5GOVA

Crystal structure of mcr-1, a phosphoethanolamine transferase, extracellular domain
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
Knots found
sequence length
323
structure length
321
Chain Sequence
DTIYHAKDAVQATKPMRKPRLVVFVVGETARADHVSFNGYERDTFPQLAKIDGVTNFSNVTSCGTSAYSVPCMFSYLGADEYDVDTAKYQENVLDTLDRLGVSILWRDNNSDSKGVMDKLPKAQFADYKSATNNAICNTNPYNECRDVGMLVGLDDFVAANNGKDMLIMLHQMGNHGPAYFKRYDEKFAKFTPVCEGNELAKCEHQSLINAYDNALLATDDFIAQSIQWLQTHSNAYDVSMLYVSDHGESLGENGVYLHGMPNAFAPKEQRSVPAFFWTDKQTGITPMATDTVLTHDAITPTLLKLFDVTADKVKDRTAFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Escherichia coli originated MCR-1, a phosphoethanolamine transferase for Colistin Resistance
doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Probable phosphatidylethanolamine transferase Mcr-1
total genus 117
structure length 321
sequence length 323
chains with identical sequence B
other databases KnotProt 2.0: S +31
ec nomenclature ec 2.7.-.-:
pdb deposition date 2016-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00884 Sulfatase Sulfatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 5govA00
4CXUA 1B8JA 4NWXA 4LRAA 5INHA 3SZZA 1ELYA 1ELXA 1AJCA 1URBA 1KH5A 2W5VA 3ED4A 2W5WA 4LRBA 3T02A 2ZKTA 1ED8A 1EW8A 3MK2A 4LR8A 4KAYA 3DPCA 5DLTA 3BDFA 2IFYA 1AJBA 1Y7AA 4KAVA 1E3CP 3TG0A 4ZGAA 3WAXA 5DLWA 1N2KA 5DLVA 4N7TA 2X98A 1KHNA 3IDDA 1ANJA 1ALKA 3TWZA 5AJ9A 2W8DA 1KHLA 1URAA 1EI6A 3BDHA 4B56A 1HJKA 4LREA 5TJ3A 5C66A 2XR9A 3OT9A 4KM4A 5IJQA 4LR7A 5L0BA 1ALJA 1AJDA 3Q3QA 4KJGA 3WAYA 1SHQA 3KD8A 5GOVA 3M8YA 5L0KA 5HRTA 3BDGB 4ZG6A 2W5TA 5GRRA 4LR9A 4YR1A 4FDIA 1ELZA 5IJSA 1HDHA 3LXQA 4FDJA 5LIAA 1AUKA 1E33P 4CYSA 4CXKA 5K4PA 2D1GA 3UN2A 4CXSA 3NKPA 1EJJA 4MHXA 2IUCB 2G9YA 1O98A 4UPIA 2VQRA 2W5RA 3B5QA 1EW9A 3M7VA 4TN0A 3SZYA 3UNYA 1KHKA 5LQQA 3UO0A 4UOPA 3NKMA 3MK1A 2GSNA 1ANIA 4UPLA 3NVLA 1P49A 3NKRA 4UORA 3M8ZA 4UPKA 1E2SP 3TX0A 1ALIA 3A52A 1ED9A 4ZG7A 3NKQA 3UN3A 1KH7A 4LR2A 1KH4A 5KXAA 4CYRA 1K7HA 1SHNA 3UN5A 1HQAA 3IGZB 4GTWA 3DYCA 3M8WA 2W5XA 1ZEFA 3WBHA 4ZG9A 1EW2A 5LRNA 1FSUA 5EGEA 3T00A 1ZEBA 2ANHA 3NKOA 5LRMA 1O99A 2QZUA 2IUCA 5L0EA 4GTXA 2GA3A 2W5QA 1KH9A 4LRDA 4GTZA 1Y6VA 3IGYB 2W8SA 4MY4A 4UOOA 2RH6A 4QAXA 1N2LA 4UPHA 3NKNA 4LQYA 3BDGA 1AJAA 2GSUA 1ZEDA 1KHJA 2XRGA 1ALHA 3MK0A 4MIVA 4KJDA 3T01A 5EGHA 1EQJA 2GLQA 3E2DA 3WAWA 2GSOA 4LRFA 4LRCA 3WAVA 2W5SA 1E1ZP 4GTYA 3CMRA 4NWJA
