3UN5A

Bacillus cereus phosphopentomutase t85e variant
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
Knots found
sequence length
391
structure length
391
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDEMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Differences between a Mutase and a Phosphatase: Investigations of the Activation Step in Bacillus cereus Phosphopentomutase.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
molecule keywords Phosphopentomutase
total genus 143
structure length 391
sequence length 391
chains with identical sequence B, C, D, E, F
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2011-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3un5A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3un5A01
1E2SP 3BDGA 3LXQA 3NKPA 4KAYA 1ED8A 3UN2A 1KH4A 2W5VA 3NKRA 1HDHA 2GLQA 3DYCA 4MY4A 3E2DA 4YR1A 3MK2A 1FSUA 1E3CP 5L0KA 3UNYA 1Y7AA 5KXAA 4LR7A 4UOPA 2XR9A 3M8YA 1EW8A 2RH6A 3NKMA 3WAWA 4LRAA 4ZG9A 5AJ9A 4KM4A 2W5QA 2W8DA 3BDHA 3IGZB 5L0EA 2G9YA 4MHXA 2W8SA 4NWXA 1P49A 4LRDA 4KJDA 5LRMA 4GTYA 2XRGA 5C66A 3NVLA 1HQAA 1HJKA 2IFYA 4UORA 1SHNA 2GA3A 4CXSA 5DLTA 3UO0A 4LRFA 1ALJA 2IUCA 3KD8A 3OT9A 2W5XA 3DPCA 4LRCA 1URBA 2GSOA 4TN0A 4LQYA 1N2LA 4CXKA 3A52A 4KAVA 1AJCA 4LREA 1EJJA 4ZG7A 1EQJA 3SZYA 5GOVA 3M7VA 3IDDA 2QZUA 3WAVA 1AJBA 1ALIA 2VQRA 2IUCB 3Q3QA 2GSNA 5EGHA 1ALKA 3NKNA 5DLWA 3TX0A 3WBHA 1KHLA 1EW9A 3ED4A 4CYSA 4GTWA 4GTXA 1KHJA 2D1GA 4UPIA 4LR8A 3UN3A 5LQQA 4MIVA 1N2KA 5TJ3A 3MK0A 4LR9A 4LRBA 3SZZA 5L0BA 1SHQA 3CMRA 1EW2A 4B56A 1AJDA 1E33P 4UPHA 1ZEFA 5DLVA 1ELYA 1O98A 3M8ZA 4CYRA 5EGEA 5K4PA 3WAXA 1URAA 1K7HA 2ZKTA 4KJGA 4QAXA 4ZG6A 1KHNA 4CXUA 4ZGAA 1KH7A 5LIAA 3TG0A 1EI6A 5GRRA 1ZEDA 2W5TA 3NKQA 4FDIA 3TWZA 1ANIA 3WAYA 3IGYB 3B5QA 4FDJA 1Y6VA 4NWJA 3T01A 4UPLA 5LRNA 1ELXA 1AJAA 5IJQA 1KHKA 2W5SA 3BDGB 5HRTA 5IJSA 1ED9A 4UPKA 1KH9A 1B8JA 4GTZA 3UN5A 3NKOA 2X98A 3BDFA 4LR2A 2GSUA 3M8WA 1ZEBA 3T00A 4N7TA 5INHA 1E1ZP 2W5RA 3T02A 1ALHA 3MK1A 1AUKA 4UOOA 1O99A 1KH5A 2ANHA 2W5WA 1ELZA 1ANJA
chains in the Genus database with same CATH superfamily
3CCQS 2VPZB 4ECVA 1VQ8S 1G2EA 3FZ2A 3IM8A 4NI2A 1FJEB 3R6GB 5GMKa 2NCKL 3TUPA 1JLAB 2DXDA 3IG1A 3HJVA 4YB5A 4BHQA 3SCJE 3VF0B 2V4QA 5KFLA 3QZ8A 3QPIA 1V3ZA 1NSQA 4KV8A 3KLFA 2WONA 1N5YA 2F4VF 5GAGI 2GMHA 1DFDA 3I0SB 2FUG9 4K8RA 2LCWA 1HPZA 2HWIA 4OHWA 2KYXA 2QL9B 4ILMA 2HBRB 3MEDB 1FFGB 3TAQA 3V2UC 1Q82T 1NK0A 2VOOA 3SSSA 4DJBA 5DDPC 4MAKA 2KB2A 4XAKA 4GO7X 1YJTA 1CJUA 4Y2MA 5KFBA 1QTMA 1FJGJ 5A8RA 1X0PA 4HH0A 4DV5J 3KHLA 3RW7A 4K4TA 3VHQA 5F9LA 4X4TA 1B70B 2BR0A 3LP1B 2VBWA 3KLIB 2GQQA 2OD6A 3OTDA 4BCAA 3QIPB 2O5DA 3L4BC 3LA0A 1SIWB 2EG1A 4WFZA 2HFUA 4J9PA 2W8SA 2ZH4A 5LOQA 2XRGA 2CJ9A 4DG1A 1J27A 3Q22A 4CI0B 2LFVA 2HHQA 1ROFA 4OX7A 1SHNA 4LUBA 3CCVS 4WU3A 2QG9B 3UO0A 1IBMJ 2V9WA 3R5AA 4U95A 4IUFA 5LJ3Y 3VAJA 4EO6A 4ITSA 1F2HA 2IYIA 2AIRB 2FGCA 2OGUA 3EICA 2EKNA 4K2XA 4EZ6A 4ANDA 1F1BB 2C2ZB 4IG0B 3FRYA 5IM0A 2VQEJ 1KQSR 1QM9A 1VC5A 1KC8T 1URBA 5F8LA 5HO4A 3GYXB 3MM8A 4UW2A 5HJYA 2ZH1A 4CLUA 3K8WA 3T1YJ 4NXMF 5B0CA 2OPQA 3T3FA 4AXIA 2C3PA 2QZUA 1RA6A 2DNQA 2RILA 4MK8A 2I9SA 4IFYB 5DDQC 5HVGA 5J2PA 4U7UD 2ZWOA 1WC6A 2NREA 3D9BA 4YN3B 3C3LA 4C48A 3TYTA 3D54A 4O4GA 1CJKA 1BY9A 1TKZB 4U96A 3TAMB 3TJ8A 1RHMB 3UNGC 4D3HA 5KG7A 2W8KA 2G2OA 2RQKA 3OPKA 2ZH7A 3H20A 3AB2B 4EYIB 3CJQA 3HLUA 3ILOA 4DPTA 3EDRB 1VIOA 1KHJA 1O8BA 3KK3A 2NZ4A 2I8EA 3FCHA 4N41A 4MIVA 4BWMA 3S8SA 5B0EA 3QWUA 3GIKA 1S0VA 2FHMA 1FCAA 3DDKA 2XEXA 5B0FA 1IBLJ 5AT1B 4ZCMA 4CTAB 1NNDA 2UV8A 2AJQA 3W63A 1CULA 2RRNA 2XSJB 3FFIB 3PJ9A 3T9NA 3BDPA 1X4EA 4BC7A 2JVRA 1S6QB 4DFPA 1SKWA 1RT7B 5I42B 4Y6IA 3B8HA 4DL6A 1S5ZA 2KXFA 3VGSA 3CCMS 4DX5A 2F40A 2BZ2A 4O44A 3RJMB 1S4EA 1NJWA 1KH7A 5K8MA 1IKXA 2KKHA 3QT8A 2V9KA 4ZIVA 2F4FA 2LVWA 2CNNB 3MM8B 3PHTA 4P7TA 3CTRA 5E7OB 1R89A 2DNKA 3LP2B 5KG2A 4YR2A 1U6FA 4WZMA 3THTA 4MH8A 3OUYB 5ADZA 2BXJA 4IFYA 4F4XA 3CJTA 3R27A 2WAQD 1VDHA 1GX5A 5J2QB 3OSPA 2O3DA 2XBPA 1T11A 4Q7AA 2H3EB 5EX3A 3R97A 4EU0A 4RUHA 5LSOA 5C5JA 1RK8A 2J6UA 1KH9A 2G0CA 1T9XA 2ZOMA 5T7LB 3RGIA 5HMWA 5KFOA 3EMTA 1IBMF 1NPKA 1ZA2B 4DR3J 4DQSA 5C42A 1YBUA 4CH7A 5GAHU 1WKKA 4UZCA 2EFPA 2Z57B 3LPYA 2ATLA 3T02A 1F5CA 2GS8A 4E0DA 2DO0A 1XR7A 3P49B 4DR7F 1HBMB 2L9WA 2PD1A 2IMOA 2WSEC 1HMVB 2WOMB 3NGRA 1VLOA 2WW8A 2CXEA 2RD5C 4M63A 1GMUA 4ANEA 2J8AA 2FPHX 5D77A 3T9ZA 1X4BA 4A8KA 3IWXA 1HYSA 4TLQA 3F56A 4JUZA 2VG6B 5H9EK 3OXLA 2AWZA 2CPJA 2H5EA 4IKAA 2KM8B 3TARA 1YITS 2AJ4A 1HYSB 2VOPA 1CVJA 3I0RB 2B5JB 2GW8A 4DL4A 3JQJA 4OYWA 4OL8A 1Z2ZA 1J5EJ 4W4MA 4UY8T 3BO4A 2KRRA 3QLHB 1URRA 3CJKB 3BEGB 4B3MF 2KTQA 5IS2A 1FVQA 3MOJB 5HVFA 2J0SD 4IH7A 3R7SB 2HVEA 2QL7B 2CIMA 2FB0A 2XS5A 2UXCJ 2ZH8A 1VQYA 3UDCA 2OO4A 2VDHA 1RT6A 1I51B 2HQ3A 5E3QA 3JS9A 2OMOA 4PEOA 4KHRA 3UFCX 5HMYA 1R27B 4ES3A 4DSLA 2QSFA 4WZQA 2EVZA 4OHZA 3VZHA 1XEZA 4OI2A 3L7OA 5J1EB 4XIUA 2Y9HA 1Y5LB 4R0EA 5DZ6A 4DUYJ 1WC0A 1BQNB 2HWTA 5F0WA 4USMA 3CULA 1NK9A 4CXSA 1DARA 2BJEA 1N56A 1XMQF 4FF4A 2QLJB 5HQLA 5KFCA 2CVIA 1KN6A 1WSVA 5HI7A 3ZTSA 4LF1A 3D1QA 3NEKA 3O5TB 2O01C 4F25A 4DZ6A 4NA2A 3HT3A 1XNRJ 4DV4J 1ZH5A 1LW0B 1HNVB 3KKFA 3U27A 2GSNA 4ECZA 5ETMA 1PO6A 1VQOS 4DR6J 1NRKA 1UVLA 3QRRA 1KKHA 2QLWA 3NL0A 1MN7A 4NASA 2JWNA 2CZ4A 2XWYA 4WTOB 1QD1A 2H54B 4ZK7M 5IV3A 2R7UA 4CO4A 2IC3A 3GSDA 2CPFA 3QLHA 1W2IA 1EX8A 3CJRA 4TY9A 2JOQA 1ZS6A 1F9EB 3LP0B 5ETLA 5IXUA 3OL7A 4LF2A 4ECYA 2D3OR 1SH3A 2J0QD 4K0KJ 2I0XA 2JH3A 4PAAA 2IM1A 3SIPB 2Q3PA 3MECA 1RT6B 1NPPA 1N5SA 1QE1B 1WACA 2BANA 4O3RA 3CMAS 1JJ4A 1G4CA 2KJVA 4GKKF 1AFIA 1ITPA 4NLPA 1G1XA 5EGEA 3WAXA 4YR3A 3CDWA 3H90A 2B43A 3VR1A 1S7HA 3TG0A 4ZGAA 3NLCA 2XHWA 4QYRA 1VISA 1G3OA 2XO6A 2E7WA 2ZH2A 1HQUA 2MGZB 4JI4F 3QJPA 2FJEB 4P52A 1ZTTA 1UJ6A 5JJBA 2C28A 2IAJB 3ZZPA 2QFIA 2KHDA 3BYPA 3WC0A 3E2EA 4QOTA 4I67A 3C19A 3RBEA 4LSLB 1XN9A 5GMEA 1M5VC 4YB7A 2D3O1 5IJSA 1IR2A 1KFSA 1ED9A 1HNVA 4KC5A 1K1QA 2DGXA 3BDEA 2PGCA 2RJZA 4MIAA 1JXVA 3ZC4A 2BQ3A 2K1RA 4N77A 4OX8A 2BEFA 3CDUA 4IDKB 1T9WA 4Q43A 1WC5A 1MU2B 3M8WA 3TANA 2JEFA 3V5RA 3RR8A 2JEIA 3DFEA 2OIHA 3NRBA 3QWPA 4ATNA 3MPDA 3MD1A 4ES1A 2ZOFA 4DV3J 2RU9A 3EE3A 3VTIA 1NKEA 2HS3A 2WVBA 1V6HA 2HWHA 1OY9A 4OYPA 1TL1B 3LGHA 1SQEA 4TU9A 1T03A 1I94F 1U4BA 1IBLF 2FJWA 2DY9A 2K2PA 2F9DA 1ED8A 1KH4A 2W5VA 2CKWA 3PX0A 2WVEA 1SQGA 3NGKA 4YY3J 4DCPB 1IR1A 2CNOB 4IR9A 1B99A 1S9GB 1NHVA 1OYEA 2GGPA 2N7CA 1Q1KA 2X1GA 1FSUA 1S0NA 4ETZA 2CAJA 3Q2SC 2ZH9A 1NK5A 4B3MJ 3KOAA 4LF8J 1T3OA 3W2WB 4CYUB 3OR2B 1N52B 2W9AA 3PR5B 2ZZTA 3US5A 3MURP 1U47A 1QJHA 1HNZJ 1RAIB 4MYTA 1IVZA 2DGUA 2W5TA 3F41A 4KIAA 2CJYB 3BPSP 5K8PA 5L46A 3SFGA 3R7BB 4B3TJ 1R8PA 3VAHA 1OMSA 4LFAJ 4DV7F 2CQ3A 5DO2A 4GC7A 2AYMA 2M52A 3TW0A 5CXTA 4NLVA 4P2FA 2ZJRQ 1J5OB 4C8MA 3A3PB 3ILLA 4FS2A 4IOBA 4ZVQB 1RWWB 2B9YA 2OPPA 4OJ1A 2YWKA 1DQ9A 1X31C 1X4CA 1NBEB 2DB1A 1FA0A 2N7YA 1X5OA 3E01B 1XMQJ 4O0IA 2JX2A 2HMIA 1VK3A 1ALJA 1TL4A 1S9EB 3AQPA 2ACMA 2MQLA 2HZVA 2W2QP 3NOCA 2JVOA 5BYRA 3EXYA 1N2LA 4X62F 3M8PA 2MZRA 3CD0A 1B7YB 1MWZA 4Q2MA 3U1LA 3IS9B 1GXLA 1YVFA 3DLJA 4F36A 1AROP 4WU2A 4YP3A 3MFIA 