3UN5A

Bacillus cereus phosphopentomutase t85e variant
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
Knots found
sequence length
391
structure length
391
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDEMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Phosphopentomutase
publication title Molecular Differences between a Mutase and a Phosphatase: Investigations of the Activation Step in Bacillus cereus Phosphopentomutase.
pubmed doi rcsb
source organism Bacillus cereus
total genus 143
structure length 391
sequence length 391
chains with identical sequence B, C, D, E, F
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2011-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3un5A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3un5A01
5GOVA 4UORA 3Q3QA 3OT9A 3NKNA 1AJBA 1ZEDA 4LQYA 4MY4A 4ZG9A 4GTZA 3B5QA 3MK0A 4LR9A 2GSUA 2W5VA 1AUKA 3WAVA 1Y7AA 1KH7A 4YR1A 1N2LA 1EW9A 5DLTA 5C66A 4NWXA 2GSOA 2W5SA 3ED4A 3TG0A 4FDJA 4CYSA 4UPIA 1EI6A 1ZEFA 1E33P 5GRRA 3SZZA 1KHJA 2IFYA 1ED9A 4GTWA 2GA3A 1ALKA 3MK1A 5L0KA 1URAA 4LR8A 3E2DA 3CMRA 4UOOA 5L0EA 4KM4A 1HJKA 4UPKA 3MK2A 3TWZA 2IUCB 3WAWA 1ALIA 1HDHA 1KHNA 3M8WA 1EW8A 3DYCA 1E1ZP 4KAYA 3M8YA 3IDDA 4ZGAA 1B8JA 3IGZB 3WAYA 3DPCA 1KH9A 1FSUA 3BDGA 3NKQA 2X98A 4LR2A 1ELYA 4ZG6A 4ZG7A 3IGYB 1ZEBA 4N7TA 3UN2A 4LR7A 1Y6VA 3T02A 3UN5A 3WAXA 5L0BA 3TX0A 1K7HA 1ELXA 2GLQA 5TJ3A 3KD8A 5IJQA 1SHQA 2VQRA 4FDIA 1N2KA 1HQAA 3UN3A 2QZUA 3T01A 5EGHA 4LRDA 3M8ZA 1KH5A 4CXKA 3UNYA 1P49A 2W5TA 5LIAA 3SZYA 1AJDA 2W8SA 4KJDA 4UOPA 3T00A 5LQQA 4MHXA 2IUCA 1E2SP 2ANHA 4CXUA 5K4PA 1KHLA 1EJJA 2XR9A 3BDHA 5LRNA 4LRAA 1SHNA 2RH6A 1KH4A 5AJ9A 5HRTA 2W5RA 5DLVA 2W5WA 3NKRA 2XRGA 2D1GA 2W5XA 3A52A 5DLWA 3WBHA 1O99A 3UO0A 4QAXA 3NKOA 1ANIA 1EQJA 3LXQA 4LREA 4UPLA 4LRCA 1ED8A 4B56A 1ALHA 1EW2A 1KHKA 1ANJA 4UPHA 5LRMA 1ELZA 4NWJA 3NKPA 1ALJA 2GSNA 3BDGB 3M7VA 1AJCA 4GTYA 4LRFA 3NKMA 2G9YA 2ZKTA 4KAVA 5KXAA 4GTXA 1URBA 4MIVA 5IJSA 5EGEA 3NVLA 1O98A 2W8DA 4CXSA 4KJGA 4TN0A 5INHA 1E3CP 4LRBA 4CYRA 3BDFA 1AJAA 2W5QA
chains in the Genus database with same CATH superfamily
1U1NA 2B6AB 2ZH2A 4P7TA 5KFYA 1PSDA 1UVJA 3DGVA 2W8LA 1S7HA 4OI3A 1JLQA 2YNIA 2OEMA 7FD1A 1QJHA 2AEFA 2I8EA 1LFPA 2EC2A 3C6TB 4LR8A 3CCRS 3DFEA 1M5SA 2ZH5A 4X4UA 5CYQB 4ZKAA 1RT1A 1RQ0A 3WAYA 1S1XB 2FDNA 3BSAA 3P5TL 5EDWA 3HM9A 5KT6A 2MGZA 4GKKJ 1Y6VA 2QL5B 2ALYB 2BJDA 1FJGF 5ETVA 4DV2J 4JI2J 4C8YA 2OFGX 2PFFB 3PW7A 4G6VB 4Q0BA 4K4WA 4MK7A 3WX4A 4BC9A 3EGVA 3HPOA 2EXUA 2F9DA 2N7YA 1NK0A 3SCIE 1QD1A 4Q2LA 2LEPA 1MSWD 5DDRC 4WFNQ 3QT7A 4AFFA 4LJMA 4OI4A 5F3TA 2WVBA 2DB1A 4IFVB 1XR5A 4PXBA 4IH7A 1X5TA 4LIWA 2Y1RI 4QR2A 4ZPCA 4M5DB 4NRTA 2BA9A 3J7YU 1JLEB 3C3LA 2IAJB 2IVFB 3WX8A 3QIDA 3IO1A 3OFFA 1VK3A 1U2CA 2JH3A 1MWZA 1TL7B 1F5BA 3DLJA 2RIJA 3NRBA 3TA2A 3MM6A 3R5GA 4B3SF 2RNEA 3KJVA 2B9YA 4F02A 2HYIB 2WB4A 1HNIB 1P49A 3QQCD 2ANHA 5KFMA 4HACB 5H9FK 1EJJA 1VQYA 3KG4A 2G2ZA 4QCLA 1PJ6A 3GFXA 1HNXJ 4P52A 4DR2J 2HGNA 2F4VJ 3EUNA 3NGSA 3QATA 2KB2A 1LWCA 1TFYA 3F44A 3GILA 1WHXA 1FT8A 3NGDA 4IDKA 1CPZA 5B7WA 4Z37A 5KXAA 4P2MA 4IFYB 4TN0A 1Y5NB 4JV1A 3OT9A 4HI2A 2CADA 2RDIA 2F1FA 3W7BA 3HI9A 4L72B 5DLTA 3KK1B 1SC3B 5D6GA 4NLPA 4B17A 3CPWR 4TLQA 1TK0A 1VRTB 3NOGA 3ILJA 2CZ9A 1S0MA 1Y9OA 3CE8A 3HHLB 3PTWA 4IUFA 4EU0A 1JKHB 4OZ1A 2NSBA 2LU2A 1WC6A 4OHXA 3HMJG 1SC6A 2QMXA 1XMBA 1UFLA 1DURA 1FX4A 1LW2B 5IJQA 4ED7A 4LFAJ 5EN1A 4OYBA 1XEZA 1HR0F 3Q89A 5HRTA 2DY9A 4WK3A 2GMJA 2UXDJ 4M5HA 2GA7A 1ANIA 3EX7B 4X66J 1HNWF 1U49A 2R7UA 1JJHA 1ALHA 4DFPA 4P74A 5H9EK 1X0PA 4LRFA 2GCFA 2IM1A 4K5RA 1YIJS 1N5VA 1T94A 2AV5A 5KFLA 2FZCB 1G2EA 1R3NA 3HT0A 2EW9A 1FKAF 1RLCL 3TUIC 4R8UB 2YH0A 3JXOA 5C24A 5AE1A 2AHOB 3SCKE 3Q8PB 3IP0A 4OYIA 3DC2A 3PEHA 3IS9B 4M5IA 2IUCB 2RRAA 2IDLA 2PMZD 2GO9A 5DGBA 4ENOA 2MQMA 3CSKA 2V34A 2X51A 4HDGA 3MMCB 1S1TA 2HBRB 5KG5A 4DPYA 1GEHA 3NAHA 5J2QA 4Y2IA 5DLVA 3I5CA 4DV7F 3GIKA 4CLTA 2A1BA 2HQFA 4ED4A 3WIUA 4RKUC 4LFCF 2YX4A 1I3OB 4FZVA 1FJ7A 2DR9A 4JB8B 1RWPB 1HQ2A 3BSOA 4LT6A 2R2UA 5IXUA 4MT1A 4NPOA 2BKPA 1HW9A 2CQHA 2ZE2B 4C2MA 1PKUA 2M3DA 5EUHA 4ZA1A 3MFHA 1KH7A 1F9EB 4OYAA 3M8PB 2DHGA 2HHPA 1YITS 3P49B 3TG0A 2LQ5A 1H2UX 2E66A 2GIQA 3P5BP 2EWHA 1NDCA 1B7YB 3BDPA 1XQIA 1R0AB 4DV3F 2AW0A 1MMLA 2EFPA 2HEKA 4A8QA 4DF8A 1KH9A 4MMOA 3GV5B 3L4BC 2BOAA 1IWGA 2FY8A 1MWQA 3UN5A 2NUUG 3MCSA 3QT8A 2Y9HA 1EX8A 1TL4A 1LV5A 4DBQA 1EHWA 4GKKF 3SXLA 2RMLA 4W90B 4DU7A 1DLOB 4DV2F 4UTGA 3PFOA 4JI6J 1S9GB 2XWYA 4JI2F 3PVXA 2ZH7A 4FVMA 5LSLA 1FKPB 1JLQB 2YNIB 3UPFA 3IRXB 1RTIB 4OJ1A 5DS7A 5F8JA 3R27A 1CQNA 1RT5A 2XBPA 4DOZA 9RUBA 1E3CP 4ERDA 3D0IE 4DX8H 2ZHAA 2AJQA 3MTKA 1RT1B 4F36A 4HTJA 2XGPA 2MXYA 2WOMA 3D9BA 5KAKA 1X8DA 1JXVA 1YRTA 1WKJA 1VR6A 2BW7A 3CEDA 1EQMA 2H4YB 3CCTA 5LMUJ 3M8WA 3M8QA 4CLZA 3CNQP 4YS2A 3K57A 4MKBA 4NYOA 1WF1A 3POTA 4M95A 1G6BA 3WAXA 1HBUA 3MM9A 4Y34A 5DG8A 2A6MA 4WP9A 3PXGa 3MAAA 4A8KA 4GVBA 1KH4A 3BGRA 4KC5A 3KHLA 3HSJA 2HRUA 3PO5A 3N0VA 2MZSA 2QRRA 1R6VA 3JQJA 4WYWA 2XS7A 1Q4RA 1H72C 4FBUA 4DR2F 5DG7A 2F4VF 4KY3A 4GTXA 1OY9A 2HFUA 3TUJC 4YB5A 2FHMA 3AB4B 5HO4A 3H20A 2HURA 3MM6B 5F8NA 4ELVA 2B51A 3AD9C 2CG8A 1Q8KA 4RO0A 4Y28C 3KJVB 1SKSA 4RW8A 4UZBA 4OI1A 3F73A 2XI2A 1RU2A 3WAWA 2PE8A 4NX9A 3KHRA 1NHUA 1EW8A 4H4KA 1SCJB 4N77A 3OTCA 3H5UA 2QN6B 3DPCA 2GHWA 4RPFA 2BV3A 2DNQA 2YKMA 3ILOA 1LWCB 1Q7YT 2DGWA 3H0PA 3OTEA 2XMKA 4YHHJ 1R31A 5GAEU 4NYPA 1ZM2A 5DLWA 3C66A 2HG4A 3BH6B 4LFAF 2CJYB 4C8ZA 3BO3A 1Y0HA 4UOHA 4JYAJ 3QZ7A 3W9HA 3BR9A 3T5JA 3CD0A 4PWDA 1URBA 4KGXB 4X66F 2MB0B 3CJ5A 5EHHA 3EZ5A 3CO9A 1C4CA 1RA6A 1EARA 3VAIA 3IM8A 7FDRA 2HHXA 2GSOA 5L46A 2E7VA 3RAQA 2QGFB 4I2QA 5L0KA 1A9NB 4TU7A 3V2UC 3IG1A 3PYEA 3LANA 3HKWA 3OTBA 1PYOB 1BLUA 5KFVA 4OZ3A 3HX9A 2AIRB 2DEIA 2ZEJA 3V6HA 5M2UA 4HEA9 1D9AA 5GMDA 1CQMA 2J9DE 3CF5Q 1WSVA 1W7WA 2XY7A 5B0DA 5LM7E 3NOCA 2G1DA 3NGKA 3BBCA 2OPSB 2Y0SD 1RCXB 4YQWA 3T1HF 2F8HA 2F8EX 1RADB 2R4FA 2GHVC 3T6JA 1IR0A 2JSXA 3LGNA 1T3OA 2W2OP 2WRMA 5ETSA 3BDGB 3K17A 3VZHA 2XLIA 2HHTA 3U02A 5L1LA 3Q2TC 2F9JA 1HWKA 3V4IA 2DGVA 3KUHA 3MCNA 3ILIA 3LUYA 4KIAA 1E6VA 4L3NA 2W5SA 1KD1T 1U8WA 5D77A 3DRSA 1OPZA 3KJQB 3P3DA 3RJMB 1URAA 4M94A 3IAM9 1UFKA 4URGA 3PEJA 4OI0A 1KHNA 2WSCC 2PFDA 2W7PA 3PZPA 4DXLA 1N6QA 4M63A 3US5A 4F0KA 4OYZA 2GJFA 2CZVC 4NA3A 3U1LA 1FJCA 4KPCA 3MECB 5KFXA 1NJIT 2FVCA 1NH8A 5E3RA 3HULA 4NLOA 4DV4J 1WC1A 3LO3A 3KK2B 4ZVHA 1LWFA 3FMBA 4JI1F 2R7XA 4RUBA 2P9EA 2OD6A 1ZM4A 1C0TA 4K2XA 4QBUA 1FFWB 3EDQB 2RDJA 4JI6F 3LWLA 3M6XA 1VQ7S 4EO8A 5HSPA 5FIIA 3FSIA 5HQMA 2EBGA 1BWEA 1U6BA 4NCGA 4F4XA 3B5QA 2UVRA 1EKRA 3PM9A 5AT1B 1QLNA 4I6WA 1S6PA 2GQCA 4GO7X 3GLJA 1M5HA 3GIIA 2M0GB 3TVYA 3RRGA 4ECTA 4AL7A 1H38A 3DU5A 2NS1B 5D0HA 4LQ9A 1Q95G 3SIPB 2FC9A 4UY8T 1FRJA 2PN6A 1N32F 4TU9A 2VFVA 1FDAA 5DZ7A 4LF6J 2H4WB 2NSCA 1MW7A 2AX0A 3FUYA 4RW4A 1S5ZA 4NI2A 4OX7A 4DEZA 1RT5B 2ZBPA 3AODA 3W9IA 4I68A 4YUDA 2QA4G 4OYOA 3MEEB 1DBDA 1YX2A 2X1AA 4MKYA 2WVFA 4OIXA 3Q24A 1HBOA 3ZZ0A 4USKA 2VBXA 4ATNA 2RAQA 4EMDA 4KBIA 3G6VA 3OTOJ 1FD8A 1V6HA 2WOMB 2HS4A 1AROP 1VQ6S 1XWLA 2LKZA 3JSMA 3PJWA 2YVSA 4LRBA 4CYRA 4FPIA 3NKNA 1Y5LB 3M8QB 2FZKB 3HVRA 4O4RA 1I6JA 4Q8FA 3POTB 4N41A 5F8HA 1X4GA 1SKUB 1HBUB 4X4TA 1CC8A 2B7BB 3R7NB 1QSSA 3WDOA 1UVMA 3EYZA 4KE5A 3RB6A 4IG3A 4NE9C 4NXNJ 3DRPA 4PWUA 1SV5A 3BBBA 1KQFB 4ECXA 4HI1A 1F9HA 1ELXA 1NCLA 4KGZB 5J2PA 2R42A 2GV1A 4J91A 4CO3A 3DOKA 4LF8J 3PW4A 3W3SA 3U1MA 2E1PA 4CP5A 4U8VA 1N4LA 5F8LA 3QNWB 4QQBA 1QM9A 1JLBA 1RT6A 1NLKL 3GCWP 1TL3A 1WC4A 4IQMA 2R3VA 2Q1LA 3VV2B 4ZN1A 4P73A 1Q8BA 2V4RA 1NPKA 1NJWA 2FC8A 3VCDA 5CXTA 3CJTA 2MKSA 3K58A 1Q78A 1VHFA 2LXIA 4HDHA 3VAKA 1M5PC 1SL1A 4IOCQ 1FX2A 2YKMB 1ZPWX 2UUBJ 2J0XA 3JTNA 2LQBA 2JDJA 1YJVA 1RHRB 3MM8A 3J80U 3UDEA 3W5YA 1NHKL 3QGHA 4Q5VA 2LXUA 5JXSA 3HCXA 4FNHA 2XMTA 4UOCA 4LR7A 3LTOA 3LP2A 2AGQA 1K8AT 2OAUA 2EVZA 2F8MA 2F3JA 4W98A 2ATLA 3P6YC 2R8JA 2FLLA 4PWDB 1XNQJ 5KFGA 2VKZG 3TAMB 1KLMB 1HQEA 5B0FA 3C2PA 1DHMA 2KH9A 1YHQS 2W9CA 5JVHQ 3DOMA 5CYMA 4L74A 2JX2A 3G87A 4EZ6A 3D3BJ 3PY8A 4NXMJ 2OEKA 2ZDPA 3AFGA 1FEHA 4IH5A 2UUAF 5CD4A 4FS1A 1B0TA 5LXRA 1JXLA 3FRZA 3MK0A 2V2VA 2BE2A 1RAFB 2CPXA 1RISA 1K1SA 4ZCMA 2CRLA 2GAHC 4X4OA 4ECZA 3QGPA 3I56S 4N56A 4O3PA 1DTQA 2K7JA 3BYPA 4PPDA 3I4PA 1OQ3A 3G82A 3M8YA 4G65A 3GIMA 4ECUA 1X9SA 5J2MA 2AYMA 1ELYA 3M1VB 2J6UA 5KFBA 1FESA 3OHBA 3EPGA 1RT3A 2ZH8A 2KXNB 3HFVA 1SKRA 4F4AA 1RWUA 3D6MB 2M9KA 1ZH5A 2O1PA 3EICA 1GXLA 4F25A 2AEJA 1LWXA 1F5AA 1KP6A 2A3JA 3TYTA 3V4IB 5IT9Y 3UO0A 2AYGA 1NK9A 4IG0A 3H7HB 1CVJA 3MGJA 4DV4F 1DQ8A 4O4GA 2DPIA 2BZ2A 1FCAA 4X4QA 4CZCA 3AT1B 1ZETA 5D0EA 1NO8A 2YKNA 3ZZTA 5E5NA 3QPIA 1NHVA 1ZEDA 2VJUA 1OSCA 4CO1A 2U1AA 3IWNC 2VD3A 4ZVGA 1JNRB 1X4DA 2PD1A 3U27A 3HHLC 1F3FA 3AD7C 5KFZA 1R6YA 2V8HA 4FS2A 1QAYA 2F4FA 5IM0A 3AQOA 2EI5A 3OR2A 3BGUA 4I6AA 4USVA 2AZ3A 4KM4A 4ED0A 3S01A 4DV0J 1LEOA 4A8FA 2DNYA 2Z8QA 3GR0A 3Q8UA 2DHAA 2Z30B 1HFEL 1TKXA 1LWFB 2FUG9 2MZRA 4J9SA 4K0KF 1IUJA 5ETMA 2NUHA 4KH1B 2KXFA 3NEKA 1X9WA 2YNFA 5A6PA 1IKXA 5DG9A 1GH8A 4WJBA 2YKPA 2ZD1A 2L08A 3O8WA 4NCGB 1GQEA 2HQDA 1OQ6A 2HFNA 4ZP8A 3KLFA 1RGVA 1GMWA 2LA4A 1ZZFA 3SCLE 1S6PB 5K9FA 5BYQA 3D1HA 4DR4F 4O3RA 1N56A 2EK1A 2Z2LA 1UAWA 3W63A 2HRYA 3KG1A 1PO6A 2E1AA 4J7CA 1HWIA 5LL6d 3EGZA 3ENQA 3G86A 4Y2MA 5K14B 4OV6A 1WSRA 2P5VA 2VG7A 4USIA 2CQCA 2GGPA 3L9ZA 1RWOB 4KJIA 3DLBA 2FJBB 4RW4B 1K73T 1ZPVA 2OPQA 1B8JA 1RWXB 1JX4A 2CPIA 4U96A 1E6YA 3OQ2A 4DR1F 4KGKA 2OPRA 2RD5C 4P72A 2M88A 1B4SA 2YX1A 3KD8A 3KMSA 5F8GA 4DZ6A 1VI7A 1NRKA 1SIZA 1YZ6A 3UDLA 1JWWA 5H9FJ 3JSMB 3PKMA 2HHHJ 4PABA 1JLGA 1FI4A 5BR8F 2JVRA 4IRCA 4HHHA 5KFOA 3SQGA 4N76A 3FVYA 1JJCB 5HQ8A 3Q0AA 1J27A 4GVLA 4IG3B 3ET6B 3CW2C 1SC1B 3DRPB 1RWWB 3RBXA 2NXNA 4FYDA 2QLBB 5J2PB 3UDCA 2YWEA 2BUNA 2HZAA 2MJUA 2MY8A 2CNLB 3QRRA 4JV0A 2UUBF 2ZVSA 1NKCA 2C3MA 2CQBA 1U02A 2YPYA 3RGIA 2VDHA 1DY3A 3QMQA 3C6UA 1JLBB 1RT6B 1T0TV 4TQRA 1IM4A 1TL3B 3AHPA 5DQGA 1ICEB 2WB1D 3PFEA 3G8TA 2ZOFA 1HW8A 1O5JA 5ETPA 4Q45A 4ZVPB 1FD2A 3CD7A 1KFDA 1ELZA 2JEIA 1UPMB 5H9EJ 4DMZA 1KHWA 2ILYA 3P4UB 3FQLA 3JYTA 4ID5A 4NXMF 3BREA 1V3SA 2IM3A 3FZBA 4LBIA 3LW5C 2B7CB 4DV1J 3C19A 4XPCA 2KHDA 2B8PA 2JJ4D 5KT4A 2C2KB 3E2DA 4TLRA 1CG2A 2ZHOA 3CJKA 5DM6Q 3PKYA 2M2BA 2YQ0A 1VC0A 1CSJA 1UTAA 2V68A 2QYCA 1HQEB 3DMJA 1PIEA 2W9CB 2CQDA 4J9LA 1U1MA 3DOMB 3H42A 1HQUA 4J9RA 3IR7B 1MNEA 2NR0A 1X5OA 2AGOA 4Z7YA 4A8YA 5CYMB 2HBYB 1NBEB 2E5JA 4QZVB 2DNOA 2UXBJ 1M1KT 3MUTP 1GFWB 4FXDA 2V69A 1TVRA 5G0RA 2CUYA 2BE2B 4YP3A 3IWLA 2I5JA 1Z2LA 2VC0A 5GAGU 4QWCA 5A0YB 4EK2A 5IJSA 1DTQB 4JV5J 1VQ4S 1YJRA 2BBEA 1X0FA 1AYEA 2WHOA 3QRQA 1V3RA 2XM3A 1Y00A 3G82B 2OPPB 3T3FA 2IA0A 3OSNA 1C1BA 5GVQA 1VGYA 1ZA1B 1RT3B 3TQ1A 4DSJA 4FF1A 1RKIA 4LF7J 2RHSB 3CCZA 3Q2SC 3QSIA 4U7UK 1P1LA 5KG0A 4IG0B 1VQOS 3G8QA 4NZ0A 2CA9A 4J9UE 1SPBP 4O4GB 1VQPS 3NCRA 5AJ9A 2V5HG 2NPFA 4HT7A 3G6ES 2E5LJ 3GZ7A 2YWHA 2G13A 2YKNB 2HQCA 3NGUA 1BQMA 1OY6A 1TMMA 1HI1A 2AP6A 2MQOA 5IM0B 1Q7LB 4WXOA 3OR2B 2JEGA 2CPEA 4CT8A 1CJUB 4E2FB 5HROA 5SZTA 1CS4B 3H25A 5KT7A 4UOGA 4MH8A 3KHHA 1OS5A 1PCAA 2R8HA 1TKXB 2V8GA 1ZM9A 