3UN5A

Bacillus cereus phosphopentomutase t85e variant
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
Knots found
sequence length
391
structure length
391
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDEMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Differences between a Mutase and a Phosphatase: Investigations of the Activation Step in Bacillus cereus Phosphopentomutase.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
molecule keywords Phosphopentomutase
total genus 143
structure length 391
sequence length 391
chains with identical sequence B, C, D, E, F
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2011-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3un5A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3un5A01
1ELZA 1N2LA 5K4PA 3TG0A 1ZEDA 1KH7A 5DLTA 3CMRA 3IDDA 4UPIA 4LR2A 2VQRA 3M8ZA 1KHNA 2XR9A 4LRFA 2RH6A 3Q3QA 2ANHA 5DLWA 2IUCB 2W8DA 4KJGA 1Y6VA 2W5WA 1E2SP 4MY4A 3WAYA 3BDGA 5L0KA 2QZUA 1ANJA 1KHJA 3MK0A 4GTYA 3T00A 4MHXA 4UPHA 1AJBA 3M8YA 1K7HA 1O99A 3BDGB 4GTZA 4LR8A 3UO0A 3UNYA 3B5QA 3OT9A 3IGYB 2XRGA 5GOVA 3UN2A 4GTWA 3DPCA 1B8JA 3NKMA 4GTXA 4LRAA 3NKPA 1P49A 3SZYA 3BDHA 2D1GA 5LRNA 1AJDA 4N7TA 4LRBA 5C66A 4MIVA 2W5TA 1HQAA 3MK2A 2IUCA 3WAWA 3A52A 2GSOA 3TX0A 4ZG6A 1ANIA 1ELYA 3NKOA 1KH5A 3NKQA 5LRMA 1E1ZP 1HDHA 5GRRA 2GA3A 3WAVA 3NKRA 1SHQA 1AJCA 3T02A 5L0BA 4UORA 1KH4A 1AUKA 3DYCA 1URBA 2W8SA 3TWZA 4UPLA 3UN3A 1EJJA 3MK1A 4TN0A 1ALIA 1ELXA 1EQJA 2W5RA 5HRTA 1O98A 3BDFA 5DLVA 4CXSA 4ZGAA 4LRDA 1KH9A 3E2DA 3NKNA 2IFYA 5KXAA 3T01A 4KAYA 1ALJA 4NWXA 4YR1A 1ED8A 1SHNA 2W5VA 4LR9A 3WAXA 4LRCA 2ZKTA 5TJ3A 1URAA 1ZEBA 2W5QA 5EGHA 1E33P 5LIAA 1Y7AA 1E3CP 4QAXA 5INHA 4CXUA 1ZEFA 2GSNA 5IJSA 1FSUA 3M7VA 4B56A 1EW2A 4ZG7A 1ED9A 3KD8A 5AJ9A 5L0EA 3ED4A 4KM4A 4UPKA 1N2KA 3WBHA 1ALHA 1KHLA 5LQQA 4FDIA 4UOPA 4CXKA 4NWJA 2W5XA 4ZG9A 3NVLA 1EI6A 4LQYA 1AJAA 2X98A 3LXQA 3M8WA 4FDJA 5IJQA 4LR7A 5EGEA 2W5SA 4KAVA 3IGZB 1ALKA 3SZZA 1EW9A 1KHKA 1HJKA 1EW8A 2G9YA 4CYRA 2GLQA 4CYSA 4LREA 2GSUA 4UOOA 4KJDA 3UN5A
chains in the Genus database with same CATH superfamily
1OQ6A 2CVEA 2G0IA 1S0MA 1R8BA 1DTQA 2KT3A 2WB1D 3VAMA 1FCAA 1YDLA 4ZPAA 3BDPA 2XS5A 5J1NA 3TW0A 4DN0A 1RAGB 3U27A 3W2WB 3GG1A 1R8PA 1EP4B 3D67A 1LW0A 2R8JA 3BKUA 2JFKA 2JRSA 3DLKB 2XC9A 5IT9Y 2YNFA 2O66A 4IH6A 3GB0A 4F0HA 9RUBA 3W60A 2RKIA 5KOWA 1PGZA 4WZQA 1ZTTA 3K8VA 2R2RA 2DYAA 3NL0A 2XULA 5DRKA 5HK4A 1ZZNA 2MKIA 5AJ3J 4M63A 1LW2A 5E0OA 2EFVA 3MM8A 5E3CA 3SCKE 2OO4A 3DYAA 4NA1A 3J7ZT 3IN5A 3HVRA 3TAQA 1N34J 2J9CA 3I0SA 4C8MA 3HSJA 2AV5A 1AZSA 1RHMB 4DR1F 1AB8A 2V8DA 4OZ2A 1NDKA 3QNWB 4WTYA 2C42A 1B7YB 2XRGA 3CSKA 2ZOGA 3P4UB 3ZNJ1 2DH9A 5CYJA 4JI8F 4HACA 5D78A 1Y9OA 5F8LA 8AT1B 2J7KA 4WP8A 4F3QA 5AXNA 4DUYJ 3WAXA 1Q16B 1ZA1B 4KGMA 1FKPB 3KOAA 2GVDB 4LQ3A 2DGVA 1VIOA 4FZVA 3PJXA 4OI2A 4FYWB 1UP1A 2QL7B 4PG5A 3NKOA 1VQ9S 4M5LA 2DHSA 3Q2SC 5KG6A 1TV6A 1JKHB 2X51A 2ZZTA 4X64F 4WFAQ 4V19J 2HK3A 4WKRA 3FEZA 2BANB 5AE1A 2AT1B 2OKQA 2CG8A 2EBGA 1K73T 3NKRA 1D9FA 3W65A 2D3OR 3SEOA 3KNGA 2XB2D 2V2QA 4JI2J 1S0OA 3ADAC 3CCTA 3KLHB 1KQFB 1IKVA 2YY3A 1S9GB 3MK1A 2QA2A 5KFTA 1YZ6A 1WC6A 2JJ4D 2RDDA 3KJNB 3OVAA 1VQ7S 3M8QA 4OHWA 4P10A 1N0UA 4FS2A 3MD3A 2A3JA 3EGVA 2R7XA 4PEOA 3GIIA 3BQ2A 2YKNB 3G87A 4RW8A 3EPGA 2XCAA 2ATCB 1WHVA 1RK8A 1TKZB 3N6NA 2W1BA 4JBCA 4L74A 5D0GA 5KFAA 4RNFA 2ADBA 2M70A 4PQUA 1RWWB 4KKOA 2ZH6A 5DQGA 2RNEA 2DR6A 3NS6A 4ES3A 1E33P 2J0QD 3KYLA 3MAQA 1IBKJ 1N33J 2B5JA 3P49B 2PSZA 3A8JA 3K5PA 1RKIA 3LPYA 1XMQJ 4DPUA 4KH1B 2K7JA 3BF4A 3MECB 3R7BB 3M7VA 4ILLA 1JWWA 3OQ2A 5HLFA 2WVEA 2DO4A 1UJ4A 2WOMA 4RKUC 3UDCA 3OXGA 1WSRA 2KFYA 3QPIA 4UOFA 1S7HA 2FHKA 2OI2A 3L9ZA 2C3UA 3MURP 4DPTA 1IBMF 1WKKA 2YX7A 1X4CA 4AL7A 2ASLA 3EXYA 4CDIA 3R1HA 3TA0A 3CULA 3BKFA 1OYEA 3PW5A 3DRPA 4WFBQ 4NLGA 3HVAA 2LEAA 2R42A 1NK7A 1UETA 1VIXA 1MN7A 3RB3A 4C8KA 2V6AA 5I42A 1HBNA 2FJBB 4F4XA 2ZH8A 5KFBA 1AUDA 2X1GA 2AYGA 3K7RA 4PYDA 4ZCMA 1EQ0A 1XR5A 2ZZMA 1FDNA 2WHOA 4U7UD 1T0TV 4RW9A 4F4AA 2LQ5A 2BMBA 3OXLA 4A8QA 3P6YC 4LF1A 4KC5A 5K4PA 2RHQB 5IXUA 3NGUA 1C0TA 1R0BG 3NLCA 2EC2A 1ITPA 3W2VB 3Q8UA 4YS2A 4X4TA 4O3RA 2DNHA 4ZPVR 1VC0A 4LF8F 3FK4A 3OUYA 3NEKA 1RTHA 1YVFA 3CW2C 2IM3A 4G6VB 2FZGB 2L3MA 4Z7CA 4P2SA 2CQ4A 1B99A 2CQPA 4NLXA 1IR0A 4JV1A 5KFKA 4P2MA 3H90A 2CZ9A 3T1YJ 1YBTA 1MN9A 2J8SA 5I3UB 4OYAA 1EKSA 4YQWA 4EK2A 1WI6A 3CD5A 4JI5F 1B4SA 1IUJA 2V8HA 4DR4F 2F9JA 3DRYA 5KFSA 1FXLA 1VI7A 2HVHA 1P9YA 2MJNA 4GTWA 2FDNA 4EI2A 1H0HB 1FNOA 5DG8A 1S0NA 2HWTA 4C97A 1WUUA 3FSXA 3OVSA 3RYLA 3GIRA 3IS9A 1I1GA 3A8IA 1C1BB 2MQMA 3QQCD 4DMZA 5A8KA 2ZM6J 2D1GA 2B43A 1F3VA 1H73A 1JLCB 3TZXA 2N82B 4O0IA 2HHQA 2VPXB 2K2PA 2RD5C 3QT5A 3WAWA 3G82B 4MIWA 2A0FB 5E2QA 5THWA 1QUVA 5EDWA 3FSIA 3NNCA 4NLTA 5KFGA 1ELYA 5HP1B 1TK8A 3PW2A 2F4VF 4MAKA 4OI1A 2R7OA 4ZKAA 2AGOA 2GV1A 3SDEB 2ZUAA 2FTRA 4FYDA 1NHVA 1GMWA 1IJEB 1TU0B 2BXJA 4ZJOA 2GO9A 1REVB 3TWZA 1IVZA 1X4FA 3MMBB 1FERA 2Y0SD 3O6QA 3OTCA 3G6YA 3C46A 5E33A 2FB0A 1WC0A 2HHTA 3UDVA 1VCTA 3CEDA 3DRSA 2FJWA 4DUZF 2WW8A 1I94F 3HDSA 3ENAA 1HWIA 4TY8A 3H2VE 3ZZUA 3OV7A 2DXDA 2OJ3A 2GFFA 1CC8A 5KG1A 4DUTA 5KFCA 3V6DB 3NKNA 3TOQA 4ITSA 4WIIA 2VA2A 5KXAA 3NS7B 2DNKA 1IR2A 3H40A 1HNVB 4K0KJ 1SJRA 4I67A 2Z56B 2N7YA 4A4JA 1FKAF 2L9NA 2HQ3A 5BYRA 5CAAA 3JB9k 4LR9A 3PR5B 4HR2A 4ZLPA 3CD7A 3GSDA 3WX8A 5K8MA 1H98A 1SBRA 4K59A 1KHKA 1T02A 1G6BA 2V34A 2QV6A 1NHUA 4IOBA 2GVDA 3U1NA 1ZEFA 2GSNA 4J5OA 3I5AA 1U1LA 1WDTA 3DKDA 3ZFVA 4B56A 2IC3B 3CCLS 2HGNA 3HFKA 4DS5A 1PYSB 2RS8A 3EX7B 2YNIA 2RRAA 2DNGA 4B3SJ 1X4BA 5KFRA 1D9DA 2AJQA 3THPA 3BN7A 2K3IA 1B0PA 2R9LA 2VKZG 2ZBRA 3T6BA 2KT2A 4Q2MA 3VVUA 2D41A 4I7FB 1XNQF 1VBXA 5CYMB 3FZ2A 4ECYA 2DCUB 3HFZB 1BE4A 2YQ1A 3N6MA 5IWAF 1WNEA 1GQEA 1RT3A 1F5BA 1OS5A 4ED6A 3NXZA 4KHPJ 4FF4A 3KLGA 4Q8FA 3OTBA 4H54A 1MMNA 1NBEB 2X1BA 3LWLA 3SSRA 2XLKA 4URSA 2ZBIA 2J6UA 1G4CA 3OTDA 1VYAA 3MM8B 5GAEU 4FS1A 4KAVA 2VG6B 1QD1A 3MPWA 1M5KC 3L95X 1NK8A 1MWYA 2MKSA 3P8BB 3SQOP 2DH8A 1M5HA 2O01C 2YWKA 3M32B 4ZVTB 3E51A 2UVVA 2OAUA 4A8OA 3V6HA 2XMKA 3TUJC 1FI4A 2DISA 4E98A 3DXBA 1LK5A 2MKKA 5J2QB 1UPPA 3C66A 2KFNA 1DLOA 2J7WA 4CLZA 2IM1A 5D0HA 1DQ8A 4JV0A 2VD3A 3HZEA 1QM9A 2E7XA 4LRFA 4DG1B 2YQ0A 3Q23A 5D15A 1QSYA 5D3GA 3QFWA 2Z0GA 4AL5A 3CWJA 3G8TA 3KUGA 2AEMA 1MROB 3UCZP 2WBRA 2C2KB 3MR2A 1TK0A 1FD8A 4AE5A 1KD1T 3OVBA 4RUHA 2Q1LA 4JYAJ 4GO5X 1N5QA 4DR3F 4JI4F 2BOAA 1Q4RA 4OI0A 3EZ5A 3EGWB 5DM6Q 2NSBA 2UUTA 1PAEX 2DB1A 2DNRA 2P5VA 2FLPA 3OUYB 1N54B 2VB6A 1DJ0A 3MUMP 4HVZA 1VQOS 1CG2A 4DHVA 2DNYA 3CCMS 3A4TA 3JXOA 3IFEA 1WEYA 3EDQB 3NGRA 1CQNA 3I0RB 4W98A 1REGX 1RISA 2CNOB 1RWMB 2H9ZA 2R2TA 5ETOA 2UUBJ 4JV2A 4LF8J 2CQ1A 3M1VB 1SKWA 1VLYA 2W01A 3I96A 4ECTA 2OPQA 3NKPA 2I5JB 3LP1B 2VQEF 4IG0B 4KGKA 2HIQA 4WXWA 2HNDB 1RWOB 3T5LA 1O6XA 3GILA 2HBZB 3KLEA 1RAFB 4MIVA 1ZM3A 3AODA 3NBPA 4I2PB 1KBRA 2L08A 4ZG6A 2BQUA 4LBPA 2BACA 2KJVA 3ILOA 4KE5A 2IVYA 1N33F 3OL8A 5KG2A 4FXVA 3IMQJ 2K8GA 4H4KC 1KQKA 4DLEA 2FD2A 1HDHA 4F7VA 1FVSA 2BE2B 3OR2A 3QLHA 5LMNJ 3QO9A 2RH3A 3CJQA 5M2PA 1CJUB 3VR1A 1FXDA 3RJMB 3LO3A 4ECSA 1KONA 4CO1A 1IM4A 2MZJA 2DR7A 4B3MJ 4F8RA 3UN3A 1UVMA 4AXIA 2RSQA 3KK2A 4Q5VA 2A2DA 1JLGB 2E7VA 5L9NA 1U1NA 1UMJA 5HRTA 1MG7A 2HIYA 1IBMJ 3BDFA 2HNZA 1S97A 5D4PA 1S59A 3FRZA 2MKJA 2XS2A 2HVIA 4ERDA 3DRSB 4MMOA 3UNGC 3TO8A 2V4QA 1S1WA 1T05A 2H65B 2RT3A 1NCLA 2ZNZA 4CM2A 5K8NA 1KQGB 2HURA 1SC4B 2B4VA 4RX6A 1MMLA 2GJIA 3W61A 5C7PA 5C25B 5J1EB 5GADU 2ZKTA 3HJVA 3M1VA 3FC9A 5KFXA 1VQNS 3AT1B 3WIUA 1JLCA 4X64J 2FLLA 3U1MA 4IQXA 2YNFB 1CEZA 1X5TA 5T14A 2EXUA 1IJFB 2DY1A 2DHHA 3O8WA 3SCLE 3MUVP 1HI8A 2B56A 1NJIT 3LH2S 4CYUB 2I2YA 2G1HA 3T9ZA 4YDDB 5JVHQ 1XMOF 4J91A 2RF2A 3FCHA 1X60A 1CJKB 4HT7A 1RWNB 2FQQB 2MGZB 4NZ6A 3H0PA 4LFAF 2CQGA 1NK5A 2LXIA 4X4SA 3I56S 4F3MA 2MQ8A 3MEDB 1WOSA 3NVLA 4B3RJ 4I64A 2W8LA 2NSCA 5E3PA 2PE8A 3FJ2A 4FDJA 1LQ9A 4KQZA 4DR4J 1T8EA 2ZD1B 3ITHA 1PIEA 3R7SB 5AXLA 2CDQA 3FEXB 4OJ3A 4N5SA 4LF9J 1S0VA 5AE2A 3GFZA 5FIIA 2W4CA 3UDLA 4JOUA 2KHCA 1FJGJ 1FKPA 2IYIA 1RAJA 1HPZA 1F2GA 1WOPA 2JFDA 1B70B 2WK4A 1RBLA 4LREA 3GSIA 4D3GA 5HROA 3H7HB 1RYSA 4Q0BA 4YB6A 1ZEDA 4YY3J 5E3AA 1XNRJ 7FDRA 2VG6A 2VF3A 2XR9A 5CCLA 4ELVA 1EQMA 2AW0A 2IIHA 3HHLB 1FRMA 3UR3C 4WXOA 2KFZA 6FD1A 1OSCA 2Z2MA 2CKWA 3PZPA 1SIZA 4J9SA 2W5WA 3WAYA 4EZ9A 2H5EA 1WF2A 4DG1A 1VQYA 3JSYA 1RTJB 2HEKA 1ZAWA 1Y5IB 2V50A 1V3RA 4MIAA 3KKFA 3TVKA 3K89A 3DLLQ 3NMRA 4B3OB 5EWGA 2F4VJ 2AJFE 1U09A 4OZ1A 3MM5A 4QR1A 1X5SA 1V3SA 2MMYA 1T95A 4KGVB 4CTAB 4K4TA 3T1HJ 1TVRA 4O3QA 4CNYA 2V2ZA 1WOOA 1V5IB 1X4GA 1HMVA 1YSJA 4R5PB 1FSUA 2UUCF 2QT7A 3CJTA 3GMGA 3DPCA 1SH3A 1FFGB 1VDHA 4K2JA 4QCLA 1RB0A 4DFKA 3HP6A 3UPFA 3MECA 4NXMF 4U8VA 2DGUA 2WCXA 2Y1IA 2B5JB 2UZAA 4DV1J 2V4JA 1JXEA 4PXCA 4FF1A 3WZ0A 3DXSX 1HNVA 3A52A 3TQ1A 3D9BA 1NLKL 4B02A 2FC9A 2GMJA 3OSPA 3UR0A 2OELA 2GA3A 1C0UA 2GQ2A 1YITS 2G2ZA 3DN9A 3VV2B 4OHVA 1RHRB 1R3NA 4NA3A 2W4DA 4ICLA 3N28A 3OXFA 2CDRB 4O3PA 2GQQA 1P6TA 1W2BR 2XMWA 3G2XA 4B08A 1TKZA 2YVSA 2Z2YB 3GTYX 4NLWA 5A0YB 4F02A 2DHGA 2MLYA 1ELXA 5KFUA 3CCES 3D0GE 1WDDA 5K9FA 1HQ2A 1K44A 3E01A 4OYMA 3DI6A 1LXJA 1JQGA 2CJAA 2HHXA 4L3NA 1GTEA 3KG0A 4A8FA 4LSZB 4DV7J 3CMAS 3TJ8A 3D1OA 3HVTB 4J37A 1NRKA 3J81Y 3QFHA 3QIPB 1K0TA 4JI7F 3BYPA 5JMNA 1SHNA 2PI4A 3HT3A 1SH0A 2NPFA 2Q79A 3DLGB 1SKRA 2R3VA 2CRLA 2V68A 4DQIA 4NLSA 4PZVA 3BKTA 5KG7A 1N6QB 2W9CA 3M32A 1AT1B 1LWCB 4GKJJ 3BDEA 4K5RA 1UEVA 3CVKA 3R27A 4ZPTR 2B9WA 3QRRA 2K1RB 3E8OA 1S6OA 3A8KA 3IRXB 2MSSA 3OJUA 1EKRA 4XAKA 4ZK7M 1ED9A 4ZG7A 3OLAA 3CCWA 5ETRA 4JB8B 2V67A 1UL3A 4ZN3A 2QLBB 2QA4G 2A18A 3HF5A 2NXCA 4KV8A 1A6LA 1FF2A 4DCOB 1HD0A 3HCXA 4WU3A 2WTFA 3AOAA 4NEZA 4DV6F 1SJ4P 3VAFA 4CXKA 3HPOA 2HWIA 4OJGA 1K1SA 2CWXA 4ZVRB 3DM2A 4ZVQB 1SL2A 2Y9HA 4DFMA 4NLVA 4IDKB 3RW6A 3SFUA 1F1BB 2HMIA 1KNZA 3ILLA 1FRJA 4J9QA 2OPQB 5EGEA 2OPSA 1W25A 5HL7Q 3DRXA 1FT8A 3BH6B 3CB4A 2BM1A 2YNGA 3CGIA 4RNHA 4LF4F 2VC0A 3OL6A 1HBMB 3J7Z5 3O2IA 4ID5A 1PSDA 2GGPA 4M95A 2KM8C 2LEPA 2ZVSA 3HKZD 3KWMA 7AT1B 1N2LA 2OSQA 3HHEA 3N5BA 6FDRA 1KH7A 2KO1A 2J0WA 4GO7X 3VHQA 2ZWOA 3RRKA 3VAIA 4DQSA 1QJHA 4Y2MA 4Q8EA 4G1QA 3KG1A 4YB5A 1JJ4A 4UTGA 1RWKB 2V2KA 5LM7E 5K5MA 5BR8F 2CAJA 4DI6A 3BQ1A 4WK3A 4RNNA 4ED0A 1E2SP 1NDCA 4KJGA 1J27A 5B0CA 1HBUB 5A2QY 1LFPA 3MMAB 1LK7A 1BQMA 5HATA 3W5ZA 3W3SA 1QE1A 1CJKA 2B0GA 4S0MA 1HW8A 4O4GB 4OZLA 1VHIA 2CG4A 4DSIA 1LWXA 5KT5A 2Z2LA 3BREA 3J81j 2CPIA 2NXNA 3MEEA 1VFJA 3VGVA 1U45A 2JEGA 4MIBA 4YOEA 3AA8A 1WF0A 3DNCA 3OT9A 3O44A 4M8LA 2YKPA 1YG0A 4Y65A 1L3SA 2G13A 3NMAA 4WU2A 4Y2CA 1S6QA 4AYBD 4BS2A 2HW3A 5EHHA 4X2BA 4WBFA 3VAJA 3FZBA 4RR5A 5HP1A 5KG0A 2LA4A 2ERRA 1TL7A 4JV5F 2ZBCA 4LRBA 5C66A 2VPWB 4USUA 1N36F 4TN2A 3MR6A 4YMEA 1GMVA 4ED1A 2O67A 4BCAA 5I3QA 2DNZA 1OSDA 2HPUA 2DGXA 5H9FJ 3WBZA 2MQOA 4DR1J 4KPYA 2MKYA 3Q83A 4OX9F 2DPJA 1KH5A 3S7RA 4PWDB 1E1ZP 4F50A 2BQ3A 1BMQB 2GGPB 2GO8A 4CLFA 1UVIA 4K4VA 5CD4A 1JLEA 2ACMA 2CXEA 3ET6A 5A8WB 1KH4A 3DFEA 5LOQA 4WK1A 1S10A 4OLPA 1URBA 3G9CA 3MR3A 3LP2A 3MXHP 1GXLA 3D68A 2HNYA 3DGPA 3HI9A 2MKHA 3M2VA 4ZVEA 1HNZF 2VODA 1U0HB 2HBQB 