chains in the Genus database with same CATH superfamily
4CXUA 1B8JA 4NWXA 4LRAA 5INHA 3SZZA 1ELYA 1ELXA 1AJCA 1URBA 1KH5A 2W5VA 3ED4A 2W5WA 4LRBA 3T02A 2ZKTA 1ED8A 1EW8A 3MK2A 4LR8A 4KAYA 3DPCA 5DLTA 3BDFA 2IFYA 1AJBA 1Y7AA 4KAVA 1E3CP 3TG0A 4ZGAA 3WAXA 5DLWA 1N2KA 5DLVA 4N7TA 2X98A 1KHNA 3IDDA 1ANJA 1ALKA 3TWZA 5AJ9A 2W8DA 1KHLA 1URAA 1EI6A 3BDHA 4B56A 1HJKA 4LREA 5TJ3A 5C66A 2XR9A 3OT9A 4KM4A 5IJQA 4LR7A 5L0BA 1ALJA 1AJDA 3Q3QA 4KJGA 3WAYA 1SHQA 3KD8A 5GOVA 3M8YA 5L0KA 5HRTA 3BDGB 4ZG6A 2W5TA 5GRRA 4LR9A 4YR1A 4FDIA 1ELZA 5IJSA 1HDHA 3LXQA 4FDJA 5LIAA 1AUKA 1E33P 4CYSA 4CXKA 5K4PA 2D1GA 3UN2A 4CXSA 3NKPA 1EJJA 4MHXA 2IUCB 2G9YA 1O98A 4UPIA 2VQRA 2W5RA 3B5QA 1EW9A 3M7VA 4TN0A 3SZYA 3UNYA 1KHKA 5LQQA 3UO0A 4UOPA 3NKMA 3MK1A 2GSNA 1ANIA 4UPLA 3NVLA 1P49A 3NKRA 4UORA 3M8ZA 4UPKA 1E2SP 3TX0A 1ALIA 3A52A 1ED9A 4ZG7A 3NKQA 3UN3A 1KH7A 4LR2A 1KH4A 5KXAA 4CYRA 1K7HA 1SHNA 3UN5A 1HQAA 3IGZB 4GTWA 3DYCA 3M8WA 2W5XA 1ZEFA 3WBHA 4ZG9A 1EW2A 5LRNA 1FSUA 5EGEA 3T00A 1ZEBA 2ANHA 3NKOA 5LRMA 1O99A 2QZUA 2IUCA 5L0EA 4GTXA 2GA3A 2W5QA 1KH9A 4LRDA 4GTZA 1Y6VA 3IGYB 2W8SA 4MY4A 4UOOA 2RH6A 4QAXA 1N2LA 4UPHA 3NKNA 4LQYA 3BDGA 1AJAA 2GSUA 1ZEDA 1KHJA 2XRGA 1ALHA 3MK0A 4MIVA 4KJDA 3T01A 5EGHA 1EQJA 2GLQA 3E2DA 3WAWA 2GSOA 4LRFA 4LRCA 3WAVA 2W5SA 1E1ZP 4GTYA 3CMRA 4NWJA
chains in the Genus database with same CATH topology
4CXUA 1B8JA 4NWXA 4LRAA 5INHA 3SZZA 1ELYA 1ELXA 1AJCA 1URBA 1KH5A 2W5VA 3ED4A 2W5WA 4LRBA 3T02A 2ZKTA 1ED8A 1EW8A 3MK2A 4LR8A 4KAYA 3DPCA 5DLTA 3BDFA 2IFYA 1AJBA 1Y7AA 4KAVA 1E3CP 3TG0A 4ZGAA 3WAXA 5DLWA 1N2KA 5DLVA 4N7TA 2X98A 1KHNA 3IDDA 1ANJA 1ALKA 3TWZA 5AJ9A 2W8DA 1KHLA 1URAA 1EI6A 3BDHA 4B56A 1HJKA 4LREA 5TJ3A 5C66A 2XR9A 3OT9A 4KM4A 5IJQA 4LR7A 5L0BA 1ALJA 1AJDA 3Q3QA 4KJGA 3WAYA 1SHQA 3KD8A 5GOVA 3M8YA 5L0KA 5HRTA 3BDGB 4ZG6A 2W5TA 5GRRA 4LR9A 4YR1A 4FDIA 1ELZA 5IJSA 1HDHA 3LXQA 4FDJA 5LIAA 1AUKA 1E33P 4CYSA 4CXKA 5K4PA 2D1GA 3UN2A 4CXSA 3NKPA 1EJJA 4MHXA 