5A2QY 2VPYB 1WOSA 3KDNA 1D1UA 1U2RA 3QLHA 1X4HA 4Q2MA 3QGIA 2ACYA 3J7A1 2D9PA 1ALIA 4NRUA 3LH2S 2YWKA 5KFNA 4N8OA 2B56A 1IKXB 3ZZZA 1WUUA 1HYSA 2X98A 2ZD1B 1N5YA 1UMJA 4NA2A 1S12A 3EVMA 4ED6A 5F0WA 3MR2A 3CMAS 4DSKA 3KLFB 4B3RF 4AE5A 4LVNP 2DGTA 4DQRA 2R7QA 3EVOA 2KG1A 1OYDA 3THTA 3JB9k 5EWEA 2VFUA 2B9WA 4ZCIA 4RNOA 2LEAA 5IWAJ 4KV8A 2C2ZB 4K5SA 2JZ5A 1SI9A 4KGVB 3FKBA 1PC4A 4F2SA 2VG7B 1KQSR 2MZQA 2GGPB 4FYYB 5M2RA 2IRUA 4C4WA 4PXEA 3N6LA 4B08A 2M8DB 1N2LA 1OPIA 1E6YB 1F2HA 4K59A 4JI4J 5KFFA 4N47A 2D9OA 1KHJA 2XG8A 2YNHA 5LT5A 2XLKA 1HDHA 2BM0A 4Z2XA 1SIWB 2V4JA 1A0OB 3EM1A 5DO2A 1APSA 4FYWB 3MEDA 4PYDA 1WC0A 4RBTA 4I56A 2EFVA 1Z1ZA 3GV7B 1K7HA 4USJC 3PR5B 3KYLA 4TN2A 4E98A 3FQKA 5KG1A 3M05A 3FMWA 3W2WA 2CFXA 5C2GA 1A7GE 2H5JB 1B3TA 3UCZP 3A3NB 3MM7A 2FPHX 1FXRA 1RTHA 1HD1A 3D1OA 4LF5F 4OQJA 4QW8A 2RB7A 4C0OC 3CDWA 3D5MA 4DCOB 4I64A 1CULA 2R7RA 3D0GE 2XMMA 5AJ3J 2ADBA 4UPHA 5KT5A 2WBRA 4X4PA 4PG5A 3KK3B 3GTYX 2AT1B 3FJ2A 2Y8WA 1P6TA 2ZH9A 3L7UA 2DNNA 4UORA 4PG4A 3PHEA 3MCOA 1K0VA 2HQ3A 1RE1B 1Y3KA 5D0GA 2W4CA 1U45A 1LXJA 4HLBA 3ITHA 4IR9A 4ZLJA 1R89A 4WFXA 3C6UB 3VZIA 4JI8J 4DR5F 5ETQA 5KG2A 5E33A 4KAIA 3MK2A 1K44A 3MI7X 5KOXA 4MIBA 4DV1F 2CQ0A 2KM8C 3AXKA 4UF4A 1IR2A 3CULA 3G6XA 4ZLLA 3CTRA 1DTTA 2JLEA 4QPTA 1SKWA 4PXCA 4CO5A 5L0EA 2FQQB 4WKRA 3LGMA 2EK6A 1HWJA 2CJBA 5IQ6A 3BF4A 1EKSA 4OYWA 3L7PA 1YJ9S 4CRJA 8ATCB 3JYTB 2KFZA 3TVKA 4ID5B 3DXBA 2MKYA 2VUGA 1S77D 3KLIB 2XGQA 1WACA 3I5AA 4AXJA 5C2CA 1C0UA 4HYKA 4ZP7A 3DKDA 3E8OA 3HT3A 1KDNA 1WF0A 3DI6A 2KKHA 1FDNA 3VVTA 4JV5F 2VBZA 1PBUA 3QJLA 2XEXA 3DMJB 3JAMU 2IMWP 1FVQA 3NS6A 2D3OR 2V63A 1AZSB 3RBZA 1EETA 2VA2A 1NKEA 1UEVA 2LCWA 4C8LA 1CJTA 1K0TA 3DYAB 4WK1A 1VLOA 1JLCA 2KZMA 1TVRB 5B0GA 3KHGA 4KH0B 4NLDA 4OX8A 2MQNA 3HO1A 2I5JB 1Q79A 4ECQA 4YMEA 2W1BA 3CD5A 5J1EA 1HHTP 3J81j 3KLHB 4L73A 5F3ZA 4F67A 2FYXA 3MD3A 5EX3A 5E7OB 2E5LF 5HMXA 4H4KC 1R8HA 1KKHA 1C1BB 2BKNA 3X1LB 2AYEA 4KJGA 4F3MA 1NJZA 4B9NA 4O3OA 4U6PA 2D74B 3Q3QA 1NSKL 3FDSA 4DX6A 3KJNB 2W5VA 1AUKA 5L1JA 1S6OA 2VU5A 1DZ5A 1RT2A 1NNDA 3VGVA 2HBQB 3ZC4A 4L6V3 4G3IA 3PIOQ 2X3DA 4M5JA 4OYXA 2Y1LB 2WTFA 4XK8C 3IM9A 2G0CA 1E1ZP 3BYRA 1X9MA 3CDAA 4B3MJ 2ZNYA 4PUOB 1BQMB 2J0WA 4J9VA 2GNKA 4ZMMA 1JLFB 3NG8A 2UXCJ 2MQLA 5K4PA 1RSCA 2I0XA 4ZVFA 3MEKA 3PIPQ 3A52A 3O2IA 4RZRA 3B54A 2X1FA 5HROB 1REVA 2W01A 2MY7A 3D3CJ 1VBXA 2PEHA 2ZKTA 2X1BA 4WIQA 5CQGA 4RW9A 3QLHB 3SEOA 1CEZA 2KVIA 4LQYA 3FBBA 3VGTA 1CC7A 3DGPA 3R1HA 4CH7A 5HL7Q 1N5YB 4QW9A 3Q83A 5DGAA 1U47A 5CHCB 2CDRB 4YY3F 1N36F 2LDYA 3ZXWA 1MMDA 4LVOP 4DS5A 3R1LA 2CXEA 3TZXA 3DM2A 4LMZA 4NLUA 1IQZA 3Q8YA 3G71S 3ZTSA 1ZBTA 3GJRB 3CC7S 2VIHA 1EIYB 2MKJA 3G8SA 3HHDA 3G6YA 3SZ2A 3H2LA 5LJ3Y 3Q8QB 4AQYF 1FTCA 3EXCX 2DR5A 1S48A 6FDRA 2MJNA 3T1AA 4W92B 1Y3JA 4QAXA 2ROGA 3IA0A 1N5SA 4ZHRA 3GIJA 4ZVSB 1ZAWA 4DQQA 1ANJA 4ETXA 4RUAA 1IR1A 3UDVA 1SQEA 5HVFA 1KFSA 1F6TA 4ES3A 4WKYA 3D0HE 2C28A 4A8SA 1UPPA 5KFDA 4NLQA 1X5SA 2PA8D 3ULHA 1WTFA 2V4JB 1SL0A 4DX7A 1YLXA 3TJ9A 2ZH4A 2WVEA 1NU4A 3MEDB 4RW6B 2HS3A 4EWTA 2Z56B 1RABB 2IM2A 2GQ2A 3UR3C 1N34J 2HRTA 2HGMA 2QFIA 3W2WB 4A8OA 3TANA 2XHCA 3MM7B 4GKJJ 4N5SA 1T3NA 1VQ8S 4JI8F 1SBRA 5FLXU 2OSQA 4LSLB 2BDPA 3OSPA 4DV6J 4DX5A 2RF2A 4BC7A 3L95X 1AFIA 1VIOA 3BO2A 1FNOA 4EUVA 1W25A 2C3UA 4RW7B 2BR0A 2WAQD 4H4MA 1BXNA 3KTQA 4FP9A 5L9NA 2LXFA 1BGXT 2MEWA 2YWGA 3G9CA 1CJKA 3DRRB 2QO3A 2B4OA 3KLEB 4RX6A 1IVZA 4LUBA 1T9UA 3VWSA 2OUGA 3GWCA 1XTZA 3ETMA 1JJ4A 3LP1A 3QWUA 3QYYA 2WZ1A 3I0SA 4NWXA 3QO9A 2BE7D 2HHUA 1DTTB 4IH6A 1X4CA 3F56A 1VK8A 2HHSA 1HBMA 1B99A 2ZITA 2NCKL 3NL0A 1J5EF 3ELHA 1IKWA 2VC1A 3LQVA 2VG6A 2G1HA 2IVYA 3RAXA 1XK8A 1D9FA 4PQAA 2D41A 1VCTA 4USTA 1S10A 4PAAA 1SJFA 1PAUB 1RAAB 4F4YA 2EC0A 3DDKA 3HSDA 3CDUA 2RUSA 2N3OA 1PJ5A 3AAWB 1S4EA 4I7FB 2E7WA 4DLEA 3MPWA 3R7SB 3LPYA 3W5XA 2W2NP 1TKDA 3TZZA 2BJEA 4HT5A 1NSQA 1VS3A 3J81U 2MTLA 3I31A 2I1RA 1ZYQA 3T5LA 4ZIVA 3OLBA 3R2DJ 1EETB 2V2QA 3BGOP 4NLRA 1YDLA 1S9FA 1IJEB 5KFKA 2B0GA 4EYIB 3LAKA 1CJTB 3K7RA 4OJHA 1N33F 5A8WA 1QDUB 2AF6A 1JLCB 3PJ9A 4V19J 1UWBA 2V9WA 5GRRA 1AA1B 5E3CA 5I4MA 3GYNA 5KFSA 1S1VA 1P9YA 5U47A 2M5YA 2VPWB 3HFKA 1RT7B 2RJZA 4PKDB 3NMAA 4Y2KA 2WVCA 5J1EB 1VQ5S 2SXLA 3G2XA 2GIFA 2PEBA 3IBWA 4MIAA 3M6UA 2DO4A 3GSDA 4Q7AA 2XMJA 5I42A 4B3MF 2ZC3A 2XR9A 1JK9B 2OIHA 4DR7J 1BQXA 1ZAXA 2PDAA 2H65B 4O44A 2VBWA 4CNYA 2CJXB 4CLPA 2UXCF 1UJ4A 1YGYA 5GAHI 5T41A 1FEEA 1M1HA 1KVIA 4C0BA 4R0JA 3GFYA 2ZBCA 1RT2B 3CC4S 2ZJRQ 2XI3A 1X4AA 2VQFJ 4Q44A 1NJYA 2WSFC 1RAOA 3JSRA 4YOEA 3RAMA 1OJ4A 4TNOA 1SJ1A 3IR6B 2R8IA 2K3IA 2DGQA 1SUQB 3MR7A 3TP2A 1VC6A 5KFRA 4G1IA 1XMOJ 4JI0J 2W2QP 3CMRA 5F8MA 1L3UA 3M2RB 2BKOA 5E3AA 1NB7A 1AFJA 1SL2A 4YB7A 1M0SA 3RTVA 4NA1A 3N79A 2XTJP 3MMBA 3HVWA 5K8PA 5F41A 4BCAA 2BOPA 2WSEC 2C1EB 4CM2A 4WFYA 4TY8A 4YN3B 4CQ1A 1REVB 2KYXA 4OHWA 5E2QA 1RHQB 4UW2A 5A8KA 3GPAA 3M30A 2VZ9A 1MN9A 2OH2A 1SHNA 4FBTA 2PMWA 4RW9B 1MROA 1LFWA 4F0MA 1BMQB 1EJ7L 1KSPA 4HR2A 5DRKA 5D3GB 2QA2A 1TELA 1RKJA 2UU9J 2DO0A 1EQJA 1H6KX 1DRZA 2XSJA 1ED8A 4NOHA 1BUXA 3DGPB 1EW2A 1T9TA 2APOA 3GB0A 2BM1A 2MDAA 3RU0A 3GCXP 5G4DA 1TKTA 3QZ8A 4F4KA 4DFKA 4OLOA 1FHTA 3VAFA 2BQRA 2BX6A 2V94A 4DU8A 2DCLA 1WORA 3VGUA 1YJUA 1O0PA 2AX1A 2ZVIA 5ETLA 3EZOA 1KRPA 2RT3A 4PPZA 2CQ1A 4QIVA 4FKYA 3D54A 3CO0P 1S57A 3DNCA 1OIAA 1S72S 1LXNA 3OV7A 4JUZA 3GU0A 5B0CA 1RAGB 1TL5A 2QFJA 3CUNA 4KFBA 1GTHA 4MK9A 2FY1A 4NLYA 4ALZA 3HSGA 1N34F 3PX6A 1WELA 3FEXB 2R2RA 4AXIA 4B3TJ 2XMUA 4ZHRB 3A4TA 3VAJA 4GKJF 1C1CA 3DRYA 2W25A 5KFJA 2DR8A 4MJKA 4DV6F 2CDQA 5HI7A 3NKRA 2HZCA 5HP1B 1RAJA 3KUEA 2QIFA 3LXQA 1IKVA 1FKOA 2LVWA 1U26A 4YB6A 3F0NA 1H73A 4AYBD 3DOLA 1TV6B 5D0RA 4F2RA 3R6GB 4XO0A 3HJVA 2RQMA 4J9QA 4DSIA 1QAIA 3BB5A 3PW2A 4C7QA 2IC3B 2EEYA 1KQGB 2RF2B 4MAKA 3HFZB 2YXLA 1UL3A 1RTDA 3PW0A 5KFEA 5KOWA 3CCQS 3IDDA 1JLAA 1NPRA 2MKKA 4H4MB 1QSLA 2UV8G 5EWGA 2RILA 5CAAA 1J5OA 3K89A 4O0NA 3BO4A 2LECA 2O5DA 3MURP 1GT8A 4X4NA 4OZLA 1AJDA 4MHXA 1RCOB 4WE1B 2E1RA 1CJKB 1AT1B 4A8XA 1D0EA 1M5VC 4RNMA 5GAEI 1O99A 4OZ2A 3BKTA 3P8BB 2YTCA 4JBCA 3QO9B 2HFZA 4ICLA 3FEYB 1KR4A 2R8KA 4BWJA 1HBMB 3L7OA 2XO6A 1QE1B 3FCWA 3JTPA 5GMEA 1IBKF 2VFRA 2L41A 1YRXA 4F0HA 3QFHA 2IYIA 3D6FB 2ZBIA 4QPXA 4CLWA 3MCMA 4C3MA 1ZA2B 5IQQA 2HWTA 4DPTA 3PACA 2A10A 2AJ0A 3PJXA 3MUVP 1S76D 2ABYA 1ZEBA 3CCLS 2CQ4A 1YI2S 3GJTB 2HNYA 4R5PA 4OZ5A 3W1YC 5GAHU 1HWUA 1WG5A 2ROPA 1RI7A 1WKKA 4DR3J 3BGLA 1CJVA 3SBMA 3CGIA 4ED3A 1HHSA 4H54A 3PRVA 2AJ2A 5DDPC 2MQQA 3DLGB 1YSJA 3WHIA 4A8WA 4LF4J 2F40A 1U0SA 2CYYA 4DR7F 1VQ9S 3BM7A 4J9NA 4X4SA 1G7CB 5A8WB 2AKWB 2W2PP 1UWBB 4K4YA 1MU2B 5C25B 1TKZA 4LIRA 5CYJA 4UY85 4OHVA 2HS0A 3I0RA 1D9DA 4ZG9A 2X7IA 1GMUA 3KLVA 3H8YA 1BQNA 4OHYA 1BHNA 4P10A 3W65A 5HMZA 1WF2A 4C48A 5ETNA 2E9ZA 2FJEB 1S1WA 5I42B 4K4TA 3M2UA 3W64A 3RW6A 1XMOF 5D4NA 4JI0F 4O44B 3FZ2A 2CIMA 1M5OC 1FERA 3D68A 2NPIA 4FYVB 1QY7A 3T01A 2CPJA 2CPHA 2P9CA 2XULA 3C16A 2UVUA 2W8SA 3RBDA 1OMSA 3KUGA 4JOUA 2N7CA 1HI0P 5IFMA 1SQGA 2VJVA 4PG7A 2Y3YA 2V2ZA 1OWXA 2HHVA 3QAUA 2R7WA 4QYZK 4FPRA 4Y3CA 3TNVA 4FF3A 2BVZA 2Z4PA 4DL7A 5CZXA 2MGZB 1S6QA 1UA0A 1SVDA 1Q1KA 5C42A 4I67A 2FJXA 3DLKA 3M9NB 3R5BA 4RBUA 1FRLA 5CZVA 1U1LA 4PQUA 3BBFA 2IYGA 1XR6A 1FXDA 1WWHA 3CJSA 4Q0BB 2HZVA 1Z2ZA 4FDJA 3BPSP 2J5AA 3NY0A 1KWMA 3KJFB 2NYHA 4C11A 4TQSA 1HJKA 5DDOC 3M30B 3LAMA 4DSEA 1FE4A 4F3OA 1MROB 2JLFA 1FFSB 2QJ3A 2HFOA 5C5JA 2IY5B 1NPPA 2W7AA 4Y0FA 2OTLS 2DVIA 2W9BA 3PHTA 1NZ8A 4GC7A 4HL9A 2OHDA 3A8JA 2K3KA 1RA7A 2ROEA 1HNXF 3WIVA 4NMXA 2CPZA 1TKTB 3JSBA 2Q6CA 2JNJA 3MPYA 3GJQB 1H3DA 4NEZA 3SSQA 2O01C 3S8SA 2OJ3A 1EB0A 3OTDA 1ULRA 4TVAB 4FDFA 3OXLA 2J0SD 4K4XA 2J8SA 4DL0C 2CPYA 4FKXA 3AOAA 3MAHA 4KHPJ 2E9RX 1ZTWA 3OJUA 1S79A 4U67Q 2QLJB 3PO4A 2KJVA 2Y8YA 1I51B 5L1IA 3BEGB 3IWXA 2VOPA 4OFZA 2JEJA 4KFBB 2QT7A 1SJ3P 3K0JA 4UQTA 4ED8A 5F8IA 1H7WA 1EI6A 2DGSA 4ER8A 1MWYA 5B0EA 1S0VA 4DL2A 5E3PA 1C1CB 3T5HA 5HN0A 1FWKA 3OHAA 1RACB 3ZTPA 4MYTA 5F0UA 1DFDA 4IDKB 1WNEA 1HI8A 1WD6A 4LR2A 2QX0A 3SI8A 1MG7A 5D4LA 3TI0A 2V6AA 5EX0A 1G3OA 1S1UA 4IFVA 5T14A 1IKVB 3W5ZA 3MWBA 2W8KA 2XHWA 1FJGJ 2UXDF 3BSNA 1N54B 3OXGA 2P6SA 3TW0A 2H1YA 3DOLB 1RHJB 5KFHA 5D4OA 2OI2A 3VQSA 2RDDA 4J9KA 1DQ9A 5F9LA 4G1PA 2LFVA 2CG4A 2DNLA 1X4FA 2KRBA 3NNAA 2KZZA 2UUTA 2DISA 4RNFA 1AW0A 4EBEA 4LF1A 1RTDB 4C6AA 5FD1A 2DHXA 4DQSA 4USWA 1M1GA 1JLAB 4QWDA 3IGNA 2MLXA 2HFSA 2BJ9A 3E3XA 2IVMA 1KVJA 3H4BA 3NS5A 1U1OA 3RBEA 2JFDA 3MEGA 4BBYA 3PYGA 3EGNA 4ID8A 4KO0A 4XTTA 3ZZRA 1HHQA 1NSAA 5L0BA 4B3SJ 3M8SA 3U7JA 1WDTA 2HWHA 4I6YA 1LNQA 5LIAA 4E8UA 5LQQA 1YJ7A 2HHWA 1RTJA 2HVZA 4ZJOA 4F26A 2DIUA 5K8OA 3SV3A 2HAFA 5C24B 4H4OA 4ZJLA 1IBCB 3TZWA 4DUZJ 1J2VA 1RAIB 1UJ5A 2MKHA 3MFIA 4DQIA 1VRTA 4DR3F 5MLCV 1MLAA 1GK8A 8AT1B 1P8GA 2KHCA 1OO0B 2J8AA 1NK6A 4CLLA 2D7SA 1S1TB 3TZYA 1I94J 4OZJA 3TQEA 4ZVTB 5HAOA 1YBTA 4LF4F 4DFMA 2Q66A 3FSYA 3H2VE 1YBUA 1LW2A 5J2QB 2OEJA 2CQGA 1R7IA 2KXHA 1TMJA 3OJSA 3KWMA 2HNYB 3LALA 4R5PB 3VF0B 4PG6A 3ZZPA 1SH0A 1S0OA 2RRBA 3M32A 5E0OA 1CJVB 2B8QA 4K4UA 4ZVRB 4OYMA 4X4RA 3GFHA 1RWNB 2W4DA 3C8YA 1F3VA 1KOOA 2CPDA 3UE2A 3SQOP 2CQIA 2VASA 3HLUA 2J0QD 2FTRA 3MMJA 3WZ0A 4CXUA 3BDHA 1PC5A 3PDNA 2RKIA 3TJ8A 4A47A 3ISZA 3HVAA 2BANA 1HR0J 3ADAC 2DNRA 3EZUA 2CJKA 3NKOA 5ETRA 2B5JA 1TL1A 3N6NA 4Y2CA 3RB4A 1NK7A 2C2EA 5D15A 5E41A 4DG1A 3DLHA 1BQNB 1KONA 1HNWJ 3UQSA 2Q79A 3AA8A 5IT0A 2OTJS 1ZM3A 3H40A 2W8DA 1UETA 4I1TA 1NDKA 2ADCA 1S1WB 2UUWA 2WVDA 5HK4A 3ZNUA 5L38A 4WYLA 3MM5A 2QMWA 4A46A 4QJVA 1N52B 3A8IA 1ITPA 2RSQA 1PG5B 5LMUF 3V6JA 1ALKA 2MQPA 3C16B 4UPKA 3J80Y 2KM8B 2KU7A 1Q5YA 4OZ0A 3W62A 1VIXA 2AWZA 2F65A 4A4JA 1Q86T 1XMQJ 4JI7J 2OMLA 2QLWA 4RUCA 1QTMA 3PR4A 3TX8A 2ZH1A 1U2FA 2GZOA 2AMCB 1GX6A 1XR7A 4ED1A 2HGLA 4TY9A 2O3DA 2XMVA 5HQLA 2EKYA 2HNZA 3M8PA 1IKYA 5B0BA 1YZ7A 5C42B 2KL8A 2JL9A 2DRAA 4DV7J 3R3TA 1FDDA 4PQUB 2QYGA 4IOAQ 4U8YA 3L09A 4LFCJ 1KHKA 1UZDA 1RLDA 1V9OA 1U6FA 1XNRJ 1D3WA 1VBYA 2K7KA 3MM9B 2AU0A 3RW7A 1HNZJ 2VFSA 1NH7A 2W5QA 4PG8A 2I2YA 3MAAB 4Q8EA 2BEFA 4GVBB 4GO5X 1LKZA 2B9XA 3BGRB 2P8IA 1R0BG 4IKAA 3IAS9 1VDHA 4URQU 1FF2A 1VJWA 2VG5A 1YKWA 2H51B 2KJWA 2C2NA 2KYZA 1S9GA 3HHKA 1L3SA 3AJDA 2V8DA 1WHVA 3VTIA 1G4CA 1FKPA 1XBWA 1PYSB 3IRXA 4DI6A 1RTIA 3IGYB 4USUA 3I55S 4DV3J 3BQ2A 4DSFA 3M9MB 4YHHF 1HA1A 4UOPA 3HSZA 4WF9Q 2DNMA 2CVIA 1UJ6A 4RW8B 4XAKA 2YNGA 3J7AN 1PGZA 3A1YG 4JYAF 2J9EA 3LP0A 4GMKA 4JI5J 3NWGA 4MFBA 2G2YA 4RU2A 4EYHB 1H0HB 1VC5A 3R5AA 1UCNA 1KQKA 2WCXA 2DITA 3DCAA 3M6WA 4C3LA 1FRKA 4MY4A 3DU6A 3LF0A 3M9OB 4C8OA 4RWXA 1LK5A 1SC4B 3T9NA 1RHUB 4B9SA 2Y0BB 1S1UB 3TO8A 2VHGA 4KQZA 4HH0A 3OD2A 3OVAA 5M2PA 1VBKA 1U1KA 4RBVA 3N9UC 3BGFA 2VV5A 4K8RA 4NWBA 4D3HA 2DXDA 3BZQA 3GJSB 3VAGA 3BSCA 3V81A 1I1GA 3E01A 3ZTRA 2MHEA 2XS5A 3O5TB 4LRAA 3T1YJ 2M7SA 4C0HA 2W5WA 4I2QB 3Q8VA 4CH1A 3IG1B 3ZFVA 1YVFA 5JVGQ 1KLNA 1JMTA 1TUVA 4DUZF 1KVKA 2HFVA 3F41A 2DT9A 4WP8A 4YR3A 4CO4A 5CABA 3JSYA 4F7VA 1XN9A 2DHSA 3N28A 3DN9A 4OI6A 3I6PA 3MEGB 4PYAA 3VGSA 2Z2MA 4IO9Q 2DTJA 2GSUA 2NXUA 1I94F 4OLPA 3J7ZT 2GHPA 4KO0B 4ZVQB 1VQMS 2CNNB 2POKA 5KFQA 4IRDA 2FVSA 2PMHA 5KFIA 4D3GA 1RTJB 4H4OB 4RJVA 3KKFA 3RR7A 