2EW9A 3GJTB 2UVUA 1VQ6S 5KT7A 2LXFA 3KLIB 1SC6A 3V5RA 5DLVA 1JJCB 4IO1A 2CQCA 3R97A 1BGXT 1S1UB 1TUGB 4CH1A 2KB2A 5LSLA 3C14B 2R8KA 3MWBA 4F36A 2IPOB 1HYSA 1KH9A 1EX8A 1JKHA 2XEXA 3FRYA 3FNNA 1VJWA 1TAQA 2P2CB 3GYXB 4DBQA 1SL0A 2F8EX 3V6JA 1EETB 4GVBA 4WKYA 4LR2A 1ALJA 3MEEB 3B82A 4NWXA 2IBOA 4KB7A 1IM6A 4PAAA 1SIWB 5KFHA 2KI2A 3E01B 4DDFA 4U67Q 2QGFB 3C16A 3CJ4A 3L3CA 1Y7AA 2CQ2A 2W9AA 3D54A 4DOZA 2Y1JA 1KFDA 5ADZA 4OV6A 3C6UB 5B0FA 1N88A 4N8OA 3PO4A 1D8ZA 2VC1A 2JX2A 3PM9A 4M5HA 4RBTA 5HN0A 1G3OA 5KFOA 4LF7J 4KJIA 2I0XA 4B9UA 3FBEA 1Q0NA 3JSMA 1UA0A 3ULHA 3Q22A 1E6VB 2AZ3A 2VFTA 4LF7F 4KM4A 4BLGA 2QL5B 4UQGA 1TVRB 2GJFA 4DR5F 4ZG9A 4L3KA 4F4KA 2EG1A 3OR1A 4C7QA 2VICA 3PIOQ 3LXQA 3DHXA 2QYCA 4JUZA 4DL4A 1HR0F 1R8HA 4LR7A 2W9BB 1IKXA 3MHYA 4X4PA 2FY1A 3A12A 2COLA 1JXVA 4PRFA 5IC6B 1EB0A 5EWFA 4U95A 1U1QA 1T03B 4IQMA 1VK8A 2BJ7A 1GFWB 2CJBA 3VQSA 3DRRA 1RE1B 2MLZA 5EGYA 6AT1B 2MZSA 2YKMA 4PWWA 2DVIA 1FXRA 2LLZA 3M2UA 4QWBA 1X0PA 3SDEA 1VS3A 2RUSA 3CJKB 2BKPA 1FX2A 5KFJA 3AQPA 2XTJP 4QW9A 2DT9A 1O5JA 2HQCA 2XY7A 3TG0A 4UPIA 4RZRA 3M8ZA 3ETOA 3MI7X 4C8ZA 2R8IA 1CULB 2VA3A 3SBMA 2AYBA 3MCOA 2R7UA 2HQFA 3CO9A 3NNHA 2DXEA 1Z2LA 1HBOB 4P9SA 4TYBA 1Q53A 2WVBA 3T41A 5CYMA 5H9EJ 2NYHA 1HR0J 2FLNA 3BDGA 1FD2A 3I5CA 3P5BP 3AD7C 3PRBA 1KHJA 2MY8A 1Q8KA 2HYIB 1CS4A 3PVXA 4DR2F 3BS9A 2KJWA 2DGTA 5DLGA 1HNWF 3G8SA 4CO3A 4NYPA 2C3PA 1CSJA 2YBVA 4DLGA 2K7KA 3MMAA 4W92B 4LR8A 5D8HB 1PG5B 2WSEC 2HFZA 1RT1B 5CHCB 4RBVA 3NAIA 5HMZA 4WFNQ 5MLCV 1WEZA 2V69A 2FVQA 1RAOA 1M90T 3QMQA 3DLGA 4LRAA 5LJ5Y 1PO6A 2XI2A 4LSLB 2XWXA 3BN4A 1VQPS 2G0CA 1SPBP 2HHPA 2MDAA 5HQLA 3M8SA 2OIHA 4UUXA 3RR8A 1HQEA 3MK2A 4G3IA 2G1DA 2DNOA 1XK8A 1KS2A 3A3NB 3O1LA 3MEGB 4RW4A 3IGVA 4DZ6A 3I55S 4I7FA 3LAKA 4RW7A 3ZZOA 3CF5Q 3M6XA 5MAOA 3VVTA 2ZHOA 4CT8A 1FKOA 1YHQS 3JYTA 5F0WA 2CQBA 3R7NB 1K1QA 3TJAA 2AKWB 3THVA 5D0RA 2GAHC 2B9XA 4TU8A 5GOVA 3IWXA 4TQRA 3TUZC 2NUHA 5FDLA 1Z2ZA 4MKVA 1UPMB 3UCGA 4KTQA 3PFOA 2Y8WA 2FJXA 4J90A 1ALIA 1U6FA 4KRWA 3C8YA 5KFLA 5I3PA 5C25A 5J1EA 2D3UA 1AA1B 1KKHA 1PBAA 2ZKUA 4UT4A 4YR0A 2R2SA 4ECUA 3GJQB 1GT8A 4C8LA 2EKYA 3H20A 4XO0A 5J2NA 4C48A 3LP2B 4JI0J 5HMWA 3KFWX 4I1TA 4O3SA 1WKLA 2RHSB 2P6SA 3MM9B 4J9RA 4ES1A 1PJ6A 1WORA 4URQU 1KVKA 2JLGA 1TZ0A 3SQGB 3RBDA 4F2SA 1RT5B 1RT7B 5TJ3A 2EKNA 4DPOA 4FXWA 3BGRB 3X1LB 3TP2A 3H2LA 2HVEA 2LCWA 4DSLA 5INHA 4CXUA 2D7SA 3SZ2A 1N0VC 1U1PA 4QIFA 2AJ0A 1N4LA 3TEGA 1N5YB 3KJVB 1RTIB 5HO4A 2EFGA 1VQ4S 2YKOA 2BW7A 4RPFA 5KT6A 3VGTA 4EZ6A 1RAAB 3QYYA 2HRTA 3GV5B 1N2KA 4UPKA 3I0RA 1KHLA 1ZS6A 1IXKA 4O44A 1FE4A 4OX7A 2C2RA 1VBZA 1X4HA 4ANCA 1RTHB 1T11A 2Y1RI 4P6QA 3EUNA 3W8GA 3RAQA 1S48A 2QLXA 2ZFHA 5HVGA 1N32J 4H4OA 3MPYA 1YX2A 1U8SA 3GE9A 3RTVA 3W66A 4ANEA 2WVFA 2B4PA 3K8WA 4LSNA 2IAJB 2C22A 3R9LA 4R0EA 3D6FB 4IRKA 4QWDA 2YNIB 4GKKJ 1ALKA 5ETSA 3MCMA 3QAEA 2R7TA 1CJTA 2BE2A 2XZDB 3BZQA 3OR2B 3QLHB 4OZJA 3UN5A 4BC7A 4IRDA 2GSUA 3TAMA 4OFZA 1EARA 3PYDA 3MFHA 2BM0A 3N5FA 3CJSA 2GHPA 4F4YA 3Q3QA 2D1CA 1WI8A 2E66A 4WZMA 1NPPA 1NEEA 4HI2A 2RQMA 1R89A 2WRMA 3C6UA 3N9UC 4M5GA 3KJQB 2V63A 5E7OB 3HHNB 5LSRA 3ETMA 1U02A 2MEWA 3ZZPA 3R2CJ 2V9KA 4TVAB 3OTOJ 1JNRB 1ANJA 4ZLNA 5BYQA 4J9UE 1KTQA 4O3OA 3RAMA 4LF6F 3DLHA 4P74A 3OW2R 2VQRA 2L41A 3PYGA 3SSQA 3G86A 2MPUA 3W8PA 3IXQA 4C0HA 5HMXA 5LT5A 4PXBA 2I1RA 1FEHA 3SXLA 3FVYA 3VZHA 3CJ3A 3B54A 3G71S 3BDGB 2J9EA 1NPRA 4OX9J 1FHTA 1HBOA 5I4MA 2R7RA 2VV5A 2C3YA 3OHAA 4IKAA 4R0JA 3PXGa 3RU0A 1MU2B 1E6YA 2LQJA 2AF6A 4YP3A 3W9JA 1HI1A 3SZYA 2CNKB 2VFRA 2IMOA 3RBEA 1FTCA 1LNQA 4N7TA 1UVKA 2JVOA 1RCXB 2N3LA 3IAS9 4Y2IA 2E5LF 2RQCA 4CLLA 1HNWJ 1UFLA 3U02A 1NJWA 4PR6A 4FDFA 2RMLA 2CZVC 5KTQA 2YWWA 1C4CA 1KHWA 4NRTA 4F4WA 2GHWA 2ZH3A 1U6BA 3J7YI 2OPPA 2VFUA 2IYGA 5M2RA 2YKAA 3S6EA 1SHQA 1CJVA 1Y3JA 5IFMA 3A1YG 1HIYA 3A3OB 3KG4A 1RA7A 1W2IA 4I2PA 4LFAJ 2IRUA 1HFEL 1EJJA 4PG8A 1TKXB 4CP5A 2IDLA 4USKA 1WWHA 4GVLA 4AQYF 1HD1A 2P9CA 2FGOA 5CYQB 4ECRA 4CXSA 4ZVGA 1KLMA 3FGVA 1HWJA 4PYAA 4LJMA 1IWGA 1WHWA 1FWPA 2F5GA 2O1PA 1SKUB 1SQFA 2ZEJA 3M8PA 1S76D 2OTLS 4C0OC 1FDDA 2FYXA 3UQSA 5M2UA 2JWNA 4H4MA 2QLJB 2HHWA 4GKKF 4IH5A 5IT9U 5F8IA 4V1Ak 5H9EK 2FZKB 4KFBB 1C0UB 1JLQA 4USHA 2XNRA 4KGZB 4NLDA 2POKA 8ATCB 3BQ0A 1T3NA 1FWKA 2PEHA 2FIUA 4CNZA 3KK1B 2VBYA 3TA1A 1E6YB 4A47A 5CABA 3ZNUA 3FBFA 1L3UA 5F8JA 2UXDJ 2KKHA 3I87A 3TR5A 2P9EA 3M8PB 1X9SA 1RT6B 3CTRA 4NI2B 2ZOMA 4IRCA 2WSCC 3GQCA 3BGRA 2XMUA 3DYAB 3PJ9A 1TFYA 2RU9A 4DV5J 3SQGA 3GCWP 4P73A 2DNLA 2GQCA 2MQLA 2EFOA 4X66F 1NH8A 3DU5A 1IKYA 3JS9A 3JQJA 3TARA 4DV4J 4ECWA 4UOPA 1W7WA 1OWXA 4F67A 4X4OA 4NWJA 3A3PB 2IFXA 1S49A 2EEYA 2HFNA 1JLBB 2YWEA 4G1IA 2M2BA 3KLFA 5I3UA 3ZXWA 4DL6A 2M8DB 4LF2A 3LA0A 2W5SA 2DJWA 2H48B 5A8RB 3PCOB 4QR2A 3G6ES 4DR2J 2R8HA 5KFYA 3AH6A 1G7CB 4O4RA 3KMQA 3JTNA 4M5IA 3IGZB 3MCSA 2BJDA 4IFVB 4B9NA 5JUMA 4CQ1A 1JB0C 3A13A 4K2XA 4OZ3A 3KK3B 2G4BA 4ZHRA 2DGWA 2DIUA 2Y1LB 3W5YA 1MW7A 3AAWB 3D1HA 1X0FA 1O0PA 2BJEA 5D4LA 2ZJQQ 4ZMMA 4MH8A 5DO2A 4DN9A 3LP0B 4H4MB 4Y0FA 3PACA 2V2VA 3G82A 4EMDA 2K1RA 3IRXA 2QRRA 3EE3A 4KFBA 1OQ3A 3J7AN 1T3OA 3MMCB 5K20B 1XWLA 1S57A 3I9ZA 1NJZA 2H4YB 1KR4A 4K8RA 1VQMS 2C2NA 2OP5A 3RRHA 1SJFA 2RDJA 1FKOB 1ZAXA 4DPXA 4EU0A 4B3RF 3MCNA 1NSAA 1IKWB 2KVQE 2RILA 3C6TB 1TKTB 3DRPB 5IQ6A 3EWGA 5C24A 1TAUA 2H5IB 4M5MA 2XYPB 4J9OA 1C1CB 4IR1A 4RWWA 4DR6J 3UNYA 1FNXH 3MOZA 2ASJA 2HFVA 3G8QA 2HZAA 1FK9B 1UJ5A 3F0NA 2AJ2A 2MQNA 4Y34A 3NCQA 5IT0A 4N77A 1RLCL 3JSRA 4K5SA 4FBUA 5EUHA 2MTLA 1KOOA 3FQKA 3CCQS 4ALZA 2SXLA 1EIYB 4ED4A 2CYYA 3S8SA 3LANA 1XMQF 1B7FA 2E5IA 2YNHB 1F6TA 2ZOFA 4QWEA 2C2MB 4RUCA 4LMZA 1OO0B 1FA0A 2FY8A 5AT1B 1VMBA 4OZ5A 3OJSA 3KMSA 4N41A 2BUNA 4UQTA 1S1XB 1U2RA 3GZ7A 1H7XA 2BEFA 1MU2A 2M3DA 4IH7A 1VRQC 2MY7A 2OPRA 3HSDA 2DITA 4NX9A 2B6AA 2HFUA 3QWPA 2JDJA 4M5DA 4YEAA 4ZHRB 2C2EA 1S9FA 1UVJA 2U2FA 1G1XA 1NM2A 1H3DA 2CWKA 3DLEB 3MF5A 1R43A 1AZSB 1Q1KA 2RDIA 2WSFC 3ENWA 4HACB 4CLTA 5D4NA 3IR5B 4ECZA 4WFZA 4FKYA 2PEBA 2VOPA 2B7CB 1O51A 3IO1A 1EHWA 2ZJRQ 2UXCF 1KHVA 4OHXA 3EYZA 3BSCA 2CQDA 2BX6A 3OFEA 3ZO7A 1IKXB 1O98A 2B6AB 2VFSA 1XMOJ 1GXTA 2L9DA 2UV8G 4PG4A 5LMUF 2B9EA 3CJRA 5G0RB 3SCJE 2MHEA 3DMJA 2YQ3A 4DPYA 1DRZA 4DFJA 2DD8S 2QC3A 5BXIA 2DRAA 2YKMB 2FJVA 1S1VB 3PO5A 2V94A 4A46A 2M5YA 3BSOA 4OHYA 2KHDA 1PYTA 4KAYA 2WZ1A 2C3OA 2OEMA 3M30B 3NOGA 4KGXB 3W5XA 5KT2A 4N76A 3US5A 5HJXA 3SV4A 3NS5A 4L73A 3ISND 5CYQA 4ZP6A 4UZBA 3TNVA 2QFJA 4ZDNA 1URAA 2EI5A 1BQXA 2ZH4A 5LIAA 5GADI 1A7GE 4PKDB 2BJ8A 1SQGA 4OX8A 3TVZA 5HVFA 1Q7LB 1K8AT 1VRTA 3HVTA 4KPCA 3J80Y 4DSJA 2GNKA 2KH9A 1WG5A 3ICLA 4CLUA 4I6AA 3LWMA 1CVJA 1RZMA 4AD6A 4M94A 3PW0A 4RU2A 5GAGI 1RKJA 1HNXF 2KTQA 3LOUA 1FVQA 2BW2A 3PEHA 3K58A 1FEEA 5ETVA 5BJRA 3AD8C 2AQ4A 5F8NA 1QAYA 2W2PP 3JAMU 3WBHA 2X1FA 4RW8B 1F3FA 1FRHA 1Q5YA 3I4PA 3MPVA 2I8EA 4RBUA 4ZOSA 5JXSA 4DL0C 4DFPA 1UCNA 1ZTWA 4X62J 1N34F 3PRVA 2Z57B 1X5OA 3C14A 3FMWA 3I9V9 2A1BA 4CLKA 2JHEA 2DY9A 2GX8A 4W90B 5KFIA 4NEYA 3DHWC 1Y5NB 2DR8A 2A10A 4OYZA 2E1RA 3SZZA 1B64A 3MEGA 5HMYA 1R27B 3MAAB 4MKYA 2GS8A 2J9DA 2QYGA 4KR0B 3L7OA 1R0AB 2M52A 4A8YA 4GRSA 2VQEJ 1ZM4A 1ELZA 4OYBA 2AYMA 1T9VA 3D6HB 3M2RB 3BBBA 1V6HA 2FHJD 3M05A 1SJ1A 1XEZA 2NPIA 3HVWA 4M1KA 4WYLA 3WX4A 3VQTA 5HLFB 4EBEA 1SJQA 3P3DA 1U0HA 3W9IA 3GONA 1N56A 4OI4A 4C6AA 4TY9A 1JLFA 1YQHA 4DV0J 4DV3F 1Y6VA 4MY4A 2CJQA 3NY0A 3H5YA 1SI9A 2FJEB 1CJUA 1KEKA 1URNA 5L0KA 2C28A 1MSWD 1J5OA 5EX0A 5L8RC 2QFIA 5KFDA 2DEJA 4EO6A 4OZNA 1I5OB 3H5SA 4PXEA 2KXHA 4X84A 4X62F 5L1JA 4K4ZA 1K7HA 2OD4A 3IBWA 3VALA 2VPZB 3UO0A 5IT4A 3MD1A 1Q8IA 3IGNA 3T6JA 2LQ9A 2ZE2A 1T03A 1FE0A 2E7WA 1NKEA 4C8YA 1B8JA 5T7LB 1QY7A 1KFSA 1IBLF 4UY85 3MAHA 1NK4A 4WP9A 1K9MT 2NREA 3AJDA 3CT9A 3V4MA 3WC2A 3MDFA 3L7PA 3NOCA 4QIEA 3AXKA 4RL1A 4RW9B 1BY9A 3TQEA 4YY3F 3GIJA 2M0GB 1WC5A 1XN9A 1NNDA 2HVZA 5E5NA 2IUCA 5DGAA 1LWFA 3TX0A 4WE1A 3WIVA 3OD2A 4BC9A 3EVOA 1C4AA 1UWBB 1P1TA 2YKNA 2XHCA 3CDBA 4USWA 3H4BA 4H4KA 1F5AA 3B78A 4WIQA 2HZCA 2BKNA 2LA6A 1SH2A 5U47A 3EVMA 5D0EA 1U48A 1DQAA 3T02A 2Y8YA 1S99A 2VU5A 3OR1B 2W8SA 1SJ3P 2RRBA 3FFIB 3DOLB 4IFYA 2ZC3A 1S1TA 2ZITA 5IQQA 2EK6A 3WC0A 2MGZA 4YN3B 4EBCA 1XNQJ 2CNNB 2LU1A 4NLOA 4KSEB 2H51B 4KHMA 3PYEA 4H4OB 2E1CA 3AFGA 2W5RA 3TZYA 1Q82T 3GV7B 4NXMJ 4RWXA 2RF2B 4YFUA 4DV2F 1RWVB 2FHMA 1U26A 3UI3A 5LJ3Y 2DPIA 2RQ4A 1J5EF 3PW4A 2WOMB 1S6PA 4QJVA 4NOHA 2HHVA 2IRXA 2MJUA 1HQUB 2NCKL 2D9OA 4LF9F 2J9DE 2O3DA 4CLYA 1DARA 4KV8B 3NGDA 5J2MA 4LF4J 5G0RA 5DZ6A 1U0SA 1OIAA 4DX5A 3PV8A 1N5YA 1M1KT 4RU9A 2F65A 5EGHA 3SI8A 1F5CA 5T7LA 4IDKA 4B9MA 1WG4A 2AGPA 4PXDA 2VIHA 2ZUGA 2HFOA 2ZZNA 4PQUB 2E5GA 4B3TF 2F9DA 2IMWP 2DHAA 9ATCB 2KYXA 2PIIA 2Z2ZA 4ZVUB 4XPEA 4J9NA 1HYSB 3AA9A 2MKCA 2LYVA 4ZCLA 1HARA 3LAMA 4WFXA 3FMBA 1XNRF 1ACMB 1TTHB 3MTKA 3V81B 4ED3A 3JAMY 1ALHA 2PGCA 4CTAA 2CPDA 1PJ5A 2A6MA 3PX4A 1VRUA 1XBWA 2CJXB 1NJYA 2GC8A 4Y6IA 5DG9A 4R5PA 2R7VA 3CC7S 2W2OP 4EFAC 2LFVA 2XYHB 2DXFA 5F41A 3PDNA 2KG1A 3T1HF 2WVDA 4ECQA 4DEZA 2CUYA 4PPDA 2NR0A 1E6VA 1QAXA 4CO5A 3D28A 3FCVA 1Q95G 3DOMA 5HBMA 3PRDA 4HYKA 2QSWA 1WHXA 4QPTA 4OJHA 3RB6A 2J6SA 2GLQA 1DQ9A 2D74B 3G6VA 2ZM6F 1T7PA 2QA4S 3HFVA 4M5KA 1UFKA 1WTBA 1N36J 5B7WA 4NCGB 4JI8J 1HI0P 1UEUA 1NUEA 1U24A 2PMHA 4ER8A 3CMRA 5IC4B 4DR7F 2NZ4A 1X8DA 4NLQA 4DCPB 2GMHA 3CJ0A 1Y3KA 3CMQA 3BO2A 5DLWA 1R0CB 4PQAA 4V19X 1BUXA 1JJHA 2V4JB 1TL1B 2V8VA 4FYVB 3IM9A 4RUBA 5LMNF 1ZPVA 2DH7A 4DS4A 2QLWA 1U7LA 4G1QB 2N4DA 2GIRA 3EVWA 5DS7A 2EG2A 4P71A 2RU3A 2KXFA 1AFJA 4UUWA 4ES2A 4ZPDA 4FYYB 2OTJS 3SV3A 1RT4A 2EK1A 4ECXA 4I6WA 2YWHA 3S01A 1RSCA 2F40A 2VFVA 3I82A 4KBIA 4PPZA 4TKTA 3GP9A 4IG3A 2W7AA 3Q86A 2HQDA 4QIGA 1V9OA 5GAGU 1NSQA 1H38A 2DEIA 4LSNB 5JJBA 5D3GB 2KU7A 1I3OB 1U47A 1DLOB 3NKMA 2HKEA 3R5DA 3FCWA 3R5BA 4KHRA 1YTYA 1DZ5A 3OFHA 3GFXA 2R7QA 4EO8A 1KC8T 3CC4S 2J7UA 1YRTA 4Y2AA 1AJDA 1DTTB 4I2QA 2RAQA 1K47A 2AEFA 3QIDA 5CQGA 3H98A 2F63A 3OLBA 4IG3B 1B3TA 5DLFA 3MUTP 3U1LA 4QW8A 4YHHJ 3LPEA 1R0AA 1OY9A 1AXQA 4DR3J 1JLAA 4P52A 5ETLA 3MZIA 4OL8A 3BSAA 5GRRA 2XMVA 4I4BA 4KKOB 1PJ7A 2B8QA 4ZPWR 4NRUA 1X4AA 1AJCA 1H6KX 2FUG9 4QIWD 1LWEA 5L0BA 5F8HA 1LXNA 1AUKA 2DGQA 3F44A 3RBXA 3BGUA 5F3TA 3CDUA 1BXNA 4Y3CA 3OL7A 4LF5F 2HHUA 3GWCA 2ZH7A 3F41A 2CADA 3T9NA 4DV2J 1GEHA 3T5JA 2BV3A 1PBUA 5DDPC 4WCEQ 2ZDPA 4NPOA 3M9MB 4XTTA 3RBZA 5IWAJ 4NXNJ 1APSA 1KVIA 1O99A 4NCBA 4A48A 1RJJA 3JYTB 3RZAA 3HHLD 3UFCX 2XSJA 4DXLA 3GIMA 2HAFA 4LBIA 3WDOA 5L39A 3LGNA 4LFCF 2J0SD 2GAGC 2Z8QA 3DOLA 2MZ1A 1L3KA 3PKMA 4B3SF 1RT2A 2LECA 1PAUB 1S1TB 1S9EA 3KUHA 4M5NA 1Q7YT 1U49A 2KYZA 2FVRA 4FNIA 2UU9F 1GH8A 1FJGF 2CPYA 4QZVB 2VBXA 4URGA 1FRXA 2W2QP 1VQ8S 1YJNS 1TUWA 1NSPA 1DURA 3KJFB 4P75A 4YB7A 2MZQA 1RTZA 3VTIA 4USVA 3HM9A 4OIXA 1HHSA 4ID5B 1J5EJ 5IJSA 1S9EB 1LWFB 3QZ8A 2AJ4A 1KLNA 3HO1A 4USMA 2F8MA 2KT5A 4E0DA 1EW2A 1TKTA 3IG1A 5C5JA 4P7VA 3QRQA 4CO2A 1C0TB 4EEYA 3DI6B 1JIHA 2V0NA 1AYEA 2LEBA 1X4EA 2ASYA 2RH6A 3ED4A 1VLOA 2VG7A 2LP4A 3DOKB 3FKBA 3KLVA 2DRDA 2KXNB 1Z4UA 4FDIA 1RBAA 4KO0A 5B0EA 1S1WB 1VK3A 2ILZA 4DUZJ 4IFVA 1ZBTA 5LXYA 1YBAA 5AJ3F 3BBFA 1BC6A 1CLFA 2ZNYA 4LQYA 2ASDA 2ABYA 2W24A 5T41A 3CDAA 2ALYB 3I0SB 