2IUCB 2G9YA 1O98A 4UPIA 2VQRA 2W5RA 3B5QA 1EW9A 3M7VA 4TN0A 3SZYA 3UNYA 1KHKA 5LQQA 3UO0A 4UOPA 3NKMA 3MK1A 2GSNA 1ANIA 4UPLA 3NVLA 1P49A 3NKRA 4UORA 3M8ZA 4UPKA 1E2SP 3TX0A 1ALIA 3A52A 1ED9A 4ZG7A 3NKQA 3UN3A 1KH7A 4LR2A 1KH4A 5KXAA 4CYRA 1K7HA 1SHNA 3UN5A 1HQAA 3IGZB 4GTWA 3DYCA 3M8WA 2W5XA 1ZEFA 3WBHA 4ZG9A 1EW2A 5LRNA 1FSUA 5EGEA 3T00A 1ZEBA 2ANHA 3NKOA 5LRMA 1O99A 2QZUA 2IUCA 5L0EA 4GTXA 2GA3A 2W5QA 1KH9A 4LRDA 4GTZA 1Y6VA 3IGYB 2W8SA 4MY4A 4UOOA 2RH6A 4QAXA 1N2LA 4UPHA 3NKNA 4LQYA 3BDGA 1AJAA 2GSUA 1ZEDA 1KHJA 2XRGA 1ALHA 3MK0A 4MIVA 4KJDA 3T01A 5EGHA 1EQJA 2GLQA 3E2DA 3WAWA 2GSOA 4LRFA 4LRCA 3WAVA 2W5SA 1E1ZP 4GTYA 3CMRA 4NWJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CXU A;  1B8J A;  4NWX A;  4LRA A;  5INH A;  3SZZ A;  1ELY A;  1ELX A;  1AJC A;  1URB A;  1KH5 A;  2W5V A;  3ED4 A;  2W5W A;  4LRB A;  3T02 A;  2ZKT A;  1ED8 A;  1EW8 A;  3MK2 A;  4LR8 A;  4KAY A;  3DPC A;  5DLT A;  3BDF A;  2IFY A;  1AJB A;  1Y7A A;  4KAV A;  1E3C P;  3TG0 A;  4ZGA A;  3WAX A;  5DLW A;  1N2K A;  5DLV A;  4N7T A;  2X98 A;  1KHN A;  3IDD A;  1ANJ A;  1ALK A;  3TWZ A;  5AJ9 A;  2W8D A;  1KHL A;  1URA A;  1EI6 A;  3BDH A;  4B56 A;  1HJK A;  4LRE A;  5TJ3 A;  5C66 A;  2XR9 A;  3OT9 A;  4KM4 A;  5IJQ A;  4LR7 A;  5L0B A;  1ALJ A;  1AJD A;  3Q3Q A;  4KJG A;  3WAY A;  1SHQ A;  3KD8 A;  5GOV A;  3M8Y A;  5L0K A;  5HRT A;  3BDG B;  4ZG6 A;  2W5T A;  5GRR A;  4LR9 A;  4YR1 A;  4FDI A;  1ELZ A;  5IJS A;  1HDH A;  3LXQ A;  4FDJ A;  5LIA A;  1AUK A;  1E33 P;  4CYS A;  4CXK A;  5K4P A;  2D1G A;  3UN2 A;  4CXS A;  3NKP A;  1EJJ A;  4MHX A;  2IUC B;  2G9Y A;  1O98 A;  4UPI A;  2VQR A;  2W5R A;  3B5Q A;  1EW9 A;  3M7V A;  4TN0 A;  3SZY A;  3UNY A;  1KHK A;  5LQQ A;  3UO0 A;  4UOP A;  3NKM A;  3MK1 A;  2GSN A;  1ANI A;  4UPL A;  3NVL A;  1P49 A;  3NKR A;  4UOR A;  3M8Z A;  4UPK A;  1E2S P;  3TX0 A;  1ALI A;  3A52 A;  1ED9 A;  4ZG7 A;  3NKQ A;  3UN3 A;  1KH7 A;  4LR2 A;  1KH4 A;  5KXA A;  4CYR A;  1K7H A;  1SHN A;  3UN5 A;  1HQA A;  3IGZ B;  4GTW A;  3DYC A;  3M8W A;  2W5X A;  1ZEF A;  3WBH A;  4ZG9 A;  1EW2 A;  5LRN A;  1FSU A;  5EGE A;  3T00 A;  1ZEB A;  2ANH A;  3NKO A;  5LRM A;  1O99 