2XNRA 2DGOA 3H2UB 1X60A 5K20B 3K5NA 4NASA 1AB8A 4DUTA 3BJYA 2GIRA 1RAHB 3UN3A 1JNZB 3OUYA 1E6VB 5I3QA 4BHQA 1B7FA 1X4BA 3IMQJ 3DRSB 1BWVA 1W2BR 3AOCA 1K47A 1W26A 2MSSA 2VONA 4WWSA 4WFBQ 1T9VA 1PJ7A 2AJ1A 4UOFA 5BXIA 1N6QB 2V9KA 4X62J 1Q82T 4A48A 3MR3A 2GSNA 4WFAQ 3ICLA 3MXHP 4IYQA 2VQEJ 1NXIA 5GAGI 1EAYC 2VH7A 4TXSA 3M32B 4DFJA 4C8NA 2J9DA 1KHVA 5A6WA 2OPSA 2ZH6A 1D8YA 3NS7B 3Q23A 4C97A 2KT2A 4U95A 3TEGA 2N82B 3PCOB 2MLYA 2HWIA 4DQPA 2LA6A 1H2VZ 1C0TB 2VKRA 5I3UA 5ETTA 4I69A 4C9DA 2RKIB 3CCWA 2FVQA 1NSPA 3BDGA 2BANB 4LF6F 2NYIA 2A6OA 1RP5A 4J9MA 2LEBA 2B5JB 1TL1B 2Z2YB 5D4PA 4DG1B 5EGHA 2UV8A 4CCHA 5LRNA 1SB6A 4FNIA 2L9WA 1XMQF 5DLGA 4JI7F 4DV5J 3N6MA 3T1HJ 1WDDA 4RWWA 4NLWA 1I5OB 3CJQA 3CJ0A 5AXKA 2QEXS 3OTOF 2RVJA 3MM5B 5LRMA 1WKLA 4FF2A 4UZCA 5HJYA 5KG7A 3ZTQA 2G9YA 1D09B 5K8MA 1FE0A 2EFGA 4HVZA 3TUPA 1O6XA 1U7LA 1M90T 2C3OA 4CLKA 3QT5A 3MECA 4FYXB 2LU1A 2J9CA 4NI2B 1XNRF 3PX4A 3DDIA 1HNZF 2E7XA 2XNQA 3KK2A 1VQLS 3PV8A 1R27B 4KKOA 3N01A 3V6DA 1HBOB 4LSNA 4NLTA 3QAEA 2QV6A 2D1CA 2GC8A 4NXNF 1IBMJ 5B08A 2HNZB 1IKYB 2A2CA 3KNAA 2ZWOA 1RXOB 2NQPA 3VHQA 4CYUA 3B6BA 2CNOB 4NZ6A 4NCBA 5KFCA 4LF8F 7AT1B 4I0WA 4ILLA 3WC2A 1U1QA 1FXLA 1UZHA 2QLXA 3LPEA 4WU2A 3HXMA 2FZGB 3UI3A 1UWAA 2IMOA 2VDIA 4C3KA 4QU7A 4JI1J 4ED2A 4P71A 2C3PA 1QVFR 3ZZUA 2BMBA 5KFTA 2K06A 2KO1A 2VG5B 1SV5B 2DNKA 2JWNA 5F9NA 2JHEA 2CPFA 5J1NA 4JI5F 2V2KA 1RWMB 4UQGA 3AA9A 1HIYA 4UUWA 2PSZA 2DY1A 4KRWA 2G0IA 4NMLA 2W2MP 3DOKB 3GFZA 1QTNB 2HLTA 4NLSA 4M5LA 8RUCA 4KR0B 2BRLA 3NP5A 4ZP9A 2A2DA 2WK4A 3MEEA 3EWGA 2PI4A 3OLAA 4ZVUB 1XIQA 4USMA 1JQGA 2HMIA 3CIZA 3SFGA 2ZM6J 5T7LA 4DS4A 1C4AA 2YNGB 2JRSA 1IWAA 2YY3A 4ZG6A 1BE4A 4YR2A 3UN2A 2RS2A 3LP0B 1N32J 1QAJA 1WOPA 4URSA 1H2TZ 2V50A 3SCJE 1NKBA 2RU9A 3OL8A 2GJIA 4MFBB 1XNQF 4KJDA 4G1QA 2RE1A 2XLJA 4HH1A 1RBAA 2OGUA 2F7VA 3ENVA 5A8RA 2XO7A 3EMTA 4WTOB 3MM8B 2FLPA 4DPOA 3T1YF 2ILZA 3IC1A 1ACMB 1T95A 2CNKB 1OY8A 2BJ8A 2GFFA 4PZVA 2DGXA 3LP2B 2XB2D 4NEYA 1S49A 1Y7PA 1URNA 2N3LA 2IIHA 2RQ4A 3BDFA 5GOVA 4C8KA 4ZVEA 3CVKA 3CCMS 3AQPA 2FGCA 3HDSA 3H4DA 3QWPA 3ENWA 3V6KA 4RL1A 4QOTA 1VLYA 5BYSA 5D78A 4LBHA 2D3UA 2HVIA 1VQNS 2COLA 3V81B 3PRBA 4OL8A 1TP7A 1WC5A 3E01B 2H5EA 1NZAA 5KG6A 5CCLA 3W8GA 3NNHA 4PWWA 3D6TB 4HHJA 3RRHA 1U1RA 4EEYA 2AD9A 2JEFA 2D3O1 2MPUA 5KG4A 3TX0A 1Q5VA 2HVEA 2M52A 1RAEB 4R0EA 4PEOA 4YDXA 1CBKA 2JC0A 1NK8A 1IN0A 2RQCA 1DARA 3NGRA 1K1QA 4LRCA 3D6HB 3CDEA 2VA3A 4OZNA 4B9LA 1WEYA 5J2MB 1AJCA 2E5IA 1MN7A 3LGHA 4CWBA 4ES1A 2DGUA 3NCQA 2E5HA 1H74A 2KN4A 2WONA 1S4FA 2J6TA 1LW0A 4F8RA 4X62F 2C2DA 1AJBA 4TYBA 4ZVOB 1S99A 5B09A 1T9YA 3CMQA 2VQEF 3G96A 4S0MA 1RZMA 2YKQA 2HQGA 2DNGA 3TAMA 1KLMA 4DV0F 4GTWA 3SFUA 1Q81T 1A6LA 3AXMA 5L39A 1L3TA 3OUYB 1Z4UA 4ZLNA 4ZGAA 4J90A 3O3LA 5DQHA 1RBOB 4DSLA 2L48A 2HAIA 2EPIA 5BYRA 4CXKA 3T00A 1ZAVA 2DRDA 1RHMB 1L3KA 1W2IA 3KOAA 2XRGA 3U1NA 4O3QA 1F60B 2QLFB 2LLZA 3M4XA 3CJ2A 4QYZJ 2ZH3A 4DV5F 3LWMA 2GQQA 2GX8A 1PBAA 2CJAA 1UVLA 4IOBA 3M1VA 5EGYA 1U48A 5I3UB 2UUAJ 4ZPTR 3FEZA 4ELTA 2DH9A 6FD1A 2YNFB 3H98A 4C98A 3FBCA 1UVKA 5CD4H 2OSRA 3ED4A 4QR0A 3W2VA 5ITHA 5AE2A 4MKAA 4ZP6A 3T5KA 1JB0C 3FNNA 1S59A 2D3ZA 1KTQA 3R2CJ 1OYEA 4PRFA 3HHLD 1IBMF 4B3OA 2VF3A 2HHHF 3HP6A 2XSFA 5KT3A 3GV8B 3MZIA 5IS2A 4DPUA 4CO2A 4BLGA 2J7UA 3TVZA 1SQFA 4I2PA 1HMVA 1ZZNA 3QSYB 5I3PA 2YKOA 2OPQB 2ATCB 2JOQA 4KKOB 1X7VA 2BACA 2OPRB 3NVLA 4ED5A 3V6DB 2AGPA 4LSNB 4ES2A 2E9TA 1R8PA 2QTWA 1NDPA 3JAMY 2E29A 3PG9A 1QVGR 2ASLA 4CYSA 2IFXA 5SUHA 4OX6A 4CYUB 3NKYA 1QUPA 2FHOB 2LP4A 1JLGB 1GX5A 1YWXA 2OO4A 2XS2A 1RB0A 4QIWD 3SQGB 2GVZA 5DLFA 4WPAA 3ENAA 3D66A 2ASYA 2FD2A 2ZM6F 4EFAC 5LMNJ 1FK9A 4K0KJ 3OPKA 2EFQA 3IR5B 2XYPB 4J37A 5K14A 3BH7B 1U8SA 3EPIA 4M5MA 4NLGA 1FO1A 2ZWPA 2EKNA 4IO1A 3K8WA 3CCSS 1NJXA 1XJWB 1S9EA 3M6VA 4YB1P 1VRQC 4DR6J 3EVWA 3GG1A 3HZEA 3K5OA 4DR4J 2ZJQQ 3N4WA 2HMIB 4Y65A 3NWRA 5T7LB 2ALZA 5DETA 2V0NA 2D69A 4I4BA 2R9LA 4FXWA 3BN7A 2ZKUA 3N5BA 4G1QB 1YTYA 3DXSX 2HQIA 4DL3A 3MR5A 3MHYA 2RS8A 1H7XA 3A13A 1P27B 5A8RB 3FCHA 2C2MB 1WC3A 2CJ9A 4DR1J 3VALA 2Z0GA 4P2XA 5CCMA 3T9ZA 2UXBF 3ONQA 1UFWA 2XYGB 5AE3A 5MAOA 3GMGA 3ET6A 2C2OB 4B9UA 2DXFA 3HJFA 4J5OA 1U4BA 2QL9B 3PRDA 3CJKB 3EDRB 1WG4A 3CCVS 1YJNS 3R5CA 5HLFA 4IRKA 2DKOB 4KB7A 2ZOMA 1NK5A 1VBZA 3ISND 1UKUA 4GTYA 5BR8J 3D1QA 1HNVA 2IA6A 1HQUB 2W24A 4B02A 1WI8A 4P9SA 2GO8A 4USHA 3GYGA 1NAQA 2DD8S 1O51A 5FDLA 4WXWA 2I6WA 1Y7AA 2OMOA 3DLEA 1N0VC 2JC1A 1ZEFA 1B70B 4LF7F 5G0RB 2RU3A 1U25A 3I32A 3GQCA 1JJ2R 2NXEA 2ZUAA 4O0IA 1RWKB 2NZ4A 1FWLA 3M8RA 3TAPA 1F9FA 3TA0A 4AUKA 1O8BA 1HQAA 4U7CA 2B9EA 2MHNA 4KYZA 3AB2B 3OVBA 4RNHA 2RH6A 4AL6A 3ZO7A 2EG1A 3NAIA 1N0UA 2WONB 2GW8A 2W5XA 3W9JA 4WZMA 1LW0B 5A76A 4ILRA 3NGTA 4FXVA 1NB2A 5J1PA 2FHJA 3HD1A 1F2GA 5J2NA 2R7SA 1VMBA 2BQ3A 2MKCA 3R5DA 3B8HA 5GMKa 5RUBA 5HMYA 4B9MA 3K5LA 3AY0A 1N88A 2P6TA 3NMRA 4DL4A 1NDLA 4X2BA 1VJQA 2BJ3A 3T41A 3CCES 2VODA 4ELUA 4DUYJ 2OKQA 5JJBA 3B4DA 3MK1A 1NEEA 1RJJA 2C42A 1CLFA 4UOOA 3D67A 1YJWS 1TZ0A 2MSTA 5THWA 5FLXY 3GE9A 2IRYA 1LOUA 1KN6A 2F5GA 3K5PA 1WHYA 2KRRA 2ZZMA 2UZAA 3UR0A 1T8EA 5A0YA 2AYBA 5TJ3A 1SHQA 1KH5A 5JMNA 3SZYA 4M5KA 5AXLA 3T6BA 2A0FB 2OPPA 2W5RA 2QSFA 3H5XA 1GAOA 2AEMA 3KXDA 4P75A 1PAEX 5IWAF 3CB4A 2FLNA 2IM0A 4K2JA 4WP3A 3X3UA 2W7OA 4UT4A 1R43A 2H48B 5IOLA 2EFOA 1HYSB 1TFWA 1VRUA 3HHEA 4B9TA 3W2VB 1QSYA 2DHHA 3CJRA 4NYZA 4CIOA 1T9XA 2ZC4A 4QU6A 4LR9A 1FNMA 3R5JB 2BW2A 3T19A 4JI4F 3B82A 2B43A 4ECWA 4O23A 1AXQA 3BN4A 5C7PA 2OD4A 5LJ5Y 1IBLJ 4W4MA 3EGWB 4J9OA 2PA3A 4KV8B 4OYPA 3WBZA 1NUEA 4OJ3A 2OELA 4DCJB 2RRNA 4B3OB 1FDBA 2DH8A 1T05A 3KDOA 3OVSA 1BD6A 4I2PB 1HMVB 1YQHA 1NK4A 1CJUA 1CS4A 3W61A 4N8NA 2NREA 4DPXA 2J76E 2OP5A 5DM7Q 3IXQA 2YNHB 5AJ3F 5LMNF 3S6EA 1D8ZA 1VISA 3E2EA 3O6QA 4UPLA 3J81Y 2AQ4A 1T9WA 2VFTA 4NCAA 2G2OA 3BV8A 4XPEA 1UEUA 4HKQA 1RWVB 1FRMA 4L75A 2OLWA 2DR6A 2GVZB 2M8HA 4DR6F 4XIUA 3R9LA 2MQ8A 1RTHB 4JI3J 4EBCA 1IM6A 3OFEA 1RDRA 2XZWA 1CULB 1GXTA 2NXCA 2ASJA 2EG2A 4YEAA 5IV3A 5ADZA 3TWZA 1FK9B 3LOUA 3UCGA 4HHUA 2WW4A 2KFYA 2AJFE 1V3ZA 2UVWA 5KFWA 4F4ZA 3QFWA 2K1RA 1B0PA 2YX7A 1WEZA 1U0HA 3OBIA 2R7TA 1S9EB 2XZTB 2ZHBA 4TYAA 3MOJB 2BQUA 3DHXA 2YWWA 3P96A 3H5SA 4B3RJ 3ITHB 2E5GA 1S6UA 4ZPDA 3N5FA 1RK8A 1UEKA 4ZN3A 2E1CA 2IBOA 4WCEQ 5GADI 5IT9U 2RQKA 1T11A 5B0AA 3FBEA 4NWJA 4ILMA 1FNXH 1SXLA 2EBEA 3OFHA 5INHA 4TU8A 2GMLA 5ETKA 2DK2A 4QR1A 4YDDB 4CI0B 3ILLA 1T02A 1FA0A 3VAMA 3A8KA 2W9AA 1T7PA 2E44A 1TQLA 3PX0A 4ZLPA 5C66A 3TRGA 3M2VA 5HATA 3TJAA 4LF2A 4JP8A 4MK8A 1GXUA 2UUCJ 3FSXA 4QWBA 2VL1A 4QIFA 1DJ0A 1FSUA 4P7VA 1C0UB 2DEJA 2IJNA 3KK3A 2A18A 5K8NA 1RHKB 4AD6A 3UVJA 1Q8IA 3DI6B 3FFIA 5HLFB 1R8AA 1XERA 3AH6A 1FRXA 1HNVB 5IV4A 3MF5A 2FHKA 1VOMA 4LF5J 3KG0A 3ISNC 3JTOA 2C2RA 5FDLB 2MLZA 4F3QA 1KC8T 1ELOA 4IR1A 1F5CA 3DLEB 3NKMA 2XCPA 2VOOA 4MIVA 3CIMA 1BY9A 4DL6A 4CTAA 2B4PA 1AJAA 1X31C 2B4VA 4P2FA 3HF5A 4KGMA 1SJ4P 2QZ8A 3CC2S 1KOHA 1PILA 2L9DA 2WW8A 1FRIA 3O44A 3NLCA 2PIIA 5JUMA 4MTPA 4DJBA 2GA3A 1H98A 2FLOA 4DR5J 2P2CB 3OL9A 1KNZA 2XWXA 4MKVA 4DUYF 3C46A 2PC6A 3KLIA 4BWMA 4LFBJ 4OX9J 1QUVA 2XY5A 2WBMA 2DNZA 1ZS6A 1LQ9A 1N2KA 5FJ4A 5J2NB 4ZPVR 2AJ4A 4P2SA 1M5KC 3MD1A 2GVDA 3NXZA 5K5MA 3IBFB 3ZZOA 2HHQA 2O67A 4CLUA 4TKTA 3VVUA 5HANA 1AZSA 1VHIA 2Q6BA 5KTQA 3M7VA 3BDEA 5DQIA 4ECSA 3SMZA 1O98A 2HBZB 3DYAA 2R7VA 1QAXA 1VYAA 3H5YA 1X4EA 4ANDA 1L5UA 3AJ2A 4YR1A 2ASDA 1R8BA 4DZDA 1HPZA 4Q43A 4R25A 3CXCR 4BS2A 4L76A 1RYSA 4CLSA 2XQCA 3KLHA 1TK8A 2ZBQA 2C22A 1SJQA 5L8RC 3NBPA 3AD8C 3MUMP 4ZPAA 1IBLF 1KBRA 1SH2A 2KI2A 3UW1A 4PCQA 3GR1A 3I96A 1Y11A 3W60A 2PGCA 3FC9A 3IGVA 3UNYA 3RB0A 4V19X 4Y6IA 4KT0C 5DDQC 1VRUB 1K9MT 5LXYA 3C15A 2KTQA 4U9RA 4ECVA 3MPUB 3DM2B 2Z58B 3KNGA 1ALJA 3MDFA 2LYVA 2UVVA 3MR6A 3B4MA 3KLGA 3OL6A 2J7WA 1Q8LA 4PUOA 4WBFA 4ZDNA 2C3YA 3RUBL 3SV4A 2DBBA 1JLFA 3BPDA 2NLWA 3HVTA 3MMAA 3V4MA 1T05B 3MOZA 1Y5IB 3JQKA 5HMWA 2YWFA 5IT4A 3GYXB 2NZCA 1V5IB 3HHNB 1EZZB 3RB3A 4DN0A 4JI3F 3IRWP 3UNGC 2HSEB 3QJJA 3RRKA 1LWEA 1FRHA 2VPZB 1HD0A 2ZDOA 3IGZB 5HJXA 5GADU 2BJ7A 3TR5A 5DJBA 2FJWA 1RUSA 2GAGC 2W5TA 2DXEA 3OL7A 1R0CB 2RUGA 3H59A 2D1GA 2PT0A 2MYFA 3KFWX 3BKUA 4M5NA 3I4HX 3MTJA 1TUGB 2V8PA 3UWTA 2KVQE 2LMIA 4B56A 2XCAA 1HBNA 3UD3P 2CVEA 4AT1B 2J6SA 3FGVA 3E51A 4CDIA 2DPJA 5EGEA 4O3SA 2PO4A 2IHR1 2M70A 5HVGA 4RLEA 4RNNA 2ZOGA 2BJ1A 4A8MP 3W66A 2K1RB 4DF4A 4PR6A 4DWIA 4UPIA 2JLGA 4HTIA 3L3CA 1DAXA 1U0HB 4YY3J 4EBDA 3CJ8A 1N36J 3TUZC 4F4WA 4K4ZA 3SDEA 1TU0B 5ETOA 3MPVA 4KTQA 3TEHB 1FFGB 2ZZTA 1YJTA 3OXFA 2K2PA 2UUCF 1N8RT 3LP1B 4FDIA 1NM2A 3I0SB 1KEKA 1WTBA 4CNZA 4M8LA 2R7OA 4WTYA 1T03A 4CLFA 4QIGA 2LQ8A 4AQYJ 2YQ1A 2N4CA 5LSRA 4RW6A 2EFNA 3QIPA 4YR0A 2GS8A 1IKWB 2OFHX 4K4VA 4OJGA 3DLLQ 4IQXA 2VG6B 3M2VB 1VFJA 2BE9B 2ZZNA 1IXKA 6AT1B 3ZTOA 1FWPA 4LSLA 1RT4A 3FCVA 5DZ6A 3CT9A 5HBMA 1YBAA 4RUHA 2YBVA 4XDCA 1KS2A 4RW7A 2VICA 5A2QU 1WI6A 2MZJA 3UVJB 3Q8SB 3FFIB 3AJ1A 2XC9A 1Q16B 3ETOA 1SH3A 2BABA 3C14A 3DRRA 3KLEA 4ZOSA 3A8EA 4X4VA 2XMAA 5AXNA 1HARA 4LFBF 3NNCA 4V1Ak 1EQ0A 4OX9F 2FGOA 2H9ZA 1N5QA 3K5MA 3KMQA 5KT2A 1S1VB 4X65J 4CTAB 3PW5A 1TTHB 5D8HB 4X64J 4Y00A 2K8GA 3W8PA 2XZDB 4C8MA 2VQFF 1RBLA 1N48A 5AXMA 2CQ3A 3OR1A 3R97A 5H1SV 4B9VA 1OSDA 4U7UD 4NLXA 4ZCKA 3MAQA 3WC0A 3HKZD 3SSRA 4CH0S 4GTZA 1SJRA 3GIRA 3WAVA 4QWAA 2L3MA 4ECRA 2MZ1A 4LSZB 2FJVA 4I7FA 3TA1A 5BJRA 2Q43A 2DNPA 2ZJPQ 2ZFHA 4LF9J 1AUDA 2GVDB 3BR8A 3K2YA 4KAYA 1J5EJ 3EE3A 3NKQA 2IRXA 1B64A 4Z7CA 4N7TA 1S7IA 3CMES 2VQRA 2MZTA 1HKAA 3ZZYA 4DPWA 4QYRA 3LA0A 3TOQA 1Y4ZB 1KHLA 4ZPBA 3UCUP 1EP4A 2G0JA 3QGGA 2UU9F 3B78A 4NLVA 1RYRA 3PNIA 3I9ZA 1X5PA 2KT3A 1UP1A 3VAHA 3MMBB 1RT7A 4LQ3A 4K50A 2HK3A 2KFNA 2CQPA 1HPZB 2LDIA 2CJQA 3A3OB 4K7QA 2I9SA 4WIIA 3BS9A 3I5BA 3P45B 4CM0A 2ACMA 4TY8B 2QA1A 3CCUS 1JXEA 2FVPA 1UA1A 2HNDA 2BXJA 5A8KB 2R2TA 2H54B 3NBPB 1YRUA 1R8CA 2Y1JA 2CAJA 2DR7A 3K8VA 2N4DA 2U2FA 1GMVA 4FVCA 1EW9A 4J9PA 2FJAB 4EGLA 3VQTA 1ED9A 1N33J 1GTEA 2XSJB 4EO6A 2B6AA 4ZITA 1JIHA 5LSOA 5IC6B 3MPDA 3C15B 4MIWA 4B3TF 2XYHB 3UD5A 1G1XA 2QC3A 2HLUA 1HL6A 2FHJD 2BYCA 1TAUA 4KSEB 3C6TA 3DHWC 4LBPA 2Z57B 3BQ0A 1ROFA 2ZUGA 5CYQA 5L9XA 1UW4A 3DDNA 2JFKA 4DLGA 2G9OA 3KLGB 4NL5A 2MMYA 2ZNZA 1S1XA 3D7SB 3HD2A 1SUQA 2Z2ZA 1UVNA 1B0VA 4LREA 3BKFA 2X1GA 2FVRA 2DIVA 2FIUA 2GMHA 3M2RA 3HVTB 3NCPA 2HKEA 2I38A 3MMAB 3TAQA 1KTVA 1YG0A 2IJRA 2NXJA 2ZBRA 4O3NA 4UUXA 3BQ1A 1RTZA 1LWEB 2R2SA 4CLYA 3I87A 3QT6A 4RR5A 1WHWA 2E1MC 1FVSA 4DCPB 2KG0A 3SZZA 3S7RA 4YFUA 2IFYA 4OI2A 4OV1A 4WZQA 1LK7A 5D3GA 5HVHA 2H5IB 3R6LB 1FKOB 2BRKA 3H90A 2CKWA 2J7KA 4E0DA 4KHMA 3UD4P 2VB6A 1GNKA 2GJ2A 3HZGA 4M5DA 2Q3PA 2B3TB 2HVDA 5L1KA 1JLEA 3FBFA 2IAJA 3GONA 2KDOA 3FK4A 2DNHA 3M8ZA 1TL7A 4F50A 2DCUB 1HBNB 3JS9A 1TAQA 2IBKA 3EJMA 4ZIWA 3QJPA 1Y10A 4ZJQA 1L3VA 1S0NA 1U1PA 3PYDA 2F63A 3J7Z5 4K4SA 1HNIA 1U6ZA 2HK2A 2PI5A 3D2WA 4ANCA 2CWKA 2H3EB 3NKPA 4HACA 1ZTTA 4KAVA 4EZ9A 1J5OB 4ZCLA 1U09A 4PXDA 5IZHA 1C2PA 1BC6A 3SDEB 3Q8RB 4GRSA 1AUSL 5KFAA 3WQPA 1E33P 1FTRA 3O1LA 3EXYA 4IFYA 3QRPA 3DRXA 2V4QA 5HP1A 1F0XA 2HPUA 1Q0NA 3DYCA 1T03B 4ICLB 2LQJA 3KK1A 4ZG7A 1UW9A 2JVOA 3I9V9 3SSSA 2QE5A 2QA4S 3CD6S 4ZPWR 3R8YA 1P9QC 3J7YI 3QIPB 1TK5A 1TV6A 2G4BA 3SYZA 2QZUA 3I82A 4ZS6A 3D28A 1E2SP 3HHLA 1RU1A 2UP1A 3S1TA 5EWFA 3RR8A 2HIYA 3CJ4A 3CDBA 2V67A 2MKIA 1JKHA 1YK9A 1RT4B 1IJFB 4FN5A 1GMWD 2IC3A 3A12A 4L3KA 4GC6A 5HBMB 1NMEB 3A3PB 4DHVA 1TR0A 4X65F 4ITSA 4X64F 2QL7B 2B4UA 4F04B 1XC9A 4P6QA 2W4PA 2L9NA 3GP9A 2RHQB 4OHZA 1VQSA 9ATCB 3C14B 4WE1A 2YH1A 2XMWA 5CH7B 2IPOB 1MMNA 3K59A 1IQTA 2DJWA 1URRA 3IBCB 2IDEA 4WU3A 4WFZA 2AZ1A 3CCJS 2RH3A 2LQ9A 2DH7A 2CQ2A 1WJ9A 1TKZB 5KFPA 2DYAA 2HIQA 4R8UA 3TARA 4LF9F 4CO0A 3T02A 4Y2AA 1S97A 3I0RB 2GLQA 1QE1A 4FF4A 5KFUA 4LRDA 2ERRA 2VPXB 3R7BB 2KT5A 3IS9A 2IUCA 3PYFA 3OR1B 2FJDB 3ZNJ1 4QWEA 1P1TA 4QIEA 1F1BB 3Q22A 1Q53A 3WBHA 3MMCA 2R8GA 2M4MA 4DN9A 2V8VA 3M2UB 2FB0A 4XDDA 1VQKS 4BDPA 1HWLA 1DQAA 2CZ4A 3CWJA 4OMFG 1FJEB 3Q86A 5CA5A 1UVIA 3D4JA 2HVHA 1REGX 3G4SS 3IFEA 2QSWA 4NZ7A 5LOQA 2P9GA 3IN5A 2QMUB 1IBKJ 3THVA 2QG9B 4ANEA 4ZK7M 5E3QA 2ZE2A 3RZAA 1V5VA 4DL5A 3V5RA 3DLGA 3GSIA 2YQ3A 1EP4B 3JQMA 1S6QB 3FRYA 4ECYA 2XY6A 1U24A 3OW2R 2CWXA 3RYLA 3DLKB 1WOOA 1MU2A 5C25A 3UFCX 4DDFA 3CJ3A 1WEXA 3QBCA 2YKAA 4EI2A 4KPYA 4KHRA 4ETZA 4M1KA 2HW3A 3THPA 1TUWA 1R0AA 5KG3A 4JV2A 2Y1IA 2YPZA 3HK2A 4C11B 2HNDB 3RG6A 2VBYA 4X84A 4MYUA 4CT9A 1ZOTA 2IJFA 4M5GA 1WG1A 4KHPF 2X3GA 3AOBA 1PYTA 1N5TA 3GG0A 1HLWA 2W9BB 5IC4B 2DRBA 4AL5A 4CXSA 1DLOA 4RU9A 3VR1A 2O66A 3OFGA