4G1PA 2PD1A 4OX6A 4BHQA 2XLJA 2RE1A 4EGLA 4K0KF 2YX1A 2Y3YA 3THTA 3LALA 2AD9A 2HBRB 2YH0A 1EW9A 2YNHA 5KFWA 1S1XA 5DDRC 4PWUA 4CYSA 1M5OC 1S6UA 3LGHA 4DUYF 2W25A 4C2MA 1UJ6A 3MFIA 4A8KA 3ZTOA 4KJDA 5ETNA 4DX8H 1LWCA 3CCVS 4PWDA 3ZZYA 1W26A 3LW5C 1WC1A 1UZHA 1FFWB 3HULA 5L1IA 5GMDA 2DBBA 1KHNA 1GAOA 5DQIA 3BSNA 2OH2A 3IWLA 1CJTB 3SMZA 4ETZA 5C42A 2VONA 2WBMA 1C1CA 4ANDA 3OHBA 3DCAA 5L9XA 1Y11A 2P6TA 1SXLA 3KDOA 1MWQA 1SUQB 3DDNA 5E41A 4EYHB 4Y2KA 1HA1A 4PABA 2MQPA 4B3MF 2NS1B 1NJXA 2ZJPQ 5DJBA 1HNIB 3WHIA 3R8YA 2RIJA 3CNQP 3T1AA 5CZVA 4C11A 1KVJA 2F1FA 4ZVPB 2W7OA 1ROFA 2A6OA 1AW0A 1NXIA 3GIKA 1U1KA 1HPZB 1M1HA 1TL3A 2C2OB 1NPKA 1VQSA 1OY6A 1GMUA 3D4JA 5CCMA 3NGKA 1UZDA 5J1PA 1YJ7A 2D9PA 3KLEB 2YNGB 1PYOB 4TLQA 4LFCJ 4JI3J 1SL1A 1R8AA 2HLTA 4DL7A 4BWMA 4Z2XA 3C16B 5LRNA 2XMTA 3KK3A 3CCRS 4D3HA 3M9OB 2IY5B 3N0VA 1CC7A 2OUGA 4XPCA 4JI3F 5DDQC 2GA7A 1EETA 1VRTB 2YPZA 4GVBB 5AXKA 1JXLA 3GJSB 2UXCJ 2PO4A 4K4SA 2PMWA 1QDUB 1KWMA 2AU0A 3C2PA 1RT5A 1YKWA 3AY0A 5K14B 2HFSA 4HTJA 2HWHA 3B4DA 3AJ2A 1BWEA 5LL6d 2AYEA 5KFNA 4JI4J 4CZCA 2DCLA 4ED5A 4B9VA 3R6GB 1VC6A 1M5SA 1X9MA 4UPLA 1HMVB 2DKOB 2IM2A 3UD5A 4UY8T 2BABA 1X7VA 4DV3J 3GG0A 3D2WA 5FJ4A 2IRYA 4UOCA 3SFGA 4N56A 4GMKA 1YIJS 1EQJA 3M9NB 3AOCA 2X3DA 3VGSA 4GC7A 2AHOB 3G96A 1KN6A 4ENOA 1L3TA 2Y0BB 2M4MA 2FVPA 1ZYQA 3KLGB 1Q8LA 2XGPA 5HJYA 3NP5A 1OPZA 1X9WA 5CA5A 2UV8A 4LVNP 3M8RA 1RHUB 3T01A 1FRLA 1N5TA 2XWYA 2QA1A 3SCIE 3W64A 4BDPA 5KFFA 2HNZB 5B0AA 2OPRB 4M5DB 1ED8A 4MK9A 2CA9A 5LXRA 3GR0A 1N5SA 4X4VA 3W1YC 2C2ZB 3JSBA 4OYOA 3VZIA 5DGBA 3T19A 1T9UA 1DY3A 3ZZTA 4CI0B 4HHUA 4HEA9 2B9YA 3QGIA 1FWLA 3DGPB 5KFZA 3TUIC 3H42A 2VHGA 3PW7A 1WJ9A 3M2UB 3N6LA 5FD1A 4X66J 1RT7A 4AQYJ 4TU9A 4ICLB 2HQIA 4ZJQA 2W8KA 1H2UX 2C2DA 4X4RA 3EZOA 3DDKA 4MFBA 4J9PA 1IKVB 2G9OA 3HZGA 3K17A 1FK9A 4ZITA 2MQQA 4ATNA 5KFPA 3I6PA 2E9ZA 2CJYB 1WSVA 4ZCKA 1Q81T 1WACA 3VCDA 4N8NA 2BJ9A 2HLUA 3KLHA 3DLBA 2VKRA 1M5PC 1TL7B 2QN6B 2EC0A 1YJUA 2VASA 1GX5A 2DR9A 3TANA 1CS4B 4FN5A 4NMXA 1RU1A 4NMLA 5RUBA 4MKBA 2VH7A 3VAGA 4O0NA 3M6UA 1GNKA 3AJ1A 1PCAA 2C1EB 2VDIA 4LBHA 2DNMA 5DM7Q 2F3JA 2G2YA 2V8PA 1RT1A 2K3KA 2YXLA 3BB5A 2CPEA 2Q6CA 3BM7A 3DLJA 4HH1A 5IM0A 4ZPBA 3V6DA 4WTOB 3KHGA 2XGQA 2QEXS 3TAPA 2BA9A 4QQBA 2DHXA 1QLNA 2I5JA 2LDIA 3LP1A 3O5TB 3PG9A 4WYWA 3ZTSA 1MLAA 2VJVA 1KTVA 2VDHA 1JNZB 3P5TL 1IR1A 3VGUA 1UVLA 1VQ5S 1RWUA 3AB2B 3GPAA 4YUDA 1HQEB 2L9WA 4CLWA 2YH1A 4NA2A 4I6YA 3D6TB 4UW2A 4A8WA 1EAYC 1WD6A 1RGVA 1Y0HA 2H4WB 2CQ0A 2JL9A 2NXJA 3DM2B 3HSGA 3MR5A 4QR0A 1X5PA 2AX0A 4B3TJ 1S77D 3OL9A 2CPFA 4P2FA 3BGLA 1L5UA 3D7SB 2RS2A 4MHXA 2QO3A 1IBCB 3Q24A 1JMTA 3UD3P 3R3TA 1AJBA 3Q8QB 5AXMA 5KFMA 4C3MA 5HROB 1NKBA 4JYAF 1H2TZ 1VJQA 2NXEA 4IR9A 3IRWP 3DDIA 4NCAA 4ILRA 4L6V3 1HBMA 1Z1ZA 3IA0A 3AQOA 4P7TA 5LMUJ 3QO9B 1QAIA 3HK2A 3ZC4A 2U1AA 1QTMA 3W2WA 3HJFA 2M8HA 3HD2A 1LOUA 1LW0B 3HD1A 2HS3A 5ETPA 3TRGA 2HG4A 4NYOA 4BWJA 3RGIA 4CO0A 2OMOA 4ZLJA 1P49A 5ITHA 2AMCB 1MNEA 3NWRA 2FJAB 1AROP 3H4DA 3T5KA 1U8WA 4CH0S 5KG5A 2M88A 1S12A 1FX4A 2OHDA 2OFHX 2GSOA 4ZGAA 4JI5J 2K06A 1U2CA 4OI3A 3L09A 1JLQB 1D9AA 1TMMA 1YJVA 2Q43A 3MPUB 4ZVHA 4CT9A 1IBKF 3T1YF 3ZTPA 1RAIB 4DV0F 4ZP7A 3K59A 3BYRA 3O3LA 2IC3A 1FESA 3HLUA 4CYUA 4UORA 3LF0A 1U1RA 4O44B 1S6PB 1KSPA 4RW6B 1TMJA 3QT7A 1HQUA 3W7BA 5J2PB 2RQKA 1FDAA 3R5GA 1RTIA 3HT0A 3EGZA 3IWNC 3PJWA 2B4OA 3GV8B 2YX4A 2PMZD 4LRDA 3Q8YA 3QSYB 3E2DA 2CPZA 3PR4A 2CQHA 3IBCB 4MT1A 2FLOA 1ZAVA 2GIQA 5L1KA 2DGSA 5KG4A 4RO0A 4TQSA 2QG9B 4FPIA 1Y00A 4R8UB 3GU0A 4Q45A 3J80U 1KOHA 4RLEA 5D4OA 1TV6B 1RXOB 3ILIA 1U4BA 3K0JA 1PILA 3CJ5A 3H2UB 3H5UA 1YRXA 3IS9B 3OTEA 4JI6F 5A8KB 1ZEBA 3HSZA 2J6TA 5J2QA 1N8RT 3M30A 2HNYB 3M2VB 5F8MA 1VRUB 2YTCA 2ZH1A 3DMJB 3RW7A 1VHFA 4HLBA 2V9WA 1HKAA 3KD8A 3LP0A 1ICEB 5L0EA 3N4WA 2ZBQA 5FDLB 2GZOA 2LVWA 1IWAA 3I32A 1S4EA 3T3FA 2HRUA 1XQIA 1RTJA 3ONQA 1RAEB 3C15B 3GLJA 5F0UA 2W4PA 2I38A 4ZVOB 4O3NA 2JSXA 2XY6A 2W5XA 4F0KA 4K4UA 5FLXU 5CD4H 4LFBJ 4LF5J 5DDOC 4QWAA 4ECVA 1P1LA 5H9FK 2E1PA 1Y10A 2DNNA 2P9GA 2QLFB 3HHLA 3ENQA 3M8WA 3R5JB 4P2XA 5IJQA 2CJ9A 2LKZA 2NUUG 3KDNA 1Q86T 3ILJA 4QU6A 2IBKA 2GCFA 4MYUA 5J2MB 2HK2A 4DSEA 4OLOA 2YWGA 5B08A 4B9LA 5F9NA 1HJKA 4RW7B 2PDAA 4LUBA 4OHZA 1DFDA 3R5AA 4HHJA 2RKIB 4OMFG 2HGLA 2OSRA 2RJZA 5E3QA 3RRGA 2R7SA 4ZP9A 3ZZZA 3JSMB 2V4RA 2Z30B 2BBEA 1BQNB 3IDDA 3D3BJ 3LGMA 3UW1A 3M4XA 2M7SA 3HHDA 5ETTA 3BO4A 2ZHAA 3P96A 4O23A 2FVSA 1VQLS 2KRRA 4HH0A 3JQMA 1QSSA 2NQPA 1RABB 2ANHA 3U7JA 4KH0B 4XK8C 1R7IA 2ACYA 4QOTA 4E2FB 4EUVA 1Y7PA 3H5XA 3BEGB 1YLXA 3CIZA 4LQ9A 4NLYA 1CJVB 3PY8A 4ELTA 4KAIA 3CMES 3NNAA 1BQNA 4MFBB 1MMDA 2OPPB 2AWZA 5A0YA 4F3OA 1U1MA 4AXJA 5IV3A 4HHHA 2B51A 4XIUA 3KXDA 4DQQA 3L7UA 3FBCA 4OYIA 2NYIA 2KM8B 3UD4P 3RB0A 1D1UA 1NKCA 1Q8BA 3UN2A 4HL9A 3ZTRA 3DOMB 1Q5VA 5HBMB 3NWGA 3W2VA 5KOXA 1NMEB 1RBOB 2VQFJ 1RWXB 3VAKA 2JEFA 4FPRA 3D0IE 3CJKA 2QX0A 3OBIA 2CFXA 4CO4A 4YR3A 1J5OB 3TUPA 3N01A 4DR7J 3BDHA 2EBEA 4UOGA 3EPIA 5HQMA 2CZ4A 2VL1A 2Z4PA 2ZC4A 2ZE2B 4KYZA 1MROA 2QE5A 5D6GA 4K7QA 3AD9C 1LFWA 3ET6B 2HSEB 2GVZA 2DIVA 1UW9A 4DQRA 4LIRA 4U7UK 2XSFA 3AXMA 3DOKA 2HGMA 4DCJB 3R6LB 1VOMA 2H3EB 4DWIA 2WW4A 1YBUA 3CC2S 4JI7J 5HQ8A 4C9DA 1U25A 1OYDA 1YZ7A 3F56A 4LF6J 4USTA 4ZJLA 1JJ2R 2MYFA 2XO7A 4TN0A 1EP4A 1UW4A 2XM3A 1H7WA 1N6QA 2JEIA 4I69A 5L46A 5GAHU 2JH3A 3IAM9 2KZMA 3PKYA 2DO0A 1DBDA 1S5ZA 4CRJA 1URRA 4C3KA 2UVWA 4IYQA 4J9KA 4RW6A 3Q8RB 2EFNA 2N7CA 3NBPB 1XTZA 2AGQA 1A0OB 3J81U 4QBUA 4OYXA 3PTWA 2O5DA 3MM7A 3DC2A 4QYRA 4AFFA 2G0JA 2VBZA 3KUEA 2XMAA 4Y28C 2CQIA 3QSIA 3CUNA 4RNMA 1NB2A 4C3LA 3CE8A 4X4UA 4FP9A 5KFQA 3UCUP 2KL8A 3BBCA 1S72S 4ILMA 1FRKA 4F0MA 4Q0BB 4QAXA 4DL3A 3R5CA 4R25A 5KG3A 5BYSA 2KRBA 3BR9A 4NE9C 4FBTA 3JTOA 1ZH5A 5SUHA 5C2GA 1NK0A 1H74A 4X65F 2AX1A 1HWLA 2GIFA 2QMWA 1KLMB 4B9TA 2KG0A 2FZCB 3DU6A 3PHEA 1HBUA 5LQQA 4HT5A 1TR0A 4FVCA 3ZTQA 5DQHA 3KHRA 3W62A 2Z58B 3PYFA 1EI6A 4JI2F 5L1LA 1HHTP 5C2CA 1S79A 3MM5B 2BQRA 2BJ3A 4B9SA 2BR0A 2X98A 1UEKA 4U8YA 4CWBA 1NZAA 7FD1A 2OD6A 2ZVIA 4DR6F 4USIA 3C19A 3C3LA 3C6TA 4PG7A 3MMJA 1SQEA 4CLSA 1TL5A 3CJ2A 4PG6A 8RUCA 4QIVA 5FLXY 2PA3A 2XMMA 2FHOB 2MZRA 2XCPA 2G9YA 3LQVA 1OMSA 4ED7A 4TXSA 4ED2A 1GK8A 3KHHA 2HVDA 1NU4A 1YGYA 1NSKL 2F7VA 3K57A 1JX4A 1HNIA 3WQPA 1BD6A 2JNJA 1WTFA 2IJFA 2YPYA 4CCHA 2PFFB 4YB1P 1IBLJ 4IO9Q 1NB7A 1FJ7A 1HL6A 1GX6A 2HHHF 2RRNA 2VZ9A 4KY3A 2W8DA 2HBYB 4UF4A 4OI6A 2KZZA 3BGFA 4M5JA 1S7IA 1C1BA 1RT3B 2B7BB 4ZPCA 4J9VA 4U7CA 3AOBA 1VQKS 2GJ2A 3DLEA 2IA6A 3QRPA 4W4MA 4QYZK 2QZUA 3VWSA 2HHSA 4L72B 1D0EA 1YJTA 2IVMA 4F2RA 2ZD1A 3ITHB 4AT1B 5F8GA 1VGYA 3IR7B 3PX0A 1QUPA 1BWVA 1N32F 1FJCA 3FFIA 2IJRA 2MZTA 5A6WA 1UFWA 4Q43A 4GTZA 1TFWA 3IGYB 2H54B 4OYPA 3UWTA 1XC9A 1M5VC 3JTPA 4TNOA 2M9KA 2B4UA 4HDHA 1SCJB 1NDLA 3QJPA 1F9FA 2UXBJ 2VUGA 1K0VA 3GYNA 1N52B 3RG6A 2E5JA 1TK5A 3MOJB 2J8AA 1FFSB 1CQMA 3D66A 4NI2A 2DNQA 1J2VA 2ROPA 3QIPA 4L76A 1PKUA 2HAIA 3D3CJ 4MJKA 3TAMB 4ZIVA 2CVIA 2W5TA 2BZ2A 4B3OA 1HQAA 3UVJB 1WC3A 4FKXA 4Q2LA 2RB7A 3NAHA 1RAHB 1S1VA 1MWZA 2QIFA 4ZCIA 3QBCA 4DF4A 2R8GA 1WC4A 1X31C 2CPXA 2IM0A 2VG7B 1U6ZA 4B17A 4A8XA 2UXDF 5LRMA 2E9RX 2CIMA 4IOCQ 4TY8B 3K2YA 4X4QA 2R4FA 5HVHA 2XZTB 3E2EA 2I6WA 3C15A 3CJ8A 4XDCA 5HSPA 5GMEA 1I51B 3P45B 2MXYA 5JVGQ 1NAQA 3RR7A 2EPIA 2YWFA 1IQZA 1P27B 4UOHA 2PA8D 1BHNA 5ETQA 3SYZA 2XG8A 1JK9B 3BGOP 5A8RA 2AZ1A 4WWSA 1FRIA 1O8BA 1LWEB 1SC1B 2H5JB 3IR6B 4U6PA 3VF0B 2UUCJ 5CXTA 2DK2A 2MSTA 1YWXA 4OYWA 1B0TA 4PCQA 2UVRA 2HRYA 2DNPA 4RJVA 3CXCR 1F2HA 1XIQA 2JC0A 3R1LA 1TQLA 1RI7A 2VOOA 4MYTA 2NZCA 1SV5A 3TZZA 2J0XA 3CCUS 5B0GA 1VBYA 1C2PA 1RHJB 4CM0A 3M2RA 5C42B 1UTAA 2BKOA 5K14A 3SIPB 3POTB 1OJ4A 1ZM2A 2XMJA 4LRCA 1VR6A 3MGJA 3A8EA 5GMKa 2W9BA 3BJYA 5IV4A 3NG8A 3CDWA 4WP3A 3KK2B 4RNOA 4HTIA 2X1AA 1TKDA 3QT8A 1T9XA 1L3VA 1E3CP 2BYCA 3D5MA 3MM9A 3FBBA 3BR8A 3W63A 2ZH9A 2QTWA 2HS4A 2WVCA 4NWBA 4ZLLA 3GFYA 3TYTA 2D3ZA 2X7IA 5J2NB 1Y5LB 3PEJA 2XS7A 4A8MP 1S4FA 2BANA 3EMTA 4KT0C 4MK8A 2E5HA 2ALZA 3H8YA 3QGGA 1QSLA 4EYIB 4FF2A 1IQTA 1HNZJ 3CIMA 1RACB 4P72A 2FJDB 3B6BA 4DU8A 4J7CA 1ZA2B 1ZPWX 1TL1A 3N79A 4MK7A 5A6PA 5CH7B 4ZS6A 3TA2A 4AUKA 3KTQA 2QL9B 5KFEA 1UWAA 1V3ZA 2XLIA 3KK1A 3CD0A 1V5VA 1BQMB 3M8QB 1XMBA 1N48A 1S9GA 1XR6A 4JI0F 1XR7A 4DV1F 3QZ7A 2EFPA 1UKUA 2ILYA 2NLWA 2BJ1A 4IUFA 3OSNA 3D0HE 1QTNB 3GJRB 5EN1A 1UAWA 4HI1A 4LSLA 4NLRA 3RB4A 4JV5J 1VISA 1RT4B 4DJBA 4WF9Q 4FXDA 3BO3A 4JI1F 1YJRA 3I4HX 4U9RA 4CLPA 3K5MA 3F73A 1HBNB 1HWUA 1RCOB 3QGHA 3TX8A 4QPXA 3HMJG 4K4YA 2MHNA 4WE1B 1ZETA 2GHVC 1RP5A 2HQGA 4FF3A 2ZH5A 2IUCB 1ANIA 4DX6A 4FYXB 4K4WA 1JLBA 3QGPA 2MLXA 1RQ0A 1WF1A 2KVIA 2LDYA 3IP0A 4ZP8A 5D77A 1JLEB 5A8WA 1M0SA 2OPSB 1NK6A 2HMIB 4GTYA 5HI7A 1U1OA 4ID8A 3CPWR 2BE7D 1RTDB 3I31A 1A9NB 4I56A 2VPYB 4FVMA 4BBYA 3PFEA 4QWCA 1RADB 3HXMA 1FJEB 1HNXJ 3DGVA 3OFFA 4OV1A 3B5QA 2XHWA 1LV5A 4HDGA 4N47A 3MMBA 1RDRA 4K4XA 3EICA 1WELA 4Q7AA 5F9LA 2J76E 4EBDA 3T5HA 4GTXA 2ZH2A 2R2UA 4DV7F 5DZ7A 3R2DJ 2AJ1A 1RA6A 1P9QC 1HHQA 4RUAA 4QU7A 1SUQA 2XY5A 1H2VZ 1KQSR 4GKJF 3CCZA 2AP6A 2BRKA 1JLFB 2Q3PA 2DR5A 4DSFA 3DLKA 3TI0A 1FTRA 2PN6A 3VAHA 3RAXA 1D3WA 4ETXA 4JI6J 1SC3B 4X4NA 2FGCA 1XJWB 2RUGA 3DRRB 4LIWA 3K5OA 1D09B 2ZDOA 1DTQB 1H72C 4I2QB 2PT0A 1U2FA 4O4GA 1RYRA 1QVGR 2B3TB 2AEJA 1QE1B 4NASA 2JZ5A 4OJ1A 5IOLA 4GC6A 1JLGA 2G2OA 3MPDA 2XO6A 1HLWA 5KAKA 3EXCX 3J7YU 4J9LA 3DYCA 3OTOF 4DQPA 5G4DA 2JLFA 2ROEA 2APOA 4TLRA 2ADCA 1IKWA 1WKJA 3ISNC 2KDOA 2LQBA 3FUYA 4DV4F 2UUAJ 2UXBF 1FO1A 4DPWA 2VBWA 1QAJA 2GMLA 3V6KA 3BH7B 2D69A 2QJ3A 1UA1A 4NLUA 3EM1A 2JLEA 1ZZFA 2LMIA 4DV5F 2L48A 1S6QB 2RVJA 3AHPA 1I6JA 4AL6A 2W7PA 1NK9A 3K5LA 1NDPA 3FQLA 1UVNA 1REVA 1OY8A 3PIPQ 3V4IB 4IOAQ 2UP1A 3QJLA 1VBKA 1AUSL 3MM6B 4DX7A 1F9EB 2IAJA 3L4BC 1HWKA 4QYZJ 2IVFB 4NCGA 1SVDA 1D8YA 2I9SA 1TP7A 4DL2A 2OLWA 1PC4A 3KNAA 5B09A 1BLUA 4NXNF 3TVYA 3M6WA 2CQ3A 4YHHF 1TKXA 5F3ZA 1EJ7L 1DHMA 5EX3A 1YK9A 3NGTA 4IFYB 4ZVFA 2F4FA 1QVFR 3V4IA 4C98A 2FPHX 3ZZRA 2IDEA 4LT6A 1P8GA 1R8CA 1T9WA 4OZ0A 2HHHJ 4F26A 3FDSA 3KLIA 5E3RA 2UUWA 1GTHA 2QZ8A 2YKQA 3H59A 1LKZA 3D1QA 3POTA 5A76A 3LTOA 1S1UA 3RUBL 1LW2B 4L75A 3UDEA 2XNQA 2XZWA 3EGNA 2JOQA 3H25A 3UE2A 2UUAF 3LUYA 4ZN1A 1RWPB 3JQKA 2ZWPA 1LEOA 4C4WA 1AJAA 3HHLC 1Q78A 3NCPA 4LFBF 3PX6A 2FHJA 5K8PA 2CJKA 4KHPF 4J9MA 2CPJA 2FVCA 2V8GA 1Y4ZB 2GVZB 3CCJS 5H1SV 4YR2A 2UU9J 1NHKL 2MB0B 2XQCA 5B0BA 4OQJA 4IG0A 1GMWD 2ZBPA 4E8UA 5IS2A 1Q79A 4DR5J 5C24B 4C8OA 2CNLB 3HHKA 2E5LJ 2UUBF 5DLTA 1NH7A 1CBKA 2VG5A 2DTJA 4ZA1A 2WAQD 3GCXP 2H1YA 3MM6A 4NZ7A 2E44A 4ZVSB 5A2QU 5IM0B 1VC5A 1N5VA 4RW4B 5GVQA 4ZIWA 5GAHI 1G2EA 3G6XA 5J2PA 2R7WA 2C3MA 3UVJA 4DSKA 3V2UC 3TJ9A 2VQFF 3FEYB 1F0XA 2EWHA 2LXUA 3NKYA 1FDBA 1R6YA 4MTPA 2ATLA 3CCSS 3MR7A 2XYGB 2EVZA 5DETA 3T00A 3FSYA 5KT4A 5AE3A 3MK0A 2VG5B 2XI3A 4UPHA 3Q8PB 5EWEA 3M8YA 1X4DA 4F25A 3KJVA 4F4ZA 5SZTA 1ZOTA 3GFHA 4KIAA 1DAXA 5B0DA 3MAAA 2ZHBA 4ELUA 4TU7A 1PC5A 2XSJB 5BR8J 4LVOP 3BV8A 4PUOA 2KN4A 3SSSA 3BPDA 2E1MC 2HS0A 1OPIA 3B4MA 3W9HA 3ISZA 1F9HA 5I42B 1YJ9S 1KRPA 3I5BA 1ZM9A 4JI1J 3E3XA 2P8IA 4JP8A 2N3OA 3G4SS 2AIRB 1RT2B 3HKWA 2X3GA 2FC8A 3GR1A 4YDXA 1SV5B 2CPHA 4Y00A 2N4CA 5K8OA 1TL4A 2JEJA 1CULA 2LQ8A 3V81A 1RUSA 2QSFA 3NKQA 2GW8A 1GXUA 3WAVA 3OPKA 4Z7YA 1EZZB 2ROGA 1WEXA 2BRLA 4G65A 1WG1A 2OEJA 2BDPA 5ETKA 2PC6A 3X3UA 1KDNA 1RLDA 3Q89A 4KO0B 2D3O1 1SKSA 1WHYA 1RT6A 4F04B 4I68A 4NLPA 3Q0AA 2BVZA 2E29A 3IM8A 1ULRA 3Q2TC 1ELOA 2JVRA 2NXUA 1KP6A 1RHQB 5ETMA 2OGUA 3IG1B 1F60B 3J7A1 2OFGX 2J5AA 2VJUA 4EWTA 1RTDA 2DGOA 5KT3A 1NO8A 3KLFB 1CPZA 1HW9A 3NRBA 3IC1A 4UZCA 2WB4A 1RHKB 2IFYA 3EDRB 4FNHA 1R31A 2IA0A 4DF8A 3Q8VA 1YJWS 2PI5A 2OEKA 2V5HG 2W9CB 1IKYB 4XDDA 1DTTA 3EJMA 4USJC 5CZXA 3ZZ0A 3QT6A 3PNIA 4NYZA 3CO0P 4DZDA 2EFQA 2HZVA 2W5VA 4YR1A 3EZUA 3K5NA 2W5QA 4A8SA 4MKAA 1UWBA 3TZWA 3QATA 4DV6J 5LSOA 4DL5A 4PUOB 5HANA 2IHR1 2HNDA 4R8UA 2B8PA 3Q8SB 5DG7A 2F8HA 5HAOA 3AB4B 1I94J 3QJJA 3B8HA 4CH7A 1SB6A 2WONA 2QMXA 2JC1A 2QMUB 1IN0A 4DU7A 2Q66A 5AJ9A 4I0WA 3KHLA 2IJNA 2OMLA 4WPAA 3MTJA 2W2MP 4WFYA 4WJBA 1T94A 3TEHB 1NZ8A 4Z37A 4X65J 4Q44A 2BE9B 3NGSA 3CDEA 3MEKA 1TL3B 3QAUA 4ED8A 1R6VA 3S1TA 1YI2S 3ELHA 3QWUA 3M6VA 3CD6S 3ENVA 1FNMA 4K50A 3IBFB 1XERA 1T9YA 5GAEI 3GYGA 3MMCA 2WONB 1T9TA 4HKQA 5KFVA 4TYAA 5L38A 3D6MB 1TELA 3HX9A 1YRUA 1B0VA 3OFGA 2E9TA 5IZHA 4C0BA 4C11B 4NL5A 2E1AA 4C8NA 1M1GA 2XBPA 2PFDA 2W2NP 3MM7B 3NCRA 4U96A 2BOPA 1AFIA 1EW8A 3BPSP 1JLAB 1TUVA 2DRBA 4NZ0A 3MEDA 4CYRA 1T05B 2A2CA 2LU2A 4CIOA 3PHTA 1RU2A 2Q6BA 4UOOA