4P74A 4F3QA 1SUQB 4TY8B 5CYMA 3KUEA 4M5JA 5AXMA 4ECXA 2JC0A 4PCQA 1IKYB 3HVTA 2AZ1A 3BGRA 3N01A 3I82A 2YPYA 3AXMA 3NP5A 2X51A 1K0TA 3KG0A 3W2WA 4CYUA 5KFEA 6AT1B 1UFKA 2K06A 2DNYA 4DCJB 1RHQB 3E3XA 1RAAB 4I7FA 1U49A 3ED4A 4JI7J 4ZVPB 3DOMA 3UD4P 4GTXA 1JLCA 2AP6A 4PXDA 4USWA 3KXDA 1WKLA 3DMJA 4MT1A 4ZOSA 4O3SA 4OZ2A 1F5AA 2HIQA 4OZJA 5EWGA 2VG5A 2D3UA 4I0WA 3R9LA 4LIRA 2RRBA 1FKAF 3PM9A 3C2PA 3PRDA 2KL8A 1P8GA 3DLEB 4NPOA 3J80Y 1EW2A 4B56A 1E33P 2ZUAA 3TJ9A 2G9OA 2VODA 3R5JB 4LIWA 1O98A 5F3TA 1SL0A 1ZM2A 1AYEA 3QAEA 3T6JA 5DZ7A 2DGSA 2Y1LB 2B4OA 2NZCA 4OHXA 3WX4A 3W9JA 4WE1B 4DV4F 4YHHJ 1SL1A 2P9GA 2J0XA 4YEAA 1ZOTA 1N36F 2UUCF 3NBPB 2BJ8A 4CXUA 3KLHB 1RAOA 3IMQJ 1RT4B 2WB1D 4LF4J 4GO5X 2HAIA 1UEVA 4F4AA 4OX9J 3K5PA 3L09A 4H4KC 3PYFA 1G6BA 3CC2S 1PAEX 1SBRA 2GIRA 3MMCB 4F04B 5A2QU 4OYIA 3SQOP 4DN9A 3T1HJ 2M8DB 1Y6VA 1IBCB 1RP5A 2IIHA 4KGMA 3FQLA 3NS5A 2C2DA 1LWEB 3HD1A 4ZP8A 5LXRA 2NUUG 5AJ3F 2GVZB 2JEGA 5KFXA 2CADA 1R8BA 3U7JA 1S6PA 2UUCJ 2OAUA 4IQMA 1HQEB 1FO1A 1FT8A 2HG4A 2OLWA 3A8EA 3FMWA 3PYEA 5ETOA 4BC9A 5D6GA 5KT4A 2GSUA 4KV8B 3T00A 3GV8B 3OVBA 3CUNA 1K47A 3I0SA 3NOGA 3M8QA 2CJBA 4NOHA 5IT9Y 4NCBA 1ALHA 3S7RA 4LQ9A 4OMFG 3ZZOA 4P73A 2IBOA 1ANJA 2YWHA 4WP3A 3J7YU 1I1GA 1LKZA 1CJUB 5LQQA 2XSFA 3CJ4A 2VG5B 3ETOA 2CQ4A 1H72C 1TKTB 4PR6A 5HQMA 2VG7B 1GNKA 9RUBA 1YJ7A 3EPIA 5LXYA 2DKOB 3FSXA 4TNOA 1LQ9A 1NAQA 2C2NA 8AT1B 1Y7PA 2CQCA 3QRPA 4W90B 4RWXA 1WTFA 2BKNA 4DL3A 1LFWA 4OV1A 3HFZB 2FZCB 4LR7A 4JV1A 1D9AA 3RRHA 4DF4A 1X9WA 4OYXA 3GE9A 3NBPA 3W5ZA 4YY3F 5DG9A 4IFVA 3MR3A 2HNZA 2KJWA 3KLHA 3IRWP 3CDBA 5E33A 2A2DA 4X4QA 3NMRA 2HBYB 3MZIA 4IRCA 4P2SA 1VBZA 2DGQA 4N8OA 4DR3F 3IAM9 4JBCA 1P49A 3G6YA 3MPVA 4F67A 2D69A 2RVJA 5SZTA 3NAHA 3L95X 3UW1A 1UVNA 2HS0A 4TKTA 1F5BA 4F4WA 3HPOA 1KD1T 1M1KT 1U1OA 1D8YA 2W2PP 4NLTA 3EX7B 4NEYA 3RRGA 1R43A 4FYWB 3ZTPA 5AE1A 4J90A 2RH3A 1JQGA 2LA6A 1Q81T 1CJKB 4P7VA 2QMXA 4IH6A 2KZMA 2ZC3A 3BPDA 1C4CA 5IT4A 4O3NA 2W25A 2PO4A 5EN1A 3MCMA 4WTYA 2CQDA 3WIVA 1ZAXA 3HI9A 1TK5A 1RZMA 3NKYA 2FDNA 5G0RB 4IO9Q 3CCSS 2UZAA 1A6LA 1OQ3A 2V2ZA 4YS2A 4I64A 3QSIA 4A8XA 2HNYB 5CD4A 2W24A 1XK8A 4K4YA 3DYAB 1ALKA 1CULB 2BM0A 2CZ9A 1S6QA 1HNXJ 1GTEA 1U2RA 2CJQA 2NYHA 4X4UA 5F8HA 1RT7A 3DDIA 1HHSA 3KHHA 5I42A 2KG0A 5F8JA 3HKZD 4NLDA 4USIA 3CJ2A 3DRYA 3FSYA 5L39A 4ECSA 2BABA 2Q6BA 5AXLA 2G0JA 2MKHA 2MYFA 4DMZA 4W92B 1JJHA 3ITHB 5E3AA 2EI5A 2YKPA 1ZA1B 4PABA 1PKUA 3NG8A 1VBYA 1IKXB 2F4VJ 4KPCA 2HRTA 2OEMA 1VQ4S 5L1JA 2IHR1 2GAGC 2Z56B 1CQNA 1RBAA 1RISA 4FNHA 5A8WA 2XGPA 3TQ1A 3OUYA 1UA0A 2AYGA 4LBPA 3QIDA 1FWPA 2RDDA 5J2MB 4HYKA 3QNWB 3KMQA 3K59A 4OZ5A 2KXNB 4C98A 3G96A 1K7HA 3CJ0A 3V6KA 3CCES 5A8KA 4OJ3A 1IJEB 1UETA 4BWJA 5C2CA 4J9RA 1CS4B 2IRYA 1KQGB 3R5DA 2MKKA 3DRRB 2R7OA 1DQ8A 1S1VB 1O6XA 3KFWX 2QA4S 2KT5A 4ZITA 2XLJA 3PW4A 4NWJA 2CFXA 3CIMA 1UWAA 1SB6A 2POKA 2YQ1A 3C16B 1P1LA 2GMLA 2GHVC 4O3PA 1RTHA 2RSQA 3UVJA 1HWIA 1Y5IB 3H4DA 1HIYA 3M05A 2GX8A 4ID5A 3IWNC 2HK3A 2AU0A 4X4VA 1CC8A 2P6TA 4JI3F 1NDLA 1RWNB 3DYAA 4J37A 2MKCA 1UZHA 4RNHA 2PFFB 4JI0J 4QWDA 3H5YA 4YB1P 1FRMA 1MSWD 1H2VZ 5LSRA 3MMBA 1PJ7A 1EAYC 3RBZA 3MK1A 3HKWA 2ZD1A 4NZ6A 5E3PA 4DCOB 2ILZA 1ELZA 4LFCJ 3ZTRA 4U8VA 1KLNA 2DNHA 3NKPA 4GMKA 2GMJA 4ZCLA 2QJ3A 1NSKL 1WSRA 3MM5B 3HP6A 3PW2A 1JK9B 3W7BA 1LWXA 1RCOB 1IKVA 4UUWA 2Z8QA 3HVRA 2GA7A 3SI8A 3P4UB 4TQSA 3H40A 2PSZA 3MK2A 4N76A 1FFWB 2Q1LA 4LVOP 1Y7AA 3Q2TC 2C22A 1KDNA 1FK9A 1TMJA 1YJRA 5CYJA 2MY8A 2ZHOA 3M9OB 4J9VA 4JI1F 2HGLA 5D4NA 4K4ZA 2GO9A 4DSEA 2KDOA 4OZ1A 2V2KA 3DRRA 1R0CB 2BDPA 2R3VA 1S1VA 1EHWA 2VQFF 4P9SA 2ALYB 3F0NA 3LW5C 1LK7A 1BQNA 1RT5A 1JWWA 1UW4A 1IWGA 3O8WA 3KHRA 3RTVA 2OP5A 4DQRA 1M5HA 1VQKS 2HIYA 2HW3A 4NWXA 3FBCA 3KK1A 1WEZA 3HZEA 2V94A 2W2NP 1A7GE 2XQCA 2YTCA 3DRSB 4DL0C 5HP1A 3MXHP 1SVDA 4L3KA 5D4LA 1HQAA 1EQ0A 3AJ1A 2UV8G 2ASYA 1RKJA 2GVDA 4DR2J 3NNAA 2I1RA 4QWBA 3QQCD 3HMJG 5DQHA 2VV5A 3POTB 1K73T 2R42A 3CJ5A 3NY0A 4B3RJ 3IO1A 1OJ4A 1VIXA 1HR0J 3PIOQ 2W7PA 4QYZK 2YNHB 3FEXB 3GG0A 2BQUA 4CXKA 4CT9A 1DTQA 3AFGA 2DH8A 5A2QY 4DV2F 1I3OB 2CA9A 3LGMA 4ZP6A 1O51A 1HI8A 2XO7A 1SJ4P 4DSIA 4KQZA 4KJIA 4KH1B 4ZVTB 2D1CA 3IG1B 3KDOA 1XIQA 3DXSX 4NLSA 1N6QA 3BZQA 1K0VA 2WONB 2RF2B 3W8GA 5GADI 2COLA 1OS5A 3DDNA 3G8TA 1EQMA 3VGTA 5A0YB 3FSIA 1FVSA 4DV1J 3JYTA 1FXDA 1X9MA 1FHTA 2E29A 2MPUA 3J7AN 4RW6B 4ZN3A 4AQYJ 2BANB 1HD1A 3NAIA 3MEEB 4RO0A 2LMIA 1T05A 1VS3A 2HK2A 6FD1A 2V8PA 2AEJA 2XMWA 2XMJA 3IRXA 5I3UA 4PRFA 2BE2A 2OPSB 3BSOA 2QYCA 2XY5A 4X4PA 3IA0A 2NXUA 3OXFA 4DV5F 1AJDA 1B0TA 1IWAA 3HHLB 4C11A 2C2MB 1TR0A 3DRSA 3UR3C 3VAGA 3A8IA 3PW5A 3BBBA 4QIEA 2A18A 4ELTA 1H7XA 1HD0A 4DUZJ 5K4PA 1OSDA 2FY8A 2D41A 3D67A 3POTA 4RNNA 3K89A 2FVQA 1JIHA 5IFMA 3BSAA 4R25A 2ROEA 3DLHA 2FJBB 2YNHA 4HACA 1UW9A 2C2OB 3ICLA 4K5RA 5AXKA 2OH2A 1OY6A 3AOAA 4MKYA 4JV2A 4RNOA 4X4OA 2GHPA 4EO8A 2CWKA 4M8LA 3FCWA 4EZ9A 3R7NB 3H2LA 3ISZA 4F4YA 2V4JB 1T7PA 4Y00A 1SJFA 1GT8A 2U2FA 3NNHA 2AEFA 4HTIA 1GFWB 1H7WA 2AKWB 1S57A 3QGHA 3RAXA 4DF8A 4RW6A 1VRUB 1FEEA 2N4CA 1HWKA 3M2VB 3FBFA 5MAOA 2PE8A 1RAFB 4O4RA 3Q8VA 4URQU 4QBUA 3SZ2A 2ZBRA 3NCRA 3LXQA 1N54B 5BR8F 3GFHA 2CZVC 3UN2A 4CTAA 3NKRA 4HEA9 3AJDA 2JHEA 2DEIA 4TN2A 4DWIA 3E2DA 4LVNP 3GJRB 4UQTA 4DPUA 3DXBA 1T95A 4U8YA 2GO8A 1C1CB 1VOMA 2C3OA 1LW2A 3UCUP 4FPIA 1J5OA 2WBMA 2H4YB 2HNDB 5B0DA 2OPPB 5KXAA 1APSA 2DY1A 4NCGB 5DLGA 4O44B 1X4GA 4W98A 1HR0F 1EW8A 1NO8A 3H5SA 2RQ4A 3E01A 4NE9C 4ZIWA 3M2RB 5HMXA 1M1GA 4J9MA 4LRAA 1U1RA 4HACB 3W3SA 2GHWA 4NLRA 2IJNA 4YOEA 5F8NA 2ERRA 4ZN1A 3CCJS 3I55S 4UOGA 2FLLA 1NK8A 2X1BA 3K2YA 3L9ZA 3O6QA 3FGVA 2M5YA 3D4JA 3JTOA 4ECWA 3LAMA 2JFDA 2G1DA 3T5JA 1WWHA 1L3UA 2ABYA 2AX1A 4FZVA 4C2MA 5EDWA 1HJKA 4UORA 1WOPA 2ZVSA 2N82B 1M5KC 4K5SA 4FYVB 3HK2A 1CJVB 2FZKB 2MZQA 1NEEA 3OFGA 1VRUA 3M2VA 3TVZA 3KJNB 4F2RA 4CLPA 3HHKA 4WP9A 3QGIA 1WEYA 1FJCA 1HNWJ 3NS7B 3CC4S 4K4UA 1YGYA 5CH7B 3ONQA 2IRXA 2JC1A 4I7FB 3C66A 1E6YA 3FZBA 2Z2LA 1JLFA 4WK3A 4ZVRB 4OX9F 2KFYA 3T5KA 1EQJA 4XDCA 1TV6A 3MAHA 3RBXA 1S77D 1AJBA 2FTRA 1ALIA 1YJVA 2HLTA 3LOUA 3JSMA 1VQ5S 3M30B 5L1KA 1NB7A 4LFBJ 5KFHA 1ZZFA 5KFFA 1C1CA 4V19X 4EUVA 1FDNA 4R0JA 2B51A 6FDRA 3U1MA 3UDVA 2W9CB 2HNDA 5IQQA 4DQPA 2YKOA 3DM2B 3I5CA 2XNQA 4ZHRB 4CYSA 5JXSA 2KVIA 5KAKA 3GWCA 3A12A 1HBNA 2IBKA 3M2RA 1AT1B 5D0EA 5MLCV 3UN3A 3VGUA 3W9HA 1T8EA 1U7LA 3MD3A 2MSSA 3EZUA 3IFEA 1KQFB 3J7A1 1IQTA 2VC1A 3BKTA 2HHWA 2NR0A 3EGNA 4O0NA 1R0BG 4DR1F 4IRKA 1SHQA 4KTQA 3AXKA 2DR6A 3UCGA 1HHQA 1NDKA 2E44A 1B0PA 4EFAC 4OJHA 1NJXA 4USVA 1NDPA 2YQ0A 2IM2A 1XTZA 4DN0A 2F8MA 4FVCA 3PTWA 3HZGA 3VVUA 5J1EA 2CPZA 1YZ6A 2WTFA 4ZJQA 1PG5B 3THVA 1SL2A 4WXOA 5IT9U 4JP8A 5IOLA 3BBCA 3WZ0A 1SJRA 1K9MT 2ZEJA 5KG5A 4DPOA 4HDHA 1W2BR 4JI5F 2C42A 3GONA 3RB0A 2HSEB 2W9BB 1TV6B 3GFXA 3GIMA 2ZUGA 4N8NA 1T9VA 2E9TA 2RS2A 3ISNC 2FHOB 3P3DA 4K4SA 1M0SA 2LA4A 1TELA 4AL7A 1S1WA 5GAEU 4DQQA 2RS8A 3BQ0A 3ENWA 2IVMA 3T5HA 1N33F 2Q66A 3ZO7A 3NKOA 2PN6A 1WOSA 5K8OA 3GQCA 1WNEA 1TVRA 2KXHA 1KLMB 2V67A 5M2RA 3ULHA 3HDSA 1S76D 1WDDA 1HNIA 3ZNUA 3BBFA 3OTEA 1O99A 4M5GA 2ANHA 3TA1A 1CQMA 2HQCA 4I1TA 4ZG9A 2QZ8A 4ZMMA 2DYAA 2HNZB 3HSZA 1AUSL 2DNLA 3S6EA 