chains in the Genus database with same CATH topology
5GOVA 4UORA 3Q3QA 3OT9A 3NKNA 1AJBA 1ZEDA 4LQYA 4MY4A 4ZG9A 4GTZA 3B5QA 3MK0A 4LR9A 2GSUA 2W5VA 1AUKA 3WAVA 1Y7AA 1KH7A 4YR1A 1N2LA 1EW9A 5DLTA 5C66A 4NWXA 2GSOA 2W5SA 3ED4A 3TG0A 4FDJA 4CYSA 4UPIA 1EI6A 1ZEFA 1E33P 5GRRA 3SZZA 1KHJA 2IFYA 1ED9A 4GTWA 2GA3A 1ALKA 3MK1A 5L0KA 1URAA 4LR8A 3E2DA 3CMRA 4UOOA 5L0EA 4KM4A 1HJKA 4UPKA 3MK2A 3TWZA 2IUCB 3WAWA 1ALIA 1HDHA 1KHNA 3M8WA 1EW8A 3DYCA 1E1ZP 4KAYA 3M8YA 3IDDA 4ZGAA 1B8JA 3IGZB 3WAYA 3DPCA 1KH9A 1FSUA 3BDGA 3NKQA 2X98A 4LR2A 1ELYA 4ZG6A 4ZG7A 3IGYB 1ZEBA 4N7TA 3UN2A 4LR7A 1Y6VA 3T02A 3UN5A 3WAXA 5L0BA 3TX0A 1K7HA 1ELXA 2GLQA 5TJ3A 3KD8A 5IJQA 1SHQA 2VQRA 4FDIA 1N2KA 1HQAA 3UN3A 2QZUA 3T01A 5EGHA 4LRDA 3M8ZA 1KH5A 4CXKA 3UNYA 1P49A 2W5TA 5LIAA 3SZYA 1AJDA 2W8SA 4KJDA 4UOPA 3T00A 5LQQA 4MHXA 2IUCA 1E2SP 2ANHA 4CXUA 5K4PA 1KHLA 1EJJA 2XR9A 3BDHA 5LRNA 4LRAA 1SHNA 2RH6A 1KH4A 5AJ9A 5HRTA 2W5RA 5DLVA 2W5WA 3NKRA 2XRGA 2D1GA 2W5XA 3A52A 5DLWA 3WBHA 1O99A 3UO0A 4QAXA 3NKOA 1ANIA 1EQJA 3LXQA 4LREA 4UPLA 4LRCA 1ED8A 4B56A 1ALHA 1EW2A 1KHKA 1ANJA 4UPHA 5LRMA 1ELZA 4NWJA 3NKPA 1ALJA 2GSNA 3BDGB 3M7VA 1AJCA 4GTYA 4LRFA 3NKMA 2G9YA 2ZKTA 4KAVA 5KXAA 4GTXA 1URBA 4MIVA 5IJSA 5EGEA 3NVLA 1O98A 2W8DA 4CXSA 4KJGA 4TN0A 5INHA 1E3CP 4LRBA 4CYRA 3BDFA 1AJAA 2W5QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GOV A;  4UOR A;  3Q3Q A;  3OT9 A;  3NKN A;  1AJB A;  1ZED A;  4LQY A;  4MY4 A;  4ZG9 A;  4GTZ A;  3B5Q A;  3MK0 A;  4LR9 A;  2GSU A;  2W5V A;  1AUK A;  3WAV A;  1Y7A A;  1KH7 A;  4YR1 A;  1N2L A;  1EW9 A;  5DLT A;  5C66 A;  4NWX A;  2GSO A;  2W5S A;  3ED4 A;  3TG0 A;  4FDJ A;  4CYS A;  4UPI A;  1EI6 A;  1ZEF A;  1E33 P;  5GRR A;  3SZZ A;  1KHJ A;  2IFY A;  1ED9 A;  4GTW A;  2GA3 A;  1ALK A;  3MK1 A;  5L0K A;  1URA A;  4LR8 A;  3E2D A;  3CMR A;  4UOO A;  5L0E A;  4KM4 A;  1HJK A;  4UPK A;  3MK2 A;  3TWZ A;  2IUC B;  3WAW A;  1ALI A;  1HDH A;  1KHN A;  3M8W A;  1EW8 A;  3DYC A;  1E1Z P;  4KAY A;  3M8Y A;  3IDD A;  4ZGA A;  1B8J A;  3IGZ B;  3WAY A;  3DPC A;  1KH9 A;  1FSU A;  3BDG A;  3NKQ A;  2X98 A;  4LR2 A;  1ELY A;  4ZG6 A;  4ZG7 A;  3IGY B;  1ZEB A;  4N7T A;  3UN2 A;  4LR7 A;  1Y6V A;  3T02 A;  3UN5 A;  3WAX A;  5L0B A;  3TX0 A;  1K7H A;  1ELX A;  2GLQ A;  5TJ3 A;  3KD8 A;  5IJQ A;  1SHQ A;  2VQR A;  4FDI A;  1N2K A;  1HQA A;  3UN3 A;  2QZU A;  3T01 A;  5EGH A;  4LRD A;  3M8Z A;  1KH5 A;  4CXK A;  3UNY A;  1P49 A;  2W5T A;  5LIA A;  3SZY A;  1AJD A;  2W8S A;  4KJD A;  4UOP A;  3T00 A;  5LQQ A;  4MHX A;  2IUC A;  1E2S P;  2ANH A;  4CXU A;  5K4P A;  1KHL A;  1EJJ A;  2XR9 A;  3BDH A;  5LRN A;  4LRA A;  1SHN A;  2RH6 A;  1KH4 A;  5AJ9 A;  5HRT A;  2W5R A;  5DLV A;  2W5W A;  3NKR A;  2XRG A;  2D1G A;  2W5X A;  3A52 A;  5DLW A;  3WBH A;  1O99 A;  3UO0 A;  4QAX A;  3NKO A;  1ANI A;  1EQJ A;  3LXQ A;  4LRE A;  4UPL A;  4LRC A;  1ED8 A;  4B56 A;  1ALH A;  1EW2 A;  1KHK A;  1ANJ A;  4UPH A;  5LRM A;  1ELZ A;  4NWJ A;  3NKP A;  1ALJ A;  2GSN A;  3BDG B;  3M7V A;  1AJC A;  4GTY A;  4LRF A;  3NKM A;  2G9Y A;  2ZKT A;  4KAV A;  5KXA A;  4GTX A;  1URB A;  4MIV A;  5IJS A;  5EGE A;  3NVL A;  1O98 A;  2W8D A;  4CXS A;  4KJG A;  4TN0 A;  5INH A;  1E3C P;  4LRB A;  4CYR A;  3BDF A;  1AJA A;  2W5Q A; 
#chains in the Genus database with same CATH topology
 1U1N A;  2B6A B;  2ZH2 A;  4P7T A;  5KFY A;  1PSD A;  1UVJ A;  3DGV A;  2W8L A;  1S7H A;  4OI3 A;  1JLQ A;  2YNI A;  2OEM A;  7FD1 A;  1QJH A;  2AEF A;  2I8E A;  1LFP A;  2EC2 A;  3C6T B;  4LR8 A;  3CCR S;  3DFE A;  1M5S A;  2ZH5 A;  4X4U A;  5CYQ B;  4ZKA A;  1RT1 A;  1RQ0 A;  3WAY A;  1S1X B;  2FDN A;  3BSA A;  3P5T L;  5EDW A;  3HM9 A;  5KT6 A;  2MGZ A;  4GKK J;  1Y6V A;  2QL5 B;  2ALY B;  2BJD A;  1FJG F;  5ETV A;  4DV2 J;  4JI2 J;  4C8Y A;  2OFG X;  2PFF B;  3PW7 A;  4G6V B;  4Q0B A;  4K4W A;  4MK7 A;  3WX4 A;  4BC9 A;  3EGV A;  3HPO A;  2EXU A;  2F9D A;  2N7Y A;  1NK0 A;  3SCI E;  1QD1 A;  4Q2L A;  2LEP A;  1MSW D;  5DDR C;  4WFN Q;  3QT7 A;  4AFF A;  4LJM A;  4OI4 A;  5F3T A;  2WVB A;  2DB1 A;  4IFV B;  1XR5 A;  4PXB A;  4IH7 A;  1X5T A;  4LIW A;  2Y1R I;  4QR2 A;  4ZPC A;  4M5D B;  4NRT A;  2BA9 A;  3J7Y U;  1JLE B;  3C3L A;  2IAJ B;  2IVF B;  3WX8 A;  3QID A;  3IO1 A;  3OFF A;  1VK3 A;  1U2C A;  2JH3 A;  1MWZ A;  1TL7 B;  1F5B A;  3DLJ A;  2RIJ A;  3NRB A;  3TA2 A;  3MM6 A;  3R5G A;  4B3S F;  2RNE A;  3KJV A;  2B9Y A;  4F02 A;  2HYI B;  2WB4 A;  1HNI B;  1P49 A;  3QQC D;  2ANH A;  5KFM A;  4HAC B;  5H9F K;  1EJJ A;  1VQY A;  3KG4 A;  2G2Z A;  4QCL A;  1PJ6 A;  3GFX A;  1HNX J;  4P52 A;  4DR2 J;  2HGN A;  2F4V J;  3EUN A;  3NGS A;  3QAT A;  2KB2 A;  1LWC A;  1TFY A;  3F44 A;  3GIL A;  1WHX A;  1FT8 A;  3NGD A;  4IDK A;  1CPZ A;  5B7W A;  4Z37 A;  5KXA A;  4P2M A;  4IFY B;  4TN0 A;  1Y5N B;  4JV1 A;  3OT9 A;  4HI2 A;  2CAD A;  2RDI A;  2F1F A;  3W7B A;  3HI9 A;  4L72 B;  5DLT A;  3KK1 B;  1SC3 B;  5D6G A;  4NLP A;  4B17 A;  3CPW R;  4TLQ A;  1TK0 A;  1VRT B;  3NOG A;  3ILJ A;  2CZ9 A;  1S0M A;  1Y9O A;  3CE8 A;  3HHL B;  3PTW A;  4IUF A;  4EU0 A;  1JKH B;  4OZ1 A;  2NSB A;  2LU2 A;  1WC6 A;  4OHX A;  3HMJ G;  1SC6 A;  2QMX A;  1XMB A;  1UFL A;  1DUR A;  1FX4 A;  1LW2 B;  5IJQ A;  4ED7 A;  4LFA J;  5EN1 A;  4OYB A;  1XEZ A;  1HR0 F;  3Q89 A;  5HRT A;  2DY9 A;  4WK3 A;  2GMJ A;  2UXD J;  4M5H A;  2GA7 A;  1ANI A;  3EX7 B;  4X66 J;  1HNW F;  1U49 A;  2R7U A;  1JJH A;  1ALH A;  4DFP A;  4P74 A;  5H9E K;  1X0P A;  4LRF A;  2GCF A;  2IM1 A;  4K5R A;  1YIJ S;  1N5V A;  1T94 A;  2AV5 A;  5KFL A;  2FZC B;  1G2E A;  1R3N A;  3HT0 A;  2EW9 A;  1FKA F;  1RLC L;  3TUI C;  4R8U B;  2YH0 A;  3JXO A;  5C24 A;  5AE1 A;  2AHO B;  3SCK E;  3Q8P B;  3IP0 A;  4OYI A;  3DC2 A;  3PEH A;  3IS9 B;  4M5I A;  2IUC B;  2RRA A;  2IDL A;  2PMZ D;  2GO9 A;  5DGB A;  4ENO A;  2MQM A;  3CSK A;  2V34 A;  2X51 A;  4HDG A;  3MMC B;  1S1T A;  2HBR B;  5KG5 A;  4DPY A;  1GEH A;  3NAH A;  5J2Q A;  4Y2I A;  5DLV A;  3I5C A;  4DV7 F;  3GIK A;  4CLT A;  2A1B A;  2HQF A;  4ED4 A;  3WIU A;  4RKU C;  4LFC F;  2YX4 A;  1I3O B;  4FZV A;  1FJ7 A;  2DR9 A;  4JB8 B;  1RWP B;  1HQ2 A;  3BSO A;  4LT6 A;  2R2U A;  5IXU A;  4MT1 A;  4NPO A;  2BKP A;  1HW9 A;  2CQH A;  2ZE2 B;  4C2M A;  1PKU A;  2M3D A;  5EUH A;  4ZA1 A;  3MFH A;  1KH7 A;  1F9E B;  4OYA A;  3M8P B;  2DHG A;  2HHP A;  1YIT S;  3P49 B;  3TG0 A;  2LQ5 A;  1H2U X;  2E66 A;  2GIQ A;  3P5B P;  2EWH A;  1NDC A;  1B7Y B;  3BDP A;  1XQI A;  1R0A B;  4DV3 F;  2AW0 A;  1MML A;  2EFP A;  2HEK A;  4A8Q A;  4DF8 A;  1KH9 A;  4MMO A;  3GV5 B;  3L4B C;  2BOA A;  1IWG A;  2FY8 A;  1MWQ A;  3UN5 A;  2NUU G;  3MCS A;  3QT8 A;  2Y9H A;  1EX8 A;  1TL4 A;  1LV5 A;  4DBQ A;  1EHW A;  4GKK F;  3SXL A;  2RML A;  4W90 B;  4DU7 A;  1DLO B;  4DV2 F;  4UTG A;  3PFO A;  4JI6 J;  1S9G B;  2XWY A;  4JI2 F;  3PVX A;  2ZH7 A;  4FVM A;  5LSL A;  1FKP B;  1JLQ B;  2YNI B;  3UPF A;  3IRX B;  1RTI B;  4OJ1 A;  5DS7 A;  5F8J A;  3R27 A;  1CQN A;  1RT5 A;  2XBP A;  4DOZ A;  9RUB A;  1E3C P;  4ERD A;  3D0I E;  4DX8 H;  2ZHA A;  2AJQ A;  3MTK A;  1RT1 B;  4F36 A;  4HTJ A;  2XGP A;  2MXY A;  2WOM A;  3D9B A;  5KAK A;  1X8D A;  1JXV A;  1YRT A;  1WKJ A;  1VR6 A;  2BW7 A;  3CED A;  1EQM A;  2H4Y B;  3CCT A;  5LMU J;  3M8W A;  3M8Q A;  4CLZ A;  3CNQ P;  4YS2 A;  3K57 A;  4MKB A;  4NYO A;  1WF1 A;  3POT A;  4M95 A;  1G6B A;  3WAX A;  1HBU A;  3MM9 A;  4Y34 A;  5DG8 A;  2A6M A;  4WP9 A;  3PXG a;  3MAA A;  4A8K A;  4GVB A;  1KH4 A;  3BGR A;  4KC5 A;  3KHL A;  3HSJ A;  2HRU A;  3PO5 A;  3N0V A;  2MZS A;  2QRR A;  1R6V A;  3JQJ A;  4WYW A;  2XS7 A;  1Q4R A;  1H72 C;  4FBU A;  4DR2 F;  5DG7 A;  2F4V F;  4KY3 A;  4GTX A;  1OY9 A;  2HFU A;  3TUJ C;  4YB5 A;  2FHM A;  3AB4 B;  5HO4 A;  3H20 A;  2HUR A;  3MM6 B;  5F8N A;  4ELV A;  2B51 A;  3AD9 C;  2CG8 A;  1Q8K A;  4RO0 A;  4Y28 C;  3KJV B;  1SKS A;  4RW8 A;  4UZB A;  4OI1 A;  3F73 A;  2XI2 A;  1RU2 A;  3WAW A;  2PE8 A;  4NX9 A;  3KHR A;  1NHU A;  1EW8 A;  4H4K A;  1SCJ B;  4N77 A;  3OTC A;  3H5U A;  2QN6 B;  3DPC A;  2GHW A;  4RPF A;  2BV3 A;  2DNQ A;  2YKM A;  3ILO A;  1LWC B;  1Q7Y T;  2DGW A;  3H0P A;  3OTE A;  2XMK A;  4YHH J;  1R31 A;  5GAE U;  4NYP A;  1ZM2 A;  5DLW A;  3C66 A;  2HG4 A;  3BH6 B;  4LFA F;  2CJY B;  4C8Z A;  3BO3 A;  1Y0H A;  4UOH A;  4JYA J;  3QZ7 A;  3W9H A;  3BR9 A;  3T5J A;  3CD0 A;  4PWD A;  1URB A;  4KGX B;  4X66 F;  2MB0 B;  3CJ5 A;  5EHH A;  3EZ5 A;  3CO9 A;  1C4C A;  1RA6 A;  1EAR A;  3VAI A;  3IM8 A;  7FDR A;  2HHX A;  2GSO A;  5L46 A;  2E7V A;  3RAQ A;  2QGF B;  4I2Q A;  5L0K A;  1A9N B;  4TU7 A;  3V2U C;  3IG1 A;  3PYE A;  3LAN A;  3HKW A;  3OTB A;  1PYO B;  1BLU A;  5KFV A;  4OZ3 A;  3HX9 A;  2AIR B;  2DEI A;  2ZEJ A;  3V6H A;  5M2U A;  4HEA 9;  1D9A A;  5GMD A;  1CQM A;  2J9D E;  3CF5 Q;  1WSV A;  1W7W A;  2XY7 A;  5B0D A;  5LM7 E;  3NOC A;  2G1D A;  3NGK A;  3BBC A;  2OPS B;  2Y0S D;  1RCX B;  4YQW A;  3T1H F;  2F8H A;  2F8E X;  1RAD B;  2R4F A;  2GHV C;  3T6J A;  1IR0 A;  2JSX A;  3LGN A;  1T3O A;  2W2O P;  2WRM A;  5ETS A;  3BDG B;  3K17 A;  3VZH A;  2XLI A;  2HHT A;  3U02 A;  5L1L A;  3Q2T C;  2F9J A;  1HWK A;  3V4I A;  2DGV A;  3KUH A;  3MCN A;  3ILI A;  3LUY A;  4KIA A;  1E6V A;  4L3N A;  2W5S A;  1KD1 T;  1U8W A;  5D77 A;  3DRS A;  1OPZ A;  3KJQ B;  3P3D A;  3RJM B;  1URA A;  4M94 A;  3IAM 9;  1UFK A;  4URG A;  3PEJ A;  4OI0 A;  1KHN A;  2WSC C;  2PFD A;  2W7P A;  3PZP A;  4DXL A;  1N6Q A;  4M63 A;  3US5 A;  4F0K A;  4OYZ A;  2GJF A;  2CZV C;  4NA3 A;  3U1L A;  1FJC A;  4KPC A;  3MEC B;  5KFX A;  1NJI T;  2FVC A;  1NH8 A;  5E3R A;  3HUL A;  4NLO A;  4DV4 J;  1WC1 A;  3LO3 