chains in the Genus database with same CATH topology
1ELZA 1N2LA 5K4PA 3TG0A 1ZEDA 1KH7A 5DLTA 3CMRA 3IDDA 4UPIA 4LR2A 2VQRA 3M8ZA 1KHNA 2XR9A 4LRFA 2RH6A 3Q3QA 2ANHA 5DLWA 2IUCB 2W8DA 4KJGA 1Y6VA 2W5WA 1E2SP 4MY4A 3WAYA 3BDGA 5L0KA 2QZUA 1ANJA 1KHJA 3MK0A 4GTYA 3T00A 4MHXA 4UPHA 1AJBA 3M8YA 1K7HA 1O99A 3BDGB 4GTZA 4LR8A 3UO0A 3UNYA 3B5QA 3OT9A 3IGYB 2XRGA 5GOVA 3UN2A 4GTWA 3DPCA 1B8JA 3NKMA 4GTXA 4LRAA 3NKPA 1P49A 3SZYA 3BDHA 2D1GA 5LRNA 1AJDA 4N7TA 4LRBA 5C66A 4MIVA 2W5TA 1HQAA 3MK2A 2IUCA 3WAWA 3A52A 2GSOA 3TX0A 4ZG6A 1ANIA 1ELYA 3NKOA 1KH5A 3NKQA 5LRMA 1E1ZP 1HDHA 5GRRA 2GA3A 3WAVA 3NKRA 1SHQA 1AJCA 3T02A 5L0BA 4UORA 1KH4A 1AUKA 3DYCA 1URBA 2W8SA 3TWZA 4UPLA 3UN3A 1EJJA 3MK1A 4TN0A 1ALIA 1ELXA 1EQJA 2W5RA 5HRTA 1O98A 3BDFA 5DLVA 4CXSA 4ZGAA 4LRDA 1KH9A 3E2DA 3NKNA 2IFYA 5KXAA 3T01A 4KAYA 1ALJA 4NWXA 4YR1A 1ED8A 1SHNA 2W5VA 4LR9A 3WAXA 4LRCA 2ZKTA 5TJ3A 1URAA 1ZEBA 2W5QA 5EGHA 1E33P 5LIAA 1Y7AA 1E3CP 4QAXA 5INHA 4CXUA 1ZEFA 2GSNA 5IJSA 1FSUA 3M7VA 4B56A 1EW2A 4ZG7A 1ED9A 3KD8A 5AJ9A 5L0EA 3ED4A 4KM4A 4UPKA 1N2KA 3WBHA 1ALHA 1KHLA 5LQQA 4FDIA 4UOPA 4CXKA 4NWJA 2W5XA 4ZG9A 3NVLA 1EI6A 4LQYA 1AJAA 2X98A 3LXQA 3M8WA 4FDJA 5IJQA 4LR7A 5EGEA 2W5SA 4KAVA 3IGZB 1ALKA 3SZZA 1EW9A 1KHKA 1HJKA 1EW8A 2G9YA 4CYRA 2GLQA 4CYSA 4LREA 2GSUA 4UOOA 4KJDA 3UN5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ELZ A;  1N2L A;  5K4P A;  3TG0 A;  1ZED A;  1KH7 A;  5DLT A;  3CMR A;  3IDD A;  4UPI A;  4LR2 A;  2VQR A;  3M8Z A;  1KHN A;  2XR9 A;  4LRF A;  2RH6 A;  3Q3Q A;  2ANH A;  5DLW A;  2IUC B;  2W8D A;  4KJG A;  1Y6V A;  2W5W A;  1E2S P;  4MY4 A;  3WAY A;  3BDG A;  5L0K A;  2QZU A;  1ANJ A;  1KHJ A;  3MK0 A;  4GTY A;  3T00 A;  4MHX A;  4UPH A;  1AJB A;  3M8Y A;  1K7H A;  1O99 A;  3BDG B;  4GTZ A;  4LR8 A;  3UO0 A;  3UNY A;  3B5Q A;  3OT9 A;  3IGY B;  2XRG A;  5GOV A;  3UN2 A;  4GTW A;  3DPC A;  1B8J A;  3NKM A;  4GTX A;  4LRA A;  3NKP A;  1P49 A;  3SZY A;  3BDH A;  2D1G A;  5LRN A;  1AJD A;  4N7T A;  4LRB A;  5C66 A;  4MIV A;  2W5T A;  1HQA A;  3MK2 A;  2IUC A;  3WAW A;  3A52 A;  2GSO A;  3TX0 A;  4ZG6 A;  1ANI A;  1ELY A;  3NKO A;  1KH5 A;  3NKQ A;  5LRM A;  1E1Z P;  1HDH A;  5GRR A;  2GA3 A;  3WAV A;  3NKR A;  1SHQ A;  1AJC A;  3T02 A;  5L0B A;  4UOR A;  1KH4 A;  1AUK A;  3DYC A;  1URB A;  2W8S A;  3TWZ A;  4UPL A;  3UN3 A;  1EJJ A;  3MK1 A;  4TN0 A;  1ALI A;  1ELX A;  1EQJ A;  2W5R A;  5HRT A;  1O98 A;  3BDF A;  5DLV A;  4CXS A;  4ZGA A;  4LRD A;  1KH9 A;  3E2D A;  3NKN A;  2IFY A;  5KXA A;  3T01 A;  4KAY A;  1ALJ A;  4NWX A;  4YR1 A;  1ED8 A;  1SHN A;  2W5V A;  4LR9 A;  3WAX A;  4LRC A;  2ZKT A;  5TJ3 A;  1URA A;  1ZEB A;  2W5Q A;  5EGH A;  1E33 P;  5LIA A;  1Y7A A;  1E3C P;  4QAX A;  5INH A;  4CXU A;  1ZEF A;  2GSN A;  5IJS A;  1FSU A;  3M7V A;  4B56 A;  1EW2 A;  4ZG7 A;  1ED9 A;  3KD8 A;  5AJ9 A;  5L0E A;  3ED4 A;  4KM4 A;  4UPK A;  1N2K A;  3WBH A;  1ALH A;  1KHL A;  5LQQ A;  4FDI A;  4UOP A;  4CXK A;  4NWJ A;  2W5X A;  4ZG9 A;  3NVL A;  1EI6 A;  4LQY A;  1AJA A;  2X98 A;  3LXQ A;  3M8W A;  4FDJ A;  5IJQ A;  4LR7 A;  5EGE A;  2W5S A;  4KAV A;  3IGZ B;  1ALK A;  3SZZ A;  1EW9 A;  1KHK A;  1HJK A;  1EW8 A;  2G9Y A;  4CYR A;  2GLQ A;  4CYS A;  4LRE A;  2GSU A;  4UOO A;  4KJD A;  3UN5 A; 
#chains in the Genus database with same CATH topology
 1OQ6 A;  2CVE A;  2G0I A;  1S0M A;  1R8B A;  1DTQ A;  2KT3 A;  2WB1 D;  3VAM A;  1FCA A;  1YDL A;  4ZPA A;  3BDP A;  2XS5 A;  5J1N A;  3TW0 A;  4DN0 A;  1RAG B;  3U27 A;  3W2W B;  3GG1 A;  1R8P A;  1EP4 B;  3D67 A;  1LW0 A;  2R8J A;  3BKU A;  2JFK A;  2JRS A;  3DLK B;  2XC9 A;  5IT9 Y;  2YNF A;  2O66 A;  4IH6 A;  3GB0 A;  4F0H A;  9RUB A;  3W60 A;  2RKI A;  5KOW A;  1PGZ A;  4WZQ A;  1ZTT A;  3K8V A;  2R2R A;  2DYA A;  3NL0 A;  2XUL A;  5DRK A;  5HK4 A;  1ZZN A;  2MKI A;  5AJ3 J;  4M63 A;  1LW2 A;  5E0O A;  2EFV A;  3MM8 A;  5E3C A;  3SCK E;  2OO4 A;  3DYA A;  4NA1 A;  3J7Z T;  3IN5 A;  3HVR A;  3TAQ A;  1N34 J;  2J9C A;  3I0S A;  4C8M A;  3HSJ A;  2AV5 A;  1AZS A;  1RHM B;  4DR1 F;  1AB8 A;  2V8D A;  4OZ2 A;  1NDK A;  3QNW B;  4WTY A;  2C42 A;  1B7Y B;  2XRG A;  3CSK A;  2ZOG A;  3P4U B;  3ZNJ 1;  2DH9 A;  5CYJ A;  4JI8 F;  4HAC A;  5D78 A;  1Y9O A;  5F8L A;  8AT1 B;  2J7K A;  4WP8 A;  4F3Q A;  5AXN A;  4DUY J;  3WAX A;  1Q16 B;  1ZA1 B;  4KGM A;  1FKP B;  3KOA A;  2GVD B;  4LQ3 A;  2DGV A;  1VIO A;  4FZV A;  3PJX A;  4OI2 A;  4FYW B;  1UP1 A;  2QL7 B;  4PG5 A;  3NKO A;  1VQ9 S;  4M5L A;  2DHS A;  3Q2S C;  5KG6 A;  1TV6 A;  1JKH B;  2X51 A;  2ZZT A;  4X64 F;  4WFA Q;  4V19 J;  2HK3 A;  4WKR A;  3FEZ A;  2BAN B;  5AE1 A;  2AT1 B;  2OKQ A;  2CG8 A;  2EBG A;  1K73 T;  3NKR A;  1D9F A;  3W65 A;  2D3O R;  3SEO A;  3KNG A;  2XB2 D;  2V2Q A;  4JI2 J;  1S0O A;  3ADA C;  3CCT A;  3KLH B;  1KQF B;  1IKV A;  2YY3 A;  1S9G B;  3MK1 A;  2QA2 A;  5KFT A;  1YZ6 A;  1WC6 A;  2JJ4 D;  2RDD A;  3KJN B;  3OVA A;  1VQ7 S;  3M8Q A;  4OHW A;  4P10 A;  1N0U A;  4FS2 A;  3MD3 A;  2A3J A;  3EGV A;  2R7X A;  4PEO A;  3GII A;  3BQ2 A;  2YKN B;  3G87 A;  4RW8 A;  3EPG A;  2XCA A;  2ATC B;  1WHV A;  1RK8 A;  1TKZ B;  3N6N A;  2W1B A;  4JBC A;  4L74 A;  5D0G A;  5KFA A;  4RNF A;  2ADB A;  2M70 A;  4PQU A;  1RWW B;  4KKO A;  2ZH6 A;  5DQG A;  2RNE A;  2DR6 A;  3NS6 A;  4ES3 A;  1E33 P;  2J0Q D;  3KYL A;  3MAQ A;  1IBK J;  1N33 J;  2B5J A;  3P49 B;  2PSZ A;  3A8J A;  3K5P A;  1RKI A;  3LPY A;  1XMQ J;  4DPU A;  4KH1 B;  2K7J A;  3BF4 A;  3MEC B;  3R7B B;  3M7V A;  4ILL A;  1JWW A;  3OQ2 A;  5HLF A;  2WVE A;  2DO4 A;  1UJ4 A;  2WOM A;  4RKU C;  3UDC A;  3OXG A;  1WSR A;  2KFY A;  3QPI A;  4UOF A;  1S7H A;  2FHK A;  2OI2 A;  3L9Z A;  2C3U A;  3MUR P;  4DPT A;  1IBM F;  1WKK A;  2YX7 A;  1X4C A;  4AL7 A;  2ASL A;  3EXY A;  4CDI A;  3R1H A;  3TA0 A;  3CUL A;  3BKF A;  1OYE A;  3PW5 A;  3DRP A;  4WFB Q;  4NLG A;  3HVA A;  2LEA A;  2R42 A;  1NK7 A;  1UET A;  1VIX A;  1MN7 A;  3RB3 A;  4C8K A;  2V6A A;  5I42 A;  1HBN A;  2FJB B;  4F4X A;  2ZH8 A;  5KFB A;  1AUD A;  2X1G A;  2AYG A;  3K7R A;  4PYD A;  4ZCM A;  1EQ0 A;  1XR5 A;  2ZZM A;  1FDN A;  2WHO A;  4U7U D;  1T0T V;  4RW9 A;  4F4A A;  2LQ5 A;  2BMB A;  3OXL A;  4A8Q A;  3P6Y C;  4LF1 A;  4KC5 A;  5K4P A;  2RHQ B;  5IXU A;  3NGU A;  1C0T A;  1R0B G;  3NLC A;  2EC2 A;  1ITP A;  3W2V B;  3Q8U A;  4YS2 A;  4X4T A;  4O3R A;  2DNH A;  4ZPV R;  1VC0 A;  4LF8 F;  3FK4 A;  3OUY A;  3NEK A;  1RTH A;  1YVF A;  3CW2 C;  2IM3 A;  4G6V B;  2FZG B;  2L3M A;  4Z7C A;  4P2S A;  2CQ4 A;  1B99 A;  2CQP A;  4NLX A;  1IR0 A;  4JV1 A;  5KFK A;  4P2M A;  3H90 A;  2CZ9 A;  3T1Y J;  1YBT A;  1MN9 A;  2J8S A;  5I3U B;  4OYA A;  1EKS A;  4YQW A;  4EK2 A;  1WI6 A;  3CD5 A;  4JI5 F;  1B4S A;  1IUJ A;  2V8H A;  4DR4 F;  2F9J A;  3DRY A;  5KFS A;  1FXL A;  1VI7 A;  2HVH A;  1P9Y A;  2MJN A;  4GTW A;  2FDN A;  4EI2 A;  1H0H B;  1FNO A;  5DG8 A;  1S0N A;  2HWT A;  4C97 A;  1WUU A;  3FSX A;  3OVS A;  3RYL A;  3GIR A;  3IS9 A;  1I1G A;  3A8I A;  1C1B B;  2MQM A;  3QQC D;  4DMZ A;  5A8K A;  2ZM6 J;  2D1G A;  2B43 A;  1F3V A;  1H73 A;  1JLC B;  3TZX A;  2N82 B;  4O0I A;  2HHQ A;  2VPX B;  2K2P A;  2RD5 C;  3QT5 A;  3WAW A;  3G82 B;  4MIW A;  2A0F B;  5E2Q A;  5THW A;  1QUV A;  5EDW A;  3FSI A;  3NNC A;  4NLT A;  5KFG A;  1ELY A;  5HP1 B;  1TK8 A;  3PW2 A;  2F4V F;  4MAK A;  4OI1 A;  2R7O A;  4ZKA A;  2AGO A;  2GV1 A;  3SDE B;  2ZUA A;  2FTR A;  4FYD A;  1NHV A;  1GMW A;  1IJE B;  1TU0 B;  2BXJ A;  4ZJO A;  2GO9 A;  1REV B;  3TWZ A;  1IVZ A;  1X4F A;  3MMB B;  1FER A;  2Y0S D;  3O6Q A;  3OTC A;  3G6Y A;  3C46 A;  5E33 A;  2FB0 A;  1WC0 A;  2HHT A;  3UDV A;  1VCT A;  3CED A;  3DRS A;  2FJW A;  4DUZ F;  2WW8 A;  1I94 F;  3HDS A;  3ENA A;  1HWI A;  4TY8 A;  3H2V E;  3ZZU A;  3OV7 A;  2DXD A;  2OJ3 A;  2GFF A;  1CC8 A;  5KG1 A;  4DUT A;  5KFC A;  3V6D B;  3NKN A;  3TOQ A;  4ITS A;  4WII A;  2VA2 A;  5KXA A;  3NS7 B;  2DNK A;  1IR2 A;  3H40 A;  1HNV B;  4K0K J;  1SJR A;  4I67 A;  2Z56 B;  2N7Y A;  4A4J A;  1FKA F;  2L9N A;  2HQ3 A;  5BYR A;  5CAA A;  3JB9 k;  4LR9 A;  3PR5 B;  4HR2 A;  4ZLP A;  3CD7 A;  3GSD A;  3WX8 A;  5K8M A;  1H98 A;  1SBR A;  4K59 A;  1KHK A;  1T02 A;  1G6B A;  2V34 A;  2QV6 A;  1NHU A;  4IOB A;  2GVD A;  3U1N A;  1ZEF A;  2GSN A;  4J5O A;  3I5A A;  1U1L A;  1WDT A;  3DKD A;  3ZFV A;  4B56 A;  2IC3 B;  3CCL S;  2HGN A;  3HFK A;  4DS5 A;  1PYS B;  2RS8 A;  3EX7 B;  2YNI A;  2RRA A;  2DNG A;  4B3S J;  1X4B A;  5KFR A;  1D9D A;  2AJQ A;  3THP A;  3BN7 A;  2K3I A;  1B0P A;  2R9L A;  2VKZ G;  2ZBR A;  3T6B A;  2KT2 A;  4Q2M A;  3VVU A;  2D41 A;  4I7F B;  1XNQ F;  1VBX A;  5CYM B;  3FZ2 A;  4ECY A;  2DCU B;  3HFZ B;  1BE4 A;  2YQ1 A;  3N6M A;  5IWA F;  1WNE A;  1GQE A;  1RT3 A;  1F5B A;  1OS5 A;  4ED6 A;  3NXZ A;  4KHP J;  4FF4 A;  3KLG A;  4Q8F A;  3OTB A;  4H54 A;  1MMN A;  1NBE B;  2X1B A;  3LWL A;  3SSR A;  2XLK A;  4URS A;  2ZBI A;  2J6U A;  1G4C A;  3OTD A;  1VYA A;  3MM8 B;  5GAE U;  4FS1 A;  4KAV A;  2VG6 B;  1QD1 A;  3MPW A;  1M5K C;  3L95 X;  1NK8 A;  1MWY A;  2MKS A;  3P8B B;  3SQO P;  2DH8 A;  1M5H A;  2O01 C;  2YWK A;  3M32 B;  4ZVT B;  3E51 A;  2UVV A;  2OAU A;  4A8O A;  3V6H A;  2XMK A;  3TUJ C;  1FI4 A;  2DIS A;  4E98 A;  3DXB A;  1LK5 A;  2MKK A;  5J2Q B;  1UPP A;  3C66 A;  2KFN A;  1DLO A;  2J7W A;  4CLZ A;  2IM1 A;  5D0H A;  1DQ8 A;  4JV0 A;  2VD3 A;  3HZE A;  1QM9 A;  2E7X A;  4LRF A;  4DG1 B;  2YQ0 A;  3Q23 A;  5D15 A;  1QSY A;  5D3G A;  3QFW A;  2Z0G A;  4AL5 A;  3CWJ A;  3G8T A;  3KUG A;  2AEM A;  1MRO B;  3UCZ P;  2WBR A;  2C2K B;  3MR2 A;  1TK0 A;  1FD8 A;  4AE5 A;  1KD1 T;  3OVB A;  4RUH A;  2Q1L A;  4JYA J;  4GO5 