4Z7CA 1Q95G 2B8PA 2VC0A 3H7HB 1Q86T 1JKHB 4LF4F 4Q8EA 3K5MA 2R7QA 2EFGA 1NU4A 2WSFC 2GLQA 3MECB 2GZOA 1Y3JA 2NXCA 3GILA 1F6TA 1QE1A 4BLGA 2M88A 4RW9A 1K8AT 1NPRA 1E3CP 4LBHA 3W61A 1UJ4A 1WG1A 3JQKA 3UE2A 3DGPA 1SIZA 2JJ4D 3PNIA 1NM2A 2XYPB 4I2QA 3VWSA 3NS6A 1SKSA 1TAQA 3HF5A 2HHUA 4GVLA 2B8QA 1TFWA 5EUHA 1HQUB 2MGZA 1LK5A 1UA1A 4C8OA 4FXDA 1HW8A 3DOKB 4ANCA 1WHXA 5HN0A 2M7SA 4KRWA 4A46A 3VALA 2ZNZA 4KHMA 2W9BA 1I5OB 3BB5A 3P96A 5EWFA 1RQ0A 4LRDA 1CPZA 3ZFVA 1F0XA 1FRKA 4JI2F 1X5PA 2G0IA 2Q6CA 1UWBB 2R7RA 4J9QA 3PV8A 2YNGB 3MWBA 4NLYA 1UMJA 2DNPA 4I2PB 4JI2J 1XQIA 4PQUA 2GA3A 1U6ZA 4YFUA 4N56A 3Q8RB 5K14B 4FS1A 3TI0A 2IUCA 1N0VC 3KD8A 2AGPA 4OX6A 1TVRB 2F8HA 3DLBA 3R2DJ 3OW2R 3OLBA 2DHHA 2OD4A 1VJWA 2KG1A 2DR9A 1HNIB 2J9DE 2R4FA 5C7PA 1NSPA 2C3UA 4DEZA 1JLBA 4LFBF 1YJNS 4HKQA 4WP8A 1S97A 4Q0BB 1D9FA 2FHKA 3A8JA 3QYYA 3IDDA 3I5BA 1JKHA 3KMSA 4Z7YA 3RR7A 3PRBA 4CLFA 4X65J 2XZDB 2ZHAA 4BBYA 2FVSA 1S9GA 3DI6A 1RSCA 3MPWA 3O2IA 2HVDA 4DXLA 2O67A 5EHHA 1S59A 1C0TA 3SQGB 4RW9B 4EYHB 3V4IA 3TQEA 1ELOA 2E7XA 2W01A 1EZZB 3WHIA 2ZH5A 3B82A 2HFZA 2IMWP 2C2EA 2W4DA 1AW0A 1KQKA 3N6MA 2C3MA 2VIHA 5CHCB 2V6AA 4PXCA 3W8PA 5KG1A 4J9SA 2JRSA 2IFXA 3JQMA 1C0UB 5ETVA 3W2VB 4EK2A 2XGQA 5CQGA 3H4BA 4EEYA 1RTJA 4O3QA 4YDDB 1JB0C 2L48A 4J9NA 1RTZA 4EBDA 2MHEA 3CO0P 1ULRA 4LRBA 1Q8KA 2DEJA 2O1PA 2UUWA 4KFBB 5DETA 4GKJJ 1U1PA 4QIGA 4ZVFA 1U8WA 1F60B 1VFJA 3EVWA 4OFZA 1RXOB 2DNOA 4ZVOB 2E1CA 1FJ7A 3PRVA 3C16A 3CMQA 3D7SB 1J2VA 4ID5B 1HI0P 1URAA 3J81Y 3GIIA 4RW7A 5CABA 3DN9A 2MB0B 3PDNA 3HSDA 4KT0C 4B17A 1RE1B 3BGUA 4CLWA 3KHGA 4QU7A 3DRXA 5HLFB 3TO8A 5KG3A 4ZCKA 3N28A 2Y8YA 1VQMS 1TL5A 2RQMA 1U0HA 2EFOA 4USTA 1BQXA 1BXNA 3QRQA 2HHVA 2DNZA 3IS9A 1HWUA 5B09A 2VA3A 3GLJA 3S1TA 2QA4G 3OQ2A 2Z2YB 2DHGA 2BE7D 2XY6A 2QT7A 5H9EJ 2VPXB 4OI0A 4ED4A 4P2XA 3L3CA 4NCAA 2VONA 1YJWS 3GV7B 1P1TA 4ELUA 3M6WA 3ZZTA 1KEKA 3FEZA 1SJ1A 2CDRB 2XNRA 3FC9A 3BGRB 4DR5F 3RBDA 2ZDOA 1TL3A 1FKPB 4B3OB 3BDFA 4DL7A 2HURA 1QSLA 2BACA 4J9UE 2UXCF 3PW0A 1X60A 2RIJA 3BM7A 3M32B 4GVBA 4NMLA 5F41A 3I9V9 3TZZA 3MEDA 4PXBA 4I6WA 5IZHA 1RTJB 1VLYA 2NXJA 1KOHA 1FE4A 2BBEA 5IV4A 4B9VA 2DRAA 3BDGA 1GH8A 3HHLD 4G65A 2CRLA 3KG1A 2UXBJ 3PEJA 3ZTOA 2VICA 1H38A 2ZJPQ 1NK6A 4KAYA 5CAAA 2DNGA 1HLWA 1U09A 4DUTA 3TZXA 2CYYA 4EMDA 1F9FA 1VQ6S 3KK1B 5L0KA 2AGQA 2APOA 4LF5J 1ZAWA 4YDXA 2AD9A 4HT5A 4MKAA 4WE1A 3V4MA 1YBAA 1T0TV 2MDAA 2YNFB 1Y9OA 1XBWA 5BXIA 3M8YA 4XPEA 2R7VA 2XG8A 1RT2B 2EK1A 4K2JA 5HLFA 4PYAA 4P71A 4DV0F 1NZ8A 1XNQF 4RBUA 2U1AA 2RB7A 2FJDB 1S99A 4IG0A 5EGYA 4ECRA 2VFUA 1NXIA 3BDHA 3H5UA 1R8HA 2Z4PA 1DLOB 4M5DA 2IDEA 4QZVB 3OTCA 2Q79A 5HK4A 2GAHC 3QO9B 2HZAA 2ZWPA 2CPEA 1H73A 2B7CB 3SSRA 4CZCA 1O5JA 3J7Z5 4DS5A 2OPQB 2GVZA 4K4VA 1OPZA 3OL6A 4NEZA 2OUGA 3THPA 1WI8A 1IBKF 1S6OA 1U8SA 1N6QB 3P6YC 2R8KA 1S12A 2PI4A 2HEKA 3M8QB 4WJBA 2LYVA 3MTKA 2L08A 4CNYA 3JYTB 4WKYA 5DG7A 2QTWA 4N47A 2EKYA 4UZBA 2GQCA 2ZBQA 4DL2A 1AJCA 2MQOA 2ROPA 3BN4A 3PCOB 3M9MB 1S9FA 5DLFA 3PX6A 3K8VA 4LMZA 2DJWA 2VF3A 3L7UA 4LSNB 3WIUA 2IVYA 1WKJA 3QZ7A 3EYZA 2BE2B 2OPSA 1MMNA 2BRLA 2VQEF 2AJ1A 5KFYA 2X1FA 2CVEA 1G7CB 3G6XA 2M2BA 2WVFA 2BJ9A 1VRTB 1KP6A 4Y65A 5BR8J 1Q53A 4QU6A 2XSJA 3FFIA 3HHLA 4C11B 3LANA 3UCZP 1RWUA 3C6TA 5KFAA 2YNFA 5CD4H 4K0KF 4FNIA 3MM6A 5DLWA 3C46A 1Q79A 1LEOA 5DDRC 1WJ9A 2AT1B 4CT8A 5K8NA 4PWDA 1RWPB 4X66F 3Q8YA 4YR0A 4DV6F 3X1LB 4DX6A 2NXNA 5LMNJ 4Y2IA 5A6PA 3HX9A 4IR1A 4KR0B 4M5DB 4DU7A 2AEMA 1Q7YT 4LSZB 4CDIA 5JUMA 3H98A 2WB4A 4HHJA 1C1BA 3VV2B 2ADBA 4X64F 1ACMB 3MAAA 4URGA 2HBQB 3ZNJ1 3P8BB 3CXCR 2NSBA 3EPGA 2XHCA 3LQVA 4IH5A 2RE1A 3UDEA 2CUYA 4KO0A 1RDRA 2EW9A 1F3VA 3OFEA 1BQMB 2XZTB 3LTOA 3Q8QB 4CLSA 2CQBA 1U02A 1SC1B 4DR4J 3KLGB 4G3IA 2RT3A 3NKQA 1NLKL 3T1YF 4NXMJ 2ASLA 3SBMA 3HHEA 1U6BA 2EBEA 2HVZA 2M9KA 1M5SA 2CQGA 4L75A 4E2FB 3DLKB 5KG4A 3QSYB 3AY0A 4LSNA 2HBZB 1AJAA 5IJQA 5HRTA 2VUGA 2FHJD 5K9FA 2EC2A 4RX6A 1GAOA 3B4MA 2X3DA 4F4ZA 1WOOA 4L3NA 1GEHA 5D0RA 2ZM6J 2LEAA 3OXGA 1GMWD 4NX9A 4ZP7A 3TZWA 5F8MA 4JI0F 2ADCA 3DKDA 1WG5A 3C6TB 2DPJA 2ZITA 2IM0A 1TKXA 1UAWA 2FLNA 1LXNA 3MM6B 1D9DA 1RT3A 1D09B 3GG1A 3ET6B 4HT7A 2GC8A 1NJIT 4UOOA 4KSEB 4H4OA 3QJLA 1EARA 3BF4A 4G1QA 3HO1A 3JSRA 3N9UC 2EFQA 3QGGA 2K7KA 4B08A 4A8FA 4WKRA 3OR1B 2VASA 1FRXA 1HDHA 4B9TA 2Q43A 1OY8A 3A13A 3O1LA 3SDEA 5KFUA 5KG0A 1SXLA 1Y4ZB 4C9DA 4MY4A 2V8GA 3AJ2A 2IDLA 2QSWA 2ZE2B 3M4XA 2J6SA 2UUAJ 3OFHA 4YR1A 2AGOA 1DJ0A 5G4DA 2W2OP 4AL6A 2HQGA 1JJCB 1S1XB 3PKYA 1QSSA 1Z4UA 2WVCA 3H59A 4RPFA 3UWTA 2ACYA 3ZXWA 1RTIB 4U67Q 2I38A 2E66A 1RWXB 1SV5A 1U25A 3EDQB 3FKBA 3KLGA 2CPHA 1R8AA 1FDBA 4M5MA 1HHTP 5T41A 2HHTA 2W5QA 1R6YA 3IGZB 1Q5VA 5LRMA 2MEWA 1QVFR 3HFKA 3BR9A 4Y3CA 3G6VA 4M5IA 1VQPS 3K0JA 2DGTA 2ZHBA 1LNQA 5LM7E 3D3CJ 2VKZG 1P9YA 4GC6A 3AA9A 4PWWA 5F8IA 1N36J 4WK1A 1NH7A 4C8LA 1CJTA 2AYBA 4MKVA 4DDFA 3WX8A 1XERA 3RYLA 5F9NA 2HHHJ 4ELVA 2E5LJ 4CIOA 4OZ0A 2J9DA 4B3SJ 4Y34A 3M30A 4ALZA 3GB0A 1BGXT 2LKZA 3G82B 3GSIA 4RR5A 3Q8UA 3EGZA 3RW6A 3HSJA 3NCQA 1R7IA 2W9CA 3TA2A 2H4WB 4DR4F 3EZOA 2B9XA 1RAJA 1FXRA 2QGFB 2N3OA 4YQWA 4ZHRA 4DLGA 2J7UA 3CCTA 3E51A 3A52A 2P9EA 4ZDNA 2CNLB 3M7VA 4E98A 3MR6A 4U9RA 1GX6A 3MM5A 3CIZA 4NA1A 1DTTA 1RWOB 1L3KA 2A10A 2MLYA 2XM3A 4X64J 3LP0A 5D3GA 3HFVA 4IRDA 2ZE2A 3MHYA 3VVTA 1RTDA 1UTAA 1MNEA 3ZTQA 4J9OA 2OEKA 2DGOA 2PA3A 3B6BA 5D78A 5LMUJ 1LV5A 1EW9A 2PDAA 4JI4J 3FK4A 2ASDA 2MKSA 3EXCX 1IKWB 2MSTA 4H4MA 4I69A 5H9FK 2EFNA 1RABB 5KFZA 4ZA1A 4LR8A 2AHOB 5E3CA 1YI2S 3AB4B 3NCPA 2QL5B 2RKIB 4LR9A 2ZZNA 2CPXA 1HNWF 3SZZA 4L72B 2OPRB 2J9CA 3CE8A 2LXFA 2LLZA 1SC6A 2Y8WA 1WHYA 1H3DA 3I5AA 2IAJA 5D0HA 4RUCA 1RT1B 5LMUF 2FIUA 1TL7B 2BJ3A 2HZCA 1CJTB 1RLCL 1PJ6A 3LF0A 2J9EA 1PAUB 5DLVA 1VK8A 2KT3A 2R8GA 3KG4A 3BGLA 3FCVA 2VZ9A 3N6NA 1C4AA 3FMBA 4MKBA 1Y3KA 3G82A 1REGX 2ROGA 5KG6A 1YBTA 1Y5NB 4MK7A 2CQPA 2K1RB 5LIAA 1HA1A 1VR6A 2QMWA 5HSPA 2BA9A 3ELHA 3EUNA 2OFGX 1Q5YA 4IDKA 4MYUA 3U02A 2R8IA 5KFSA 3BKUA 5GVQA 2MQNA 2ZC4A 3QGPA 4MMOA 2IPOB 3W9IA 3Q24A 4B3RF 2OSRA 1VHIA 4OYMA 4B3TF 1TUGB 2F1FA 1S1TB 1DTTB 1S1UA 3IC1A 1FKOA 1XNRF 1ICEB 2YKQA 5D3GB 4HLBA 4R8UA 3NWRA 4UPKA 1DAXA 2RF2A 3T19A 2YPZA 1N5VA 1MROB 3A4TA 2BW2A 1TFYA 2OTJS 4PG8A 1RAGB 1WC3A 3AODA 1U24A 2BUNA 1KOOA 1REVA 4LJMA 1IR0A 5L9XA 1ZAVA 2OHDA 2WBRA 2W1BA 2YH1A 2E7VA 3ZZ0A 3H25A 3G4SS 2PT0A 5I3UB 5HJXA 3IRXB 1DRZA 4USJC 5CYQA 2HVIA 2R2RA 1JJ2R 4F26A 5L8RC 4CH0S 2L41A 3TA0A 2BKOA 4Z2XA 1XJWB 3CDEA 4CO0A 3H2UB 3KJVB 1S0MA 2DXFA 3HVAA 2Y0SD 1HBOA 4XDDA 1TL7A 3R6LB 2CJAA 2RDJA 1FRLA 1U1KA 3MI7X 2B9EA 3OFFA 4DOZA 4I2PA 1ZZNA 4PQUB 3EVMA 2KFNA 3RZAA 3DNCA 2ZJQQ 3R5GA 3MCNA 1NMEB 4C97A 2H1YA 1PJ5A 2KYZA 1W26A 4F7VA 2VKRA 4RKUC 5D4OA 5HBMB 3OHAA 1JLAA 4LF6J 2JSXA 4FF2A 2MLZA 4CO3A 4Q5VA 4ER8A 3OVAA 3JSYA 1H98A 4MHXA 1WC4A 3GJTB 5J2NB 4R5PA 3OLAA 1U45A 1HPZB 4FPRA 2VPWB 2F8EX 3Q8PB 5KT5A 3QT5A 3CJ8A 2V4JA 4PYDA 4L74A 3CGIA 5K5MA 1EIYB 1ZBTA 3D2WA 1VQNS 5IQ6A 2MQMA 4TY8A 1IUJA 5CYMB 2MZ1A 4QR2A 3T1AA 1OPIA 3HULA 3QBCA 1YRTA 1VRQC 4ZVUB 2MXYA 2EK6A 4USHA 2CQIA 3LP1A 2GCFA 1VYAA 2B4PA 3MMJA 2AYEA 4ZVSB 3J7ZT 3R1LA 4YB6A 2KZZA 3BREA 3W5XA 1URNA 4UF4A 5KT7A 5HMZA 