A;  3KK2 B;  4ZVH A;  1LWF A;  3FMB A;  4JI1 F;  2R7X A;  4RUB A;  2P9E A;  2OD6 A;  1ZM4 A;  1C0T A;  4K2X A;  4QBU A;  1FFW B;  3EDQ B;  2RDJ A;  4JI6 F;  3LWL A;  3M6X A;  1VQ7 S;  4EO8 A;  5HSP A;  5FII A;  3FSI A;  5HQM A;  2EBG A;  1BWE A;  1U6B A;  4NCG A;  4F4X A;  3B5Q A;  2UVR A;  1EKR A;  3PM9 A;  5AT1 B;  1QLN A;  4I6W A;  1S6P A;  2GQC A;  4GO7 X;  3GLJ A;  1M5H A;  3GII A;  2M0G B;  3TVY A;  3RRG A;  4ECT A;  4AL7 A;  1H38 A;  3DU5 A;  2NS1 B;  5D0H A;  4LQ9 A;  1Q95 G;  3SIP B;  2FC9 A;  4UY8 T;  1FRJ A;  2PN6 A;  1N32 F;  4TU9 A;  2VFV A;  1FDA A;  5DZ7 A;  4LF6 J;  2H4W B;  2NSC A;  1MW7 A;  2AX0 A;  3FUY A;  4RW4 A;  1S5Z A;  4NI2 A;  4OX7 A;  4DEZ A;  1RT5 B;  2ZBP A;  3AOD A;  3W9I A;  4I68 A;  4YUD A;  2QA4 G;  4OYO A;  3MEE B;  1DBD A;  1YX2 A;  2X1A A;  4MKY A;  2WVF A;  4OIX A;  3Q24 A;  1HBO A;  3ZZ0 A;  4USK A;  2VBX A;  4ATN A;  2RAQ A;  4EMD A;  4KBI A;  3G6V A;  3OTO J;  1FD8 A;  1V6H A;  2WOM B;  2HS4 A;  1ARO P;  1VQ6 S;  1XWL A;  2LKZ A;  3JSM A;  3PJW A;  2YVS A;  4LRB A;  4CYR A;  4FPI A;  3NKN A;  1Y5L B;  3M8Q B;  2FZK B;  3HVR A;  4O4R A;  1I6J A;  4Q8F A;  3POT B;  4N41 A;  5F8H A;  1X4G A;  1SKU B;  1HBU B;  4X4T A;  1CC8 A;  2B7B B;  3R7N B;  1QSS A;  3WDO A;  1UVM A;  3EYZ A;  4KE5 A;  3RB6 A;  4IG3 A;  4NE9 C;  4NXN J;  3DRP A;  4PWU A;  1SV5 A;  3BBB A;  1KQF B;  4ECX A;  4HI1 A;  1F9H A;  1ELX A;  1NCL A;  4KGZ B;  5J2P A;  2R42 A;  2GV1 A;  4J91 A;  4CO3 A;  3DOK A;  4LF8 J;  3PW4 A;  3W3S A;  3U1M A;  2E1P A;  4CP5 A;  4U8V A;  1N4L A;  5F8L A;  3QNW B;  4QQB A;  1QM9 A;  1JLB A;  1RT6 A;  1NLK L;  3GCW P;  1TL3 A;  1WC4 A;  4IQM A;  2R3V A;  2Q1L A;  3VV2 B;  4ZN1 A;  4P73 A;  1Q8B A;  2V4R A;  1NPK A;  1NJW A;  2FC8 A;  3VCD A;  5CXT A;  3CJT A;  2MKS A;  3K58 A;  1Q78 A;  1VHF A;  2LXI A;  4HDH A;  3VAK A;  1M5P C;  1SL1 A;  4IOC Q;  1FX2 A;  2YKM B;  1ZPW X;  2UUB J;  2J0X A;  3JTN A;  2LQB A;  2JDJ A;  1YJV A;  1RHR B;  3MM8 A;  3J80 U;  3UDE A;  3W5Y A;  1NHK L;  3QGH A;  4Q5V A;  2LXU A;  5JXS A;  3HCX A;  4FNH A;  2XMT A;  4UOC A;  4LR7 A;  3LTO A;  3LP2 A;  2AGQ A;  1K8A T;  2OAU A;  2EVZ A;  2F8M A;  2F3J A;  4W98 A;  2ATL A;  3P6Y C;  2R8J A;  2FLL A;  4PWD B;  1XNQ J;  5KFG A;  2VKZ G;  3TAM B;  1KLM B;  1HQE A;  5B0F A;  3C2P A;  1DHM A;  2KH9 A;  1YHQ S;  2W9C A;  5JVH Q;  3DOM A;  5CYM A;  4L74 A;  2JX2 A;  3G87 A;  4EZ6 A;  3D3B J;  3PY8 A;  4NXM J;  2OEK A;  2ZDP A;  3AFG A;  1FEH A;  4IH5 A;  2UUA F;  5CD4 A;  4FS1 A;  1B0T A;  5LXR A;  1JXL A;  3FRZ A;  3MK0 A;  2V2V A;  2BE2 A;  1RAF B;  2CPX A;  1RIS A;  1K1S A;  4ZCM A;  2CRL A;  2GAH C;  4X4O A;  4ECZ A;  3QGP A;  3I56 S;  4N56 A;  4O3P A;  1DTQ A;  2K7J A;  3BYP A;  4PPD A;  3I4P A;  1OQ3 A;  3G82 A;  3M8Y A;  4G65 A;  3GIM A;  4ECU A;  1X9S A;  5J2M A;  2AYM A;  1ELY A;  3M1V B;  2J6U A;  5KFB A;  1FES A;  3OHB A;  3EPG A;  1RT3 A;  2ZH8 A;  2KXN B;  3HFV A;  1SKR A;  4F4A A;  1RWU A;  3D6M B;  2M9K A;  1ZH5 A;  2O1P A;  3EIC A;  1GXL A;  4F25 A;  2AEJ A;  1LWX A;  1F5A A;  1KP6 A;  2A3J A;  3TYT A;  3V4I B;  5IT9 Y;  3UO0 A;  2AYG A;  1NK9 A;  4IG0 A;  3H7H B;  1CVJ A;  3MGJ A;  4DV4 F;  1DQ8 A;  4O4G A;  2DPI A;  2BZ2 A;  1FCA A;  4X4Q A;  4CZC A;  3AT1 B;  1ZET A;  5D0E A;  1NO8 A;  2YKN A;  3ZZT A;  5E5N A;  3QPI A;  1NHV A;  1ZED A;  2VJU A;  1OSC A;  4CO1 A;  2U1A A;  3IWN C;  2VD3 A;  4ZVG A;  1JNR B;  1X4D A;  2PD1 A;  3U27 A;  3HHL C;  1F3F A;  3AD7 C;  5KFZ A;  1R6Y A;  2V8H A;  4FS2 A;  1QAY A;  2F4F A;  5IM0 A;  3AQO A;  2EI5 A;  3OR2 A;  3BGU A;  4I6A A;  4USV A;  2AZ3 A;  4KM4 A;  4ED0 A;  3S01 A;  4DV0 J;  1LEO A;  4A8F A;  2DNY A;  2Z8Q A;  3GR0 A;  3Q8U A;  2DHA A;  2Z30 B;  1HFE L;  1TKX A;  1LWF B;  2FUG 9;  2MZR A;  4J9S A;  4K0K F;  1IUJ A;  5ETM A;  2NUH A;  4KH1 B;  2KXF A;  3NEK A;  1X9W A;  2YNF A;  5A6P A;  1IKX A;  5DG9 A;  1GH8 A;  4WJB A;  2YKP A;  2ZD1 A;  2L08 A;  3O8W A;  4NCG B;  1GQE A;  2HQD A;  1OQ6 A;  2HFN A;  4ZP8 A;  3KLF A;  1RGV A;  1GMW A;  2LA4 A;  1ZZF A;  3SCL E;  1S6P B;  5K9F A;  5BYQ A;  3D1H A;  4DR4 F;  4O3R A;  1N56 A;  2EK1 A;  2Z2L A;  1UAW A;  3W63 A;  2HRY A;  3KG1 A;  1PO6 A;  2E1A A;  4J7C A;  1HWI A;  5LL6 d;  3EGZ A;  3ENQ A;  3G86 A;  4Y2M A;  5K14 B;  4OV6 A;  1WSR A;  2P5V A;  2VG7 A;  4USI A;  2CQC A;  2GGP A;  3L9Z A;  1RWO B;  4KJI A;  3DLB A;  2FJB B;  4RW4 B;  1K73 T;  1ZPV A;  2OPQ A;  1B8J A;  1RWX B;  1JX4 A;  2CPI A;  4U96 A;  1E6Y A;  3OQ2 A;  4DR1 F;  4KGK A;  2OPR A;  2RD5 C;  4P72 A;  2M88 A;  1B4S A;  2YX1 A;  3KD8 A;  3KMS A;  5F8G A;  4DZ6 A;  1VI7 A;  1NRK A;  1SIZ A;  1YZ6 A;  3UDL A;  1JWW A;  5H9F J;  3JSM B;  3PKM A;  2HHH J;  4PAB A;  1JLG A;  1FI4 A;  5BR8 F;  2JVR A;  4IRC A;  4HHH A;  5KFO A;  3SQG A;  4N76 A;  3FVY A;  1JJC B;  5HQ8 A;  3Q0A A;  1J27 A;  4GVL A;  4IG3 B;  3ET6 B;  3CW2 C;  1SC1 B;  3DRP B;  1RWW B;  3RBX A;  2NXN A;  4FYD A;  2QLB B;  5J2P B;  3UDC A;  2YWE A;  2BUN A;  2HZA A;  2MJU A;  2MY8 A;  2CNL B;  3QRR A;  4JV0 A;  2UUB F;  2ZVS A;  1NKC A;  2C3M A;  2CQB A;  1U02 A;  2YPY A;  3RGI A;  2VDH A;  1DY3 A;  3QMQ A;  3C6U A;  1JLB B;  1RT6 B;  1T0T V;  4TQR A;  1IM4 A;  1TL3 B;  3AHP A;  5DQG A;  1ICE B;  2WB1 D;  3PFE A;  3G8T A;  2ZOF A;  1HW8 A;  1O5J A;  5ETP A;  4Q45 A;  4ZVP B;  1FD2 A;  3CD7 A;  1KFD A;  1ELZ A;  2JEI A;  1UPM B;  5H9E J;  4DMZ A;  1KHW A;  2ILY A;  3P4U B;  3FQL A;  3JYT A;  4ID5 A;  4NXM F;  3BRE A;  1V3S A;  2IM3 A;  3FZB A;  4LBI A;  3LW5 C;  2B7C B;  4DV1 J;  3C19 A;  4XPC A;  2KHD A;  2B8P A;  2JJ4 D;  5KT4 A;  2C2K B;  3E2D A;  4TLR A;  1CG2 A;  2ZHO A;  3CJK A;  5DM6 Q;  3PKY A;  2M2B A;  2YQ0 A;  1VC0 A;  1CSJ A;  1UTA A;  2V68 A;  2QYC A;  1HQE B;  3DMJ A;  1PIE A;  2W9C B;  2CQD A;  4J9L A;  1U1M A;  3DOM B;  3H42 A;  1HQU A;  4J9R A;  3IR7 B;  1MNE A;  2NR0 A;  1X5O A;  2AGO A;  4Z7Y A;  4A8Y A;  5CYM B;  2HBY B;  1NBE B;  2E5J A;  4QZV B;  2DNO A;  2UXB J;  1M1K T;  3MUT P;  1GFW B;  4FXD A;  2V69 A;  1TVR A;  5G0R A;  2CUY A;  2BE2 B;  4YP3 A;  3IWL A;  2I5J A;  1Z2L A;  2VC0 A;  5GAG U;  4QWC A;  5A0Y B;  4EK2 A;  5IJS A;  1DTQ B;  4JV5 J;  1VQ4 S;  1YJR A;  2BBE A;  1X0F A;  1AYE A;  2WHO A;  3QRQ A;  1V3R A;  2XM3 A;  1Y00 A;  3G82 B;  2OPP B;  3T3F A;  2IA0 A;  3OSN A;  1C1B A;  5GVQ A;  1VGY A;  1ZA1 B;  1RT3 B;  3TQ1 A;  4DSJ A;  4FF1 A;  1RKI A;  4LF7 J;  2RHS B;  3CCZ A;  3Q2S C;  3QSI A;  4U7U K;  1P1L A;  5KG0 A;  4IG0 B;  1VQO S;  3G8Q A;  4NZ0 A;  2CA9 A;  4J9U E;  1SPB P;  4O4G B;  1VQP S;  3NCR A;  5AJ9 A;  2V5H G;  2NPF A;  4HT7 A;  3G6E S;  2E5L J;  3GZ7 A;  2YWH A;  2G13 A;  2YKN B;  2HQC A;  3NGU A;  1BQM A;  1OY6 A;  1TMM A;  1HI1 A;  2AP6 A;  2MQO A;  5IM0 B;  1Q7L B;  4WXO A;  3OR2 B;  2JEG A;  2CPE A;  4CT8 A;  1CJU B;  4E2F B;  5HRO A;  5SZT A;  1CS4 B;  3H25 A;  5KT7 A;  4UOG A;  4MH8 A;  3KHH A;  1OS5 A;  1PCA A;  2R8H A;  1TKX B;  2V8G A;  1ZM9 A;  5A2Q Y;  2VPY B;  1WOS A;  3KDN A;  1D1U A;  1U2R A;  3QLH A;  1X4H A;  4Q2M A;  3QGI A;  2ACY A;  3J7A 1;  2D9P A;  1ALI A;  4NRU A;  3LH2 S;  2YWK A;  5KFN A;  4N8O A;  2B56 A;  1IKX B;  3ZZZ A;  1WUU A;  1HYS A;  2X98 A;  2ZD1 B;  1N5Y A;  1UMJ A;  4NA2 A;  1S12 A;  3EVM A;  4ED6 A;  5F0W A;  3MR2 A;  3CMA S;  4DSK A;  3KLF B;  4B3R F;  4AE5 A;  4LVN P;  2DGT A;  4DQR A;  2R7Q A;  3EVO A;  2KG1 A;  1OYD A;  3THT A;  3JB9 k;  5EWE A;  2VFU A;  2B9W A;  4ZCI A;  4RNO A;  2LEA A;  5IWA J;  4KV8 A;  2C2Z B;  4K5S A;  2JZ5 A;  1SI9 A;  4KGV B;  3FKB A;  1PC4 A;  4F2S A;  2VG7 B;  1KQS R;  2MZQ A;  2GGP B;  4FYY B;  5M2R A;  2IRU A;  4C4W A;  4PXE A;  3N6L A;  4B08 A;  2M8D B;  1N2L A;  1OPI A;  1E6Y B;  1F2H A;  4K59 A;  4JI4 J;  5KFF A;  4N47 A;  2D9O A;  1KHJ A;  2XG8 A;  2YNH A;  5LT5 A;  2XLK A;  1HDH A;  2BM0 A;  4Z2X A;  1SIW B;  2V4J A;  1A0O B;  3EM1 A;  5DO2 A;  1APS A;  4FYW B;  3MED A;  4PYD A;  1WC0 A;  4RBT A;  4I56 A;  2EFV A;  1Z1Z A;  3GV7 B;  1K7H A;  4USJ C;  3PR5 B;  3KYL A;  4TN2 A;  4E98 A;  3FQK A;  5KG1 A;  3M05 A;  3FMW A;  3W2W A;  2CFX A;  5C2G A;  1A7G E;  2H5J B;  1B3T A;  3UCZ P;  3A3N B;  3MM7 A;  2FPH X;  1FXR A;  1RTH A;  1HD1 A;  3D1O A;  4LF5 F;  4OQJ A;  4QW8 A;  2RB7 A;  4C0O C;  3CDW A;  3D5M A;  4DCO B;  4I64 A;  1CUL A;  2R7R A;  3D0G E;  2XMM A;  5AJ3 J;  2ADB A;  4UPH A;  5KT5 A;  2WBR A;  4X4P A;  4PG5 A;  3KK3 B;  3GTY X;  2AT1 B;  3FJ2 A;  2Y8W A;  1P6T A;  2ZH9 A;  3L7U A;  2DNN A;  4UOR A;  4PG4 A;  3PHE A;  3MCO A;  1K0V A;  2HQ3 A;  1RE1 B;  1Y3K A;  5D0G A;  2W4C A;  1U45 A;  1LXJ A;  4HLB A;  3ITH A;  4IR9 A;  4ZLJ A;  1R89 A;  4WFX A;  3C6U B;  3VZI A;  4JI8 J;  4DR5 F;  5ETQ A;  5KG2 A;  5E33 A;  4KAI A;  3MK2 A;  1K44 A;  3MI7 X;  5KOX A;  4MIB A;  4DV1 F;  2CQ0 A;  2KM8 C;  3AXK A;  4UF4 A;  1IR2 A;  3CUL A;  3G6X A;  4ZLL A;  3CTR A;  1DTT A;  2JLE A;  4QPT A;  1SKW A;  4PXC A;  4CO5 A;  5L0E A;  2FQQ B;  4WKR A;  3LGM A;  2EK6 A;  1HWJ A;  2CJB A;  5IQ6 A;  3BF4 A;  1EKS A;  4OYW A;  3L7P A;  1YJ9 S;  4CRJ A;  8ATC B;  3JYT B;  2KFZ A;  3TVK A;  4ID5 B;  3DXB A;  2MKY A;  2VUG A;  1S77 D;  3KLI B;  2XGQ A;  1WAC A;  3I5A A;  4AXJ A;  5C2C A;  1C0U A;  4HYK A;  4ZP7 A;  3DKD A;  3E8O A;  3HT3 A;  1KDN A;  1WF0 A;  3DI6 A;  2KKH A;  1FDN A;  3VVT A;  4JV5 F;  2VBZ A;  1PBU A;  3QJL A;  2XEX A;  3DMJ B;  3JAM U;  2IMW P;  1FVQ A;  3NS6 A;  2D3O R;  2V63 A;  1AZS B;  3RBZ A;  1EET A;  2VA2 A;  1NKE A;  1UEV A;  2LCW A;  4C8L A;  1CJT A;  1K0T A;  3DYA B;  4WK1 A;  1VLO A;  1JLC A;  2KZM A;  1TVR B;  5B0G A;  3KHG A;  4KH0 B;  4NLD A;  4OX8 A;  2MQN A;  3HO1 A;  2I5J B;  1Q79 A;  4ECQ A;  4YME A;  2W1B A;  3CD5 A;  5J1E A;  1HHT P;  3J81 j;  3KLH B;  4L73 A;  5F3Z A;  4F67 A;  2FYX A;  3MD3 A;  5EX3 A;  5E7O B;  2E5L F;  5HMX A;  4H4K C;  1R8H A;  1KKH A;  1C1B B;  2BKN A;  3X1L B;  2AYE A;  4KJG A;  4F3M A;  1NJZ A;  4B9N A;  4O3O A;  4U6P A;  2D74 B;  3Q3Q A;  1NSK L;  3FDS A;  4DX6 A;  3KJN B;  2W5V A;  1AUK A;  5L1J A;  1S6O A;  2VU5 A;  1DZ5 A;  1RT2 A;  1NND A;  3VGV A;  2HBQ B;  3ZC4 A;  4L6V 3;  4G3I A;  3PIO Q;  2X3D A;  4M5J A;  4OYX A;  2Y1L B;  2WTF A;  4XK8 C;  3IM9 A;  2G0C A;  1E1Z P;  3BYR A;  1X9M A;  3CDA A;  4B3M J;  2ZNY A;  4PUO B;  1BQM B;  2J0W A;  4J9V A;  2GNK A;  4ZMM A;  1JLF B;  3NG8 A;  2UXC J;  2MQL A;  5K4P A;  1RSC A;  2I0X A;  4ZVF A;  3MEK A;  3PIP Q;  3A52 A;  3O2I A;  4RZR A;  3B54 A;  2X1F A;  5HRO B;  1REV A;  2W01 A;  2MY7 A;  3D3C J;  1VBX A;  2PEH A;  2ZKT A;  2X1B A;  4WIQ A;  5CQG A;  4RW9 A;  3QLH B;  3SEO A;  1CEZ A;  2KVI A;  4LQY A;  3FBB A;  3VGT A;  1CC7 A;  3DGP A;  3R1H A;  4CH7 A;  5HL7 Q;  1N5Y B;  4QW9 A;  3Q83 A;  5DGA A;  1U47 A;  5CHC B;  2CDR B;  4YY3 F;  1N36 F;  2LDY A;  3ZXW A;  1MMD A;  4LVO P;  4DS5 A;  3R1L A;  2CXE A;  3TZX A;  3DM2 A;  4LMZ A;  4NLU A;  1IQZ A;  3Q8Y A;  3G71 S;  3ZTS A;  1ZBT A;  3GJR B;  3CC7 S;  2VIH A;  1EIY B;  2MKJ A;  3G8S A;  3HHD A;  