A;  2QZU A;  2IUC A;  5L0E A;  4GTX A;  2GA3 A;  2W5Q A;  1KH9 A;  4LRD A;  4GTZ A;  1Y6V A;  3IGY B;  2W8S A;  4MY4 A;  4UOO A;  2RH6 A;  4QAX A;  1N2L A;  4UPH A;  3NKN A;  4LQY A;  3BDG A;  1AJA A;  2GSU A;  1ZED A;  1KHJ A;  2XRG A;  1ALH A;  3MK0 A;  4MIV A;  4KJD A;  3T01 A;  5EGH A;  1EQJ A;  2GLQ A;  3E2D A;  3WAW A;  2GSO A;  4LRF A;  4LRC A;  3WAV A;  2W5S A;  1E1Z P;  4GTY A;  3CMR A;  4NWJ A; 
#chains in the Genus database with same CATH topology
 4CXU A;  1B8J A;  4NWX A;  4LRA A;  5INH A;  3SZZ A;  1ELY A;  1ELX A;  1AJC A;  1URB A;  1KH5 A;  2W5V A;  3ED4 A;  2W5W A;  4LRB A;  3T02 A;  2ZKT A;  1ED8 A;  1EW8 A;  3MK2 A;  4LR8 A;  4KAY A;  3DPC A;  5DLT A;  3BDF A;  2IFY A;  1AJB A;  1Y7A A;  4KAV A;  1E3C P;  3TG0 A;  4ZGA A;  3WAX A;  5DLW A;  1N2K A;  5DLV A;  4N7T A;  2X98 A;  1KHN A;  3IDD A;  1ANJ A;  1ALK A;  3TWZ A;  5AJ9 A;  2W8D A;  1KHL A;  1URA A;  1EI6 A;  3BDH A;  4B56 A;  1HJK A;  4LRE A;  5TJ3 A;  5C66 A;  2XR9 A;  3OT9 A;  4KM4 A;  5IJQ A;  4LR7 A;  5L0B A;  1ALJ A;  1AJD A;  3Q3Q A;  4KJG A;  3WAY A;  1SHQ A;  3KD8 A;  5GOV A;  3M8Y A;  5L0K A;  5HRT A;  3BDG B;  4ZG6 A;  2W5T A;  5GRR A;  4LR9 A;  4YR1 A;  4FDI A;  1ELZ A;  5IJS A;  1HDH A;  3LXQ A;  4FDJ A;  5LIA A;  1AUK A;  1E33 P;  4CYS A;  4CXK A;  5K4P A;  2D1G A;  3UN2 A;  4CXS A;  3NKP A;  1EJJ A;  4MHX A;  2IUC B;  2G9Y A;  1O98 A;  4UPI A;  2VQR A;  2W5R A;  3B5Q A;  1EW9 A;  3M7V A;  4TN0 A;  3SZY A;  3UNY A;  1KHK A;  5LQQ A;  3UO0 A;  4UOP A;  3NKM A;  3MK1 A;  2GSN A;  1ANI A;  4UPL A;  3NVL A;  1P49 A;  3NKR A;  4UOR A;  3M8Z A;  4UPK A;  1E2S P;  3TX0 A;  1ALI A;  3A52 A;  1ED9 A;  4ZG7 A;  3NKQ A;  3UN3 A;  1KH7 A;  4LR2 A;  1KH4 A;  5KXA A;  4CYR A;  1K7H A;  1SHN A;  3UN5 A;  1HQA A;  3IGZ B;  4GTW A;  3DYC A;  3M8W A;  2W5X A;  1ZEF A;  3WBH A;  4ZG9 A;  1EW2 A;  5LRN A;  1FSU A;  5EGE A;  3T00 A;  1ZEB A;  2ANH A;  3NKO A;  5LRM A;  1O99 A;  2QZU A;  2IUC A;  5L0E A;  4GTX A;  2GA3 A;  2W5Q A;  1KH9 A;  4LRD A;  4GTZ A;  1Y6V A;  3IGY B;  2W8S A;  4MY4 A;  4UOO A;  2RH6 A;  4QAX A;  1N2L A;  4UPH A;  3NKN A;  4LQY A;  3BDG A;  1AJA A;  2GSU A;  1ZED A;  1KHJ A;  2XRG A;  1ALH A;  3MK0 A;  4MIV A;  4KJD A;  3T01 A;  5EGH A;  1EQJ A;  2GLQ A;  3E2D A;  3WAW A;  2GSO A;  4LRF A;  4LRC A;  3WAV A;  2W5S A;  1E1Z P;  4GTY A;  3CMR A;  4NWJ A; 