4B9LA 4KAVA 1M90T 4DG1B 1SPBP 1C0UA 3W2VA 3TUZC 3WAVA 2XR9A 3KJVA 4Z37A 1FRHA 4ZVHA 3BQ2A 4P75A 4AQYF 5HROA 4OYBA 3VGVA 1NSAA 2DBBA 1FNOA 2XMVA 4H54A 2HAFA 4XPCA 2R9LA 5JVHQ 3CD6S 3AH6A 4M5HA 2R2UA 4NCGA 1IJFB 2XC9A 2IY5B 3DLGA 3AAWB 4ECUA 1NJYA 1KRPA 4ZS6A 2RRAA 1FERA 1CLFA 1FDDA 5HBMA 1RA7A 3HD2A 2J5AA 1IXKA 2VJVA 1PYTA 3GCWP 5AJ3J 2B56A 4R5PB 5J2NA 3MUTP 5L0BA 3UD5A 3G6ES 3C14B 4DUYF 1ZEFA 2RHSB 4QWCA 3CC7S 3W5YA 4ICLB 1PC5A 4V19J 1UVJA 1VI7A 3I96A 1N5QA 1YG0A 1WF1A 3BR8A 3KK3B 1LWEA 4ILLA 1TMMA 3CD5A 5KT2A 3ILJA 2E5IA 2ZKTA 3M9NB 4ZJLA 4ZP9A 1HQEA 2D9PA 1TL3B 3HCXA 3GV5B 2QA2A 5ETKA 3D1HA 2YX4A 1QUPA 1E6VA 3MR5A 2NPFA 4CCHA 2A2CA 1DY3A 2W2MP 2LP4A 3M32A 5E2QA 1CSJA 4PUOA 4FYDA 2Y1IA 2BW7A 1FI4A 3PW7A 3AD8C 3K17A 1UVKA 4HHUA 2YY3A 2Y1JA 4CWBA 3B4DA 2FHJA 4ZLLA 3BDGB 2NUHA 1UP1A 3I87A 4AL5A 5HROB 2VBYA 2R8JA 1HFEL 1AA1B 1QUVA 1GMWA 2WHOA 4RNFA 2LXIA 2V69A 2M70A 1ZYQA 1B64A 4GTZA 5KFRA 1H2TZ 4ES2A 2AQ4A 3DM2A 2QV6A 2V2QA 1RHRB 2XMTA 4FKYA 3LP2A 1P27B 2CQHA 5DM6Q 4JI7F 3OL8A 4QPTA 1CC7A 5CZXA 1X5TA 4P72A 5KFNA 1PYOB 3A1YG 2NYIA 5L0EA 5J2QA 5GAEI 5U47A 4HH1A 2B7BB 3BN7A 3LALA 4IFVB 4UOHA 4DHVA 5CCMA 4C8KA 3R5CA 4C0BA 4C8ZA 3AOBA 2D74B 3J80U 1B4SA 1LWFA 2XI2A 2AF6A 1RWKB 2MTLA 5DDOC 3OV7A 3KLVA 3RAQA 2W7AA 5IC4B 1DLOA 1U2FA 1UJ5A 3BYRA 1PSDA 2BV3A 3DOLA 2UXBF 3CJ3A 2LDIA 3QO9A 3TEGA 2MY7A 4A8OA 5DQIA 3RB4A 2RHQB 2R7XA 1JX4A 2XZWA 3BH6B 3DRPB 2PMHA 1NCLA 4ZKAA 3KLEB 1HBMA 1UEKA 3PJWA 4NZ7A 1EP4B 1UFWA 3DLLQ 5AJ9A 3Q89A 4USUA 4OI6A 4XK8C 1NH8A 1T9TA 4PUOB 2DT9A 5B0BA 4WBFA 3FEYB 4PXEA 1YX2A 3EM1A 1DQAA 4UTGA 2PMWA 3D0HE 3UI3A 2A6OA 3CMES 1HWJA 1PC4A 1WF2A 2B3TB 1L3TA 2FJXA 2E1MC 2P6SA 4TVAB 4Q45A 1PGZA 5G0RA 2B4UA 1N32J 3KNAA 1S1WB 5DLTA 1V5IB 1NK7A 1NKCA 3WBZA 1MMDA 1WTBA 4B3SF 3Q86A 2XCPA 2RQCA 4C0HA 2DHXA 4JV5J 4FVMA 1DBDA 4L6V3 4M5LA 2DTJA 3KTQA 5C24B 3CPWR 4DSKA 2AJ2A 4J9LA 4PWDB 3SZYA 1DURA 2FC9A 3TUJC 1FRIA 4M5NA 2K8GA 2AJFE 1S72S 5LL6d 3ITHA 5KOWA 3OL9A 5AXNA 3MGJA 2VQRA 5I3PA 3OTOF 1FX2A 1Y10A 3D1OA 1VQ9S 2ZDPA 3FBEA 3DU6A 4PG5A 1V3SA 1FWKA 4PZVA 5F3ZA 2QLXA 4UUXA 3MMAA 1C1BB 1EB0A 4AD6A 4AFFA 1NHUA 2YKNB 4A8YA 2KFZA 4I56A 5J2MA 5DGBA 3HT0A 4I2QB 4IG3B 2P8IA 3K5OA 4TXSA 1Z1ZA 3G86A 4KO0B 4X4NA 5B0AA 1OQ6A 1X8DA 3A3NB 1ZTWA 5L9NA 1CS4A 1LW0A 4LFCF 2FZGB 2Z2ZA 4NA3A 2B0GA 1YRXA 4UPHA 3PKMA 2FVPA 3DLKA 5K14A 2EBGA 4EBCA 3D68A 1RTHB 3UVJB 2Z30B 5FDLA 2IC3B 1Q8BA 4OV6A 4X65F 4NYPA 2BQRA 1KR4A 3J81j 4MIWA 4OZLA 2DISA 3QFHA 4M5KA 1JLBB 1TKXB 1V5VA 3H8YA 1O0PA 3FBBA 3MMBB 1NHKL 1RT3B 2X3GA 4I4BA 3ET6A 4NLQA 4OLPA 2VQFJ 4F4KA 3NMAA 4UPLA 4A4JA 4UQGA 3GR1A 4ENOA 2M8HA 4LBIA 1N34J 2HQFA 3AQOA 4IOCQ 5SUHA 3RB3A 4DR1J 2CQ2A 3LAKA 3DI6B 4OHVA 5FLXU 4G6VB 1B8JA 4P2MA 4Y2AA 3W1YC 5BJRA 5L38A 4Q44A 3SDEB 1IKVB 3MMAB 1VCTA 4OI1A 4TYAA 3MUVP 3G87A 4Y2KA 1E1ZP 2PEBA 1N88A 2A6MA 4NWBA 1AUKA 5B08A 3CO9A 1UVMA 2H5IB 3TZYA 1LFPA 1JLGB 5D4PA 1H6KX 2ZBPA 1HARA 2JZ5A 2VFTA 3P5TL 4S0MA 2BVZA 3C15A 1PCAA 4KFBA 4CO2A 3Q23A 1NB2A 1RWVB 3K7RA 3SCLE 3IAS9 4UT4A 3V81B 1RT5B 3O44A 3IM9A 2VJUA 3CDAA 3TNVA 3G2XA 1VC6A 3GIRA 2MQPA 4DV6J 2E5GA 4KGXB 1ZM9A 2MQQA 1U26A 3ENQA 2MZSA 5FDLB 4RUAA 3PX4A 4G1IA 3Q0AA 2UVVA 4UOPA 1ANIA 2C1EB 1TL1A 2DK2A 2GVDB 3A8KA 4DFMA 1T03B 3PYGA 3PY8A 1KHVA 1U2CA 1AFJA 4WCEQ 2H48B 1D1UA 1MG7A 3OTBA 2ZFHA 2BMBA 3ADAC 4ZPDA 4AUKA 3PIPQ 1FTRA 4A8QA 2W8DA 4ZJOA 5HATA 4QIWD 1TTHB 2M4MA 2NPIA 4C7QA 3BO3A 3KNGA 2DPIA 4TU8A 1DTQB 1PIEA 1ZM4A 3MOZA 1DZ5A 5JMNA 4B02A 8ATCB 4JV5F 4NYOA 5H1SV 3M6VA 1TK8A 4QW8A 2XYHB 4AXJA 1N48A 2JEJA 3T6BA 3GMGA 1IBKJ 2A0FB 1Q8LA 1TU0B 3OT9A 3QJJA 4B9SA 5A0YA 1OIAA 3A3OB 1SI9A 2CPYA 3OD2A 2OJ3A 5D8HB 3DPCA 2R8HA 5ITHA 2CJXB 4NXNF 3IGVA 3KYLA 3ENVA 4DR2F 5GMDA 4TU7A 2DD8S 4OZ3A 1AZSA 3QFWA 4UOFA 1T05B 3K5NA 2NQPA 2XMUA 4B9NA 4K50A 3L7PA 4UY85 1BWVA 1AB8A 2DHSA 4QIVA 3G8QA 2F5GA 2UP1A 2FGOA 3MEGB 2GJFA 5ETQA 1N34F 4ZPVR 4ED0A 1NDCA 2Y3YA 1LOUA 3M1VA 1S9EA 5ETSA 3TX8A 4KGKA 2OPRA 3VQTA 3H5XA 4C4WA 3N0VA 3TX0A 2V5HG 3WBHA 2MKYA 2V8VA 3DU5A 4DU8A 3ISND 5ETPA 2HRUA 3RAMA 3M8PB 2XS7A 2Y0BB 2IVFB 5KT6A 4JYAF 4L76A 3PR4A 5J1NA 1WI6A 1ZPWX 2LXUA 4JI6F 3CNQP 3PO5A 2UU9F 1SUQA 4C8NA 4B9MA 2BYCA 2GQ2A 4DPWA 1R0AA 1BUXA 1IKYA 2QX0A 3HVTB 2M0GB 3I6PA 3GCXP 3MF5A 3IP0A 3ZZZA 3G71S 4U7UK 4ZVGA 1QAIA 2ZZMA 3CMRA 1X7VA 3EGWB 3VQSA 2BJ7A 2I6WA 2W4PA 1S1TA 2WCXA 4A8SA 3GYNA 3SXLA 2FVRA 2HVHA 1S1UB 3FDSA 4M1KA 3R3TA 1H2UX 2CNKB 3BQ1A 4JI6J 3AOCA 2LU2A 1FD8A 2AX0A 2OELA 2YBVA 3DC2A 1UL3A 2FD2A 3MAQA 3W65A 2KHCA 3K58A 1Q16B 4ED6A 4WIQA 5A8RB 1YLXA 2JLEA 4WIIA 1S79A 3GP9A 5IWAJ 1UZDA 5DG8A 1YZ7A 1FRJA 3WAYA 1D3WA 1AZSB 1RJJA 1YIJS 1SH2A 2B6AB 2PIIA 2FYXA 1GTHA 1WORA 2I2YA 1Z2LA 3D0IE 4N5SA 2C3YA 3OTOJ 3M6UA 2R2SA 1TUWA 4ID8A 4HHHA 3M1VB 1VRTA 3K57A 2VU5A 2VB6A 4RU2A 3OHBA 1MWYA 3HHNB 4LR2A 3CW2C 2HPUA 1GXTA 2F9JA 5DJBA 3SFUA 4KGVB 1WHWA 2F63A 3BKFA 2W5RA 3H42A 3CCWA 2LQJA 2V34A 3ETMA 3M8SA 1RU1A 2DR5A 4FF1A 1KH5A 3MR7A 1KHWA 3H0PA 1E2SP 3PG9A 5HVHA 1YK9A 4HVZA 1R0AB 5HANA 1RCXB 1L3SA 5I4MA 3N5BA 1S6PB 1YJ9S 2C2RA 4NZ0A 5J2PB 3MR2A 4X4RA 3SV4A 4A47A 4DQIA 2HS4A 3HVWA 9ATCB 4DX8H 3CCRS 1S49A 3C6UB 1TKZA 3TAMA 5KFTA 1B7FA 4RJVA 1R6VA 2CDQA 2L3MA 3AHPA 3M8RA 2IYGA 3FRZA 3MPYA 5D0GA 3AA8A 3WAWA 3UQSA 1Q4RA 2XYGB 1CJVA 1TKTA 2RU3A 4I6AA 5B7WA 4FP9A 2DR7A 4KM4A 2J0WA 3VCDA 2UU9J 2B6AA 3R2CJ 2K3IA 1XMBA 5IC6B 4GTYA 3RRKA 4NLXA 2JLFA 2GJ2A 2IJRA 2QFJA 1E6YB 3AT1B 3CB4A 3IBWA 4ZPCA 3WDOA 1ZM3A 4YHHF 2CQ1A 1TK0A 4JOUA 2W8LA 3SV3A 1RAHB 1LXJA 1WHVA 1X5SA 2BM1A 3HJFA 2MKIA 2R7TA 4Q8FA 1CG2A 1FF2A 1FEHA 4RL1A 1VBXA 4Y28C 2UXDJ 1BC6A 5F8GA 1T02A 1TUVA 1WD6A 2WRMA 4CO5A 2DRDA 2GSOA 1KSPA 4H4OB 5LSLA 2G13A 4JI8F 4BDPA 1VMBA 2FVCA 4OI4A 3RUBL 5IWAF 4HDGA 1JLQA 2L9NA 2R7WA 4ECTA 2EXUA 2AW0A 4DFJA 4JI8J 1JLEB 5KFWA 2Z2MA 4CLKA 7AT1B 4NXNJ 4U7CA 3BH7B 4RU9A 1TZ0A 2RNEA 4HL9A 4Y0FA 3Q3QA 4PQAA 1KFDA 1PBAA 2W4CA 2MZJA 2UXDF 1R3NA 5I3QA 2WVDA 4KH0B 5EGHA 4I68A 5GAHI 3N6LA 1RUSA 1KHLA 4NYZA 1S6UA 3LPEA 3IBCB 2V4RA 5C42B 1BD6A 1S1XA 5LMNF 4QW9A 3UD3P 1MMLA 2YKMA 2MZTA 3D6HB 2I5JB 3N79A 2R2TA 3P45B 4UPIA 3GU0A 2NLWA 4WFYA 2WK4A 3TJAA 3CSKA 1PBUA 4MTPA 1FNXH 2E1PA 1HNXF 3MM9A 1TP7A 4NLOA 3OBIA 1HMVA 2WOMA 4JYAJ 1UPMB 4CH1A 1TAUA 5FIIA 4JV0A 2EC0A 4F02A 3D28A 2EFVA 2M3DA 4F0KA 5IT0A 2BOPA 3PJXA 3EWGA 4FDFA 4DBQA 1UFLA 2PC6A 2YXLA 3TUIC 2BRKA 5K20B 1T3NA 2UVRA 1KHNA 4CYRA 3MCSA 1DHMA 4RZRA 4IYQA 5DRKA 3VZIA 4DV2J 2WZ1A 1IQZA 4NL5A 4PKDB 3HHLC 3I0RA 4ED1A 1YQHA 5ETRA 4QQBA 4WF9Q 4QAXA 3S01A 4ED7A 1FTCA 4M95A 2QRRA 1YHQS 2DITA 4EI2A 1KLMA 4PPDA 3MCOA 5A8WB 3CJKA 2XMAA 1UCNA 1JLQB 5B0GA 1RYRA 1JLEA 1KONA 2DNNA 2Y1RI 4RW4B 1I6JA 2LQ9A 2UUTA 2VFSA 1GXUA 4KE5A 2CG8A 4OJGA 4FXVA 4QR0A 4RBTA 2YWGA 4USKA 3IN5A 1RTDB 1KVKA 4JI5J 4AE5A 1LWFB 1H74A 1WEXA 4CLZA 2V0NA 5A8KB 3MPUB 1QAXA 1ZEBA 5H9FJ 3X3UA 2YKMB 3DOLB 2I5JA 1OSCA 3LH2S 4O23A 1SQFA 1ZPVA 3BJYA 3QT6A 4JB8B 2VH7A 1GQEA 1P9QC 3M2UB 4C3KA 4U6PA 3DGPB 2ZBCA 1IM4A 2RKIA 3U1NA 3HM9A 3KLEA 3UR0A 2HGMA 4DR7J 4KHPF 1EETA 3CEDA 1EP4A 2H5JB 4RW8A 4XTTA 4WWSA 3OJSA 4CLYA 4JI1J 1RT1A 1NZAA 2KO1A 2ZH6A 3NWGA 4LF5F 2BJDA 3T41A 1WC1A 2AJ0A 