3G6Y A;  3SZ2 A;  3H2L A;  5LJ3 Y;  3Q8Q B;  4AQY F;  1FTC A;  3EXC X;  2DR5 A;  1S48 A;  6FDR A;  2MJN A;  3T1A A;  4W92 B;  1Y3J A;  4QAX A;  2ROG A;  3IA0 A;  1N5S A;  4ZHR A;  3GIJ A;  4ZVS B;  1ZAW A;  4DQQ A;  1ANJ A;  4ETX A;  4RUA A;  1IR1 A;  3UDV A;  1SQE A;  5HVF A;  1KFS A;  1F6T A;  4ES3 A;  4WKY A;  3D0H E;  2C28 A;  4A8S A;  1UPP A;  5KFD A;  4NLQ A;  1X5S A;  2PA8 D;  3ULH A;  1WTF A;  2V4J B;  1SL0 A;  4DX7 A;  1YLX A;  3TJ9 A;  2ZH4 A;  2WVE A;  1NU4 A;  3MED B;  4RW6 B;  2HS3 A;  4EWT A;  2Z56 B;  1RAB B;  2IM2 A;  2GQ2 A;  3UR3 C;  1N34 J;  2HRT A;  2HGM A;  2QFI A;  3W2W B;  4A8O A;  3TAN A;  2XHC A;  3MM7 B;  4GKJ J;  4N5S A;  1T3N A;  1VQ8 S;  4JI8 F;  1SBR A;  5FLX U;  2OSQ A;  4LSL B;  2BDP A;  3OSP A;  4DV6 J;  4DX5 A;  2RF2 A;  4BC7 A;  3L95 X;  1AFI A;  1VIO A;  3BO2 A;  1FNO A;  4EUV A;  1W25 A;  2C3U A;  4RW7 B;  2BR0 A;  2WAQ D;  4H4M A;  1BXN A;  3KTQ A;  4FP9 A;  5L9N A;  2LXF A;  1BGX T;  2MEW A;  2YWG A;  3G9C A;  1CJK A;  3DRR B;  2QO3 A;  2B4O A;  3KLE B;  4RX6 A;  1IVZ A;  4LUB A;  1T9U A;  3VWS A;  2OUG A;  3GWC A;  1XTZ A;  3ETM A;  1JJ4 A;  3LP1 A;  3QWU A;  3QYY A;  2WZ1 A;  3I0S A;  4NWX A;  3QO9 A;  2BE7 D;  2HHU A;  1DTT B;  4IH6 A;  1X4C A;  3F56 A;  1VK8 A;  2HHS A;  1HBM A;  1B99 A;  2ZIT A;  2NCK L;  3NL0 A;  1J5E F;  3ELH A;  1IKW A;  2VC1 A;  3LQV A;  2VG6 A;  2G1H A;  2IVY A;  3RAX A;  1XK8 A;  1D9F A;  4PQA A;  2D41 A;  1VCT A;  4UST A;  1S10 A;  4PAA A;  1SJF A;  1PAU B;  1RAA B;  4F4Y A;  2EC0 A;  3DDK A;  3HSD A;  3CDU A;  2RUS A;  2N3O A;  1PJ5 A;  3AAW B;  1S4E A;  4I7F B;  2E7W A;  4DLE A;  3MPW A;  3R7S B;  3LPY A;  3W5X A;  2W2N P;  1TKD A;  3TZZ A;  2BJE A;  4HT5 A;  1NSQ A;  1VS3 A;  3J81 U;  2MTL A;  3I31 A;  2I1R A;  1ZYQ A;  3T5L A;  4ZIV A;  3OLB A;  3R2D J;  1EET B;  2V2Q A;  3BGO P;  4NLR A;  1YDL A;  1S9F A;  1IJE B;  5KFK A;  2B0G A;  4EYI B;  3LAK A;  1CJT B;  3K7R A;  4OJH A;  1N33 F;  5A8W A;  1QDU B;  2AF6 A;  1JLC B;  3PJ9 A;  4V19 J;  1UWB A;  2V9W A;  5GRR A;  1AA1 B;  5E3C A;  5I4M A;  3GYN A;  5KFS A;  1S1V A;  1P9Y A;  5U47 A;  2M5Y A;  2VPW B;  3HFK A;  1RT7 B;  2RJZ A;  4PKD B;  3NMA A;  4Y2K A;  2WVC A;  5J1E B;  1VQ5 S;  2SXL A;  3G2X A;  2GIF A;  2PEB A;  3IBW A;  4MIA A;  3M6U A;  2DO4 A;  3GSD A;  4Q7A A;  2XMJ A;  5I42 A;  4B3M F;  2ZC3 A;  2XR9 A;  1JK9 B;  2OIH A;  4DR7 J;  1BQX A;  1ZAX A;  2PDA A;  2H65 B;  4O44 A;  2VBW A;  4CNY A;  2CJX B;  4CLP A;  2UXC F;  1UJ4 A;  1YGY A;  5GAH I;  5T41 A;  1FEE A;  1M1H A;  1KVI A;  4C0B A;  4R0J A;  3GFY A;  2ZBC A;  1RT2 B;  3CC4 S;  2ZJR Q;  2XI3 A;  1X4A A;  2VQF J;  4Q44 A;  1NJY A;  2WSF C;  1RAO A;  3JSR A;  4YOE A;  3RAM A;  1OJ4 A;  4TNO A;  1SJ1 A;  3IR6 B;  2R8I A;  2K3I A;  2DGQ A;  1SUQ B;  3MR7 A;  3TP2 A;  1VC6 A;  5KFR A;  4G1I A;  1XMO J;  4JI0 J;  2W2Q P;  3CMR A;  5F8M A;  1L3U A;  3M2R B;  2BKO A;  5E3A A;  1NB7 A;  1AFJ A;  1SL2 A;  4YB7 A;  1M0S A;  3RTV A;  4NA1 A;  3N79 A;  2XTJ P;  3MMB A;  3HVW A;  5K8P A;  5F41 A;  4BCA A;  2BOP A;  2WSE C;  2C1E B;  4CM2 A;  4WFY A;  4TY8 A;  4YN3 B;  4CQ1 A;  1REV B;  2KYX A;  4OHW A;  5E2Q A;  1RHQ B;  4UW2 A;  5A8K A;  3GPA A;  3M30 A;  2VZ9 A;  1MN9 A;  2OH2 A;  1SHN A;  4FBT A;  2PMW A;  4RW9 B;  1MRO A;  1LFW A;  4F0M A;  1BMQ B;  1EJ7 L;  1KSP A;  4HR2 A;  5DRK A;  5D3G B;  2QA2 A;  1TEL A;  1RKJ A;  2UU9 J;  2DO0 A;  1EQJ A;  1H6K X;  1DRZ A;  2XSJ A;  1ED8 A;  4NOH A;  1BUX A;  3DGP B;  1EW2 A;  1T9T A;  2APO A;  3GB0 A;  2BM1 A;  2MDA A;  3RU0 A;  3GCX P;  5G4D A;  1TKT A;  3QZ8 A;  4F4K A;  4DFK A;  4OLO A;  1FHT A;  3VAF A;  2BQR A;  2BX6 A;  2V94 A;  4DU8 A;  2DCL A;  1WOR A;  3VGU A;  1YJU A;  1O0P A;  2AX1 A;  2ZVI A;  5ETL A;  3EZO A;  1KRP A;  2RT3 A;  4PPZ A;  2CQ1 A;  4QIV A;  4FKY A;  3D54 A;  3CO0 P;  1S57 A;  3DNC A;  1OIA A;  1S72 S;  1LXN A;  3OV7 A;  4JUZ A;  3GU0 A;  5B0C A;  1RAG B;  1TL5 A;  2QFJ A;  3CUN A;  4KFB A;  1GTH A;  4MK9 A;  2FY1 A;  4NLY A;  4ALZ A;  3HSG A;  1N34 F;  3PX6 A;  1WEL A;  3FEX B;  2R2R A;  4AXI A;  4B3T J;  2XMU A;  4ZHR B;  3A4T A;  3VAJ A;  4GKJ F;  1C1C A;  3DRY A;  2W25 A;  5KFJ A;  2DR8 A;  4MJK A;  4DV6 F;  2CDQ A;  5HI7 A;  3NKR A;  2HZC A;  5HP1 B;  1RAJ A;  3KUE A;  2QIF A;  3LXQ A;  1IKV A;  1FKO A;  2LVW A;  1U26 A;  4YB6 A;  3F0N A;  1H73 A;  4AYB D;  3DOL A;  1TV6 B;  5D0R A;  4F2R A;  3R6G B;  4XO0 A;  3HJV A;  2RQM A;  4J9Q A;  4DSI A;  1QAI A;  3BB5 A;  3PW2 A;  4C7Q A;  2IC3 B;  2EEY A;  1KQG B;  2RF2 B;  4MAK A;  3HFZ B;  2YXL A;  1UL3 A;  1RTD A;  3PW0 A;  5KFE A;  5KOW A;  3CCQ S;  3IDD A;  1JLA A;  1NPR A;  2MKK A;  4H4M B;  1QSL A;  2UV8 G;  5EWG A;  2RIL A;  5CAA A;  1J5O A;  3K89 A;  4O0N A;  3BO4 A;  2LEC A;  2O5D A;  3MUR P;  1GT8 A;  4X4N A;  4OZL A;  1AJD A;  4MHX A;  1RCO B;  4WE1 B;  2E1R A;  1CJK B;  1AT1 B;  4A8X A;  1D0E A;  1M5V C;  4RNM A;  5GAE I;  1O99 A;  4OZ2 A;  3BKT A;  3P8B B;  2YTC A;  4JBC A;  3QO9 B;  2HFZ A;  4ICL A;  3FEY B;  1KR4 A;  2R8K A;  4BWJ A;  1HBM B;  3L7O A;  2XO6 A;  1QE1 B;  3FCW A;  3JTP A;  5GME A;  1IBK F;  2VFR A;  2L41 A;  1YRX A;  4F0H A;  3QFH A;  2IYI A;  3D6F B;  2ZBI A;  4QPX A;  4CLW A;  3MCM A;  4C3M A;  1ZA2 B;  5IQQ A;  2HWT A;  4DPT A;  3PAC A;  2A10 A;  2AJ0 A;  3PJX A;  3MUV P;  1S76 D;  2ABY A;  1ZEB A;  3CCL S;  2CQ4 A;  1YI2 S;  3GJT B;  2HNY A;  4R5P A;  4OZ5 A;  3W1Y C;  5GAH U;  1HWU A;  1WG5 A;  2ROP A;  1RI7 A;  1WKK A;  4DR3 J;  3BGL A;  1CJV A;  3SBM A;  3CGI A;  4ED3 A;  1HHS A;  4H54 A;  3PRV A;  2AJ2 A;  5DDP C;  2MQQ A;  3DLG B;  1YSJ A;  3WHI A;  4A8W A;  4LF4 J;  2F40 A;  1U0S A;  2CYY A;  4DR7 F;  1VQ9 S;  3BM7 A;  4J9N A;  4X4S A;  1G7C B;  5A8W B;  2AKW B;  2W2P P;  1UWB B;  4K4Y A;  1MU2 B;  5C25 B;  1TKZ A;  4LIR A;  5CYJ A;  4UY8 5;  4OHV A;  2HS0 A;  3I0R A;  1D9D A;  4ZG9 A;  2X7I A;  1GMU A;  3KLV A;  3H8Y A;  1BQN A;  4OHY A;  1BHN A;  4P10 A;  3W65 A;  5HMZ A;  1WF2 A;  4C48 A;  5ETN A;  2E9Z A;  2FJE B;  1S1W A;  5I42 B;  4K4T A;  3M2U A;  3W64 A;  3RW6 A;  1XMO F;  5D4N A;  4JI0 F;  4O44 B;  3FZ2 A;  2CIM A;  1M5O C;  1FER A;  3D68 A;  2NPI A;  4FYV B;  1QY7 A;  3T01 A;  2CPJ A;  2CPH A;  2P9C A;  2XUL A;  3C16 A;  2UVU A;  2W8S A;  3RBD A;  1OMS A;  3KUG A;  4JOU A;  2N7C A;  1HI0 P;  5IFM A;  1SQG A;  2VJV A;  4PG7 A;  2Y3Y A;  2V2Z A;  1OWX A;  2HHV A;  3QAU A;  2R7W A;  4QYZ K;  4FPR A;  4Y3C A;  3TNV A;  4FF3 A;  2BVZ A;  2Z4P A;  4DL7 A;  5CZX A;  2MGZ B;  1S6Q A;  1UA0 A;  1SVD A;  1Q1K A;  5C42 A;  4I67 A;  2FJX A;  3DLK A;  3M9N B;  3R5B A;  4RBU A;  1FRL A;  5CZV A;  1U1L A;  4PQU A;  3BBF A;  2IYG A;  1XR6 A;  1FXD A;  1WWH A;  3CJS A;  4Q0B B;  2HZV A;  1Z2Z A;  4FDJ A;  3BPS P;  2J5A A;  3NY0 A;  1KWM A;  3KJF B;  2NYH A;  4C11 A;  4TQS A;  1HJK A;  5DDO C;  3M30 B;  3LAM A;  4DSE A;  1FE4 A;  4F3O A;  1MRO B;  2JLF A;  1FFS B;  2QJ3 A;  2HFO A;  5C5J A;  2IY5 B;  1NPP A;  2W7A A;  4Y0F A;  2OTL S;  2DVI A;  2W9B A;  3PHT A;  1NZ8 A;  4GC7 A;  4HL9 A;  2OHD A;  3A8J A;  2K3K A;  1RA7 A;  2ROE A;  1HNX F;  3WIV A;  4NMX A;  2CPZ A;  1TKT B;  3JSB A;  2Q6C A;  2JNJ A;  3MPY A;  3GJQ B;  1H3D A;  4NEZ A;  3SSQ A;  2O01 C;  3S8S A;  2OJ3 A;  1EB0 A;  3OTD A;  1ULR A;  4TVA B;  4FDF A;  3OXL A;  2J0S D;  4K4X A;  2J8S A;  4DL0 C;  2CPY A;  4FKX A;  3AOA A;  3MAH A;  4KHP J;  2E9R X;  1ZTW A;  3OJU A;  1S79 A;  4U67 Q;  2QLJ B;  3PO4 A;  2KJV A;  2Y8Y A;  1I51 B;  5L1I A;  3BEG B;  3IWX A;  2VOP A;  4OFZ A;  2JEJ A;  4KFB B;  2QT7 A;  1SJ3 P;  3K0J A;  4UQT A;  4ED8 A;  5F8I A;  1H7W A;  1EI6 A;  2DGS A;  4ER8 A;  1MWY A;  5B0E A;  1S0V A;  4DL2 A;  5E3P A;  1C1C B;  3T5H A;  5HN0 A;  1FWK A;  3OHA A;  1RAC B;  3ZTP A;  4MYT A;  5F0U A;  1DFD A;  4IDK B;  1WNE A;  1HI8 A;  1WD6 A;  4LR2 A;  2QX0 A;  3SI8 A;  1MG7 A;  5D4L A;  3TI0 A;  2V6A A;  5EX0 A;  1G3O A;  1S1U A;  4IFV A;  5T14 A;  1IKV B;  3W5Z A;  3MWB A;  2W8K A;  2XHW A;  1FJG J;  2UXD F;  3BSN A;  1N54 B;  3OXG A;  2P6S A;  3TW0 A;  2H1Y A;  3DOL B;  1RHJ B;  5KFH A;  5D4O A;  2OI2 A;  3VQS A;  2RDD A;  4J9K A;  1DQ9 A;  5F9L A;  4G1P A;  2LFV A;  2CG4 A;  2DNL A;  1X4F A;  2KRB A;  3NNA A;  2KZZ A;  2UUT A;  2DIS A;  4RNF A;  1AW0 A;  4EBE A;  4LF1 A;  1RTD B;  4C6A A;  5FD1 A;  2DHX A;  4DQS A;  4USW A;  1M1G A;  1JLA B;  4QWD A;  3IGN A;  2MLX A;  2HFS A;  2BJ9 A;  3E3X A;  2IVM A;  1KVJ A;  3H4B A;  3NS5 A;  1U1O A;  3RBE A;  2JFD A;  3MEG A;  4BBY A;  3PYG A;  3EGN A;  4ID8 A;  4KO0 A;  4XTT A;  3ZZR A;  1HHQ A;  1NSA A;  5L0B A;  4B3S J;  3M8S A;  3U7J A;  1WDT A;  2HWH A;  4I6Y A;  1LNQ A;  5LIA A;  4E8U A;  5LQQ A;  1YJ7 A;  2HHW A;  1RTJ A;  2HVZ A;  4ZJO A;  4F26 A;  2DIU A;  5K8O A;  3SV3 A;  2HAF A;  5C24 B;  4H4O A;  4ZJL A;  1IBC B;  3TZW A;  4DUZ J;  1J2V A;  1RAI B;  1UJ5 A;  2MKH A;  3MFI A;  4DQI A;  1VRT A;  4DR3 F;  5MLC V;  1MLA A;  1GK8 A;  8AT1 B;  1P8G A;  2KHC A;  1OO0 B;  2J8A A;  1NK6 A;  4CLL A;  2D7S A;  1S1T B;  3TZY A;  1I94 J;  4OZJ A;  3TQE A;  4ZVT B;  5HAO A;  1YBT A;  4LF4 F;  4DFM A;  2Q66 A;  3FSY A;  3H2V E;  1YBU A;  1LW2 A;  5J2Q B;  2OEJ A;  2CQG A;  1R7I A;  2KXH A;  1TMJ A;  3OJS A;  3KWM A;  2HNY B;  3LAL A;  4R5P B;  3VF0 B;  4PG6 A;  3ZZP A;  1SH0 A;  1S0O A;  2RRB A;  3M32 A;  5E0O A;  1CJV B;  2B8Q A;  4K4U A;  4ZVR B;  4OYM A;  4X4R A;  3GFH A;  1RWN B;  2W4D A;  3C8Y A;  1F3V A;  1KOO A;  2CPD A;  3UE2 A;  3SQO P;  2CQI A;  2VAS A;  3HLU A;  2J0Q D;  2FTR A;  3MMJ A;  3WZ0 A;  4CXU A;  3BDH A;  1PC5 A;  3PDN A;  2RKI A;  3TJ8 A;  4A47 A;  3ISZ A;  3HVA A;  2BAN A;  1HR0 J;  3ADA C;  2DNR A;  3EZU A;  2CJK A;  3NKO A;  5ETR A;  2B5J A;  1TL1 A;  3N6N A;  4Y2C A;  3RB4 A;  1NK7 A;  2C2E A;  5D15 A;  5E41 A;  4DG1 A;  3DLH A;  1BQN B;  1KON A;  1HNW J;  3UQS A;  2Q79 A;  3AA8 A;  5IT0 A;  2OTJ S;  1ZM3 A;  3H40 A;  2W8D A;  1UET A;  4I1T A;  1NDK A;  2ADC A;  1S1W B;  2UUW A;  2WVD A;  5HK4 A;  3ZNU A;  5L38 A;  4WYL A;  3MM5 A;  2QMW A;  4A46 A;  4QJV A;  1N52 B;  3A8I A;  1ITP A;  2RSQ A;  1PG5 B;  5LMU F;  3V6J A;  1ALK A;  2MQP A;  3C16 B;  4UPK A;  3J80 Y;  2KM8 B;  2KU7 A;  1Q5Y A;  4OZ0 A;  3W62 A;  1VIX A;  2AWZ A;  2F65 A;  4A4J A;  1Q86 T;  1XMQ J;  4JI7 J;  2OML A;  2QLW A;  4RUC A;  1QTM A;  3PR4 A;  3TX8 A;  2ZH1 A;  1U2F A;  2GZO A;  2AMC B;  1GX6 A;  1XR7 A;  4ED1 A;  2HGL A;  4TY9 A;  2O3D A;  2XMV A;  5HQL A;  2EKY A;  2HNZ A;  3M8P A;  1IKY A;  5B0B A;  1YZ7 A;  5C42 B;  2KL8 A;  2JL9 A;  2DRA A;  4DV7 J;  3R3T A;  1FDD A;  4PQU B;  2QYG A;  4IOA Q;  4U8Y A;  3L09 A;  4LFC J;  1KHK A;  1UZD A;  1RLD A;  1V9O A;  1U6F A;  1XNR J;  1D3W A;  1VBY A;  2K7K A;  3MM9 B;  2AU0 A;  3RW7 A;  1HNZ J;  2VFS A;  1NH7 A;  2W5Q A;  4PG8 A;  2I2Y A;  3MAA B;  4Q8E A;  2BEF A;  4GVB B;  4GO5 X;  1LKZ A;  2B9X A;  3BGR B;  2P8I A;  1R0B G;  4IKA A;  3IAS 9;  1VDH A;  4URQ U;  1FF2 A;  1VJW A;  2VG5 A;  1YKW A;  2H51 B;  2KJW A;  2C2N A;  2KYZ A;  