#chains in the Genus database with same CATH homology
 4CXU A;  1B8J A;  4NWX A;  4LRA A;  5INH A;  3SZZ A;  1ELY A;  1ELX A;  1AJC A;  1URB A;  1KH5 A;  2W5V A;  3ED4 A;  2W5W A;  4LRB A;  3T02 A;  2ZKT A;  1ED8 A;  1EW8 A;  3MK2 A;  4LR8 A;  4KAY A;  3DPC A;  5DLT A;  3BDF A;  2IFY A;  1AJB A;  1Y7A A;  4KAV A;  1E3C P;  3TG0 A;  4ZGA A;  3WAX A;  5DLW A;  1N2K A;  5DLV A;  4N7T A;  2X98 A;  1KHN A;  3IDD A;  1ANJ A;  1ALK A;  3TWZ A;  5AJ9 A;  2W8D A;  1KHL A;  1URA A;  1EI6 A;  3BDH A;  4B56 A;  1HJK A;  4LRE A;  5TJ3 A;  5C66 A;  2XR9 A;  3OT9 A;  4KM4 A;  5IJQ A;  4LR7 A;  5L0B A;  1ALJ A;  1AJD A;  3Q3Q A;  4KJG A;  3WAY A;  1SHQ A;  3KD8 A;  5GOV A;  3M8Y A;  5L0K A;  5HRT A;  3BDG B;  4ZG6 A;  2W5T A;  5GRR A;  4LR9 A;  4YR1 A;  4FDI A;  1ELZ A;  5IJS A;  1HDH A;  3LXQ A;  4FDJ A;  5LIA A;  1AUK A;  1E33 P;  4CYS A;  4CXK A;  5K4P A;  2D1G A;  3UN2 A;  4CXS A;  3NKP A;  1EJJ A;  4MHX A;  2IUC B;  2G9Y A;  1O98 A;  4UPI A;  2VQR A;  2W5R A;  3B5Q A;  1EW9 A;  3M7V A;  4TN0 A;  3SZY A;  3UNY A;  1KHK A;  5LQQ A;  3UO0 A;  4UOP A;  3NKM A;  3MK1 A;  2GSN A;  1ANI A;  4UPL A;  3NVL A;  1P49 A;  3NKR A;  4UOR A;  3M8Z A;  4UPK A;  1E2S P;  3TX0 A;  1ALI A;  3A52 A;  1ED9 A;  4ZG7 A;  3NKQ A;  3UN3 A;  1KH7 A;  4LR2 A;  1KH4 A;  5KXA A;  4CYR A;  1K7H A;  1SHN A;  3UN5 A;  1HQA A;  3IGZ B;  4GTW A;  3DYC A;  3M8W A;  2W5X A;  1ZEF A;  3WBH A;  4ZG9 A;  1EW2 A;  5LRN A;  1FSU A;  5EGE A;  3T00 A;  1ZEB A;  2ANH A;  3NKO A;  5LRM A;  1O99 A;  2QZU A;  2IUC A;  5L0E A;  4GTX A;  2GA3 A;  2W5Q A;  1KH9 A;  4LRD A;  4GTZ A;  1Y6V A;  3IGY B;  2W8S A;  4MY4 A;  4UOO A;  2RH6 A;  4QAX A;  1N2L A;  4UPH A;  3NKN A;  4LQY A;  3BDG A;  1AJA A;  2GSU A;  1ZED A;  1KHJ A;  2XRG A;  1ALH A;  3MK0 A;  4MIV A;  4KJD A;  3T01 A;  5EGH A;  1EQJ A;  2GLQ A;  3E2D A;  3WAW A;  2GSO A;  4LRF A;  4LRC A;  3WAV A;  2W5S A;  1E1Z P;  4GTY A;  3CMR A;  4NWJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...