5M2PA 1KVIA 2YX7A 2QYGA 4DV1F 4MFBB 3F73A 1UEUA 2G2YA 2HFVA 5KFVA 3D66A 2J76E 3DHXA 4ILRA 4X4SA 3UPFA 5HQ8A 2UUBJ 4OYZA 3CD7A 1KNZA 1W7WA 2KM8C 1S7IA 2MLXA 2H65B 4F3MA 4F8RA 2QLBB 2BOAA 5C25B 4RW4A 5DGAA 4KJDA 2QN6B 1K1SA 5C24A 3CCZA 4JI3J 3QAUA 2XLKA 4K7QA 3Q8SB 4R8UB 3OJUA 3GTYX 2IFYA 2CPIA 1B3TA 4L73A 1UPPA 1MROA 1XR6A 2GJIA 5FLXY 3BGOP 2H51B 3NNCA 2LU1A 3F44A 2KN4A 4FYYB 3I32A 4MIBA 1X9SA 5FJ4A 1REVB 4WXWA 1SCJB 2W5XA 4FDIA 1WDTA 2VD3A 4B9UA 1C0TB 3SQGA 3O3LA 1PYSB 4GRSA 1AXQA 1OYDA 3KLIA 1Q78A 3QIPA 2VBXA 2WSCC 3M2UA 4E8UA 2ASJA 4LQYA 4TN0A 3I9ZA 5CYQB 3GYGA 1HI1A 5HP1B 4IG3A 5JVGQ 1EETB 2RAQA 2VL1A 1X4AA 4LF9F 3B54A 1WG4A 2IJFA 2MMYA 1Y00A 1RADB 4KBIA 2QC3A 2HHXA 2PFDA 5KFDA 4DZDA 1VQLS 5KOXA 1KS2A 1LWCA 2V8DA 5CA5A 4LF6F 2DIVA 1MW7A 4A8WA 4DR6F 2X1AA 5IM0B 5FD1A 4MFBA 4PPZA 3JTPA 5DQGA 2K3KA 1RHKB 3PACA 4ETXA 1X0FA 4GKJF 1S4FA 1RBOB 4TYBA 3DGVA 3DHWC 4H4KA 2QEXS 1PILA 1U0SA 4NMXA 4RW7B 1OO0B 1S0OA 4LF9J 3GJSB 3JSBA 3QATA 4ZPAA 2J8SA 1N5TA 3EJMA 1KBRA 5C25A 3LUYA 1FDAA 5HAOA 4HI2A 4RWWA 4O4GB 5KFPA 4DV0J 1FD2A 1U0HB 2G9YA 1C2PA 2B9WA 3I4PA 1EKSA 1QY7A 4G1PA 4I6YA 3PO4A 4ERDA 1KWMA 2CJKA 1ELYA 3M8ZA 2XB2D 2E5JA 3MEEA 2HGNA 2GNKA 1FFSB 2LEPA 3OR2A 5BYQA 5THWA 5GAGU 1Y11A 2ATCB 2C2KB 3AD7C 2BE9B 3B78A 3FQKA 1FKPA 4HI1A 3MEKA 4KY3A 4QWEA 2E5HA 4B3OA 2GIFA 1U48A 4IOAQ 1MLAA 3NKMA 4QPXA 2HYIB 1KVJA 1VBKA 2GIQA 4GVBB 4WYLA 4CO1A 1RB0A 1VC0A 3G9CA 2OKQA 2YVSA 4A8MP 3PXGa 1RKIA 4NLGA 1N8RT 2AV5A 1KHKA 1JLGA 3IGNA 3KDNA 2DCUB 2HFOA 2NS1B 1LWCB 2HQDA 4ZLNA 3TP2A 5AE3A 5T14A 2X98A 3FNNA 1WF0A 2FC8A 3V81A 2LEBA 2MJUA 4N7TA 1QDUB 1R31A 2NSCA 5E41A 5INHA 2DHAA 2KI2A 2XLIA 3KK2A 1QVGR 2XCAA 3DLGB 4OZNA 3P5BP 2XULA 4QWAA 1QAJA 4ZPTR 4PG6A 3V6DA 3FJ2A 3N5FA 1IM6A 1RT2A 2HFSA 4CM0A 5AE2A 4Q2LA 1F3FA 3EVOA 1NK4A 2E5LF 3UDLA 3AD9C 2JLGA 5DM7Q 5E0OA 3C14A 5T7LA 3D6MB 3JXOA 3JTNA 4XO0A 4TQRA 3D6TB 2VFRA 2DNRA 4ICLA 2JFKA 1QAYA 2NXEA 2XWXA 3FUYA 3H2VE 1V3RA 1D8ZA 2MHNA 2O66A 4FXWA 2PMZD 4TLRA 4V1Ak 3UNYA 1MN9A 3GPAA 1BLUA 2PA8D 2QMUB 4CNZA 3JAMU 2FLPA 1JNZB 7FDRA 2VPYB 1SC3B 8RUCA 3MTJA 3PFEA 1RI7A 2QA1A 3DOMB 1QTNB 1JLCB 5HL7Q 1XC9A 4LF7J 1U1LA 4NLUA 1E6VB 3EZ5A 5A76A 3LO3A 2J7KA 1YSJA 2QO3A 1A9NB 3M6XA 3ZZRA 2UUAF 2BX6A 3DLEA 2VG6A 2CWXA 2P9CA 1LW2B 1T9YA 3PYDA 4OQJA 2YWWA 5DS7A 3GFZA 3CJSA 4LRFA 3HXMA 2F7VA 4NRTA 3DYCA 2B5JA 3MEGA 1VQ7S 4DX7A 1SKRA 4OHYA 3KUGA 3TEHB 3PFOA 4KYZA 1RGVA 3W60A 1SC4B 4J5OA 3ZZUA 2LECA 5J1PA 5KFQA 4LF7F 4F0HA 3KK2B 3T1HF 4C8YA 4LRCA 1RT4A 2HLUA 3BS9A 4WFBQ 1U1NA 4FN5A 2HQIA 4MK9A 1RAEB 3V6DB 3HSGA 4LREA 4KPYA 3CCLS 4QIFA 3LWLA 1ZETA 3WC2A 1EJJA 2E1AA 5GOVA 1CEZA 4ECQA 4GKKJ 4P6QA 1XMOJ 1KTQA 1KTVA 2DH7A 2YQ3A 2G4BA 4CLTA 3PZPA 2DH9A 2EEYA 5C2GA 4P10A 1BE4A 2IM3A 5EX0A 4CM2A 2DGWA 1VQSA 5KTQA 4K4XA 1YTYA 3HHDA 1I94J 3NKNA 2BJ1A 7FD1A 2YKAA 5GADU 4LT6A 3G8SA 1FE0A 2PEHA 3NGTA 3MAAB 5F0UA 3RU0A 3DRPA 4CQ1A 3SSQA 4GTWA 1S48A 1N32F 3GJQB 1JLFB 2EG2A 1U1QA 4X84A 1JNRB 2D1GA 3J7YI 5LJ5Y 1N2KA 5TJ3A 3MK0A 2OMLA 1BQMA 2MQ8A 3PHEA 3JSMB 2DR8A 2RDIA 4WFAQ 4ED8A 1FX4A 4QJVA 2G2ZA 1M5PC 1P6TA 3D3BJ 3MM7B 2VG7A 2OFHX 2A1BA 2KT2A 4OYOA 1X4DA 4K4WA 1K44A 1UVIA 1VJQA 3D5MA 4O3OA 2PI5A 4FBTA 5KFJA 1VHFA 1HBNB 4URSA 1GMVA 4DSFA 4ED5A 1JXEA 2XMKA 4ZPBA 1VGYA 2ZKUA 1UKUA 4DR5J 3KUHA 4OIXA 3W66A 1IN0A 3BO2A 1QSYA 4KJGA 4DFKA 3KJFB 2V50A 4OI3A 5GRRA 2X7IA 2G1HA 3BSCA 2DNMA 4EGLA 5ETNA 3R5BA 2UVUA 4IQXA 4QYZJ 2KRBA 4CRJA 4PG4A 4OYAA 2ZM6F 3VAIA 1HWLA 3T01A 2CG4A 4LQ3A 5M2UA 3TRGA 4ZPWR 2N4DA 1N4LA 4FDJA 3IXQA 3K5LA 5ETTA 1WUUA 4BS2A 1SJ3P 2W5SA 3IR5B 1BHNA 2JL9A 4G1QB 4K59A 4DLEA 2FQQB 1HBUA 3MDFA 1Y0HA 3MUMP 1RYSA 4F2SA 2V8HA 3OR1A 4DL5A 2DGVA 1NKBA 2YWEA 3V6JA 5RUBA 4WFNQ 1AUDA 2V2VA 2LQ8A 4C3MA 2YKNA 1BWEA 1D0EA 3W64A 3C6UA 1RLDA 1U1MA 3CCUS 2IRUA 4KB7A 2BKPA 2AMCB 4DI6A 2A3JA 2CQ0A 2W5WA 4M94A 2F3JA 2XMMA 3I31A 4LSLA 2YNIB 2Z0GA 2E1RA 2V68A 1YWXA 4D3GA 1RTIA 1H0HB 1Q0NA 2B4VA 2GFFA 1SV5B 4F50A 2VFVA 1MWQA 3MM7A 1RWMB 3KWMA 4NLWA 4UOCA 3CT9A 4NRUA 3TR5A 1N0UA 1RU2A 3C8YA 1RACB 3QMQA 4QR1A 4AYBD 4HTJA 4C6AA 1XMOF 2DVIA 1MU2A 2DXEA 2HNYA 3WQPA 2DCLA 2KU7A 2J6TA 1YKWA 1SKUB 5E5NA 2XI3A 3JAMY 3MFHA 1TKDA 3IWLA 1NUEA 2OI2A 1F9HA 4ZVEA 2XY7A 2OTLS 3ZZYA 2H9ZA 3BV8A 1RBLA 4AT1B 4ZLPA 3SCKE 4FKXA 3I56S 2RH6A 2F65A 2XTJP 2LDYA 3Q83A 4HR2A 1R8CA 2HFNA 2ZNYA 4RLEA 4CP5A 1X4HA 4PG7A 4DS4A 5LT5A 2HHSA 1XWLA 3IBFB 4C3LA 2K7JA 2W7OA 4FYXB 5KFGA 3IR6B 4Y2CA 2GGPB 4DV3F 3NXZA 2FJAB 4KKOB 4DPYA 3W62A 4QCLA 1W25A 4YUDA 3TVYA 3VAFA 3NVLA 5C66A 2MJNA 5BYSA 1NJZA 1EJ7L 1HBUB 2VBZA 4J9KA 1HL6A 3BGFA 3ENAA 4ED2A 2R7SA 3IR7B 1N33J 2AZ3A 3D6FB 2HRYA 2GV1A 4ZCIA 2DRBA 2FJVA 5CZVA 1L3VA 2UUBF 1J5EF 2D9OA 3DOKA 3SEOA 5KFKA 3TOQA 1SJQA 3RG6A 2ZVIA 2QLFB 3NGDA 3SMZA 4RBVA 1Q7LB 2YH0A 2SXLA 3R1HA 2J7WA 4ED3A 2VHGA 4DSJA 2HHPA 2YNIA 3BSNA 1IKWA 1Q8IA 1UWBA 3CVKA 1TQLA 2LQBA 2WW4A 2YNGA 3NGUA 4H4MB 3SCIE 3SYZA 3C15B 4DV7J 4LFAF 5KFMA 2QE5A 2HKEA 3CWJA 2HMIB 1FNMA 1CBKA 2RUGA 2D7SA 3D0GE 3DCAA 3MM9B 2ZOGA 3GZ7A 2IUCB 1BMQB 1JMTA 3VAKA 4DUZF 1B0VA 2VDIA 4KHPJ 3FVYA 1L5UA 4ZLJA 3IGYB 1XNQJ 4LF8F 2JNJA 1HQ2A 1RHUB 5L1LA 3V6HA 2HHHF 2E9RX 2FLOA 4Q0BA 1FJGF 4EBEA 3GR0A 4C0OC 2ZD1B 2IA6A 3NGSA 3E8OA 3I4HX 3TAPA 2ZBIA 1GK8A 4FBUA 1FESA 2DIUA 1A0OB 5D15A 5A6WA 3ILIA 4NI2B 4X62J 3T5LA 3JB9k 1S10A 4IO1A 2KH9A 4KKOA 3V4IB 1OWXA 2ALZA 1HKAA 2DO4A 2N3LA 2QIFA 3GFYA 3KLFB 1N5YB 2YWFA 1M5OC 1FWLA 4WYWA 1QLNA 2L9DA 2RMLA 1YDLA 2ILYA 2KVQE 1FKOB 1FXLA 3VAMA 1M1HA 1WELA 2D3ZA 3OVSA 1T94A 4FF3A 1FK9B 2P2CB 2YX1A 3DMJB 1SH0A 4X66J 3GIJA 4DPXA 2OEJA 2ZH3A 2E9ZA 4ZG6A 4MJKA 3TVKA 3LGNA 2IA0A 3QT7A 4J91A 3R8YA 3OSNA 1EI6A 1ZEDA 3RB6A 2Z58B 4A48A 4OLOA 3TWZA 1T9UA 2XS2A 3B5QA 4RNMA 5LRNA 4CLLA 5EWEA 2P5VA 3LWMA 1X4FA 1YJUA 1JXLA 3EGVA 2VA2A 3CF5Q 1ELXA 3PVXA 2CPDA 5KFIA 4EWTA 4F0MA 2V63A 4J7CA 4YMEA 2RUSA 1HNZF 4RW8B 5L1IA 1F2GA 4KAIA 5E3RA 1RHJB 3UN5A 5CCLA 2JDJA 1HBOB 3N4WA 2UVWA 4ZG7A 5KT3A 2EWHA 3J81U 2FY1A 4X2BA 4WPAA 2EPIA 2OSQA 4WFXA 1EKRA 3MMCA 2LQ5A 1HW9A 2MKJA 3PEHA 4KGZB 4RUBA 1XR5A 4F3OA 1YRUA 4PWUA 3KJQB 1V9OA
chains in the Genus database with same CATH topology