1S9G A;  3HHK A;  1L3S A;  3AJD A;  2V8D A;  1WHV A;  3VTI A;  1G4C A;  1FKP A;  1XBW A;  1PYS B;  3IRX A;  4DI6 A;  1RTI A;  3IGY B;  4USU A;  3I55 S;  4DV3 J;  3BQ2 A;  4DSF A;  3M9M B;  4YHH F;  1HA1 A;  4UOP A;  3HSZ A;  4WF9 Q;  2DNM A;  2CVI A;  1UJ6 A;  4RW8 B;  4XAK A;  2YNG A;  3J7A N;  1PGZ A;  3A1Y G;  4JYA F;  2J9E A;  3LP0 A;  4GMK A;  4JI5 J;  3NWG A;  4MFB A;  2G2Y A;  4RU2 A;  4EYH B;  1H0H B;  1VC5 A;  3R5A A;  1UCN A;  1KQK A;  2WCX A;  2DIT A;  3DCA A;  3M6W A;  4C3L A;  1FRK A;  4MY4 A;  3DU6 A;  3LF0 A;  3M9O B;  4C8O A;  4RWX A;  1LK5 A;  1SC4 B;  3T9N A;  1RHU B;  4B9S A;  2Y0B B;  1S1U B;  3TO8 A;  2VHG A;  4KQZ A;  4HH0 A;  3OD2 A;  3OVA A;  5M2P A;  1VBK A;  1U1K A;  4RBV A;  3N9U C;  3BGF A;  2VV5 A;  4K8R A;  4NWB A;  4D3H A;  2DXD A;  3BZQ A;  3GJS B;  3VAG A;  3BSC A;  3V81 A;  1I1G A;  3E01 A;  3ZTR A;  2MHE A;  2XS5 A;  3O5T B;  4LRA A;  3T1Y J;  2M7S A;  4C0H A;  2W5W A;  4I2Q B;  3Q8V A;  4CH1 A;  3IG1 B;  3ZFV A;  1YVF A;  5JVG Q;  1KLN A;  1JMT A;  1TUV A;  4DUZ F;  1KVK A;  2HFV A;  3F41 A;  2DT9 A;  4WP8 A;  4YR3 A;  4CO4 A;  5CAB A;  3JSY A;  4F7V A;  1XN9 A;  2DHS A;  3N28 A;  3DN9 A;  4OI6 A;  3I6P A;  3MEG B;  4PYA A;  3VGS A;  2Z2M A;  4IO9 Q;  2DTJ A;  2GSU A;  2NXU A;  1I94 F;  4OLP A;  3J7Z T;  2GHP A;  4KO0 B;  4ZVQ B;  1VQM S;  2CNN B;  2POK A;  5KFQ A;  4IRD A;  2FVS A;  2PMH A;  5KFI A;  4D3G A;  1RTJ B;  4H4O B;  4RJV A;  3KKF A;  3RR7 A;  2XNR A;  2DGO A;  3H2U B;  1X60 A;  5K20 B;  3K5N A;  4NAS A;  1AB8 A;  4DUT A;  3BJY A;  2GIR A;  1RAH B;  3UN3 A;  1JNZ B;  3OUY A;  1E6V B;  5I3Q A;  4BHQ A;  1B7F A;  1X4B A;  3IMQ J;  3DRS B;  1BWV A;  1W2B R;  3AOC A;  1K47 A;  1W26 A;  2MSS A;  2VON A;  4WWS A;  4WFB Q;  1T9V A;  1PJ7 A;  2AJ1 A;  4UOF A;  5BXI A;  1N6Q B;  2V9K A;  4X62 J;  1Q82 T;  4A48 A;  3MR3 A;  2GSN A;  4WFA Q;  3ICL A;  3MXH P;  4IYQ A;  2VQE J;  1NXI A;  5GAG I;  1EAY C;  2VH7 A;  4TXS A;  3M32 B;  4DFJ A;  4C8N A;  2J9D A;  1KHV A;  5A6W A;  2OPS A;  2ZH6 A;  1D8Y A;  3NS7 B;  3Q23 A;  4C97 A;  2KT2 A;  4U95 A;  3TEG A;  2N82 B;  3PCO B;  2MLY A;  2HWI A;  4DQP A;  2LA6 A;  1H2V Z;  1C0T B;  2VKR A;  5I3U A;  5ETT A;  4I69 A;  4C9D A;  2RKI B;  3CCW A;  2FVQ A;  1NSP A;  3BDG A;  2BAN B;  4LF6 F;  2NYI A;  2A6O A;  1RP5 A;  4J9M A;  2LEB A;  2B5J B;  1TL1 B;  2Z2Y B;  5D4P A;  4DG1 B;  5EGH A;  2UV8 A;  4CCH A;  5LRN A;  1SB6 A;  4FNI A;  2L9W A;  1XMQ F;  5DLG A;  4JI7 F;  4DV5 J;  3N6M A;  3T1H J;  1WDD A;  4RWW A;  4NLW A;  1I5O B;  3CJQ A;  3CJ0 A;  5AXK A;  2QEX S;  3OTO F;  2RVJ A;  3MM5 B;  5LRM A;  1WKL A;  4FF2 A;  4UZC A;  5HJY A;  5KG7 A;  3ZTQ A;  2G9Y A;  1D09 B;  5K8M A;  1FE0 A;  2EFG A;  4HVZ A;  3TUP A;  1O6X A;  1U7L A;  1M90 T;  2C3O A;  4CLK A;  3QT5 A;  3MEC A;  4FYX B;  2LU1 A;  2J9C A;  4NI2 B;  1XNR F;  3PX4 A;  3DDI A;  1HNZ F;  2E7X A;  2XNQ A;  3KK2 A;  1VQL S;  3PV8 A;  1R27 B;  4KKO A;  3N01 A;  3V6D A;  1HBO B;  4LSN A;  4NLT A;  3QAE A;  2QV6 A;  2D1C A;  2GC8 A;  4NXN F;  1IBM J;  5B08 A;  2HNZ B;  1IKY B;  2A2C A;  3KNA A;  2ZWO A;  1RXO B;  2NQP A;  3VHQ A;  4CYU A;  3B6B A;  2CNO B;  4NZ6 A;  4NCB A;  5KFC A;  4LF8 F;  7AT1 B;  4I0W A;  4ILL A;  3WC2 A;  1U1Q A;  1FXL A;  1UZH A;  2QLX A;  3LPE A;  4WU2 A;  3HXM A;  2FZG B;  3UI3 A;  1UWA A;  2IMO A;  2VDI A;  4C3K A;  4QU7 A;  4JI1 J;  4ED2 A;  4P71 A;  2C3P A;  1QVF R;  3ZZU A;  2BMB A;  5KFT A;  2K06 A;  2KO1 A;  2VG5 B;  1SV5 B;  2DNK A;  2JWN A;  5F9N A;  2JHE A;  2CPF A;  5J1N A;  4JI5 F;  2V2K A;  1RWM B;  4UQG A;  3AA9 A;  1HIY A;  4UUW A;  2PSZ A;  2DY1 A;  4KRW A;  2G0I A;  4NML A;  2W2M P;  3DOK B;  3GFZ A;  1QTN B;  2HLT A;  4NLS A;  4M5L A;  8RUC A;  4KR0 B;  2BRL A;  3NP5 A;  4ZP9 A;  2A2D A;  2WK4 A;  3MEE A;  3EWG A;  2PI4 A;  3OLA A;  4ZVU B;  1XIQ A;  4USM A;  1JQG A;  2HMI A;  3CIZ A;  3SFG A;  2ZM6 J;  5T7L A;  4DS4 A;  1C4A A;  2YNG B;  2JRS A;  1IWA A;  2YY3 A;  4ZG6 A;  1BE4 A;  4YR2 A;  3UN2 A;  2RS2 A;  3LP0 B;  1N32 J;  1QAJ A;  1WOP A;  4URS A;  1H2T Z;  2V50 A;  3SCJ E;  1NKB A;  2RU9 A;  3OL8 A;  2GJI A;  4MFB B;  1XNQ F;  4KJD A;  4G1Q A;  2RE1 A;  2XLJ A;  4HH1 A;  1RBA A;  2OGU A;  2F7V A;  3ENV A;  5A8R A;  2XO7 A;  3EMT A;  4WTO B;  3MM8 B;  2FLP A;  4DPO A;  3T1Y F;  2ILZ A;  3IC1 A;  1ACM B;  1T95 A;  2CNK B;  1OY8 A;  2BJ8 A;  2GFF A;  4PZV A;  2DGX A;  3LP2 B;  2XB2 D;  4NEY A;  1S49 A;  1Y7P A;  1URN A;  2N3L A;  2IIH A;  2RQ4 A;  3BDF A;  5GOV A;  4C8K A;  4ZVE A;  3CVK A;  3CCM S;  3AQP A;  2FGC A;  3HDS A;  3H4D A;  3QWP A;  3ENW A;  3V6K A;  4RL1 A;  4QOT A;  1VLY A;  5BYS A;  5D78 A;  4LBH A;  2D3U A;  2HVI A;  1VQN S;  2COL A;  3V81 B;  3PRB A;  4OL8 A;  1TP7 A;  1WC5 A;  3E01 B;  2H5E A;  1NZA A;  5KG6 A;  5CCL A;  3W8G A;  3NNH A;  4PWW A;  3D6T B;  4HHJ A;  3RRH A;  1U1R A;  4EEY A;  2AD9 A;  2JEF A;  2D3O 1;  2MPU A;  5KG4 A;  3TX0 A;  1Q5V A;  2HVE A;  2M52 A;  1RAE B;  4R0E A;  4PEO A;  4YDX A;  1CBK A;  2JC0 A;  1NK8 A;  1IN0 A;  2RQC A;  1DAR A;  3NGR A;  1K1Q A;  4LRC A;  3D6H B;  3CDE A;  2VA3 A;  4OZN A;  4B9L A;  1WEY A;  5J2M B;  1AJC A;  2E5I A;  1MN7 A;  3LGH A;  4CWB A;  4ES1 A;  2DGU A;  3NCQ A;  2E5H A;  1H74 A;  2KN4 A;  2WON A;  1S4F A;  2J6T A;  1LW0 A;  4F8R A;  4X62 F;  2C2D A;  1AJB A;  4TYB A;  4ZVO B;  1S99 A;  5B09 A;  1T9Y A;  3CMQ A;  2VQE F;  3G96 A;  4S0M A;  1RZM A;  2YKQ A;  2HQG A;  2DNG A;  3TAM A;  1KLM A;  4DV0 F;  4GTW A;  3SFU A;  1Q81 T;  1A6L A;  3AXM A;  5L39 A;  1L3T A;  3OUY B;  1Z4U A;  4ZLN A;  4ZGA A;  4J90 A;  3O3L A;  5DQH A;  1RBO B;  4DSL A;  2L48 A;  2HAI A;  2EPI A;  5BYR A;  4CXK A;  3T00 A;  1ZAV A;  2DRD A;  1RHM B;  1L3K A;  1W2I A;  3KOA A;  2XRG A;  3U1N A;  4O3Q A;  1F60 B;  2QLF B;  2LLZ A;  3M4X A;  3CJ2 A;  4QYZ J;  2ZH3 A;  4DV5 F;  3LWM A;  2GQQ A;  2GX8 A;  1PBA A;  2CJA A;  1UVL A;  4IOB A;  3M1V A;  5EGY A;  1U48 A;  5I3U B;  2UUA J;  4ZPT R;  3FEZ A;  4ELT A;  2DH9 A;  6FD1 A;  2YNF B;  3H98 A;  4C98 A;  3FBC A;  1UVK A;  5CD4 H;  2OSR A;  3ED4 A;  4QR0 A;  3W2V A;  5ITH A;  5AE2 A;  4MKA A;  4ZP6 A;  3T5K A;  1JB0 C;  3FNN A;  1S59 A;  2D3Z A;  1KTQ A;  3R2C J;  1OYE A;  4PRF A;  3HHL D;  1IBM F;  4B3O A;  2VF3 A;  2HHH F;  3HP6 A;  2XSF A;  5KT3 A;  3GV8 B;  3MZI A;  5IS2 A;  4DPU A;  4CO2 A;  4BLG A;  2J7U A;  3TVZ A;  1SQF A;  4I2P A;  1HMV A;  1ZZN A;  3QSY B;  5I3P A;  2YKO A;  2OPQ B;  2ATC B;  2JOQ A;  4KKO B;  1X7V A;  2BAC A;  2OPR B;  3NVL A;  4ED5 A;  3V6D B;  2AGP A;  4LSN B;  4ES2 A;  2E9T A;  1R8P A;  2QTW A;  1NDP A;  3JAM Y;  2E29 A;  3PG9 A;  1QVG R;  2ASL A;  4CYS A;  2IFX A;  5SUH A;  4OX6 A;  4CYU B;  3NKY A;  1QUP A;  2FHO B;  2LP4 A;  1JLG B;  1GX5 A;  1YWX A;  2OO4 A;  2XS2 A;  1RB0 A;  4QIW D;  3SQG B;  2GVZ A;  5DLF A;  4WPA A;  3ENA A;  3D66 A;  2ASY A;  2FD2 A;  2ZM6 F;  4EFA C;  5LMN J;  1FK9 A;  4K0K J;  3OPK A;  2EFQ A;  3IR5 B;  2XYP B;  4J37 A;  5K14 A;  3BH7 B;  1U8S A;  3EPI A;  4M5M A;  4NLG A;  1FO1 A;  2ZWP A;  2EKN A;  4IO1 A;  3K8W A;  3CCS S;  1NJX A;  1XJW B;  1S9E A;  3M6V A;  4YB1 P;  1VRQ C;  4DR6 J;  3EVW A;  3GG1 A;  3HZE A;  3K5O A;  4DR4 J;  2ZJQ Q;  3N4W A;  2HMI B;  4Y65 A;  3NWR A;  5T7L B;  2ALZ A;  5DET A;  2V0N A;  2D69 A;  4I4B A;  2R9L A;  4FXW A;  3BN7 A;  2ZKU A;  3N5B A;  4G1Q B;  1YTY A;  3DXS X;  2HQI A;  4DL3 A;  3MR5 A;  3MHY A;  2RS8 A;  1H7X A;  3A13 A;  1P27 B;  5A8R B;  3FCH A;  2C2M B;  1WC3 A;  2CJ9 A;  4DR1 J;  3VAL A;  2Z0G A;  4P2X A;  5CCM A;  3T9Z A;  2UXB F;  3ONQ A;  1UFW A;  2XYG B;  5AE3 A;  5MAO A;  3GMG A;  3ET6 A;  2C2O B;  4B9U A;  2DXF A;  3HJF A;  4J5O A;  1U4B A;  2QL9 B;  3PRD A;  3CJK B;  3EDR B;  1WG4 A;  3CCV S;  1YJN S;  3R5C A;  5HLF A;  4IRK A;  2DKO B;  4KB7 A;  2ZOM A;  1NK5 A;  1VBZ A;  3ISN D;  1UKU A;  4GTY A;  5BR8 J;  3D1Q A;  1HNV A;  2IA6 A;  1HQU B;  2W24 A;  4B02 A;  1WI8 A;  4P9S A;  2GO8 A;  4USH A;  3GYG A;  1NAQ A;  2DD8 S;  1O51 A;  5FDL A;  4WXW A;  2I6W A;  1Y7A A;  2OMO A;  3DLE A;  1N0V C;  2JC1 A;  1ZEF A;  1B70 B;  4LF7 F;  5G0R B;  2RU3 A;  1U25 A;  3I32 A;  3GQC A;  1JJ2 R;  2NXE A;  2ZUA A;  4O0I A;  1RWK B;  2NZ4 A;  1FWL A;  3M8R A;  3TAP A;  1F9F A;  3TA0 A;  4AUK A;  1O8B A;  1HQA A;  4U7C A;  2B9E A;  2MHN A;  4KYZ A;  3AB2 B;  3OVB A;  4RNH A;  2RH6 A;  4AL6 A;  3ZO7 A;  2EG1 A;  3NAI A;  1N0U A;  2WON B;  2GW8 A;  2W5X A;  3W9J A;  4WZM A;  1LW0 B;  5A76 A;  4ILR A;  3NGT A;  4FXV A;  1NB2 A;  5J1P A;  2FHJ A;  3HD1 A;  1F2G A;  5J2N A;  2R7S A;  1VMB A;  2BQ3 A;  2MKC A;  3R5D A;  3B8H A;  5GMK a;  5RUB A;  5HMY A;  4B9M A;  3K5L A;  3AY0 A;  1N88 A;  2P6T A;  3NMR A;  4DL4 A;  1NDL A;  4X2B A;  1VJQ A;  2BJ3 A;  3T41 A;  3CCE S;  2VOD A;  4ELU A;  4DUY J;  2OKQ A;  5JJB A;  3B4D A;  3MK1 A;  1NEE A;  1RJJ A;  2C42 A;  1CLF A;  4UOO A;  3D67 A;  1YJW S;  1TZ0 A;  2MST A;  5THW A;  5FLX Y;  3GE9 A;  2IRY A;  1LOU A;  1KN6 A;  2F5G A;  3K5P A;  1WHY A;  2KRR A;  2ZZM A;  2UZA A;  3UR0 A;  1T8E A;  5A0Y A;  2AYB A;  5TJ3 A;  1SHQ A;  1KH5 A;  5JMN A;  3SZY A;  4M5K A;  5AXL A;  3T6B A;  2A0F B;  2OPP A;  2W5R A;  2QSF A;  3H5X A;  1GAO A;  2AEM A;  3KXD A;  4P75 A;  1PAE X;  5IWA F;  3CB4 A;  2FLN A;  2IM0 A;  4K2J A;  4WP3 A;  3X3U A;  2W7O A;  4UT4 A;  1R43 A;  2H48 B;  5IOL A;  2EFO A;  1HYS B;  1TFW A;  1VRU A;  3HHE A;  4B9T A;  3W2V B;  1QSY A;  2DHH A;  3CJR A;  4NYZ A;  4CIO A;  1T9X A;  2ZC4 A;  4QU6 A;  4LR9 A;  1FNM A;  3R5J B;  2BW2 A;  3T19 A;  4JI4 F;  3B82 A;  2B43 A;  4ECW A;  4O23 A;  1AXQ A;  3BN4 A;  5C7P A;  2OD4 A;  5LJ5 Y;  1IBL J;  4W4M A;  3EGW B;  4J9O A;  2PA3 A;  4KV8 B;  4OYP A;  3WBZ A;  1NUE A;  4OJ3 A;  2OEL A;  4DCJ B;  2RRN A;  4B3O B;  1FDB A;  2DH8 A;  1T05 A;  3KDO A;  3OVS A;  1BD6 A;  4I2P B;  1HMV B;  1YQH A;  1NK4 A;  1CJU A;  1CS4 A;  3W61 A;  4N8N A;  2NRE A;  4DPX A;  2J76 E;  2OP5 A;  5DM7 Q;  3IXQ A;  2YNH B;  5AJ3 F;  5LMN F;  3S6E A;  1D8Z A;  1VIS A;  3E2E A;  3O6Q A;  4UPL A;  3J81 Y;  2AQ4 A;  1T9W A;  2VFT A;  4NCA A;  2G2O A;  3BV8 A;  4XPE A;  1UEU A;  4HKQ A;  1RWV B;  1FRM A;  4L75 A;  2OLW A;  2DR6 A;  2GVZ B;  2M8H A;  4DR6 F;  4XIU A;  3R9L A;  2MQ8 A;  1RTH B;  4JI3 J;  4EBC A;  1IM6 A;  3OFE A;  1RDR A;  2XZW A;  1CUL B;  1GXT A;  2NXC A;  2ASJ A;  2EG2 A;  4YEA A;  5IV3 A;  5ADZ A;  3TWZ A;  1FK9 B;  3LOU A;  3UCG A;  4HHU A;  2WW4 A;  2KFY A;  2AJF E;  1V3Z A;  2UVW A;  5KFW A;  4F4Z A;  3QFW A;  2K1R A;  1B0P A;  2YX7 A;  1WEZ A;  1U0H A;  3OBI A;  2R7T A;  1S9E B;  2XZT B;  2ZHB A;  4TYA A;  3MOJ B;  2BQU A;  3DHX A;  2YWW A;  3P96 A;  3H5S A;  4B3R J;  3ITH B;  2E5G A;  1S6U A;  4ZPD A;  3N5F A;  1RK8 A;  1UEK A;  4ZN3 A;  2E1C A;  2IBO A;  4WCE Q;  5GAD I;  5IT9 U;  2RQK A;  1T11 A;  5B0A A;  3FBE A;  4NWJ A;  4ILM A;  1FNX H;  1SXL A;  2EBE A;  3OFH A;  5INH A;  4TU8 A;  2GML A;  5ETK A;  2DK2 A;  4QR1 A;  4YDD B;  4CI0 B;  3ILL A;  1T02 A;  1FA0 A;  3VAM A;  