X;  1N5Q A;  4DR3 F;  4JI4 F;  2BOA A;  1Q4R A;  4OI0 A;  3EZ5 A;  3EGW B;  5DM6 Q;  2NSB A;  2UUT A;  1PAE X;  2DB1 A;  2DNR A;  2P5V A;  2FLP A;  3OUY B;  1N54 B;  2VB6 A;  1DJ0 A;  3MUM P;  4HVZ A;  1VQO S;  1CG2 A;  4DHV A;  2DNY A;  3CCM S;  3A4T A;  3JXO A;  3IFE A;  1WEY A;  3EDQ B;  3NGR A;  1CQN A;  3I0R B;  4W98 A;  1REG X;  1RIS A;  2CNO B;  1RWM B;  2H9Z A;  2R2T A;  5ETO A;  2UUB J;  4JV2 A;  4LF8 J;  2CQ1 A;  3M1V B;  1SKW A;  1VLY A;  2W01 A;  3I96 A;  4ECT A;  2OPQ A;  3NKP A;  2I5J B;  3LP1 B;  2VQE F;  4IG0 B;  4KGK A;  2HIQ A;  4WXW A;  2HND B;  1RWO B;  3T5L A;  1O6X A;  3GIL A;  2HBZ B;  3KLE A;  1RAF B;  4MIV A;  1ZM3 A;  3AOD A;  3NBP A;  4I2P B;  1KBR A;  2L08 A;  4ZG6 A;  2BQU A;  4LBP A;  2BAC A;  2KJV A;  3ILO A;  4KE5 A;  2IVY A;  1N33 F;  3OL8 A;  5KG2 A;  4FXV A;  3IMQ J;  2K8G A;  4H4K C;  1KQK A;  4DLE A;  2FD2 A;  1HDH A;  4F7V A;  1FVS A;  2BE2 B;  3OR2 A;  3QLH A;  5LMN J;  3QO9 A;  2RH3 A;  3CJQ A;  5M2P A;  1CJU B;  3VR1 A;  1FXD A;  3RJM B;  3LO3 A;  4ECS A;  1KON A;  4CO1 A;  1IM4 A;  2MZJ A;  2DR7 A;  4B3M J;  4F8R A;  3UN3 A;  1UVM A;  4AXI A;  2RSQ A;  3KK2 A;  4Q5V A;  2A2D A;  1JLG B;  2E7V A;  5L9N A;  1U1N A;  1UMJ A;  5HRT A;  1MG7 A;  2HIY A;  1IBM J;  3BDF A;  2HNZ A;  1S97 A;  5D4P A;  1S59 A;  3FRZ A;  2MKJ A;  2XS2 A;  2HVI A;  4ERD A;  3DRS B;  4MMO A;  3UNG C;  3TO8 A;  2V4Q A;  1S1W A;  1T05 A;  2H65 B;  2RT3 A;  1NCL A;  2ZNZ A;  4CM2 A;  5K8N A;  1KQG B;  2HUR A;  1SC4 B;  2B4V A;  4RX6 A;  1MML A;  2GJI A;  3W61 A;  5C7P A;  5C25 B;  5J1E B;  5GAD U;  2ZKT A;  3HJV A;  3M1V A;  3FC9 A;  5KFX A;  1VQN S;  3AT1 B;  3WIU A;  1JLC A;  4X64 J;  2FLL A;  3U1M A;  4IQX A;  2YNF B;  1CEZ A;  1X5T A;  5T14 A;  2EXU A;  1IJF B;  2DY1 A;  2DHH A;  3O8W A;  3SCL E;  3MUV P;  1HI8 A;  2B56 A;  1NJI T;  3LH2 S;  4CYU B;  2I2Y A;  2G1H A;  3T9Z A;  4YDD B;  5JVH Q;  1XMO F;  4J91 A;  2RF2 A;  3FCH A;  1X60 A;  1CJK B;  4HT7 A;  1RWN B;  2FQQ B;  2MGZ B;  4NZ6 A;  3H0P A;  4LFA F;  2CQG A;  1NK5 A;  2LXI A;  4X4S A;  3I56 S;  4F3M A;  2MQ8 A;  3MED B;  1WOS A;  3NVL A;  4B3R J;  4I64 A;  2W8L A;  2NSC A;  5E3P A;  2PE8 A;  3FJ2 A;  4FDJ A;  1LQ9 A;  4KQZ A;  4DR4 J;  1T8E A;  2ZD1 B;  3ITH A;  1PIE A;  3R7S B;  5AXL A;  2CDQ A;  3FEX B;  4OJ3 A;  4N5S A;  4LF9 J;  1S0V A;  5AE2 A;  3GFZ A;  5FII A;  2W4C A;  3UDL A;  4JOU A;  2KHC A;  1FJG J;  1FKP A;  2IYI A;  1RAJ A;  1HPZ A;  1F2G A;  1WOP A;  2JFD A;  1B70 B;  2WK4 A;  1RBL A;  4LRE A;  3GSI A;  4D3G A;  5HRO A;  3H7H B;  1RYS A;  4Q0B A;  4YB6 A;  1ZED A;  4YY3 J;  5E3A A;  1XNR J;  7FDR A;  2VG6 A;  2VF3 A;  2XR9 A;  5CCL A;  4ELV A;  1EQM A;  2AW0 A;  2IIH A;  3HHL B;  1FRM A;  3UR3 C;  4WXO A;  2KFZ A;  6FD1 A;  1OSC A;  2Z2M A;  2CKW A;  3PZP A;  1SIZ A;  4J9S A;  2W5W A;  3WAY A;  4EZ9 A;  2H5E A;  1WF2 A;  4DG1 A;  1VQY A;  3JSY A;  1RTJ B;  2HEK A;  1ZAW A;  1Y5I B;  2V50 A;  1V3R A;  4MIA A;  3KKF A;  3TVK A;  3K89 A;  3DLL Q;  3NMR A;  4B3O B;  5EWG A;  2F4V J;  2AJF E;  1U09 A;  4OZ1 A;  3MM5 A;  4QR1 A;  1X5S A;  1V3S A;  2MMY A;  1T95 A;  4KGV B;  4CTA B;  4K4T A;  3T1H J;  1TVR A;  4O3Q A;  4CNY A;  2V2Z A;  1WOO A;  1V5I B;  1X4G A;  1HMV A;  1YSJ A;  4R5P B;  1FSU A;  2UUC F;  2QT7 A;  3CJT A;  3GMG A;  3DPC A;  1SH3 A;  1FFG B;  1VDH A;  4K2J A;  4QCL A;  1RB0 A;  4DFK A;  3HP6 A;  3UPF A;  3MEC A;  4NXM F;  4U8V A;  2DGU A;  2WCX A;  2Y1I A;  2B5J B;  2UZA A;  4DV1 J;  2V4J A;  1JXE A;  4PXC A;  4FF1 A;  3WZ0 A;  3DXS X;  1HNV A;  3A52 A;  3TQ1 A;  3D9B A;  1NLK L;  4B02 A;  2FC9 A;  2GMJ A;  3OSP A;  3UR0 A;  2OEL A;  2GA3 A;  1C0U A;  2GQ2 A;  1YIT S;  2G2Z A;  3DN9 A;  3VV2 B;  4OHV A;  1RHR B;  1R3N A;  4NA3 A;  2W4D A;  4ICL A;  3N28 A;  3OXF A;  2CDR B;  4O3P A;  2GQQ A;  1P6T A;  1W2B R;  2XMW A;  3G2X A;  4B08 A;  1TKZ A;  2YVS A;  2Z2Y B;  3GTY X;  4NLW A;  5A0Y B;  4F02 A;  2DHG A;  2MLY A;  1ELX A;  5KFU A;  3CCE S;  3D0G E;  1WDD A;  5K9F A;  1HQ2 A;  1K44 A;  3E01 A;  4OYM A;  3DI6 A;  1LXJ A;  1JQG A;  2CJA A;  2HHX A;  4L3N A;  1GTE A;  3KG0 A;  4A8F A;  4LSZ B;  4DV7 J;  3CMA S;  3TJ8 A;  3D1O A;  3HVT B;  4J37 A;  1NRK A;  3J81 Y;  3QFH A;  3QIP B;  1K0T A;  4JI7 F;  3BYP A;  5JMN A;  1SHN A;  2PI4 A;  3HT3 A;  1SH0 A;  2NPF A;  2Q79 A;  3DLG B;  1SKR A;  2R3V A;  2CRL A;  2V68 A;  4DQI A;  4NLS A;  4PZV A;  3BKT A;  5KG7 A;  1N6Q B;  2W9C A;  3M32 A;  1AT1 B;  1LWC B;  4GKJ J;  3BDE A;  4K5R A;  1UEV A;  3CVK A;  3R27 A;  4ZPT R;  2B9W A;  3QRR A;  2K1R B;  3E8O A;  1S6O A;  3A8K A;  3IRX B;  2MSS A;  3OJU A;  1EKR A;  4XAK A;  4ZK7 M;  1ED9 A;  4ZG7 A;  3OLA A;  3CCW A;  5ETR A;  4JB8 B;  2V67 A;  1UL3 A;  4ZN3 A;  2QLB B;  2QA4 G;  2A18 A;  3HF5 A;  2NXC A;  4KV8 A;  1A6L A;  1FF2 A;  4DCO B;  1HD0 A;  3HCX A;  4WU3 A;  2WTF A;  3AOA A;  4NEZ A;  4DV6 F;  1SJ4 P;  3VAF A;  4CXK A;  3HPO A;  2HWI A;  4OJG A;  1K1S A;  2CWX A;  4ZVR B;  3DM2 A;  4ZVQ B;  1SL2 A;  2Y9H A;  4DFM A;  4NLV A;  4IDK B;  3RW6 A;  3SFU A;  1F1B B;  2HMI A;  1KNZ A;  3ILL A;  1FRJ A;  4J9Q A;  2OPQ B;  5EGE A;  2OPS A;  1W25 A;  5HL7 Q;  3DRX A;  1FT8 A;  3BH6 B;  3CB4 A;  2BM1 A;  2YNG A;  3CGI A;  4RNH A;  4LF4 F;  2VC0 A;  3OL6 A;  1HBM B;  3J7Z 5;  3O2I A;  4ID5 A;  1PSD A;  2GGP A;  4M95 A;  2KM8 C;  2LEP A;  2ZVS A;  3HKZ D;  3KWM A;  7AT1 B;  1N2L A;  2OSQ A;  3HHE A;  3N5B A;  6FDR A;  1KH7 A;  2KO1 A;  2J0W A;  4GO7 X;  3VHQ A;  2ZWO A;  3RRK A;  3VAI A;  4DQS A;  1QJH A;  4Y2M A;  4Q8E A;  4G1Q A;  3KG1 A;  4YB5 A;  1JJ4 A;  4UTG A;  1RWK B;  2V2K A;  5LM7 E;  5K5M A;  5BR8 F;  2CAJ A;  4DI6 A;  3BQ1 A;  4WK3 A;  4RNN A;  4ED0 A;  1E2S P;  1NDC A;  4KJG A;  1J27 A;  5B0C A;  1HBU B;  5A2Q Y;  1LFP A;  3MMA B;  1LK7 A;  1BQM A;  5HAT A;  3W5Z A;  3W3S A;  1QE1 A;  1CJK A;  2B0G A;  4S0M A;  1HW8 A;  4O4G B;  4OZL A;  1VHI A;  2CG4 A;  4DSI A;  1LWX A;  5KT5 A;  2Z2L A;  3BRE A;  3J81 j;  2CPI A;  2NXN A;  3MEE A;  1VFJ A;  3VGV A;  1U45 A;  2JEG A;  4MIB A;  4YOE A;  3AA8 A;  1WF0 A;  3DNC A;  3OT9 A;  3O44 A;  4M8L A;  2YKP A;  1YG0 A;  4Y65 A;  1L3S A;  2G13 A;  3NMA A;  4WU2 A;  4Y2C A;  1S6Q A;  4AYB D;  4BS2 A;  2HW3 A;  5EHH A;  4X2B A;  4WBF A;  3VAJ A;  3FZB A;  4RR5 A;  5HP1 A;  5KG0 A;  2LA4 A;  2ERR A;  1TL7 A;  4JV5 F;  2ZBC A;  4LRB A;  5C66 A;  2VPW B;  4USU A;  1N36 F;  4TN2 A;  3MR6 A;  4YME A;  1GMV A;  4ED1 A;  2O67 A;  4BCA A;  5I3Q A;  2DNZ A;  1OSD A;  2HPU A;  2DGX A;  5H9F J;  3WBZ A;  2MQO A;  4DR1 J;  4KPY A;  2MKY A;  3Q83 A;  4OX9 F;  2DPJ A;  1KH5 A;  3S7R A;  4PWD B;  1E1Z P;  4F50 A;  2BQ3 A;  1BMQ B;  2GGP B;  2GO8 A;  4CLF A;  1UVI A;  4K4V A;  5CD4 A;  1JLE A;  2ACM A;  2CXE A;  3ET6 A;  5A8W B;  1KH4 A;  3DFE A;  5LOQ A;  4WK1 A;  1S10 A;  4OLP A;  1URB A;  3G9C A;  3MR3 A;  3LP2 A;  3MXH P;  1GXL A;  3D68 A;  2HNY A;  3DGP A;  3HI9 A;  2MKH A;  3M2V A;  4ZVE A;  1HNZ F;  2VOD A;  1U0H B;  2HBQ B;  2EW9 A;  3GJT B;  2UVU A;  1VQ6 S;  5KT7 A;  2LXF A;  3KLI B;  1SC6 A;  3V5R A;  5DLV A;  1JJC B;  4IO1 A;  2CQC A;  3R97 A;  1BGX T;  1S1U B;  1TUG B;  4CH1 A;  2KB2 A;  5LSL A;  3C14 B;  2R8K A;  3MWB A;  4F36 A;  2IPO B;  1HYS A;  1KH9 A;  1EX8 A;  1JKH A;  2XEX A;  3FRY A;  3FNN A;  1VJW A;  1TAQ A;  2P2C B;  3GYX B;  4DBQ A;  1SL0 A;  2F8E X;  3V6J A;  1EET B;  4GVB A;  4WKY A;  4LR2 A;  1ALJ A;  3MEE B;  3B82 A;  4NWX A;  2IBO A;  4KB7 A;  1IM6 A;  4PAA A;  1SIW B;  5KFH A;  2KI2 A;  3E01 B;  4DDF A;  4U67 Q;  2QGF B;  3C16 A;  3CJ4 A;  3L3C A;  1Y7A A;  2CQ2 A;  2W9A A;  3D54 A;  4DOZ A;  2Y1J A;  1KFD A;  5ADZ A;  4OV6 A;  3C6U B;  5B0F A;  1N88 A;  4N8O A;  3PO4 A;  1D8Z A;  2VC1 A;  2JX2 A;  3PM9 A;  4M5H A;  4RBT A;  5HN0 A;  1G3O A;  5KFO A;  4LF7 J;  4KJI A;  2I0X A;  4B9U A;  3FBE A;  1Q0N A;  3JSM A;  1UA0 A;  3ULH A;  3Q22 A;  1E6V B;  2AZ3 A;  2VFT A;  4LF7 F;  4KM4 A;  4BLG A;  2QL5 B;  4UQG A;  1TVR B;  2GJF A;  4DR5 F;  4ZG9 A;  4L3K A;  4F4K A;  2EG1 A;  3OR1 A;  4C7Q A;  2VIC A;  3PIO Q;  3LXQ A;  3DHX A;  2QYC A;  4JUZ A;  4DL4 A;  1HR0 F;  1R8H A;  4LR7 A;  2W9B B;  1IKX A;  3MHY A;  4X4P A;  2FY1 A;  3A12 A;  2COL A;  1JXV A;  4PRF A;  5IC6 B;  1EB0 A;  5EWF A;  4U95 A;  1U1Q A;  1T03 B;  4IQM A;  1VK8 A;  2BJ7 A;  1GFW B;  2CJB A;  3VQS A;  3DRR A;  1RE1 B;  2MLZ A;  5EGY A;  6AT1 B;  2MZS A;  2YKM A;  4PWW A;  2DVI A;  1FXR A;  2LLZ A;  3M2U A;  4QWB A;  1X0P A;  3SDE A;  1VS3 A;  2RUS A;  3CJK B;  2BKP A;  1FX2 A;  5KFJ A;  3AQP A;  2XTJ P;  4QW9 A;  2DT9 A;  1O5J A;  2HQC A;  2XY7 A;  3TG0 A;  4UPI A;  4RZR A;  3M8Z A;  3ETO A;  3MI7 X;  4C8Z A;  2R8I A;  1CUL B;  2VA3 A;  3SBM A;  2AYB A;  3MCO A;  2R7U A;  2HQF A;  3CO9 A;  3NNH A;  2DXE A;  1Z2L A;  1HBO B;  4P9S A;  4TYB A;  1Q53 A;  2WVB A;  3T41 A;  5CYM A;  5H9E J;  2NYH A;  1HR0 J;  2FLN A;  3BDG A;  1FD2 A;  3I5C A;  3P5B P;  3AD7 C;  3PRB A;  1KHJ A;  2MY8 A;  1Q8K A;  2HYI B;  1CS4 A;  3PVX A;  4DR2 F;  3BS9 A;  2KJW A;  2DGT A;  5DLG A;  1HNW F;  3G8S A;  4CO3 A;  4NYP A;  2C3P A;  1CSJ A;  2YBV A;  4DLG A;  2K7K A;  3MMA A;  4W92 B;  4LR8 A;  5D8H B;  1PG5 B;  2WSE C;  2HFZ A;  1RT1 B;  5CHC B;  4RBV A;  3NAI A;  5HMZ A;  4WFN Q;  5MLC V;  1WEZ A;  2V69 A;  2FVQ A;  1RAO A;  1M90 T;  3QMQ A;  3DLG A;  4LRA A;  5LJ5 Y;  1PO6 A;  2XI2 A;  4LSL B;  2XWX A;  3BN4 A;  1VQP S;  2G0C A;  1SPB P;  2HHP A;  2MDA A;  5HQL A;  3M8S A;  2OIH A;  4UUX A;  3RR8 A;  1HQE A;  3MK2 A;  4G3I A;  2G1D A;  2DNO A;  1XK8 A;  1KS2 A;  3A3N B;  3O1L A;  3MEG B;  4RW4 A;  3IGV A;  4DZ6 A;  3I55 S;  4I7F A;  3LAK A;  4RW7 A;  3ZZO A;  3CF5 Q;  3M6X A;  5MAO A;  3VVT A;  2ZHO A;  4CT8 A;  1FKO A;  1YHQ S;  3JYT A;  5F0W A;  2CQB A;  3R7N B;  1K1Q A;  3TJA A;  2AKW B;  3THV A;  5D0R A;  2GAH C;  2B9X A;  4TU8 A;  5GOV A;  3IWX A;  4TQR A;  3TUZ C;  2NUH A;  5FDL A;  1Z2Z A;  4MKV A;  1UPM B;  3UCG A;  4KTQ A;  3PFO A;  2Y8W A;  2FJX A;  4J90 A;  1ALI A;  1U6F A;  4KRW A;  3C8Y A;  5KFL A;  5I3P A;  5C25 A;  5J1E A;  2D3U A;  1AA1 B;  1KKH A;  1PBA A;  2ZKU A;  4UT4 A;  4YR0 A;  2R2S A;  4ECU A;  3GJQ B;  1GT8 A;  4C8L A;  2EKY A;  3H20 A;  4XO0 A;  5J2N A;  4C48 A;  3LP2 B;  4JI0 J;  5HMW A;  3KFW X;  4I1T A;  4O3S A;  1WKL A;  2RHS B;  2P6S A;  3MM9 B;  4J9R A;  4ES1 A;  1PJ6 A;  1WOR A;  4URQ U;  1KVK A;  2JLG A;  1TZ0 A;  3SQG B;  3RBD A;  4F2S A;  1RT5 B;  1RT7 B;  5TJ3 A;  2EKN A;  4DPO A;  4FXW A;  3BGR B;  3X1L B;  3TP2 A;  3H2L A;  2HVE A;  2LCW A;  4DSL A;  5INH A;  4CXU A;  2D7S A;  3SZ2 A;  1N0V C;  1U1P A;  4QIF A;  2AJ0 A;  1N4L A;  3TEG A;  1N5Y B;  3KJV B;  1RTI B;  5HO4 A;  2EFG A;  1VQ4 S;  2YKO A;  2BW7 A;  4RPF A;  5KT6 A;  3VGT A;  4EZ6 A;  1RAA B;  3QYY A;  2HRT A;  3GV5 B;  1N2K A;  4UPK A;  3I0R A;  1KHL A;  1ZS6 A;  1IXK A;  4O44 A;  1FE4 A;  4OX7 A;  2C2R A;  1VBZ A;  1X4H A;  4ANC A;  1RTH B;  1T11 A;  2Y1R I;  4P6Q A;  3EUN A;  3W8G A;  3RAQ A;  1S48 A;  2QLX A;  2ZFH A;  5HVG