1E2SP 3BDGA 3LXQA 3NKPA 4KAYA 1ED8A 3UN2A 1KH4A 2W5VA 3NKRA 1HDHA 2GLQA 3DYCA 4MY4A 3E2DA 4YR1A 3MK2A 1FSUA 1E3CP 5L0KA 3UNYA 1Y7AA 5KXAA 4LR7A 4UOPA 2XR9A 3M8YA 1EW8A 2RH6A 3NKMA 3WAWA 4LRAA 4ZG9A 5AJ9A 4KM4A 2W5QA 2W8DA 3BDHA 3IGZB 5L0EA 2G9YA 4MHXA 2W8SA 4NWXA 1P49A 4LRDA 4KJDA 5LRMA 4GTYA 2XRGA 5C66A 3NVLA 1HQAA 1HJKA 2IFYA 4UORA 1SHNA 2GA3A 4CXSA 5DLTA 3UO0A 4LRFA 1ALJA 2IUCA 3KD8A 3OT9A 2W5XA 3DPCA 4LRCA 1URBA 2GSOA 4TN0A 4LQYA 1N2LA 4CXKA 3A52A 4KAVA 1AJCA 4LREA 1EJJA 4ZG7A 1EQJA 3SZYA 5GOVA 3M7VA 3IDDA 2QZUA 3WAVA 1AJBA 1ALIA 2VQRA 2IUCB 3Q3QA 2GSNA 5EGHA 1ALKA 3NKNA 5DLWA 3TX0A 3WBHA 1KHLA 1EW9A 3ED4A 4CYSA 4GTWA 4GTXA 1KHJA 2D1GA 4UPIA 4LR8A 3UN3A 5LQQA 4MIVA 1N2KA 5TJ3A 3MK0A 4LR9A 4LRBA 3SZZA 5L0BA 1SHQA 3CMRA 1EW2A 4B56A 1AJDA 1E33P 4UPHA 1ZEFA 5DLVA 1ELYA 1O98A 3M8ZA 4CYRA 5EGEA 5K4PA 3WAXA 1URAA 1K7HA 2ZKTA 4KJGA 4QAXA 4ZG6A 1KHNA 4CXUA 4ZGAA 1KH7A 5LIAA 3TG0A 1EI6A 5GRRA 1ZEDA 2W5TA 3NKQA 4FDIA 3TWZA 1ANIA 3WAYA 3IGYB 3B5QA 4FDJA 1Y6VA 4NWJA 3T01A 4UPLA 5LRNA 1ELXA 1AJAA 5IJQA 1KHKA 2W5SA 3BDGB 5HRTA 5IJSA 1ED9A 4UPKA 1KH9A 1B8JA 4GTZA 3UN5A 3NKOA 2X98A 3BDFA 4LR2A 2GSUA 3M8WA 1ZEBA 3T00A 4N7TA 5INHA 1E1ZP 2W5RA 3T02A 1ALHA 3MK1A 1AUKA 4UOOA 1O99A 1KH5A 2ANHA 2W5WA 1ELZA 1ANJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E2S P;  3BDG A;  3LXQ A;  3NKP A;  4KAY A;  1ED8 A;  3UN2 A;  1KH4 A;  2W5V A;  3NKR A;  1HDH A;  2GLQ A;  3DYC A;  4MY4 A;  3E2D A;  4YR1 A;  3MK2 A;  1FSU A;  1E3C P;  5L0K A;  3UNY A;  1Y7A A;  5KXA A;  4LR7 A;  4UOP A;  2XR9 A;  3M8Y A;  1EW8 A;  2RH6 A;  3NKM A;  3WAW A;  4LRA A;  4ZG9 A;  5AJ9 A;  4KM4 A;  2W5Q A;  2W8D A;  3BDH A;  3IGZ B;  5L0E A;  2G9Y A;  4MHX A;  2W8S A;  4NWX A;  1P49 A;  4LRD A;  4KJD A;  5LRM A;  4GTY A;  2XRG A;  5C66 A;  3NVL A;  1HQA A;  1HJK A;  2IFY A;  4UOR A;  1SHN A;  2GA3 A;  4CXS A;  5DLT A;  3UO0 A;  4LRF A;  1ALJ A;  2IUC A;  3KD8 A;  3OT9 A;  2W5X A;  3DPC A;  4LRC A;  1URB A;  2GSO A;  4TN0 A;  4LQY A;  1N2L A;  4CXK A;  3A52 A;  4KAV A;  1AJC A;  4LRE A;  1EJJ A;  4ZG7 A;  1EQJ A;  3SZY A;  5GOV A;  3M7V A;  3IDD A;  2QZU A;  3WAV A;  1AJB A;  1ALI A;  2VQR A;  2IUC B;  3Q3Q A;  2GSN A;  5EGH A;  1ALK A;  3NKN A;  5DLW A;  3TX0 A;  3WBH A;  1KHL A;  1EW9 A;  3ED4 A;  4CYS A;  4GTW A;  4GTX A;  1KHJ A;  2D1G A;  4UPI A;  4LR8 A;  3UN3 A;  5LQQ A;  4MIV A;  1N2K A;  5TJ3 A;  3MK0 A;  4LR9 A;  4LRB A;  3SZZ A;  5L0B A;  1SHQ A;  3CMR A;  1EW2 A;  4B56 A;  1AJD A;  1E33 P;  4UPH A;  1ZEF A;  5DLV A;  1ELY A;  1O98 A;  3M8Z A;  4CYR A;  5EGE A;  5K4P A;  3WAX A;  1URA A;  1K7H A;  2ZKT A;  4KJG A;  4QAX A;  4ZG6 A;  1KHN A;  4CXU A;  4ZGA A;  1KH7 A;  5LIA A;  3TG0 A;  1EI6 A;  5GRR A;  1ZED A;  2W5T A;  3NKQ A;  4FDI A;  3TWZ A;  1ANI A;  3WAY A;  3IGY B;  3B5Q A;  4FDJ A;  1Y6V A;  4NWJ A;  3T01 A;  4UPL A;  5LRN A;  1ELX A;  1AJA A;  5IJQ A;  1KHK A;  2W5S A;  3BDG B;  5HRT A;  5IJS A;  1ED9 A;  4UPK A;  1KH9 A;  1B8J A;  4GTZ A;  3UN5 A;  3NKO A;  2X98 A;  3BDF A;  4LR2 A;  2GSU A;  3M8W A;  1ZEB A;  3T00 A;  4N7T A;  5INH A;  1E1Z P;  2W5R A;  3T02 A;  1ALH A;  3MK1 A;  1AUK A;  4UOO A;  1O99 A;  1KH5 A;  2ANH A;  2W5W A;  1ELZ A;  1ANJ A; 
#chains in the Genus database with same CATH topology
 3CCQ S;  2VPZ B;  4ECV A;  1VQ8 S;  1G2E A;  3FZ2 A;  3IM8 A;  4NI2 A;  1FJE B;  3R6G B;  5GMK a;  2NCK L;  3TUP A;  1JLA B;  2DXD A;  3IG1 A;  3HJV A;  4YB5 A;  4BHQ A;  3SCJ E;  3VF0 B;  2V4Q A;  5KFL A;  3QZ8 A;  3QPI A;  1V3Z A;  1NSQ A;  4KV8 A;  3KLF A;  2WON A;  1N5Y A;  2F4V F;  5GAG I;  2GMH A;  1DFD A;  3I0S B;  2FUG 9;  4K8R A;  2LCW A;  1HPZ A;  2HWI A;  4OHW A;  2KYX A;  2QL9 B;  4ILM A;  2HBR B;  3MED B;  1FFG B;  3TAQ A;  3V2U C;  1Q82 T;  1NK0 A;  2VOO A;  3SSS A;  4DJB A;  5DDP C;  4MAK A;  2KB2 A;  4XAK A;  4GO7 X;  1YJT A;  1CJU A;  4Y2M A;  5KFB A;  1QTM A;  1FJG J;  5A8R A;  1X0P A;  4HH0 A;  4DV5 J;  3KHL A;  3RW7 A;  4K4T A;  3VHQ A;  5F9L A;  4X4T A;  1B70 B;  2BR0 A;  3LP1 B;  2VBW A;  3KLI B;  2GQQ A;  2OD6 A;  3OTD A;  4BCA A;  3QIP B;  2O5D A;  3L4B C;  3LA0 A;  1SIW B;  2EG1 A;  4WFZ A;  2HFU A;  4J9P A;  2W8S A;  2ZH4 A;  5LOQ A;  2XRG A;  2CJ9 A;  4DG1 A;  1J27 A;  3Q22 A;  4CI0 B;  2LFV A;  2HHQ A;  1ROF A;  4OX7 A;  1SHN A;  4LUB A;  3CCV S;  4WU3 A;  2QG9 B;  3UO0 A;  1IBM J;  2V9W A;  3R5A A;  4U95 A;  4IUF A;  5LJ3 Y;  3VAJ A;  4EO6 A;  4ITS A;  1F2H A;  2IYI A;  2AIR B;  2FGC A;  2OGU A;  3EIC A;  2EKN A;  4K2X A;  4EZ6 A;  4AND A;  1F1B B;  2C2Z B;  4IG0 B;  3FRY A;  5IM0 A;  2VQE J;  1KQS R;  1QM9 A;  1VC5 A;  1KC8 T;  1URB A;  5F8L A;  5HO4 A;  3GYX B;  3MM8 A;  4UW2 A;  5HJY A;  2ZH1 A;  4CLU A;  3K8W A;  3T1Y J;  4NXM F;  5B0C A;  2OPQ A;  3T3F A;  4AXI A;  2C3P A;  2QZU A;  1RA6 A;  2DNQ A;  2RIL A;  4MK8 A;  2I9S A;  4IFY B;  5DDQ C;  5HVG A;  5J2P A;  4U7U D;  2ZWO A;  1WC6 A;  2NRE A;  3D9B A;  4YN3 B;  3C3L A;  4C48 A;  3TYT A;  3D54 A;  4O4G A;  1CJK A;  1BY9 A;  1TKZ B;  4U96 A;  3TAM B;  3TJ8 A;  1RHM B;  3UNG C;  4D3H A;  5KG7 A;  2W8K A;  2G2O A;  2RQK A;  3OPK A;  2ZH7 A;  3H20 A;  3AB2 B;  4EYI B;  3CJQ A;  3HLU A;  3ILO A;  4DPT A;  3EDR B;  1VIO A;  1KHJ A;  1O8B A;  3KK3 A;  2NZ4 A;  2I8E A;  3FCH A;  4N41 A;  4MIV A;  4BWM A;  3S8S A;  5B0E A;  3QWU A;  3GIK A;  1S0V A;  2FHM A;  1FCA A;  3DDK A;  2XEX A;  5B0F A;  1IBL J;  5AT1 B;  4ZCM A;  4CTA B;  1NND A;  2UV8 A;  2AJQ A;  3W63 A;  1CUL A;  2RRN A;  2XSJ B;  3FFI B;  3PJ9 A;  3T9N A;  3BDP A;  1X4E A;  4BC7 A;  2JVR A;  1S6Q B;  4DFP A;  1SKW A;  1RT7 B;  5I42 B;  4Y6I A;  3B8H A;  4DL6 A;  1S5Z A;  2KXF A;  3VGS A;  3CCM S;  4DX5 A;  2F40 A;  2BZ2 A;  4O44 A;  3RJM B;  1S4E A;  1NJW A;  1KH7 A;  5K8M A;  1IKX A;  2KKH A;  3QT8 A;  2V9K A;  4ZIV A;  2F4F A;  2LVW A;  2CNN B;  3MM8 B;  3PHT A;  4P7T A;  3CTR A;  5E7O B;  1R89 A;  2DNK A;  3LP2 B;  5KG2 A;  4YR2 A;  1U6F A;  4WZM A;  3THT A;  4MH8 A;  3OUY B;  5ADZ A;  2BXJ A;  4IFY A;  4F4X A;  3CJT A;  3R27 A;  2WAQ D;  1VDH A;  1GX5 A;  5J2Q B;  3OSP A;  2O3D A;  2XBP A;  1T11 A;  4Q7A A;  2H3E B;  5EX3 A;  3R97 A;  4EU0 A;  4RUH A;  5LSO A;  5C5J A;  1RK8 A;  2J6U A;  1KH9 A;  2G0C A;  1T9X A;  2ZOM A;  5T7L B;  3RGI A;  5HMW A;  5KFO A;  3EMT A;  1IBM F;  1NPK A;  1ZA2 B;  4DR3 J;  4DQS A;  5C42 A;  1YBU A;  4CH7 A;  5GAH U;  1WKK A;  4UZC A;  2EFP A;  2Z57 B;  3LPY A;  2ATL A;  3T02 A;  1F5C A;  2GS8 A;  4E0D A;  2DO0 A;  1XR7 A;  3P49 B;  4DR7 F;  1HBM B;  2L9W A;  2PD1 A;  2IMO A;  2WSE C;  1HMV B;  2WOM B;  3NGR A;  1VLO A;  2WW8 A;  2CXE A;  2RD5 C;  4M63 A;  1GMU A;  4ANE A;  2J8A A;  2FPH X;  5D77 A;  3T9Z A;  1X4B A;  4A8K A;  3IWX A;  1HYS A;  4TLQ A;  3F56 A;  4JUZ A;  2VG6 B;  5H9E K;  3OXL A;  2AWZ A;  2CPJ A;  2H5E A;  4IKA A;  2KM8 B;  3TAR A;  1YIT S;  2AJ4 A;  1HYS B;  2VOP A;  1CVJ A;  3I0R B;  2B5J B;  2GW8 A;  4DL4 A;  3JQJ A;  4OYW A;  4OL8 A;  1Z2Z A;  1J5E J;  4W4M A;  4UY8 T;  3BO4 A;  2KRR A;  3QLH B;  1URR A;  3CJK B;  3BEG B;  4B3M F;  2KTQ A;  5IS2 A;  1FVQ A;  3MOJ B;  5HVF A;  2J0S D;  4IH7 A;  3R7S B;  2HVE A;  2QL7 B;  2CIM A;  2FB0 A;  2XS5 A;  2UXC J;  2ZH8 A;  1VQY A;  3UDC A;  2OO4 A;  2VDH A;  1RT6 A;  1I51 B;  2HQ3 A;  5E3Q A;  3JS9 A;  2OMO A;  4PEO A;  4KHR A;  3UFC X;  5HMY A;  1R27 B;  4ES3 A;  4DSL A;  2QSF A;  4WZQ A;  2EVZ A;  4OHZ A;  3VZH A;  1XEZ A;  4OI2 A;  3L7O A;  5J1E B;  4XIU A;  2Y9H A;  1Y5L B;  4R0E A;  5DZ6 A;  4DUY J;  1WC0 A;  1BQN B;  2HWT A;  5F0W A;  4USM A;  3CUL A;  1NK9 A;  4CXS A;  1DAR A;  2BJE A;  1N56 A;  1XMQ F;  4FF4 A;  2QLJ B;  5HQL A;  5KFC A;  2CVI A;  1KN6 A;  1WSV A;  5HI7 A;  3ZTS A;  4LF1 A;  3D1Q A;  3NEK A;  3O5T B;  2O01 C;  4F25 A;  4DZ6 A;  4NA2 A;  3HT3 A;  1XNR J;  4DV4 J;  1ZH5 A;  1LW0 B;  1HNV B;  3KKF A;  3U27 A;  2GSN A;  4ECZ A;  5ETM A;  1PO6 A;  1VQO S;  4DR6 J;  1NRK A;  1UVL A;  3QRR A;  1KKH A;  2QLW A;  3NL0 A;  1MN7 A;  4NAS A;  2JWN A;  2CZ4 A;  2XWY A;  4WTO B;  1QD1 A;  2H54 B;  4ZK7 M;  5IV3 A;  2R7U A;  4CO4 A;  2IC3 