3A8K A;  2W9A A;  1T7P A;  2E44 A;  1TQL A;  3PX0 A;  4ZLP A;  5C66 A;  3TRG A;  3M2V A;  5HAT A;  3TJA A;  4LF2 A;  4JP8 A;  4MK8 A;  1GXU A;  2UUC J;  3FSX A;  4QWB A;  2VL1 A;  4QIF A;  1DJ0 A;  1FSU A;  4P7V A;  1C0U B;  2DEJ A;  2IJN A;  3KK3 A;  2A18 A;  5K8N A;  1RHK B;  4AD6 A;  3UVJ A;  1Q8I A;  3DI6 B;  3FFI A;  5HLF B;  1R8A A;  1XER A;  3AH6 A;  1FRX A;  1HNV B;  5IV4 A;  3MF5 A;  2FHK A;  1VOM A;  4LF5 J;  3KG0 A;  3ISN C;  3JTO A;  2C2R A;  5FDL B;  2MLZ A;  4F3Q A;  1KC8 T;  1ELO A;  4IR1 A;  1F5C A;  3DLE B;  3NKM A;  2XCP A;  2VOO A;  4MIV A;  3CIM A;  1BY9 A;  4DL6 A;  4CTA A;  2B4P A;  1AJA A;  1X31 C;  2B4V A;  4P2F A;  3HF5 A;  4KGM A;  1SJ4 P;  2QZ8 A;  3CC2 S;  1KOH A;  1PIL A;  2L9D A;  2WW8 A;  1FRI A;  3O44 A;  3NLC A;  2PII A;  5JUM A;  4MTP A;  4DJB A;  2GA3 A;  1H98 A;  2FLO A;  4DR5 J;  2P2C B;  3OL9 A;  1KNZ A;  2XWX A;  4MKV A;  4DUY F;  3C46 A;  2PC6 A;  3KLI A;  4BWM A;  4LFB J;  4OX9 J;  1QUV A;  2XY5 A;  2WBM A;  2DNZ A;  1ZS6 A;  1LQ9 A;  1N2K A;  5FJ4 A;  5J2N B;  4ZPV R;  2AJ4 A;  4P2S A;  1M5K C;  3MD1 A;  2GVD A;  3NXZ A;  5K5M A;  3IBF B;  3ZZO A;  2HHQ A;  2O67 A;  4CLU A;  4TKT A;  3VVU A;  5HAN A;  1AZS A;  1VHI A;  2Q6B A;  5KTQ A;  3M7V A;  3BDE A;  5DQI A;  4ECS A;  3SMZ A;  1O98 A;  2HBZ B;  3DYA A;  2R7V A;  1QAX A;  1VYA A;  3H5Y A;  1X4E A;  4AND A;  1L5U A;  3AJ2 A;  4YR1 A;  2ASD A;  1R8B A;  4DZD A;  1HPZ A;  4Q43 A;  4R25 A;  3CXC R;  4BS2 A;  4L76 A;  1RYS A;  4CLS A;  2XQC A;  3KLH A;  1TK8 A;  2ZBQ A;  2C22 A;  1SJQ A;  5L8R C;  3NBP A;  3AD8 C;  3MUM P;  4ZPA A;  1IBL F;  1KBR A;  1SH2 A;  2KI2 A;  3UW1 A;  4PCQ A;  3GR1 A;  3I96 A;  1Y11 A;  3W60 A;  2PGC A;  3FC9 A;  3IGV A;  3UNY A;  3RB0 A;  4V19 X;  4Y6I A;  4KT0 C;  5DDQ C;  1VRU B;  1K9M T;  5LXY A;  3C15 A;  2KTQ A;  4U9R A;  4ECV A;  3MPU B;  3DM2 B;  2Z58 B;  3KNG A;  1ALJ A;  3MDF A;  2LYV A;  2UVV A;  3MR6 A;  3B4M A;  3KLG A;  3OL6 A;  2J7W A;  1Q8L A;  4PUO A;  4WBF A;  4ZDN A;  2C3Y A;  3RUB L;  3SV4 A;  2DBB A;  1JLF A;  3BPD A;  2NLW A;  3HVT A;  3MMA A;  3V4M A;  1T05 B;  3MOZ A;  1Y5I B;  3JQK A;  5HMW A;  2YWF A;  5IT4 A;  3GYX B;  2NZC A;  1V5I B;  3HHN B;  1EZZ B;  3RB3 A;  4DN0 A;  4JI3 F;  3IRW P;  3UNG C;  2HSE B;  3QJJ A;  3RRK A;  1LWE A;  1FRH A;  2VPZ B;  1HD0 A;  2ZDO A;  3IGZ B;  5HJX A;  5GAD U;  2BJ7 A;  3TR5 A;  5DJB A;  2FJW A;  1RUS A;  2GAG C;  2W5T A;  2DXE A;  3OL7 A;  1R0C B;  2RUG A;  3H59 A;  2D1G A;  2PT0 A;  2MYF A;  3KFW X;  3BKU A;  4M5N A;  3I4H X;  3MTJ A;  1TUG B;  2V8P A;  3UWT A;  2KVQ E;  2LMI A;  4B56 A;  2XCA A;  1HBN A;  3UD3 P;  2CVE A;  4AT1 B;  2J6S A;  3FGV A;  3E51 A;  4CDI A;  2DPJ A;  5EGE A;  4O3S A;  2PO4 A;  2IHR 1;  2M70 A;  5HVG A;  4RLE A;  4RNN A;  2ZOG A;  2BJ1 A;  4A8M P;  3W66 A;  2K1R B;  4DF4 A;  4PR6 A;  4DWI A;  4UPI A;  2JLG A;  4HTI A;  3L3C A;  1DAX A;  1U0H B;  4YY3 J;  4EBD A;  3CJ8 A;  1N36 J;  3TUZ C;  4F4W A;  4K4Z A;  3SDE A;  1TU0 B;  5ETO A;  3MPV A;  4KTQ A;  3TEH B;  1FFG B;  2ZZT A;  1YJT A;  3OXF A;  2K2P A;  2UUC F;  1N8R T;  3LP1 B;  4FDI A;  1NM2 A;  3I0S B;  1KEK A;  1WTB A;  4CNZ A;  4M8L A;  2R7O A;  4WTY A;  1T03 A;  4CLF A;  4QIG A;  2LQ8 A;  4AQY J;  2YQ1 A;  2N4C A;  5LSR A;  4RW6 A;  2EFN A;  3QIP A;  4YR0 A;  2GS8 A;  1IKW B;  2OFH X;  4K4V A;  4OJG A;  3DLL Q;  4IQX A;  2VG6 B;  3M2V B;  1VFJ A;  2BE9 B;  2ZZN A;  1IXK A;  6AT1 B;  3ZTO A;  1FWP A;  4LSL A;  1RT4 A;  3FCV A;  5DZ6 A;  3CT9 A;  5HBM A;  1YBA A;  4RUH A;  2YBV A;  4XDC A;  1KS2 A;  4RW7 A;  2VIC A;  5A2Q U;  1WI6 A;  2MZJ A;  3UVJ B;  3Q8S B;  3FFI B;  3AJ1 A;  2XC9 A;  1Q16 B;  3ETO A;  1SH3 A;  2BAB A;  3C14 A;  3DRR A;  3KLE A;  4ZOS A;  3A8E A;  4X4V A;  2XMA A;  5AXN A;  1HAR A;  4LFB F;  3NNC A;  4V1A k;  1EQ0 A;  4OX9 F;  2FGO A;  2H9Z A;  1N5Q A;  3K5M A;  3KMQ A;  5KT2 A;  1S1V B;  4X65 J;  4CTA B;  3PW5 A;  1TTH B;  5D8H B;  4X64 J;  4Y00 A;  2K8G A;  3W8P A;  2XZD B;  4C8M A;  2VQF F;  1RBL A;  1N48 A;  5AXM A;  2CQ3 A;  3OR1 A;  3R97 A;  5H1S V;  4B9V A;  1OSD A;  4U7U D;  4NLX A;  4ZCK A;  3MAQ A;  3WC0 A;  3HKZ D;  3SSR A;  4CH0 S;  4GTZ A;  1SJR A;  3GIR A;  3WAV A;  4QWA A;  2L3M A;  4ECR A;  2MZ1 A;  4LSZ B;  2FJV A;  4I7F A;  3TA1 A;  5BJR A;  2Q43 A;  2DNP A;  2ZJP Q;  2ZFH A;  4LF9 J;  1AUD A;  2GVD B;  3BR8 A;  3K2Y A;  4KAY A;  1J5E J;  3EE3 A;  3NKQ A;  2IRX A;  1B64 A;  4Z7C A;  4N7T A;  1S7I A;  3CME S;  2VQR A;  2MZT A;  1HKA A;  3ZZY A;  4DPW A;  4QYR A;  3LA0 A;  3TOQ A;  1Y4Z B;  1KHL A;  4ZPB A;  3UCU P;  1EP4 A;  2G0J A;  3QGG A;  2UU9 F;  3B78 A;  4NLV A;  1RYR A;  3PNI A;  3I9Z A;  1X5P A;  2KT3 A;  1UP1 A;  3VAH A;  3MMB B;  1RT7 A;  4LQ3 A;  4K50 A;  2HK3 A;  2KFN A;  2CQP A;  1HPZ B;  2LDI A;  2CJQ A;  3A3O B;  4K7Q A;  2I9S A;  4WII A;  3BS9 A;  3I5B A;  3P45 B;  4CM0 A;  2ACM A;  4TY8 B;  2QA1 A;  3CCU S;  1JXE A;  2FVP A;  1UA1 A;  2HND A;  2BXJ A;  5A8K B;  2R2T A;  2H54 B;  3NBP B;  1YRU A;  1R8C A;  2Y1J A;  2CAJ A;  2DR7 A;  3K8V A;  2N4D A;  2U2F A;  1GMV A;  4FVC A;  1EW9 A;  4J9P A;  2FJA B;  4EGL A;  3VQT A;  1ED9 A;  1N33 J;  1GTE A;  2XSJ B;  4EO6 A;  2B6A A;  4ZIT A;  1JIH A;  5LSO A;  5IC6 B;  3MPD A;  3C15 B;  4MIW A;  4B3T F;  2XYH B;  3UD5 A;  1G1X A;  2QC3 A;  2HLU A;  1HL6 A;  2FHJ D;  2BYC A;  1TAU A;  4KSE B;  3C6T A;  3DHW C;  4LBP A;  2Z57 B;  3BQ0 A;  1ROF A;  2ZUG A;  5CYQ A;  5L9X A;  1UW4 A;  3DDN A;  2JFK A;  4DLG A;  2G9O A;  3KLG B;  4NL5 A;  2MMY A;  2ZNZ A;  1S1X A;  3D7S B;  3HD2 A;  1SUQ A;  2Z2Z A;  1UVN A;  1B0V A;  4LRE A;  3BKF A;  2X1G A;  2FVR A;  2DIV A;  2FIU A;  2GMH A;  3M2R A;  3HVT B;  3NCP A;  2HKE A;  2I38 A;  3MMA B;  3TAQ A;  1KTV A;  1YG0 A;  2IJR A;  2NXJ A;  2ZBR A;  4O3N A;  4UUX A;  3BQ1 A;  1RTZ A;  1LWE B;  2R2S A;  4CLY A;  3I87 A;  3QT6 A;  4RR5 A;  1WHW A;  2E1M C;  1FVS A;  4DCP B;  2KG0 A;  3SZZ A;  3S7R A;  4YFU A;  2IFY A;  4OI2 A;  4OV1 A;  4WZQ A;  1LK7 A;  5D3G A;  5HVH A;  2H5I B;  3R6L B;  1FKO B;  2BRK A;  3H90 A;  2CKW A;  2J7K A;  4E0D A;  4KHM A;  3UD4 P;  2VB6 A;  1GNK A;  2GJ2 A;  3HZG A;  4M5D A;  2Q3P A;  2B3T B;  2HVD A;  5L1K A;  1JLE A;  3FBF A;  2IAJ A;  3GON A;  2KDO A;  3FK4 A;  2DNH A;  3M8Z A;  1TL7 A;  4F50 A;  2DCU B;  1HBN B;  3JS9 A;  1TAQ A;  2IBK A;  3EJM A;  4ZIW A;  3QJP A;  1Y10 A;  4ZJQ A;  1L3V A;  1S0N A;  1U1P A;  3PYD A;  2F63 A;  3J7Z 5;  4K4S A;  1HNI A;  1U6Z A;  2HK2 A;  2PI5 A;  3D2W A;  4ANC A;  2CWK A;  2H3E B;  3NKP A;  4HAC A;  1ZTT A;  4KAV A;  4EZ9 A;  1J5O B;  4ZCL A;  1U09 A;  4PXD A;  5IZH A;  1C2P A;  1BC6 A;  3SDE B;  3Q8R B;  4GRS A;  1AUS L;  5KFA A;  3WQP A;  1E33 P;  1FTR A;  3O1L A;  3EXY A;  4IFY A;  3QRP A;  3DRX A;  2V4Q A;  5HP1 A;  1F0X A;  2HPU A;  1Q0N A;  3DYC A;  1T03 B;  4ICL B;  2LQJ A;  3KK1 A;  4ZG7 A;  1UW9 A;  2JVO A;  3I9V 9;  3SSS A;  2QE5 A;  2QA4 S;  3CD6 S;  4ZPW R;  3R8Y A;  1P9Q C;  3J7Y I;  3QIP B;  1TK5 A;  1TV6 A;  2G4B A;  3SYZ A;  2QZU A;  3I82 A;  4ZS6 A;  3D28 A;  1E2S P;  3HHL A;  1RU1 A;  2UP1 A;  3S1T A;  5EWF A;  3RR8 A;  2HIY A;  3CJ4 A;  3CDB A;  2V67 A;  2MKI A;  1JKH A;  1YK9 A;  1RT4 B;  1IJF B;  4FN5 A;  1GMW D;  2IC3 A;  3A12 A;  4L3K A;  4GC6 A;  5HBM B;  1NME B;  3A3P B;  4DHV A;  1TR0 A;  4X65 F;  4ITS A;  4X64 F;  2QL7 B;  2B4U A;  4F04 B;  1XC9 A;  4P6Q A;  2W4P A;  2L9N A;  3GP9 A;  2RHQ B;  4OHZ A;  1VQS A;  9ATC B;  3C14 B;  4WE1 A;  2YH1 A;  2XMW A;  5CH7 B;  2IPO B;  1MMN A;  3K59 A;  1IQT A;  2DJW A;  1URR A;  3IBC B;  2IDE A;  4WU3 A;  4WFZ A;  2AZ1 A;  3CCJ S;  2RH3 A;  2LQ9 A;  2DH7 A;  2CQ2 A;  1WJ9 A;  1TKZ B;  5KFP A;  2DYA A;  2HIQ A;  4R8U A;  3TAR A;  4LF9 F;  4CO0 A;  3T02 A;  4Y2A A;  1S97 A;  3I0R B;  2GLQ A;  1QE1 A;  4FF4 A;  5KFU A;  4LRD A;  2ERR A;  2VPX B;  3R7B B;  2KT5 A;  3IS9 A;  2IUC A;  3PYF A;  3OR1 B;  2FJD B;  3ZNJ 1;  4QWE A;  1P1T A;  4QIE A;  1F1B B;  3Q22 A;  1Q53 A;  3WBH A;  3MMC A;  2R8G A;  2M4M A;  4DN9 A;  2V8V A;  3M2U B;  2FB0 A;  4XDD A;  1VQK S;  4BDP A;  1HWL A;  1DQA A;  2CZ4 A;  3CWJ A;  4OMF G;  1FJE B;  3Q86 A;  5CA5 A;  1UVI A;  3D4J A;  2HVH A;  1REG X;  3G4S S;  3IFE A;  2QSW A;  4NZ7 A;  5LOQ A;  2P9G A;  3IN5 A;  2QMU B;  1IBK J;  3THV A;  2QG9 B;  4ANE A;  4ZK7 M;  5E3Q A;  2ZE2 A;  3RZA A;  1V5V A;  4DL5 A;  3V5R A;  3DLG A;  3GSI A;  2YQ3 A;  1EP4 B;  3JQM A;  1S6Q B;  3FRY A;  4ECY A;  2XY6 A;  1U24 A;  3OW2 R;  2CWX A;  3RYL A;  3DLK B;  1WOO A;  1MU2 A;  5C25 A;  3UFC X;  4DDF A;  3CJ3 A;  1WEX A;  3QBC A;  2YKA A;  4EI2 A;  4KPY A;  4KHR A;  4ETZ A;  4M1K A;  2HW3 A;  3THP A;  1TUW A;  1R0A A;  5KG3 A;  4JV2 A;  2Y1I A;  2YPZ A;  3HK2 A;  4C11 B;  2HND B;  3RG6 A;  2VBY A;  4X84 A;  4MYU A;  4CT9 A;  1ZOT A;  2IJF A;  4M5G A;  1WG1 A;  4KHP F;  2X3G A;  3AOB A;  1PYT A;  1N5T A;  3GG0 A;  1HLW A;  2W9B B;  5IC4 B;  2DRB A;  4AL5 A;  4CXS A;  1DLO A;  4RU9 A;  3VR1 A;  2O66 A;  3OFG A; 
#chains in the Genus database with same CATH homology
 5GOV A;  4UOR A;  3Q3Q A;  3OT9 A;  3NKN A;  1AJB A;  1ZED A;  4LQY A;  4MY4 A;  4ZG9 A;  4GTZ A;  3B5Q A;  3MK0 A;  4LR9 A;  2GSU A;  2W5V A;  1AUK A;  3WAV A;  1Y7A A;  1KH7 A;  4YR1 A;  1N2L A;  1EW9 A;  5DLT A;  5C66 A;  4NWX A;  2GSO A;  2W5S A;  3ED4 A;  3TG0 A;  4FDJ A;  4CYS A;  4UPI A;  1EI6 A;  1ZEF A;  1E33 P;  5GRR A;  3SZZ A;  1KHJ A;  2IFY A;  1ED9 A;  4GTW A;  2GA3 A;  1ALK A;  3MK1 A;  5L0K A;  1URA A;  4LR8 A;  3E2D A;  3CMR A;  4UOO A;  5L0E A;  4KM4 A;  1HJK A;  4UPK A;  3MK2 A;  3TWZ A;  2IUC B;  3WAW A;  1ALI A;  1HDH A;  1KHN A;  3M8W A;  1EW8 A;  3DYC A;  1E1Z P;  4KAY A;  3M8Y A;  3IDD A;  4ZGA A;  1B8J A;  3IGZ B;  3WAY A;  3DPC A;  1KH9 A;  1FSU A;  3BDG A;  3NKQ A;  2X98 A;  4LR2 A;  1ELY A;  4ZG6 A;  4ZG7 A;  3IGY B;  1ZEB A;  4N7T A;  3UN2 A;  4LR7 A;  1Y6V A;  3T02 A;  3UN5 A;  3WAX A;  5L0B A;  3TX0 A;  1K7H A;  1ELX A;  2GLQ A;  5TJ3 A;  3KD8 A;  5IJQ A;  1SHQ A;  2VQR A;  4FDI A;  1N2K A;  1HQA A;  3UN3 A;  2QZU A;  3T01 A;  5EGH A;  4LRD A;  3M8Z A;  1KH5 A;  4CXK A;  3UNY A;  1P49 A;  2W5T A;  5LIA A;  3SZY A;  1AJD A;  2W8S A;  4KJD A;  4UOP A;  3T00 A;  5LQQ A;  4MHX A;  2IUC A;  1E2S P;  2ANH A;  4CXU A;  5K4P A;  1KHL A;  1EJJ A;  2XR9 A;  3BDH A;  5LRN A;  4LRA A;  1SHN A;  2RH6 A;  1KH4 A;  5AJ9 A;  5HRT A;  2W5R A;  5DLV A;  2W5W A;  3NKR A;  2XRG A;  2D1G A;  2W5X A;  3A52 A;  5DLW A;  3WBH A;  1O99 A;  3UO0 A;  4QAX A;  3NKO A;  1ANI A;  1EQJ A;  3LXQ A;  4LRE A;  4UPL A;  4LRC A;  1ED8 A;  4B56 A;  1ALH A;  1EW2 A;  1KHK A;  1ANJ A;  4UPH A;  5LRM A;  1ELZ A;  4NWJ A;  3NKP A;  1ALJ A;  2GSN A;  3BDG B;  3M7V A;  1AJC A;  4GTY A;  4LRF A;  3NKM A;  2G9Y A;  2ZKT A;  4KAV A;  5KXA A;  4GTX A;  1URB A;  4MIV A;  5IJS A;  5EGE A;  3NVL A;  1O98 A;  2W8D A;  4CXS A;  4KJG A;  4TN0 A;  5INH A;  1E3C P;  4LRB A;  4CYR A;  3BDF A;  1AJA A;  2W5Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...