A;  1N32 J;  4H4O A;  3MPY A;  1YX2 A;  1U8S A;  3GE9 A;  3RTV A;  3W66 A;  4ANE A;  2WVF A;  2B4P A;  3K8W A;  4LSN A;  2IAJ B;  2C22 A;  3R9L A;  4R0E A;  3D6F B;  4IRK A;  4QWD A;  2YNI B;  4GKK J;  1ALK A;  5ETS A;  3MCM A;  3QAE A;  2R7T A;  1CJT A;  2BE2 A;  2XZD B;  3BZQ A;  3OR2 B;  3QLH B;  4OZJ A;  3UN5 A;  4BC7 A;  4IRD A;  2GSU A;  3TAM A;  4OFZ A;  1EAR A;  3PYD A;  3MFH A;  2BM0 A;  3N5F A;  3CJS A;  2GHP A;  4F4Y A;  3Q3Q A;  2D1C A;  1WI8 A;  2E66 A;  4WZM A;  1NPP A;  1NEE A;  4HI2 A;  2RQM A;  1R89 A;  2WRM A;  3C6U A;  3N9U C;  4M5G A;  3KJQ B;  2V63 A;  5E7O B;  3HHN B;  5LSR A;  3ETM A;  1U02 A;  2MEW A;  3ZZP A;  3R2C J;  2V9K A;  4TVA B;  3OTO J;  1JNR B;  1ANJ A;  4ZLN A;  5BYQ A;  4J9U E;  1KTQ A;  4O3O A;  3RAM A;  4LF6 F;  3DLH A;  4P74 A;  3OW2 R;  2VQR A;  2L41 A;  3PYG A;  3SSQ A;  3G86 A;  2MPU A;  3W8P A;  3IXQ A;  4C0H A;  5HMX A;  5LT5 A;  4PXB A;  2I1R A;  1FEH A;  3SXL A;  3FVY A;  3VZH A;  3CJ3 A;  3B54 A;  3G71 S;  3BDG B;  2J9E A;  1NPR A;  4OX9 J;  1FHT A;  1HBO A;  5I4M A;  2R7R A;  2VV5 A;  2C3Y A;  3OHA A;  4IKA A;  4R0J A;  3PXG a;  3RU0 A;  1MU2 B;  1E6Y A;  2LQJ A;  2AF6 A;  4YP3 A;  3W9J A;  1HI1 A;  3SZY A;  2CNK B;  2VFR A;  2IMO A;  3RBE A;  1FTC A;  1LNQ A;  4N7T A;  1UVK A;  2JVO A;  1RCX B;  2N3L A;  3IAS 9;  4Y2I A;  2E5L F;  2RQC A;  4CLL A;  1HNW J;  1UFL A;  3U02 A;  1NJW A;  4PR6 A;  4FDF A;  2RML A;  2CZV C;  5KTQ A;  2YWW A;  1C4C A;  1KHW A;  4NRT A;  4F4W A;  2GHW A;  2ZH3 A;  1U6B A;  3J7Y I;  2OPP A;  2VFU A;  2IYG A;  5M2R A;  2YKA A;  3S6E A;  1SHQ A;  1CJV A;  1Y3J A;  5IFM A;  3A1Y G;  1HIY A;  3A3O B;  3KG4 A;  1RA7 A;  1W2I A;  4I2P A;  4LFA J;  2IRU A;  1HFE L;  1EJJ A;  4PG8 A;  1TKX B;  4CP5 A;  2IDL A;  4USK A;  1WWH A;  4GVL A;  4AQY F;  1HD1 A;  2P9C A;  2FGO A;  5CYQ B;  4ECR A;  4CXS A;  4ZVG A;  1KLM A;  3FGV A;  1HWJ A;  4PYA A;  4LJM A;  1IWG A;  1WHW A;  1FWP A;  2F5G A;  2O1P A;  1SKU B;  1SQF A;  2ZEJ A;  3M8P A;  1S76 D;  2OTL S;  4C0O C;  1FDD A;  2FYX A;  3UQS A;  5M2U A;  2JWN A;  4H4M A;  2QLJ B;  2HHW A;  4GKK F;  4IH5 A;  5IT9 U;  5F8I A;  4V1A k;  5H9E K;  2FZK B;  4KFB B;  1C0U B;  1JLQ A;  4USH A;  2XNR A;  4KGZ B;  4NLD A;  2POK A;  8ATC B;  3BQ0 A;  1T3N A;  1FWK A;  2PEH A;  2FIU A;  4CNZ A;  3KK1 B;  2VBY A;  3TA1 A;  1E6Y B;  4A47 A;  5CAB A;  3ZNU A;  3FBF A;  1L3U A;  5F8J A;  2UXD J;  2KKH A;  3I87 A;  3TR5 A;  2P9E A;  3M8P B;  1X9S A;  1RT6 B;  3CTR A;  4NI2 B;  2ZOM A;  4IRC A;  2WSC C;  3GQC A;  3BGR A;  2XMU A;  3DYA B;  3PJ9 A;  1TFY A;  2RU9 A;  4DV5 J;  3SQG A;  3GCW P;  4P73 A;  2DNL A;  2GQC A;  2MQL A;  2EFO A;  4X66 F;  1NH8 A;  3DU5 A;  1IKY A;  3JS9 A;  3JQJ A;  3TAR A;  4DV4 J;  4ECW A;  4UOP A;  1W7W A;  1OWX A;  4F67 A;  4X4O A;  4NWJ A;  3A3P B;  2IFX A;  1S49 A;  2EEY A;  2HFN A;  1JLB B;  2YWE A;  4G1I A;  2M2B A;  3KLF A;  5I3U A;  3ZXW A;  4DL6 A;  2M8D B;  4LF2 A;  3LA0 A;  2W5S A;  2DJW A;  2H48 B;  5A8R B;  3PCO B;  4QR2 A;  3G6E S;  4DR2 J;  2R8H A;  5KFY A;  3AH6 A;  1G7C B;  4O4R A;  3KMQ A;  3JTN A;  4M5I A;  3IGZ B;  3MCS A;  2BJD A;  4IFV B;  4B9N A;  5JUM A;  4CQ1 A;  1JB0 C;  3A13 A;  4K2X A;  4OZ3 A;  3KK3 B;  2G4B A;  4ZHR A;  2DGW A;  2DIU A;  2Y1L B;  3W5Y A;  1MW7 A;  3AAW B;  3D1H A;  1X0F A;  1O0P A;  2BJE A;  5D4L A;  2ZJQ Q;  4ZMM A;  4MH8 A;  5DO2 A;  4DN9 A;  3LP0 B;  4H4M B;  4Y0F A;  3PAC A;  2V2V A;  3G82 A;  4EMD A;  2K1R A;  3IRX A;  2QRR A;  3EE3 A;  4KFB A;  1OQ3 A;  3J7A N;  1T3O A;  3MMC B;  5K20 B;  1XWL A;  1S57 A;  3I9Z A;  1NJZ A;  2H4Y B;  1KR4 A;  4K8R A;  1VQM S;  2C2N A;  2OP5 A;  3RRH A;  1SJF A;  2RDJ A;  1FKO B;  1ZAX A;  4DPX A;  4EU0 A;  4B3R F;  3MCN A;  1NSA A;  1IKW B;  2KVQ E;  2RIL A;  3C6T B;  1TKT B;  3DRP B;  5IQ6 A;  3EWG A;  5C24 A;  1TAU A;  2H5I B;  4M5M A;  2XYP B;  4J9O A;  1C1C B;  4IR1 A;  4RWW A;  4DR6 J;  3UNY A;  1FNX H;  3MOZ A;  2ASJ A;  2HFV A;  3G8Q A;  2HZA A;  1FK9 B;  1UJ5 A;  3F0N A;  2AJ2 A;  2MQN A;  4Y34 A;  3NCQ A;  5IT0 A;  4N77 A;  1RLC L;  3JSR A;  4K5S A;  4FBU A;  5EUH A;  2MTL A;  1KOO A;  3FQK A;  3CCQ S;  4ALZ A;  2SXL A;  1EIY B;  4ED4 A;  2CYY A;  3S8S A;  3LAN A;  1XMQ F;  1B7F A;  2E5I A;  2YNH B;  1F6T A;  2ZOF A;  4QWE A;  2C2M B;  4RUC A;  4LMZ A;  1OO0 B;  1FA0 A;  2FY8 A;  5AT1 B;  1VMB A;  4OZ5 A;  3OJS A;  3KMS A;  4N41 A;  2BUN A;  4UQT A;  1S1X B;  1U2R A;  3GZ7 A;  1H7X A;  2BEF A;  1MU2 A;  2M3D A;  4IH7 A;  1VRQ C;  2MY7 A;  2OPR A;  3HSD A;  2DIT A;  4NX9 A;  2B6A A;  2HFU A;  3QWP A;  2JDJ A;  4M5D A;  4YEA A;  4ZHR B;  2C2E A;  1S9F A;  1UVJ A;  2U2F A;  1G1X A;  1NM2 A;  1H3D A;  2CWK A;  3DLE B;  3MF5 A;  1R43 A;  1AZS B;  1Q1K A;  2RDI A;  2WSF C;  3ENW A;  4HAC B;  4CLT A;  5D4N A;  3IR5 B;  4ECZ A;  4WFZ A;  4FKY A;  2PEB A;  2VOP A;  2B7C B;  1O51 A;  3IO1 A;  1EHW A;  2ZJR Q;  2UXC F;  1KHV A;  4OHX A;  3EYZ A;  3BSC A;  2CQD A;  2BX6 A;  3OFE A;  3ZO7 A;  1IKX B;  1O98 A;  2B6A B;  2VFS A;  1XMO J;  1GXT A;  2L9D A;  2UV8 G;  4PG4 A;  5LMU F;  2B9E A;  3CJR A;  5G0R B;  3SCJ E;  2MHE A;  3DMJ A;  2YQ3 A;  4DPY A;  1DRZ A;  4DFJ A;  2DD8 S;  2QC3 A;  5BXI A;  2DRA A;  2YKM B;  2FJV A;  1S1V B;  3PO5 A;  2V94 A;  4A46 A;  2M5Y A;  3BSO A;  4OHY A;  2KHD A;  1PYT A;  4KAY A;  2WZ1 A;  2C3O A;  2OEM A;  3M30 B;  3NOG A;  4KGX B;  3W5X A;  5KT2 A;  4N76 A;  3US5 A;  5HJX A;  3SV4 A;  3NS5 A;  4L73 A;  3ISN D;  5CYQ A;  4ZP6 A;  4UZB A;  3TNV A;  2QFJ A;  4ZDN A;  1URA A;  2EI5 A;  1BQX A;  2ZH4 A;  5LIA A;  5GAD I;  1A7G E;  4PKD B;  2BJ8 A;  1SQG A;  4OX8 A;  3TVZ A;  5HVF A;  1Q7L B;  1K8A T;  1VRT A;  3HVT A;  4KPC A;  3J80 Y;  4DSJ A;  2GNK A;  2KH9 A;  1WG5 A;  3ICL A;  4CLU A;  4I6A A;  3LWM A;  1CVJ A;  1RZM A;  4AD6 A;  4M94 A;  3PW0 A;  4RU2 A;  5GAG I;  1RKJ A;  1HNX F;  2KTQ A;  3LOU A;  1FVQ A;  2BW2 A;  3PEH A;  3K58 A;  1FEE A;  5ETV A;  5BJR A;  3AD8 C;  2AQ4 A;  5F8N A;  1QAY A;  2W2P P;  3JAM U;  3WBH A;  2X1F A;  4RW8 B;  1F3F A;  1FRH A;  1Q5Y A;  3I4P A;  3MPV A;  2I8E A;  4RBU A;  4ZOS A;  5JXS A;  4DL0 C;  4DFP A;  1UCN A;  1ZTW A;  4X62 J;  1N34 F;  3PRV A;  2Z57 B;  1X5O A;  3C14 A;  3FMW A;  3I9V 9;  2A1B A;  4CLK A;  2JHE A;  2DY9 A;  2GX8 A;  4W90 B;  5KFI A;  4NEY A;  3DHW C;  1Y5N B;  2DR8 A;  2A10 A;  4OYZ A;  2E1R A;  3SZZ A;  1B64 A;  3MEG A;  5HMY A;  1R27 B;  3MAA B;  4MKY A;  2GS8 A;  2J9D A;  2QYG A;  4KR0 B;  3L7O A;  1R0A B;  2M52 A;  4A8Y A;  4GRS A;  2VQE J;  1ZM4 A;  1ELZ A;  4OYB A;  2AYM A;  1T9V A;  3D6H B;  3M2R B;  3BBB A;  1V6H A;  2FHJ D;  3M05 A;  1SJ1 A;  1XEZ A;  2NPI A;  3HVW A;  4M1K A;  4WYL A;  3WX4 A;  3VQT A;  5HLF B;  4EBE A;  1SJQ A;  3P3D A;  1U0H A;  3W9I A;  3GON A;  1N56 A;  4OI4 A;  4C6A A;  4TY9 A;  1JLF A;  1YQH A;  4DV0 J;  4DV3 F;  1Y6V A;  4MY4 A;  2CJQ A;  3NY0 A;  3H5Y A;  1SI9 A;  2FJE B;  1CJU A;  1KEK A;  1URN A;  5L0K A;  2C28 A;  1MSW D;  1J5O A;  5EX0 A;  5L8R C;  2QFI A;  5KFD A;  2DEJ A;  4EO6 A;  4OZN A;  1I5O B;  3H5S A;  4PXE A;  2KXH A;  4X84 A;  4X62 F;  5L1J A;  4K4Z A;  1K7H A;  2OD4 A;  3IBW A;  3VAL A;  2VPZ B;  3UO0 A;  5IT4 A;  3MD1 A;  1Q8I A;  3IGN A;  3T6J A;  2LQ9 A;  2ZE2 A;  1T03 A;  1FE0 A;  2E7W A;  1NKE A;  4C8Y A;  1B8J A;  5T7L B;  1QY7 A;  1KFS A;  1IBL F;  4UY8 5;  3MAH A;  1NK4 A;  4WP9 A;  1K9M T;  2NRE A;  3AJD A;  3CT9 A;  3V4M A;  3WC2 A;  3MDF A;  3L7P A;  3NOC A;  4QIE A;  3AXK A;  4RL1 A;  4RW9 B;  1BY9 A;  3TQE A;  4YY3 F;  3GIJ A;  2M0G B;  1WC5 A;  1XN9 A;  1NND A;  2HVZ A;  5E5N A;  2IUC A;  5DGA A;  1LWF A;  3TX0 A;  4WE1 A;  3WIV A;  3OD2 A;  4BC9 A;  3EVO A;  1C4A A;  1UWB B;  1P1T A;  2YKN A;  2XHC A;  3CDB A;  4USW A;  3H4B A;  4H4K A;  1F5A A;  3B78 A;  4WIQ A;  2HZC A;  2BKN A;  2LA6 A;  1SH2 A;  5U47 A;  3EVM A;  5D0E A;  1U48 A;  1DQA A;  3T02 A;  2Y8Y A;  1S99 A;  2VU5 A;  3OR1 B;  2W8S A;  1SJ3 P;  2RRB A;  3FFI B;  3DOL B;  4IFY A;  2ZC3 A;  1S1T A;  2ZIT A;  5IQQ A;  2EK6 A;  3WC0 A;  2MGZ A;  4YN3 B;  4EBC A;  1XNQ J;  2CNN B;  2LU1 A;  4NLO A;  4KSE B;  2H51 B;  4KHM A;  3PYE A;  4H4O B;  2E1C A;  3AFG A;  2W5R A;  3TZY A;  1Q82 T;  3GV7 B;  4NXM J;  4RWX A;  2RF2 B;  4YFU A;  4DV2 F;  1RWV B;  2FHM A;  1U26 A;  3UI3 A;  5LJ3 Y;  2DPI A;  2RQ4 A;  1J5E F;  3PW4 A;  2WOM B;  1S6P A;  4QJV A;  4NOH A;  2HHV A;  2IRX A;  2MJU A;  1HQU B;  2NCK L;  2D9O A;  4LF9 F;  2J9D E;  2O3D A;  4CLY A;  1DAR A;  4KV8 B;  3NGD A;  5J2M A;  4LF4 J;  5G0R A;  5DZ6 A;  1U0S A;  1OIA A;  4DX5 A;  3PV8 A;  1N5Y A;  1M1K T;  4RU9 A;  2F65 A;  5EGH A;  3SI8 A;  1F5C A;  5T7L A;  4IDK A;  4B9M A;  1WG4 A;  2AGP A;  4PXD A;  2VIH A;  2ZUG A;  2HFO A;  2ZZN A;  4PQU B;  2E5G A;  4B3T F;  2F9D A;  2IMW P;  2DHA A;  9ATC B;  2KYX A;  2PII A;  2Z2Z A;  4ZVU B;  4XPE A;  4J9N A;  1HYS B;  3AA9 A;  2MKC A;  2LYV A;  4ZCL A;  1HAR A;  3LAM A;  4WFX A;  3FMB A;  1XNR F;  1ACM B;  1TTH B;  3MTK A;  3V81 B;  4ED3 A;  3JAM Y;  1ALH A;  2PGC A;  4CTA A;  2CPD A;  1PJ5 A;  2A6M A;  3PX4 A;  1VRU A;  1XBW A;  2CJX B;  1NJY A;  2GC8 A;  4Y6I A;  5DG9 A;  4R5P A;  2R7V A;  3CC7 S;  2W2O P;  4EFA C;  2LFV A;  2XYH B;  2DXF A;  5F41 A;  3PDN A;  2KG1 A;  3T1H F;  2WVD A;  4ECQ A;  4DEZ A;  2CUY A;  4PPD A;  2NR0 A;  1E6V A;  1QAX A;  4CO5 A;  3D28 A;  3FCV A;  1Q95 G;  3DOM A;  5HBM A;  3PRD A;  4HYK A;  2QSW A;  1WHX A;  4QPT A;  4OJH A;  3RB6 A;  2J6S A;  2GLQ A;  1DQ9 A;  2D74 B;  3G6V A;  2ZM6 F;  1T7P A;  2QA4 S;  3HFV A;  4M5K A;  1UFK A;  1WTB A;  1N36 J;  5B7W A;  4NCG B;  4JI8 J;  1HI0 P;  1UEU A;  1NUE A;  1U24 A;  2PMH A;  4ER8 A;  3CMR A;  5IC4 B;  4DR7 F;  2NZ4 A;  1X8D A;  4NLQ A;  4DCP B;  2GMH A;  3CJ0 A;  1Y3K A;  3CMQ A;  3BO2 A;  5DLW A;  1R0C B;  4PQA A;  4V19 X;  1BUX A;  1JJH A;  2V4J B;  1TL1 B;  2V8V A;  4FYV B;  3IM9 A;  4RUB A;  5LMN F;  1ZPV A;  2DH7 A;  4DS4 A;  2QLW A;  1U7L A;  4G1Q B;  2N4D A;  2GIR A;  3EVW A;  5DS7 A;  2EG2 A;  4P71 A;  2RU3 A;  2KXF A;  1AFJ A;  4UUW A;  4ES2 A;  4ZPD A;  4FYY B;  2OTJ S;  3SV3 A;  1RT4 A;  2EK1 A;  4ECX A;  4I6W A;  2YWH A;  3S01 A;  1RSC A;  2F40 A;  2VFV A;  3I82 A;  4KBI A;  4PPZ A;  4TKT A;  3GP9 A;  4IG3 A;  2W7A A;  3Q86 A;  2HQD A;  4QIG A;  1V9O A;  5GAG U;  1NSQ A;  1H38 A;  2DEI A;  4LSN B;  5JJB A;  5D3G B;  2KU7 A;  1I3O B;  1U47 A;  1DLO B;  3NKM A;  2HKE A;  3R5D A;  3FCW A;  3R5B A;  4KHR A;  1YTY A;  1DZ5 A;  3OFH A;  3GFX A;  2R7Q A;  4EO8 A;  1KC8 T;  3CC4 S;  2J7U A;  1YRT A;  4Y2A A;  1AJD A;  1DTT B;  4I2Q A;  2RAQ A;  1K47 A;  2AEF A;  3QID A;  5CQG A;  3H98 A;  2F63 A;  3OLB A;  4IG3 B;  1B3T A;  5DLF A;  3MUT P;  3U1L A;  4QW8 A;  4YHH J;  3LPE A;  1R0A A;  1OY9 A;  1AXQ A;  4DR3 J;  1JLA A;  4P52 A;  5ETL A;  3MZI A;  4OL8 A;  3BSA A;  5GRR A;  2XMV A;  4I4B A;  4KKO B;  1PJ7 A;  2B8Q A;  4ZPW R;  4NRU A;  1X4A A;  1AJC A;  1H6K X;  2FUG 9;  4QIW D;  1LWE A;  5L0B A;  5F8H A;  1LXN A;  1AUK A;  2DGQ A;  