A;  3GSD A;  2CPF A;  3QLH A;  1W2I A;  1EX8 A;  3CJR A;  4TY9 A;  2JOQ A;  1ZS6 A;  1F9E B;  3LP0 B;  5ETL A;  5IXU A;  3OL7 A;  4LF2 A;  4ECY A;  2D3O R;  1SH3 A;  2J0Q D;  4K0K J;  2I0X A;  2JH3 A;  4PAA A;  2IM1 A;  3SIP B;  2Q3P A;  3MEC A;  1RT6 B;  1NPP A;  1N5S A;  1QE1 B;  1WAC A;  2BAN A;  4O3R A;  3CMA S;  1JJ4 A;  1G4C A;  2KJV A;  4GKK F;  1AFI A;  1ITP A;  4NLP A;  1G1X A;  5EGE A;  3WAX A;  4YR3 A;  3CDW A;  3H90 A;  2B43 A;  3VR1 A;  1S7H A;  3TG0 A;  4ZGA A;  3NLC A;  2XHW A;  4QYR A;  1VIS A;  1G3O A;  2XO6 A;  2E7W A;  2ZH2 A;  1HQU A;  2MGZ B;  4JI4 F;  3QJP A;  2FJE B;  4P52 A;  1ZTT A;  1UJ6 A;  5JJB A;  2C28 A;  2IAJ B;  3ZZP A;  2QFI A;  2KHD A;  3BYP A;  3WC0 A;  3E2E A;  4QOT A;  4I67 A;  3C19 A;  3RBE A;  4LSL B;  1XN9 A;  5GME A;  1M5V C;  4YB7 A;  2D3O 1;  5IJS A;  1IR2 A;  1KFS A;  1ED9 A;  1HNV A;  4KC5 A;  1K1Q A;  2DGX A;  3BDE A;  2PGC A;  2RJZ A;  4MIA A;  1JXV A;  3ZC4 A;  2BQ3 A;  2K1R A;  4N77 A;  4OX8 A;  2BEF A;  3CDU A;  4IDK B;  1T9W A;  4Q43 A;  1WC5 A;  1MU2 B;  3M8W A;  3TAN A;  2JEF A;  3V5R A;  3RR8 A;  2JEI A;  3DFE A;  2OIH A;  3NRB A;  3QWP A;  4ATN A;  3MPD A;  3MD1 A;  4ES1 A;  2ZOF A;  4DV3 J;  2RU9 A;  3EE3 A;  3VTI A;  1NKE A;  2HS3 A;  2WVB A;  1V6H A;  2HWH A;  1OY9 A;  4OYP A;  1TL1 B;  3LGH A;  1SQE A;  4TU9 A;  1T03 A;  1I94 F;  1U4B A;  1IBL F;  2FJW A;  2DY9 A;  2K2P A;  2F9D A;  1ED8 A;  1KH4 A;  2W5V A;  2CKW A;  3PX0 A;  2WVE A;  1SQG A;  3NGK A;  4YY3 J;  4DCP B;  1IR1 A;  2CNO B;  4IR9 A;  1B99 A;  1S9G B;  1NHV A;  1OYE A;  2GGP A;  2N7C A;  1Q1K A;  2X1G A;  1FSU A;  1S0N A;  4ETZ A;  2CAJ A;  3Q2S C;  2ZH9 A;  1NK5 A;  4B3M J;  3KOA A;  4LF8 J;  1T3O A;  3W2W B;  4CYU B;  3OR2 B;  1N52 B;  2W9A A;  3PR5 B;  2ZZT A;  3US5 A;  3MUR P;  1U47 A;  1QJH A;  1HNZ J;  1RAI B;  4MYT A;  1IVZ A;  2DGU A;  2W5T A;  3F41 A;  4KIA A;  2CJY B;  3BPS P;  5K8P A;  5L46 A;  3SFG A;  3R7B B;  4B3T J;  1R8P A;  3VAH A;  1OMS A;  4LFA J;  4DV7 F;  2CQ3 A;  5DO2 A;  4GC7 A;  2AYM A;  2M52 A;  3TW0 A;  5CXT A;  4NLV A;  4P2F A;  2ZJR Q;  1J5O B;  4C8M A;  3A3P B;  3ILL A;  4FS2 A;  4IOB A;  4ZVQ B;  1RWW B;  2B9Y A;  2OPP A;  4OJ1 A;  2YWK A;  1DQ9 A;  1X31 C;  1X4C A;  1NBE B;  2DB1 A;  1FA0 A;  2N7Y A;  1X5O A;  3E01 B;  1XMQ J;  4O0I A;  2JX2 A;  2HMI A;  1VK3 A;  1ALJ A;  1TL4 A;  1S9E B;  3AQP A;  2ACM A;  2MQL A;  2HZV A;  2W2Q P;  3NOC A;  2JVO A;  5BYR A;  3EXY A;  1N2L A;  4X62 F;  3M8P A;  2MZR A;  3CD0 A;  1B7Y B;  1MWZ A;  4Q2M A;  3U1L A;  3IS9 B;  1GXL A;  1YVF A;  3DLJ A;  4F36 A;  1ARO P;  4WU2 A;  4YP3 A;  3MFI A;  4P74 A;  4F3Q A;  1SUQ B;  4TY8 B;  5CYM A;  3KUE A;  4M5J A;  5AXM A;  4ECX A;  2JC0 A;  4PCQ A;  1IKY B;  3HVT A;  2AZ1 A;  3BGR A;  3N01 A;  3I82 A;  2YPY A;  3AXM A;  3NP5 A;  2X51 A;  1K0T A;  3KG0 A;  3W2W A;  4CYU A;  5KFE A;  6AT1 B;  1UFK A;  2K06 A;  2DNY A;  4DCJ B;  1RHQ B;  3E3X A;  1RAA B;  4I7F A;  1U49 A;  3ED4 A;  4JI7 J;  4ZVP B;  3DOM A;  3UD4 P;  4GTX A;  1JLC A;  2AP6 A;  4PXD A;  4USW A;  3KXD A;  1WKL A;  3DMJ A;  4MT1 A;  4ZOS A;  4O3S A;  4OZ2 A;  1F5A A;  2HIQ A;  4OZJ A;  5EWG A;  2VG5 A;  2D3U A;  4I0W A;  3R9L A;  4LIR A;  2RRB A;  1FKA F;  3PM9 A;  3C2P A;  3PRD A;  2KL8 A;  1P8G A;  3DLE B;  4NPO A;  3J80 Y;  1EW2 A;  4B56 A;  1E33 P;  2ZUA A;  3TJ9 A;  2G9O A;  2VOD A;  3R5J B;  4LIW A;  1O98 A;  5F3T A;  1SL0 A;  1ZM2 A;  1AYE A;  3QAE A;  3T6J A;  5DZ7 A;  2DGS A;  2Y1L B;  2B4O A;  2NZC A;  4OHX A;  3WX4 A;  3W9J A;  4WE1 B;  4DV4 F;  4YHH J;  1SL1 A;  2P9G A;  2J0X A;  4YEA A;  1ZOT A;  1N36 F;  2UUC F;  3NBP B;  2BJ8 A;  4CXU A;  3KLH B;  1RAO A;  3IMQ J;  1RT4 B;  2WB1 D;  4LF4 J;  4GO5 X;  2HAI A;  1UEV A;  4F4A A;  4OX9 J;  3K5P A;  3L09 A;  4H4K C;  3PYF A;  1G6B A;  3CC2 S;  1PAE X;  1SBR A;  2GIR A;  3MMC B;  4F04 B;  5A2Q U;  4OYI A;  3SQO P;  4DN9 A;  3T1H J;  2M8D B;  1Y6V A;  1IBC B;  1RP5 A;  2IIH A;  4KGM A;  3FQL A;  3NS5 A;  2C2D A;  1LWE B;  3HD1 A;  4ZP8 A;  5LXR A;  2NUU G;  5AJ3 F;  2GVZ B;  2JEG A;  5KFX A;  2CAD A;  1R8B A;  3U7J A;  1S6P A;  2UUC J;  2OAU A;  4IQM A;  1HQE B;  1FO1 A;  1FT8 A;  2HG4 A;  2OLW A;  3A8E A;  3FMW A;  3PYE A;  5ETO A;  4BC9 A;  5D6G A;  5KT4 A;  2GSU A;  4KV8 B;  3T00 A;  3GV8 B;  3OVB A;  3CUN A;  1K47 A;  3I0S A;  3NOG A;  3M8Q A;  2CJB A;  4NOH A;  5IT9 Y;  4NCB A;  1ALH A;  3S7R A;  4LQ9 A;  4OMF G;  3ZZO A;  4P73 A;  2IBO A;  1ANJ A;  2YWH A;  4WP3 A;  3J7Y U;  1I1G A;  1LKZ A;  1CJU B;  5LQQ A;  2XSF A;  3CJ4 A;  2VG5 B;  3ETO A;  2CQ4 A;  1H72 C;  1TKT B;  4PR6 A;  5HQM A;  2VG7 B;  1GNK A;  9RUB A;  1YJ7 A;  3EPI A;  5LXY A;  2DKO B;  3FSX A;  4TNO A;  1LQ9 A;  1NAQ A;  2C2N A;  8AT1 B;  1Y7P A;  2CQC A;  3QRP A;  4W90 B;  4RWX A;  1WTF A;  2BKN A;  4DL3 A;  1LFW A;  4OV1 A;  3HFZ B;  2FZC B;  4LR7 A;  4JV1 A;  1D9A A;  3RRH A;  4DF4 A;  1X9W A;  4OYX A;  3GE9 A;  3NBP A;  3W5Z A;  4YY3 F;  5DG9 A;  4IFV A;  3MR3 A;  2HNZ A;  2KJW A;  3KLH A;  3IRW P;  3CDB A;  5E33 A;  2A2D A;  4X4Q A;  3NMR A;  2HBY B;  3MZI A;  4IRC A;  4P2S A;  1VBZ A;  2DGQ A;  4N8O A;  4DR3 F;  3IAM 9;  4JBC A;  1P49 A;  3G6Y A;  3MPV A;  4F67 A;  2D69 A;  2RVJ A;  5SZT A;  3NAH A;  3L95 X;  3UW1 A;  1UVN A;  2HS0 A;  4TKT A;  1F5B A;  4F4W A;  3HPO A;  1KD1 T;  1M1K T;  1U1O A;  1D8Y A;  2W2P P;  4NLT A;  3EX7 B;  4NEY A;  3RRG A;  1R43 A;  4FYW B;  3ZTP A;  5AE1 A;  4J90 A;  2RH3 A;  1JQG A;  2LA6 A;  1Q81 T;  1CJK B;  4P7V A;  2QMX A;  4IH6 A;  2KZM A;  2ZC3 A;  3BPD A;  1C4C A;  5IT4 A;  4O3N A;  2W25 A;  2PO4 A;  5EN1 A;  3MCM A;  4WTY A;  2CQD A;  3WIV A;  1ZAX A;  3HI9 A;  1TK5 A;  1RZM A;  3NKY A;  2FDN A;  5G0R B;  4IO9 Q;  3CCS S;  2UZA A;  1A6L A;  1OQ3 A;  2V2Z A;  4YS2 A;  4I64 A;  3QSI A;  4A8X A;  2HNY B;  5CD4 A;  2W24 A;  1XK8 A;  4K4Y A;  3DYA B;  1ALK A;  1CUL B;  2BM0 A;  2CZ9 A;  1S6Q A;  1HNX J;  1GTE A;  1U2R A;  2CJQ A;  2NYH A;  4X4U A;  5F8H A;  1RT7 A;  3DDI A;  1HHS A;  3KHH A;  5I42 A;  2KG0 A;  5F8J A;  3HKZ D;  4NLD A;  4USI A;  3CJ2 A;  3DRY A;  3FSY A;  5L39 A;  4ECS A;  2BAB A;  2Q6B A;  5AXL A;  2G0J A;  2MKH A;  2MYF A;  4DMZ A;  4W92 B;  1JJH A;  3ITH B;  5E3A A;  2EI5 A;  2YKP A;  1ZA1 B;  4PAB A;  1PKU A;  3NG8 A;  1VBY A;  1IKX B;  2F4V J;  4KPC A;  2HRT A;  2OEM A;  1VQ4 S;  5L1J A;  2IHR 1;  2GAG C;  2Z56 B;  1CQN A;  1RBA A;  1RIS A;  4FNH A;  5A8W A;  2XGP A;  3TQ1 A;  3OUY A;  1UA0 A;  2AYG A;  4LBP A;  3QID A;  1FWP A;  2RDD A;  5J2M B;  4HYK A;  3QNW B;  3KMQ A;  3K59 A;  4OZ5 A;  2KXN B;  4C98 A;  3G96 A;  1K7H A;  3CJ0 A;  3V6K A;  3CCE S;  5A8K A;  4OJ3 A;  1IJE B;  1UET A;  4BWJ A;  5C2C A;  4J9R A;  1CS4 B;  2IRY A;  1KQG B;  3R5D A;  2MKK A;  3DRR B;  2R7O A;  1DQ8 A;  1S1V B;  1O6X A;  3KFW X;  2QA4 S;  2KT5 A;  4ZIT A;  2XLJ A;  3PW4 A;  4NWJ A;  2CFX A;  3CIM A;  1UWA A;  1SB6 A;  2POK A;  2YQ1 A;  3C16 B;  1P1L A;  2GML A;  2GHV C;  4O3P A;  1RTH A;  2RSQ A;  3UVJ A;  1HWI A;  1Y5I B;  3H4D A;  1HIY A;  3M05 A;  2GX8 A;  4ID5 A;  3IWN