1HDH A;  4ZG9 A;  2D1G A;  4KJD A;  3SZZ A;  1P49 A;  1HQA A;  4GTW A;  1AJC A;  4QAX A;  4UOR A;  2QZU A;  3UO0 A;  4B56 A;  3TG0 A;  1K7H A;  3T00 A;  5L0K A;  2W5V A;  1KHJ A;  2ZKT A;  4GTZ A;  3WAV A;  1FSU A;  2ANH A;  1ELZ A;  2IUC B;  2W5Q A;  1AJA A;  3KD8 A;  1ZEF A;  2IFY A;  2W5S A;  4NWX A;  1E33 P;  3DPC A;  1URA A; 
#chains in the Genus database with same CATH homology
 3M8Z A;  1EW9 A;  2GSN A;  1E1Z P;  3NKP A;  1ALJ A;  1N2K A;  4ZG7 A;  4CXU A;  4LRD A;  3B5Q A;  3NKN A;  1SHQ A;  3LXQ A;  4UPI A;  4KAV A;  5EGH A;  4LRA A;  1ZED A;  1KHN A;  1Y7A A;  2GSU A;  3NKQ A;  2W5X A;  3NKM A;  3Q3Q A;  3WBH A;  3WAY A;  3BDG B;  3TWZ A;  3NKR A;  2GLQ A;  1E3C P;  5AJ9 A;  5GRR A;  1ANJ A;  5INH A;  3TX0 A;  5C66 A;  2XRG A;  3MK1 A;  3E2D A;  1KH9 A;  2G9Y A;  1O99 A;  3M7V A;  2W5R A;  4UOP A;  3IGY B;  4NWJ A;  4LR9 A;  3BDH A;  3UNY A;  4LRB A;  5K4P A;  1B8J A;  3M8W A;  4N7T A;  1ALK A;  3IGZ B;  2VQR A;  3UN5 A;  5DLV A;  4CYR A;  5IJQ A;  1AJD A;  4LR8 A;  3UN3 A;  1EW2 A;  2GA3 A;  4TN0 A;  2IUC A;  1URB A;  4UPK A;  1ELX A;  3UN2 A;  5L0B A;  5LQQ A;  3A52 A;  4ZGA A;  1E2S P;  1KHK A;  5LRM A;  1EI6 A;  3T02 A;  3DYC A;  3MK0 A;  5TJ3 A;  5IJS A;  1HJK A;  3M8Y A;  3NVL A;  4UOO A;  1ANI A;  1KH4 A;  4UPH A;  4GTX A;  1Y6V A;  1KH7 A;  4LRE A;  5LIA A;  1N2L A;  3WAX A;  4KM4 A;  4UPL A;  4LR2 A;  2W5W A;  4LRF A;  1ALH A;  1ED8 A;  4YR1 A;  3IDD A;  3WAW A;  5L0E A;  4CXS A;  1AUK A;  3MK2 A;  2W8S A;  4LQY A;  1AJB A;  3NKO A;  2X98 A;  3BDG A;  3CMR A;  1ELY A;  1EQJ A;  5HRT A;  1KHL A;  1ED9 A;  4FDJ A;  4MHX A;  4CYS A;  4ZG6 A;  5KXA A;  4FDI A;  3OT9 A;  3SZY A;  4LR7 A;  2W5T A;  2GSO A;  3ED4 A;  1ZEB A;  5EGE A;  4MY4 A;  2W8D A;  5GOV A;  1EW8 A;  4MIV A;  4CXK A;  1O98 A;  2XR9 A;  4KJG A;  5DLW A;  1KH5 A;  3T01 A;  1ALI A;  4KAY A;  1EJJ A;  1SHN A;  4LRC A;  3BDF A;  5LRN A;  4GTY A;  5DLT A;  2RH6 A;  1HDH A;  4ZG9 A;  2D1G A;  4KJD A;  3SZZ A;  1P49 A;  1HQA A;  4GTW A;  1AJC A;  4QAX A;  4UOR A;  2QZU A;  3UO0 A;  4B56 A;  3TG0 A;  1K7H A;  3T00 A;  5L0K A;  2W5V A;  1KHJ A;  2ZKT A;  4GTZ A;  3WAV A;  1FSU A;  2ANH A;  1ELZ A;  2IUC B;  2W5Q A;  1AJA A;  3KD8 A;  1ZEF A;  2IFY A;  2W5S A;  4NWX A;  1E33 P;  3DPC A;  1URA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...