3F44 A;  3RBX A;  3BGU A;  5F3T A;  3CDU A;  1BXN A;  4Y3C A;  3OL7 A;  4LF5 F;  2HHU A;  3GWC A;  2ZH7 A;  3F41 A;  2CAD A;  3T9N A;  4DV2 J;  1GEH A;  3T5J A;  2BV3 A;  1PBU A;  5DDP C;  4WCE Q;  2ZDP A;  4NPO A;  3M9M B;  4XTT A;  3RBZ A;  5IWA J;  4NXN J;  1APS A;  1KVI A;  1O99 A;  4NCB A;  4A48 A;  1RJJ A;  3JYT B;  3RZA A;  3HHL D;  3UFC X;  2XSJ A;  4DXL A;  3GIM A;  2HAF A;  4LBI A;  3WDO A;  5L39 A;  3LGN A;  4LFC F;  2J0S D;  2GAG C;  2Z8Q A;  3DOL A;  2MZ1 A;  1L3K A;  3PKM A;  4B3S F;  1RT2 A;  2LEC A;  1PAU B;  1S1T B;  1S9E A;  3KUH A;  4M5N A;  1Q7Y T;  1U49 A;  2KYZ A;  2FVR A;  4FNI A;  2UU9 F;  1GH8 A;  1FJG F;  2CPY A;  4QZV B;  2VBX A;  4URG A;  1FRX A;  2W2Q P;  1VQ8 S;  1YJN S;  1TUW A;  1NSP A;  1DUR A;  3KJF B;  4P75 A;  4YB7 A;  2MZQ A;  1RTZ A;  3VTI A;  4USV A;  3HM9 A;  4OIX A;  1HHS A;  4ID5 B;  1J5E J;  5IJS A;  1S9E B;  1LWF B;  3QZ8 A;  2AJ4 A;  1KLN A;  3HO1 A;  4USM A;  2F8M A;  2KT5 A;  4E0D A;  1EW2 A;  1TKT A;  3IG1 A;  5C5J A;  4P7V A;  3QRQ A;  4CO2 A;  1C0T B;  4EEY A;  3DI6 B;  1JIH A;  2V0N A;  1AYE A;  2LEB A;  1X4E A;  2ASY A;  2RH6 A;  3ED4 A;  1VLO A;  2VG7 A;  2LP4 A;  3DOK B;  3FKB A;  3KLV A;  2DRD A;  2KXN B;  1Z4U A;  4FDI A;  1RBA A;  4KO0 A;  5B0E A;  1S1W B;  1VK3 A;  2ILZ A;  4DUZ J;  4IFV A;  1ZBT A;  5LXY A;  1YBA A;  5AJ3 F;  3BBF A;  1BC6 A;  1CLF A;  2ZNY A;  4LQY A;  2ASD A;  2ABY A;  2W24 A;  5T41 A;  3CDA A;  2ALY B;  3I0S B;  4G1P A;  2PD1 A;  4OX6 A;  4BHQ A;  2XLJ A;  2RE1 A;  4EGL A;  4K0K F;  2YX1 A;  2Y3Y A;  3THT A;  3LAL A;  2AD9 A;  2HBR B;  2YH0 A;  1EW9 A;  2YNH A;  5KFW A;  1S1X A;  5DDR C;  4PWU A;  4CYS A;  1M5O C;  1S6U A;  3LGH A;  4DUY F;  2W25 A;  4C2M A;  1UJ6 A;  3MFI A;  4A8K A;  3ZTO A;  4KJD A;  5ETN A;  4DX8 H;  1LWC A;  3CCV S;  4PWD A;  3ZZY A;  1W26 A;  3LW5 C;  1WC1 A;  1UZH A;  1FFW B;  3HUL A;  5L1I A;  5GMD A;  2DBB A;  1KHN A;  1GAO A;  5DQI A;  3BSN A;  2OH2 A;  3IWL A;  1CJT B;  3SMZ A;  4ETZ A;  5C42 A;  2VON A;  2WBM A;  1C1C A;  4AND A;  3OHB A;  3DCA A;  5L9X A;  1Y11 A;  2P6T A;  1SXL A;  3KDO A;  1MWQ A;  1SUQ B;  3DDN A;  5E41 A;  4EYH B;  4Y2K A;  1HA1 A;  4PAB A;  2MQP A;  4B3M F;  2NS1 B;  1NJX A;  2ZJP Q;  5DJB A;  1HNI B;  3WHI A;  3R8Y A;  2RIJ A;  3CNQ P;  3T1A A;  5CZV A;  4C11 A;  1KVJ A;  2F1F A;  4ZVP B;  2W7O A;  1ROF A;  2A6O A;  1AW0 A;  1NXI A;  3GIK A;  1U1K A;  1HPZ B;  1M1H A;  1TL3 A;  2C2O B;  1NPK A;  1VQS A;  1OY6 A;  1GMU A;  3D4J A;  5CCM A;  3NGK A;  1UZD A;  5J1P A;  1YJ7 A;  2D9P A;  3KLE B;  2YNG B;  1PYO B;  4TLQ A;  4LFC J;  4JI3 J;  1SL1 A;  1R8A A;  2HLT A;  4DL7 A;  4BWM A;  4Z2X A;  3C16 B;  5LRN A;  2XMT A;  3KK3 A;  3CCR S;  4D3H A;  3M9O B;  2IY5 B;  3N0V A;  1CC7 A;  2OUG A;  4XPC A;  4JI3 F;  5DDQ C;  2GA7 A;  1EET A;  1VRT B;  2YPZ A;  4GVB B;  5AXK A;  1JXL A;  3GJS B;  2UXC J;  2PO4 A;  4K4S A;  2PMW A;  1QDU B;  1KWM A;  2AU0 A;  3C2P A;  1RT5 A;  1YKW A;  3AY0 A;  5K14 B;  2HFS A;  4HTJ A;  2HWH A;  3B4D A;  3AJ2 A;  1BWE A;  5LL6 d;  2AYE A;  5KFN A;  4JI4 J;  4CZC A;  2DCL A;  4ED5 A;  4B9V A;  3R6G B;  1VC6 A;  1M5S A;  1X9M A;  4UPL A;  1HMV B;  2DKO B;  2IM2 A;  3UD5 A;  4UY8 T;  2BAB A;  1X7V A;  4DV3 J;  3GG0 A;  3D2W A;  5FJ4 A;  2IRY A;  4UOC A;  3SFG A;  4N56 A;  4GMK A;  1YIJ S;  1EQJ A;  3M9N B;  3AOC A;  2X3D A;  3VGS A;  4GC7 A;  2AHO B;  3G96 A;  1KN6 A;  4ENO A;  1L3T A;  2Y0B B;  2M4M A;  2FVP A;  1ZYQ A;  3KLG B;  1Q8L A;  2XGP A;  5HJY A;  3NP5 A;  1OPZ A;  1X9W A;  5CA5 A;  2UV8 A;  4LVN P;  3M8R A;  1RHU B;  3T01 A;  1FRL A;  1N5T A;  2XWY A;  2QA1 A;  3SCI E;  3W64 A;  4BDP A;  5KFF A;  2HNZ B;  5B0A A;  2OPR B;  4M5D B;  1ED8 A;  4MK9 A;  2CA9 A;  5LXR A;  3GR0 A;  1N5S A;  4X4V A;  3W1Y C;  2C2Z B;  3JSB A;  4OYO A;  3VZI A;  5DGB A;  3T19 A;  1T9U A;  1DY3 A;  3ZZT A;  4CI0 B;  4HHU A;  4HEA 9;  2B9Y A;  3QGI A;  1FWL A;  3DGP B;  5KFZ A;  3TUI C;  3H42 A;  2VHG A;  3PW7 A;  1WJ9 A;  3M2U B;  3N6L A;  5FD1 A;  4X66 J;  1RT7 A;  4AQY J;  4TU9 A;  4ICL B;  2HQI A;  4ZJQ A;  2W8K A;  1H2U X;  2C2D A;  4X4R A;  3EZO A;  3DDK A;  4MFB A;  4J9P A;  1IKV B;  2G9O A;  3HZG A;  3K17 A;  1FK9 A;  4ZIT A;  2MQQ A;  4ATN A;  5KFP A;  3I6P A;  2E9Z A;  2CJY B;  1WSV A;  4ZCK A;  1Q81 T;  1WAC A;  3VCD A;  4N8N A;  2BJ9 A;  2HLU A;  3KLH A;  3DLB A;  2VKR A;  1M5P C;  1TL7 B;  2QN6 B;  2EC0 A;  1YJU A;  2VAS A;  1GX5 A;  2DR9 A;  3TAN A;  1CS4 B;  4FN5 A;  4NMX A;  1RU1 A;  4NML A;  5RUB A;  4MKB A;  2VH7 A;  3VAG A;  4O0N A;  3M6U A;  1GNK A;  3AJ1 A;  1PCA A;  2C1E B;  2VDI A;  4LBH A;  2DNM A;  5DM7 Q;  2F3J A;  2G2Y A;  2V8P A;  1RT1 A;  2K3K A;  2YXL A;  3BB5 A;  2CPE A;  2Q6C A;  3BM7 A;  3DLJ A;  4HH1 A;  5IM0 A;  4ZPB A;  3V6D A;  4WTO B;  3KHG A;  2XGQ A;  2QEX S;  3TAP A;  2BA9 A;  4QQB A;  2DHX A;  1QLN A;  2I5J A;  2LDI A;  3LP1 A;  3O5T B;  3PG9 A;  4WYW A;  3ZTS A;  1MLA A;  2VJV A;  1KTV A;  2VDH A;  1JNZ B;  3P5T L;  1IR1 A;  3VGU A;  1UVL A;  1VQ5 S;  1RWU A;  3AB2 B;  3GPA A;  4YUD A;  1HQE B;  2L9W A;  4CLW A;  2YH1 A;  4NA2 A;  4I6Y A;  3D6T B;  4UW2 A;  4A8W A;  1EAY C;  1WD6 A;  1RGV A;  1Y0H A;  2H4W B;  2CQ0 A;  2JL9 A;  2NXJ A;  3DM2 B;  3HSG A;  3MR5 A;  4QR0 A;  1X5P A;  2AX0 A;  4B3T J;  1S77 D;  3OL9 A;  2CPF A;  4P2F A;  3BGL A;  1L5U A;  3D7S B;  2RS2 A;  4MHX A;  2QO3 A;  1IBC B;  3Q24 A;  1JMT A;  3UD3 P;  3R3T A;  1AJB A;  3Q8Q B;  5AXM A;  5KFM A;  4C3M A;  5HRO B;  1NKB A;  4JYA F;  1H2T Z;  1VJQ A;  2NXE A;  4IR9 A;  3IRW P;  3DDI A;  4NCA A;  4ILR A;  4L6V 3;  1HBM A;  1Z1Z A;  3IA0 A;  3AQO A;  4P7T A;  5LMU J;  3QO9 B;  1QAI A;  3HK2 A;  3ZC4 A;  2U1A A;  1QTM A;  3W2W A;  3HJF A;  2M8H A;  3HD2 A;  1LOU A;  1LW0 B;  3HD1 A;  2HS3 A;  5ETP A;  3TRG A;  2HG4 A;  4NYO A;  4BWJ A;  3RGI A;  4CO0 A;  2OMO A;  4ZLJ A;  1P49 A;  5ITH A;  2AMC B;  1MNE A;  3NWR A;  2FJA B;  1ARO P;  3H4D A;  3T5K A;  1U8W A;  4CH0 S;  5KG5 A;  2M88 A;  1S12 A;  1FX4 A;  2OHD A;  2OFH X;  2GSO A;  4ZGA A;  4JI5 J;  2K06 A;  1U2C A;  4OI3 A;  3L09 A;  1JLQ B;  1D9A A;  1TMM A;  1YJV A;  2Q43 A;  3MPU B;  4ZVH A;  4CT9 A;  1IBK F;  3T1Y F;  3ZTP A;  1RAI B;  4DV0 F;  4ZP7 A;  3K59 A;  3BYR A;  3O3L A;  2IC3 A;  1FES A;  3HLU A;  4CYU A;  4UOR A;  3LF0 A;  1U1R A;  4O44 B;  1S6P B;  1KSP A;  4RW6 B;  1TMJ A;  3QT7 A;  1HQU A;  3W7B A;  5J2P B;  2RQK A;  1FDA A;  3R5G A;  1RTI A;  3HT0 A;  3EGZ A;  3IWN C;  3PJW A;  2B4O A;  3GV8 B;  2YX4 A;  2PMZ D;  4LRD A;  3Q8Y A;  3QSY B;  3E2D A;  2CPZ A;  3PR4 A;  2CQH A;  3IBC B;  4MT1 A;  2FLO A;  1ZAV A;  2GIQ A;  5L1K A;  2DGS A;  5KG4 A;  4RO0 A;  4TQS A;  2QG9 B;  4FPI A;  1Y00 A;  4R8U B;  3GU0 A;  4Q45 A;  3J80 U;  1KOH A;  4RLE A;  5D4O A;  1TV6 B;  1RXO B;  3ILI A;  1U4B A;  3K0J A;  1PIL A;  3CJ5 A;  3H2U B;  3H5U A;  1YRX A;  3IS9 B;  3OTE A;  4JI6 F;  5A8K B;  1ZEB A;  3HSZ A;  2J6T A;  5J2Q A;  1N8R T;  3M30 A;  2HNY B;  3M2V B;  5F8M A;  1VRU B;  2YTC A;  2ZH1 A;  3DMJ B;  3RW7 A;  1VHF A;  4HLB A;  2V9W A;  1HKA A;  3KD8 A;  3LP0 A;  1ICE B;  5L0E A;  3N4W A;  2ZBQ A;  5FDL B;  2GZO A;  2LVW A;  1IWA A;  3I32 A;  1S4E A;  3T3F A;  2HRU A;  1XQI A;  1RTJ A;  3ONQ A;  1RAE B;  3C15 B;  3GLJ A;  5F0U A;  2W4P A;  2I38 A;  4ZVO B;  4O3N A;  2JSX A;  2XY6 A;  2W5X A;  4F0K A;  4K4U A;  5FLX U;  5CD4 H;  4LFB J;  4LF5 J;  5DDO C;  4QWA A;  4ECV A;  1P1L A;  5H9F K;  2E1P A;  1Y10 A;  2DNN A;  2P9G A;  2QLF B;  3HHL A;  3ENQ A;  3M8W A;  3R5J B;  4P2X A;  5IJQ A;  2CJ9 A;  2LKZ A;  2NUU G;  3KDN A;  1Q86 T;  3ILJ A;  4QU6 A;  2IBK A;  2GCF A;  4MYU A;  5J2M B;  2HK2 A;  4DSE A;  4OLO A;  2YWG A;  5B08 A;  4B9L A;  5F9N A;  1HJK A;  4RW7 B;  2PDA A;  4LUB A;  4OHZ A;  1DFD A;  3R5A A;  4HHJ A;  2RKI B;  4OMF G;  2HGL A;  2OSR A;  2RJZ A;  5E3Q A;  3RRG A;  2R7S A;  4ZP9 A;  3ZZZ A;  3JSM B;  2V4R A;  2Z30 B;  2BBE A;  1BQN B;  3IDD A;  3D3B J;  3LGM A;  3UW1 A;  3M4X A;  2M7S A;  3HHD A;  5ETT A;  3BO4 A;  2ZHA A;  3P96 A;  4O23 A;  2FVS A;  1VQL S;  2KRR A;  4HH0 A;  3JQM A;  1QSS A;  2NQP A;  1RAB B;  2ANH A;  3U7J A;  4KH0 B;  4XK8 C;  1R7I A;  2ACY A;  4QOT A;  4E2F B;  4EUV A;  1Y7P A;  3H5X A;  3BEG B;  1YLX A;  3CIZ A;  4LQ9 A;  4NLY A;  1CJV B;  3PY8 A;  4ELT A;  4KAI A;  3CME S;  3NNA A;  1BQN A;  4MFB B;  1MMD A;  2OPP B;  2AWZ A;  5A0Y A;  4F3O A;  1U1M A;  4AXJ A;  5IV3 A;  4HHH A;  2B51 A;  4XIU A;  3KXD A;  4DQQ A;  3L7U A;  3FBC A;  4OYI A;  2NYI A;  2KM8 B;  3UD4 P;  3RB0 A;  1D1U A;  1NKC A;  1Q8B A;  3UN2 A;  4HL9 A;  3ZTR A;  3DOM B;  1Q5V A;  5HBM B;  3NWG A;  3W2V A;  5KOX A;  1NME B;  1RBO B;  2VQF J;  1RWX B;  3VAK A;  2JEF A;  4FPR A;  3D0I E;  3CJK A;  2QX0 A;  3OBI A;  2CFX A;  4CO4 A;  4YR3 A;  1J5O B;  3TUP A;  3N01 A;  4DR7 J;  3BDH A;  2EBE A;  4UOG A;  3EPI A;  5HQM A;  2CZ4 A;  2VL1 A;  2Z4P A;  2ZC4 A;  2ZE2 B;  4KYZ A;  1MRO A;  2QE5 A;  5D6G A;  4K7Q A;  3AD9 C;  1LFW A;  3ET6 B;  2HSE B;  2GVZ A;  2DIV A;  1UW9 A;  4DQR A;  4LIR A;  4U7U K;  2XSF A;  3AXM A;  3DOK A;  2HGM A;  4DCJ B;  3R6L B;  1VOM A;  2H3E B;  4DWI A;  2WW4 A;  1YBU A;  3CC2 S;  4JI7 J;  5HQ8 A;  4C9D A;  1U25 A;  1OYD A;  1YZ7 A;  3F56 A;  4LF6 J;  4UST A;  4ZJL A;  1JJ2 R;  2MYF A;  2XO7 A;  4TN0 A;  1EP4 A;  1UW4 A;  2XM3 A;  1H7W A;  1N6Q A;  2JEI A;  4I69 A;  5L46 A;  5GAH U;  2JH3 A;  3IAM 9;  2KZM A;  3PKY A;  2DO0 A;  1DBD A;  1S5Z A;  4CRJ A;  1URR A;  4C3K A;  2UVW A;  4IYQ A;  4J9K A;  4RW6 A;  3Q8R B;  2EFN A;  2N7C A;  3NBP B;  1XTZ A;  2AGQ A;  1A0O B;  3J81 U;  4QBU A;  4OYX A;  3PTW A;  2O5D A;  3MM7 A;  3DC2 A;  4QYR A;  4AFF A;  2G0J A;  2VBZ A;  3KUE A;  2XMA A;  4Y28 C;  2CQI A;  3QSI A;  3CUN A;  4RNM A;  1NB2 A;  4C3L A;  3CE8 A;  4X4U A;  4FP9 A;  5KFQ A;  3UCU P;  2KL8 A;  3BBC A;  1S72 S;  4ILM A;  1FRK A;  4F0M A;  4Q0B B;  4QAX A;  4DL3 A;  3R5C A;  4R25 A;  5KG3 A;  5BYS A;  2KRB A;  3BR9 A;  4NE9 C;  4FBT A;  3JTO A;  1ZH5 A;  5SUH A;  5C2G A;  1NK0 A;  1H74 A;  4X65 F;  2AX1 A;  1HWL A;  2GIF A;  2QMW A;  1KLM B;  4B9T A;  2KG0 A;  2FZC B;  3DU6 A;  3PHE A;  1HBU A;  5LQQ A;  4HT5 A;  1TR0 A;  4FVC A;  3ZTQ A;  5DQH A;  3KHR A;  3W62 A;  2Z58 B;  3PYF A;  1EI6 A;  4JI2 F;  5L1L A;  1HHT P;  5C2C A;  1S79 A;  3MM5 B;  2BQR A;  2BJ3 A;  4B9S A;  2BR0 A;  2X98 A;  1UEK A;  4U8Y A;  4CWB A;  1NZA A;  7FD1 A;  2OD6 A;  2ZVI A;  4DR6 F;  4USI A;  3C19 A;  3C3L A;  3C6T A;  4PG7 A;  3MMJ A;  1SQE A;  4CLS A;  1TL5 A;  3CJ2 A;  4PG6 A;  8RUC A;  4QIV A;  5FLX Y;  2PA3 A;  2XMM A;  2FHO B;  2MZR A;  2XCP A;  2G9Y A;  3LQV A;  1OMS A;  4ED7 A;  4TXS A;  4ED2 A;  1GK8 A;  3KHH A;  2HVD A;  1NU4 A;  1YGY A;  1NSK L;  2F7V A;  3K57 A;  1JX4 A;  1HNI A;  3WQP A;  1BD6 A;  2JNJ A;  1WTF A;  2IJF A;  2YPY A;  4CCH A;  2PFF B;  4YB1 P;  1IBL J;  4IO9 Q;  1NB7 A;  1FJ7 A;  1HL6 A;  1GX6 A;  2HHH F;  2RRN A;  2VZ9 A;  4KY3 A;  2W8D A;  2HBY B;  4UF4 A;  4OI6 A;  2KZZ A;  3BGF A;  4M5J A;  1S7I A;  1C1B A;  1RT3 B;  2B7B B;  4ZPC A;  4J9V A;  4U7C A;  3AOB A;  1VQK S;  2GJ2 A;  3DLE A;  2IA6 A;  3QRP A;  4W4M A;  4QYZ K;  2QZU A;  3VWS A;  2HHS A;  4L72 B;  1D0E A;  1YJT A;  2IVM A;  4F2R A;  2ZD1 A;  3ITH B;  4AT1 B;  5F8G A;  1VGY A;  3IR7 B;  3PX0 A;  1QUP A;  1BWV A;  1N32 F;  1FJC A;  3FFI A;  2IJR A;  2MZT A;  5A6W A;  1UFW A;  4Q43 A;  4GTZ A;  1TFW A;  3IGY B;  2H54 B;  4OYP A;  3UWT A;  1XC9 A;  1M5V C;  3JTP A;  4TNO A;  2M9K A;  2B4U A;  4HDH A;  1SCJ B;  1NDL A;  3QJP A;  1F9F A;  2UXB J;  2VUG A;  1K0V A;  3GYN A;  1N52 B;  3RG6 A;  2E5J A;  1TK5 A;  3MOJ B;  2J8A A;  1FFS B;  1CQM A;  3D66 A;  4NI2 A;  2DNQ A;  1J2V A;  2ROP A;  3QIP A;  4L76 A;  1PKU A;  2HAI A;  3D3C J;  4MJK A;  3TAM B;  4ZIV A;  2CVI A;  2W5T A;  2BZ2 A;  4B3O A;  1HQA A;  3UVJ B;  1WC3 A;  4FKX A;  4Q2L A;  2RB7 A;  3NAH A;  1RAH B;  1S1V A;  1MWZ A;  2QIF A;  4ZCI A;  3QBC A;  4DF4 A;  2R8G A;  1WC4 A;  1X31 C;  2CPX A;  2IM0 A;  2VG7 B;  1U6Z A;  4B17 A;  4A8X A;  2UXD F;  5LRM A;  2E9R X;  2CIM A;  4IOC Q;  4TY8 B;  3K2Y A;  4X4Q A;  2R4F A;  5HVH A;  2XZT B;  3E2E A;  2I6W A;  3C15 A;  3CJ8 A;  4XDC A;  5HSP A;  5GME A;  1I51 B;  3P45 B;  2MXY A;  5JVG Q;  1NAQ A;  3RR7 A;  2EPI A;  2YWF A;  1IQZ A;  1P27 B;  4UOH A;  2PA8 D;  1BHN A;  5ETQ A;  3SYZ A;  2XG8 A;  1JK9 B;  3BGO P;  5A8R A;  2AZ1 A;  4WWS A;  1FRI A;  1O8B A;  1LWE B;  1SC1 B;  2H5J B;  3IR6 B;  4U6P A;  3VF0 B;  2UUC J;  5CXT A;  2DK2 A;  2MST A;  1YWX A;  4OYW A;  1B0T A;  4PCQ A;  2UVR A;  2HRY A;  2DNP A;  4RJV A;  3CXC R;  1F2H A;  1XIQ A;  2JC0 A;  3R1L A;  1TQL A;  1RI7 A;  2VOO A;  4MYT A;  2NZC A;  1SV5 A;  3TZZ A;  2J0X A;  3CCU S;  5B0G A;  1VBY A;  1C2P A;  1RHJ B;  4CM0 A;  3M2R A;  5C42 B;  1UTA A;  2BKO A;  5K14 A;  3SIP B;  3POT B;  1OJ4 A;  1ZM2 A;  2XMJ A;  4LRC A;  1VR6 A;  3MGJ A;  3A8E A;  5GMK a;  2W9B A;  3BJY A;  5IV4 A;  3NG8 A;  3CDW A;  4WP3 A;  3KK2 B;  4RNO A;  4HTI A;  2X1A A;  1TKD A;  3QT8 A;  1T9X A;  1L3V A;  1E3C P;  2BYC A;  3D5M A;  3MM9 A;  3FBB A;  3BR8 A;  3W63 A;  2ZH9 A;  2QTW A;  2HS4 A;  2WVC A;  4NWB A;  4ZLL A;  3GFY A;  3TYT A;  2D3Z A;  2X7I A;  5J2N B;  1Y5L B;  3PEJ A;  2XS7 A;  4A8M P;  1S4F A;  2BAN A;  3EMT A;  4KT0 C;  4MK8 A;  2E5H A;  2ALZ A;  3H8Y A;  3QGG A;  1QSL A;  4EYI B;  4FF2 A;  1IQT A;  1HNZ J;  3CIM A;  1RAC B;  4P72 A;  2FJD B;  3B6B A;  4DU8 A;  4J7C A;  1ZA2 B;  1ZPW X;  1TL1 A;  3N79 A;  4MK7 A;  5A6P A;  5CH7 B;  4ZS6 A;  3TA2 A;  4AUK A;  3KTQ A;  2QL9 B;  5KFE A;  1UWA A;  1V3Z A;  2XLI A;  3KK1 A;  3CD0 A;  1V5V A;  1BQM B;  3M8Q B;  1XMB A;  1N48 A;  1S9G A;  1XR6 A;  4JI0 F;  1XR7 A;  4DV1 F;  3QZ7 A;  2EFP A;  1UKU A;  2ILY A;  2NLW A;  2BJ1 A;  4IUF A;  3OSN A;  3D0H E;  1QTN B;  3GJR B;  5EN1 A;  1UAW A;  4HI1 A;  4LSL A;  4NLR A;  3RB4 A;  4JV5 J;  1VIS A;  1RT4 B;  4DJB A;  4WF9 Q;  4FXD A;  3BO3 A;  4JI1 F;  1YJR A;  3I4H X;  4U9R A;  4CLP A;  3K5M A;  3F73 A;  1HBN B;  1HWU A;  1RCO B;  3QGH A;  3TX8 A;  4QPX A;  3HMJ G;  4K4Y A;  2MHN A;  4WE1 B;  1ZET A;  2GHV C;  1RP5 A;  2HQG A;  4FF3 A;  2ZH5 A;  2IUC B;  1ANI A;  4DX6 A;  4FYX B;  4K4W A;  1JLB A;  3QGP A;  2MLX A;  1RQ0 A;  1WF1 A;  2KVI A;  2LDY A;  3IP0 A;  4ZP8 A;  5D77 A;  1JLE B;  5A8W A;  1M0S A;  2OPS B;  1NK6 A;  2HMI B;  4GTY A;  5HI7 A;  1U1O A;  4ID8 A;  3CPW R;  2BE7 D;  1RTD B;  3I31 A;  1A9N B;  4I56 A;  2VPY B;  4FVM A;  4BBY A;  3PFE A;  4QWC A;  1RAD B;  3HXM A;  1FJE B;  1HNX J;  3DGV A;  3OFF A;  4OV1 A;  3B5Q A;  2XHW A;  1LV5 A;  4HDG A;  4N47 A;  3MMB A;  1RDR A;  4K4X A;  3EIC A;  1WEL A;  4Q7A A;  5F9L A;  2J76 E;  4EBD A;  3T5H A;  4GTX A;  2ZH2 A;  2R2U A;  4DV7 F;  5DZ7 A;  3R2D J;  2AJ1 A;  1RA6 A;  1P9Q C;  1HHQ A;  4RUA A;  4QU7 A;  1SUQ A;  2XY5 A;  1H2V Z;  1KQS R;  4GKJ F;  3CCZ A;  2AP6 A;  2BRK A;  1JLF B;  2Q3P A;  2DR5 A;  4DSF A;  3DLK A;  3TI0 A;  1FTR A;  2PN6 A;  3VAH A;  3RAX A;  1D3W A;  4ETX A;  4JI6 J;  1SC3 B;  4X4N A;  2FGC A;  1XJW B;  2RUG A;  3DRR B;  4LIW A;  3K5O A;  1D09 B;  2ZDO A;  1DTQ B;  1H72 C;  4I2Q B;  2PT0 A;  1U2F A;  4O4G A;  1RYR A;  1QVG R;  2B3T B;  2AEJ A;  1QE1 B;  4NAS A;  2JZ5 A;  4OJ1 A;  5IOL A;  4GC6 A;  1JLG A;  2G2O A;  3MPD A;  2XO6 A;  1HLW A;  5KAK A;  3EXC X;  3J7Y U;  4J9L A;  3DYC A;  3OTO F;  4DQP A;  5G4D A;  2JLF A;  2ROE A;  2APO A;  4TLR A;  2ADC A;  1IKW A;  1WKJ A;  3ISN C;  2KDO A;  2LQB A;  3FUY A;  4DV4 F;  2UUA J;  2UXB F;  1FO1 A;  4DPW A;  2VBW A;  1QAJ A;  2GML A;  3V6K A;  3BH7 B;  2D69 A;  2QJ3 A;  1UA1 A;  4NLU A;  3EM1 A;  2JLE A;  1ZZF A;  2LMI A;  4DV5 F;  2L48 A;  1S6Q B;  2RVJ A;  3AHP A;  1I6J A;  4AL6 A;  2W7P A;  1NK9 A;  3K5L A;  1NDP A;  3FQL A;  1UVN A;  1REV A;  1OY8 A;  3PIP Q;  3V4I B;  4IOA Q;  2UP1 A;  3QJL A;  1VBK A;  1AUS L;  3MM6 B;  4DX7 A;  1F9E B;  2IAJ A;  3L4B C;  1HWK A;  4QYZ J;  2IVF B;  4NCG A;  1SVD A;  1D8Y A;  2I9S A;  1TP7 A;  4DL2 A;  2OLW A;  1PC4 A;  3KNA A;  5B09 A;  1BLU A;  4NXN F;  3TVY A;  3M6W A;  2CQ3 A;  4YHH F;  1TKX A;  5F3Z A;  1EJ7 L;  1DHM A;  5EX3 A;  1YK9 A;  3NGT A;  4IFY B;  4ZVF A;  2F4F A;  1QVF R;  3V4I A;  4C98 A;  2FPH X;  3ZZR A;  2IDE A;  4LT6 A;  1P8G A;  1R8C A;  1T9W A;  4OZ0 A;  2HHH J;  4F26 A;  3FDS A;  3KLI A;  5E3R A;  2UUW A;  1GTH A;  2QZ8 A;  2YKQ A;  3H59 A;  1LKZ A;  3D1Q A;  3POT A;  5A76 A;  3LTO A;  1S1U A;  3RUB L;  1LW2 B;  4L75 A;  3UDE A;  2XNQ A;  2XZW A;  3EGN A;  2JOQ A;  3H25 A;  3UE2 A;  2UUA F;  3LUY A;  4ZN1 A;  1RWP B;  3JQK A;  2ZWP A;  1LEO A;  4C4W A;  1AJA A;  3HHL C;  1Q78 A;  3NCP A;  4LFB F;  3PX6 A;  2FHJ A;  5K8P A;  2CJK A;  4KHP F;  4J9M A;  2CPJ A;  2FVC A;  2V8G A;  1Y4Z B;  2GVZ B;  3CCJ S;  5H1S V;  4YR2 A;  2UU9 J;  1NHK L;  2MB0 B;  2XQC A;  5B0B A;  4OQJ A;  4IG0 A;  1GMW D;  2ZBP A;  4E8U A;  5IS2 A;  1Q79 A;  4DR5 J;  5C24 B;  4C8O A;  2CNL B;  3HHK A;  2E5L J;  2UUB F;  5DLT A;  1NH7 A;  1CBK A;  2VG5 A;  2DTJ A;  4ZA1 A;  2WAQ D;  3GCX P;  2H1Y A;  3MM6 A;  4NZ7 A;  2E44 A;  4ZVS B;  5A2Q U;  5IM0 B;  1VC5 A;  1N5V A;  4RW4 B;  5GVQ A;  4ZIW A;  5GAH I;  1G2E A;  3G6X A;  5J2P A;  2R7W A;  2C3M A;  3UVJ A;  4DSK A;  3V2U C;  3TJ9 A;  2VQF F;  3FEY B;  1F0X A;  2EWH A;  2LXU A;  3NKY A;  1FDB A;  1R6Y A;  4MTP A;  2ATL A;  3CCS S;  3MR7 A;  2XYG B;  2EVZ A;  5DET A;  3T00 A;  3FSY A;  5KT4 A;  5AE3 A;  3MK0 A;  2VG5 B;  2XI3 A;  4UPH A;  3Q8P B;  5EWE A;  3M8Y A;  1X4D A;  4F25 A;  3KJV A;  4F4Z A;  5SZT A;  1ZOT A;  3GFH A;  4KIA A;  1DAX A;  5B0D A;  3MAA A;  2ZHB A;  4ELU A;  4TU7 A;  1PC5 A;  2XSJ B;  5BR8 J;  4LVO P;  3BV8 A;  4PUO A;  2KN4 A;  3SSS A;  3BPD A;  2E1M C;  2HS0 A;  1OPI A;  3B4M A;  3W9H A;  3ISZ A;  1F9H A;  5I42 B;  1YJ9 S;  1KRP A;  3I5B A;  1ZM9 A;  4JI1 J;  3E3X A;  2P8I A;  4JP8 A;  2N3O A;  3G4S S;  2AIR B;  1RT2 B;  3HKW A;  2X3G A;  2FC8 A;  3GR1 A;  4YDX A;  1SV5 B;  2CPH A;  4Y00 A;  2N4C A;  5K8O A;  1TL4 A;  2JEJ A;  1CUL A;  2LQ8 A;  3V81 A;  1RUS A;  2QSF A;  3NKQ A;  2GW8 A;  1GXU A;  3WAV A;  3OPK A;  4Z7Y A;  1EZZ B;  2ROG A;  1WEX A;  2BRL A;  4G65 A;  1WG1 A;  2OEJ A;  2BDP A;  5ETK A;  2PC6 A;  3X3U A;  1KDN A;  1RLD A;  3Q89 A;  4KO0 B;  2D3O 1;  1SKS A;  1WHY A;  1RT6 A;  4F04 B;  4I68 A;  4NLP A;  3Q0A A;  2BVZ A;  2E29 A;  3IM8 A;  1ULR A;  3Q2T C;  1ELO A;  2JVR A;  2NXU A;  1KP6 A;  1RHQ B;  5ETM A;  2OGU A;  3IG1 B;  1F60 B;  3J7A 1;  2OFG X;  2J5A A;  2VJU A;  4EWT A;  1RTD A;  2DGO A;  5KT3 A;  1NO8 A;  3KLF B;  1CPZ A;  1HW9 A;  3NRB A;  3IC1 A;  4UZC A;  2WB4 A;  1RHK B;  2IFY A;  3EDR B;  4FNH A;  1R31 A;  2IA0 A;  4DF8 A;  3Q8V A;  1YJW S;  2PI5 A;  2OEK A;  2V5H G;  2W9C B;  1IKY B;  4XDD A;  1DTT A;  3EJM A;  4USJ C;  5CZX A;  3ZZ0 A;  3QT6 A;  3PNI A;  4NYZ A;  3CO0 P;  4DZD A;  2EFQ A;  2HZV A;  2W5V A;  4YR1 A;  3EZU A;  3K5N A;  2W5Q A;  4A8S A;  4MKA A;  1UWB A;  3TZW A;  3QAT A;  4DV6 J;  5LSO A;  4DL5 A;  4PUO B;  5HAN A;  2IHR 1;  2HND A;  4R8U A;  2B8P A;  3Q8S B;  5DG7 A;  2F8H A;  5HAO A;  3AB4 B;  1I94 J;  3QJJ A;  3B8H A;  4CH7 A;  1SB6 A;  2WON A;  2QMX A;  2JC1 A;  2QMU B;  1IN0 A;  4DU7 A;  2Q66 A;  5AJ9 A;  4I0W A;  3KHL A;  2IJN A;  2OML A;  4WPA A;  3MTJ A;  2W2M P;  4WFY A;  4WJB A;  1T94 A;  3TEH B;  1NZ8 A;  4Z37 A;  4X65 J;  4Q44 A;  2BE9 B;  3NGS A;  3CDE A;  3MEK A;  1TL3 B;  3QAU A;  4ED8 A;  1R6V A;  3S1T A;  1YI2 S;  3ELH A;  3QWU A;  3M6V A;  3CD6 S;  3ENV A;  1FNM A;  4K50 A;  3IBF B;  1XER A;  1T9Y A;  5GAE I;  3GYG A;  3MMC A;  2WON B;  1T9T A;  4HKQ A;  5KFV A;  4TYA A;  5L38 A;  3D6M B;  1TEL A;  3HX9 A;  1YRU A;  1B0V A;  3OFG A;  2E9T A;  5IZH A;  4C0B A;  4C11 B;  4NL5 A;  2E1A A;  4C8N A;  1M1G A;  2XBP A;  2PFD A;  2W2N P;  3MM7 B;  3NCR A;  4U96 A;  2BOP A;  1AFI A;  1EW8 A;  3BPS P;  1JLA B;  1TUV A;  2DRB A;  4NZ0 A;  3MED A;  4CYR A;  1T05 B;  2A2C A;  2LU2 A;  4CIO A;  3PHT A;  1RU2 A;  2Q6B A;  4UOO A; 
#chains in the Genus database with same CATH homology
 1ELZ A;  1N2L A;  5K4P A;  3TG0 A;  1ZED A;  1KH7 A;  5DLT A;  3CMR A;  3IDD A;  4UPI A;  4LR2 A;  2VQR A;  3M8Z A;  1KHN A;  2XR9 A;  4LRF A;  2RH6 A;  3Q3Q A;  2ANH A;  5DLW A;  2IUC B;  2W8D A;  4KJG A;  1Y6V A;  2W5W A;  1E2S P;  4MY4 A;  3WAY A;  3BDG A;  5L0K A;  2QZU A;  1ANJ A;  1KHJ A;  3MK0 A;  4GTY A;  3T00 A;  4MHX A;  4UPH A;  1AJB A;  3M8Y A;  1K7H A;  1O99 A;  3BDG B;  4GTZ A;  4LR8 A;  3UO0 A;  3UNY A;  3B5Q A;  3OT9 A;  3IGY B;  2XRG A;  5GOV A;  3UN2 A;  4GTW A;  3DPC A;  1B8J A;  3NKM A;  4GTX A;  4LRA A;  3NKP A;  1P49 A;  3SZY A;  3BDH A;  2D1G A;  5LRN A;  1AJD A;  4N7T A;  4LRB A;  5C66 A;  4MIV A;  2W5T A;  1HQA A;  3MK2 A;  2IUC A;  3WAW A;  3A52 A;  2GSO A;  3TX0 A;  4ZG6 A;  1ANI A;  1ELY A;  3NKO A;  1KH5 A;  3NKQ A;  5LRM A;  1E1Z P;  1HDH A;  5GRR A;  2GA3 A;  3WAV A;  3NKR A;  1SHQ A;  1AJC A;  3T02 A;  5L0B A;  4UOR A;  1KH4 A;  1AUK A;  3DYC A;  1URB A;  2W8S A;  3TWZ A;  4UPL A;  3UN3 A;  1EJJ A;  3MK1 A;  4TN0 A;  1ALI A;  1ELX A;  1EQJ A;  2W5R A;  5HRT A;  1O98 A;  3BDF A;  5DLV A;  4CXS A;  4ZGA A;  4LRD A;  1KH9 A;  3E2D A;  3NKN A;  2IFY A;  5KXA A;  3T01 A;  4KAY A;  1ALJ A;  4NWX A;  4YR1 A;  1ED8 A;  1SHN A;  2W5V A;  4LR9 A;  3WAX A;  4LRC A;  2ZKT A;  5TJ3 A;  1URA A;  1ZEB A;  2W5Q A;  5EGH A;  1E33 P;  5LIA A;  1Y7A A;  1E3C P;  4QAX A;  5INH A;  4CXU A;  1ZEF A;  2GSN A;  5IJS A;  1FSU A;  3M7V A;  4B56 A;  1EW2 A;  4ZG7 A;  1ED9 A;  3KD8 A;  5AJ9 A;  5L0E A;  3ED4 A;  4KM4 A;  4UPK A;  1N2K A;  3WBH A;  1ALH A;  1KHL A;  5LQQ A;  4FDI A;  4UOP A;  4CXK A;  4NWJ A;  2W5X A;  4ZG9 A;  3NVL A;  1EI6 A;  4LQY A;  1AJA A;  2X98 A;  3LXQ A;  3M8W A;  4FDJ A;  5IJQ A;  4LR7 A;  5EGE A;  2W5S A;  4KAV A;  3IGZ B;  1ALK A;  3SZZ A;  1EW9 A;  1KHK A;  1HJK A;  1EW8 A;  2G9Y A;  4CYR A;  2GLQ A;  4CYS A;  4LRE A;  2GSU A;  4UOO A;  4KJD A;  3UN5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...