C;  2HK3 A;  2AU0 A;  4X4V A;  1CC8 A;  2P6T A;  4JI3 F;  1NDL A;  1RWN B;  3DYA A;  4J37 A;  2MKC A;  1UZH A;  4RNH A;  2PFF B;  4JI0 J;  4QWD A;  3H5Y A;  4YB1 P;  1FRM A;  1MSW D;  1H2V Z;  5LSR A;  3MMB A;  1PJ7 A;  1EAY C;  3RBZ A;  3MK1 A;  3HKW A;  2ZD1 A;  4NZ6 A;  5E3P A;  4DCO B;  2ILZ A;  1ELZ A;  4LFC J;  3ZTR A;  4U8V A;  1KLN A;  2DNH A;  3NKP A;  4GMK A;  2GMJ A;  4ZCL A;  2QJ3 A;  1NSK L;  1WSR A;  3MM5 B;  3HP6 A;  3PW2 A;  1JK9 B;  3W7B A;  1LWX A;  1RCO B;  1IKV A;  4UUW A;  2Z8Q A;  3HVR A;  2GA7 A;  3SI8 A;  3P4U B;  4TQS A;  3H40 A;  2PSZ A;  3MK2 A;  4N76 A;  1FFW B;  2Q1L A;  4LVO P;  1Y7A A;  3Q2T C;  2C22 A;  1KDN A;  1FK9 A;  1TMJ A;  1YJR A;  5CYJ A;  2MY8 A;  2ZHO A;  3M9O B;  4J9V A;  4JI1 F;  2HGL A;  5D4N A;  4K4Z A;  2GO9 A;  4DSE A;  2KDO A;  4OZ1 A;  2V2K A;  3DRR A;  1R0C B;  2BDP A;  2R3V A;  1S1V A;  1EHW A;  2VQF F;  4P9S A;  2ALY B;  3F0N A;  3LW5 C;  1LK7 A;  1BQN A;  1RT5 A;  1JWW A;  1UW4 A;  1IWG A;  3O8W A;  3KHR A;  3RTV A;  2OP5 A;  4DQR A;  1M5H A;  1VQK S;  2HIY A;  2HW3 A;  4NWX A;  3FBC A;  3KK1 A;  1WEZ A;  3HZE A;  2V94 A;  2W2N P;  1A7G E;  2XQC A;  2YTC A;  3DRS B;  4DL0 C;  5HP1 A;  3MXH P;  1SVD A;  4L3K A;  5D4L A;  1HQA A;  1EQ0 A;  3AJ1 A;  2UV8 G;  2ASY A;  1RKJ A;  2GVD A;  4DR2 J;  3NNA A;  2I1R A;  4QWB A;  3QQC D;  3HMJ G;  5DQH A;  2VV5 A;  3POT B;  1K73 T;  2R42 A;  3CJ5 A;  3NY0 A;  4B3R J;  3IO1 A;  1OJ4 A;  1VIX A;  1HR0 J;  3PIO Q;  2W7P A;  4QYZ K;  2YNH B;  3FEX B;  3GG0 A;  2BQU A;  4CXK A;  4CT9 A;  1DTQ A;  3AFG A;  2DH8 A;  5A2Q Y;  4DV2 F;  1I3O B;  2CA9 A;  3LGM A;  4ZP6 A;  1O51 A;  1HI8 A;  2XO7 A;  1SJ4 P;  4DSI A;  4KQZ A;  4KJI A;  4KH1 B;  4ZVT B;  2D1C A;  3IG1 B;  3KDO A;  1XIQ A;  3DXS X;  4NLS A;  1N6Q A;  3BZQ A;  1K0V A;  2WON B;  2RF2 B;  3W8G A;  5GAD I;  2COL A;  1OS5 A;  3DDN A;  3G8T A;  1EQM A;  3VGT A;  5A0Y B;  3FSI A;  1FVS A;  4DV1 J;  3JYT A;  1FXD A;  1X9M A;  1FHT A;  2E29 A;  2MPU A;  3J7A N;  4RW6 B;  4ZN3 A;  4AQY J;  2BAN B;  1HD1 A;  3NAI A;  3MEE B;  4RO0 A;  2LMI A;  1T05 A;  1VS3 A;  2HK2 A;  6FD1 A;  2V8P A;  2AEJ A;  2XMW A;  2XMJ A;  3IRX A;  5I3U A;  4PRF A;  2BE2 A;  2OPS B;  3BSO A;  2QYC A;  2XY5 A;  4X4P A;  3IA0 A;  2NXU A;  3OXF A;  4DV5 F;  1AJD A;  1B0T A;  1IWA A;  3HHL B;  4C11 A;  2C2M B;  1TR0 A;  3DRS A;  3UR3 C;  3VAG A;  3A8I A;  3PW5 A;  3BBB A;  4QIE A;  2A18 A;  4ELT A;  1H7X A;  1HD0 A;  4DUZ J;  5K4P A;  1OSD A;  2FY8 A;  2D41 A;  3D67 A;  3POT A;  4RNN A;  3K89 A;  2FVQ A;  1JIH A;  5IFM A;  3BSA A;  4R25 A;  2ROE A;  3DLH A;  2FJB B;  2YNH A;  4HAC A;  1UW9 A;  2C2O B;  3ICL A;  4K5R A;  5AXK A;  2OH2 A;  1OY6 A;  3AOA A;  4MKY A;  4JV2 A;  4RNO A;  4X4O A;  2GHP A;  4EO8 A;  2CWK A;  4M8L A;  3FCW A;  4EZ9 A;  3R7N B;  3H2L A;  3ISZ A;  4F4Y A;  2V4J B;  1T7P A;  4Y00 A;  1SJF A;  1GT8 A;  2U2F A;  3NNH A;  2AEF A;  4HTI A;  1GFW B;  1H7W A;  2AKW B;  1S57 A;  3QGH A;  3RAX A;  4DF8 A;  4RW6 A;  1VRU B;  1FEE A;  2N4C A;  1HWK A;  3M2V B;  3FBF A;  5MAO A;  2PE8 A;  1RAF B;  4O4R A;  3Q8V A;  4URQ U;  4QBU A;  3SZ2 A;  2ZBR A;  3NCR A;  3LXQ A;  1N54 B;  5BR8 F;  3GFH A;  2CZV C;  3UN2 A;  4CTA A;  3NKR A;  4HEA 9;  3AJD A;  2JHE A;  2DEI A;  4TN2 A;  4DWI A;  3E2D A;  4LVN P;  3GJR B;  4UQT A;  4DPU A;  3DXB A;  1T95 A;  4U8Y A;  2GO8 A;  1C1C B;  1VOM A;  2C3O A;  1LW2 A;  3UCU P;  4FPI A;  1J5O A;  2WBM A;  2H4Y B;  2HND B;  5B0D A;  2OPP B;  5KXA A;  1APS A;  2DY1 A;  4NCG B;  5DLG A;  4O44 B;  1X4G A;  4W98 A;  1HR0 F;  1EW8 A;  1NO8 A;  3H5S A;  2RQ4 A;  3E01 A;  4NE9 C;  4ZIW A;  3M2R B;  5HMX A;  1M1G A;  4J9M A;  4LRA A;  1U1R A;  4HAC B;  3W3S A;  2GHW A;  4NLR A;  2IJN A;  4YOE A;  5F8N A;  2ERR A;  4ZN1 A;  3CCJ S;  3I55 S;  4UOG A;  2FLL A;  1NK8 A;  2X1B A;  3K2Y A;  3L9Z A;  3O6Q A;  3FGV A;  2M5Y A;  3D4J A;  3JTO A;  4ECW A;  3LAM A;  2JFD A;  2G1D A;  3T5J A;  1WWH A;  1L3U A;  2ABY A;  2AX1 A;  4FZV A;  4C2M A;  5EDW A;  1HJK A;  4UOR A;  1WOP A;  2ZVS A;  2N82 B;  1M5K C;  4K5S A;  4FYV B;  3HK2 A;  1CJV B;  2FZK B;  2MZQ A;  1NEE A;  3OFG A;  1VRU A;  3M2V A;  3TVZ A;  3KJN B;  4F2R A;  4CLP A;  3HHK A;  4WP9 A;  3QGI A;  1WEY A;  1FJC A;  1HNW J;  3NS7 B;  3CC4 S;  4K4U A;  1YGY A;  5CH7 B;  3ONQ A;  2IRX A;  2JC1 A;  4I7F B;  3C66 A;  1E6Y A;  3FZB A;  2Z2L A;  1JLF A;  4WK3 A;  4ZVR B;  4OX9 F;  2KFY A;  3T5K A;  1EQJ A;  4XDC A;  1TV6 A;  3MAH A;  3RBX A;  1S77 D;  1AJB A;  2FTR A;  1ALI A;  1YJV A;  2HLT A;  3LOU A;  3JSM A;  1VQ5 S;  3M30 B;  5L1K A;  1NB7 A;  4LFB J;  5KFH A;  1ZZF A;  5KFF A;  1C1C A;  4V19 X;  4EUV A;  1FDN A;  4R0J A;  2B51 A;  6FDR A;  3U1M A;  3UDV A;  2W9C B;  2HND A;  5IQQ A;  4DQP A;  2YKO A;  3DM2 B;  3I5C A;  2XNQ A;  4ZHR B;  4CYS A;  5JXS A;  2KVI A;  5KAK A;  3GWC A;  3A12 A;  1HBN A;  2IBK A;  3M2R A;  1AT1 B;  5D0E A;  5MLC V;  3UN3 A;  3VGU A;  3W9H A;  1T8E A;  1U7L A;  3MD3 A;  2MSS A;  3EZU A;  3IFE A;  1KQF B;  3J7A 1;  1IQT A;  2VC1 A;  3BKT A;  2HHW A;  2NR0 A;  3EGN A;  4O0N A;  1R0B G;  4DR1 F;  4IRK A;  1SHQ A;  4KTQ A;  3AXK A;  2DR6 A;  3UCG A;  1HHQ A;  1NDK A;  2E44 A;  1B0P A;  4EFA C;  4OJH A;  1NJX A;  4USV A;  1NDP A;  2YQ0 A;  2IM2 A;  1XTZ A;  4DN0 A;  2F8M A;  4FVC A;  3PTW A;  3HZG A;  3VVU A;  5J1E A;  2CPZ A;  1YZ6 A;  2WTF A;  4ZJQ A;  1PG5 B;  3THV A;  1SL2 A;  4WXO A;  5IT9 U;  4JP8 A;  5IOL A;  3BBC A;  3WZ0 A;  1SJR A;  1K9M T;  2ZEJ A;  5KG5 A;  4DPO A;  4HDH A;  1W2B R;  4JI5 F;  2C42 A;  3GON A;  3RB0 A;  2HSE B;  2W9B B;  1TV6 B;  3GFX A;  3GIM A;  2ZUG A;  4N8N A;  1T9V A;  2E9T A;  2RS2 A;  3ISN C;  2FHO B;  3P3D A;  4K4S A;  1M0S A;  2LA4 A;  1TEL A;  4AL7 A;  1S1W A;  5GAE U;  4DQQ A;  2RS8 A;  3BQ0 A;  3ENW A;  2IVM A;  3T5H A;  1N33 F;  2Q66 A;  3ZO7 A;  3NKO A;  2PN6 A;  1WOS A;  5K8O A;  3GQC A;  1WNE A;  1TVR A;  2KXH A;  1KLM B;  2V67 A;  5M2R A;  3ULH A;  3HDS A;  1S76 D;  1WDD A;  1HNI A;  3ZNU A;  3BBF A;  3OTE A;  1O99 A;  4M5G A;  2ANH A;  3TA1 A;  1CQM A;  2HQC A;  4I1T A;  4ZG9 A;  2QZ8 A;  4ZMM A;  2DYA A;  2HNZ B;  3HSZ A;  1AUS L;  2DNL A;  3S6E A;  4Z7C A;  1Q95 G;  2B8P A;  2VC0 A;  3H7H B;  1Q86 T;  1JKH B;  4LF4 F;  4Q8E A;  3K5M A;  2R7Q A;  2EFG A;  1NU4 A;  2WSF C;  2GLQ A;  3MEC B;  2GZO A;  1Y3J A;  2NXC A;  3GIL A;  1F6T A;  1QE1 A;  4BLG A;  2M88 A;  4RW9 A;  1K8A T;  1NPR A;  1E3C P;  4LBH A;  3W61 A;  1UJ4 A;  1WG1 A;  3JQK A;  3UE2 A;  3DGP A;  1SIZ A;  2JJ4 D;  3PNI A;  1NM2 A;  2XYP B;  4I2Q A;  3VWS A;  3NS6 A;  1SKS A;  1TAQ A;  3HF5 A;  2HHU A;  4GVL A;  2B8Q A;  1TFW A;  5EUH A;  1HQU B;  2MGZ A;  1LK5 A;  1UA1 A;  4C8O A;  4FXD A;  1HW8 A;  3DOK B;  4ANC A;  1WHX A;  5HN0 A;  2M7S A;  4KRW A;  4A46 A;  3VAL A;  2ZNZ A;  4KHM A;  2W9B A;  1I5O B;  3BB5 A;  3P96 A;  5EWF A;  1RQ0 A;  4LRD A;  1CPZ A;  3ZFV A;  1F0X A;  1FRK A;  4JI2 F;  1X5P A;  2G0I A;  2Q6C A;  1UWB B;  2R7R A;  4J9Q A;  3PV8 A;  2YNG B;  3MWB A;  4NLY A;  1UMJ A;  2DNP A;  4I2P B;  4JI2 J;  1XQI A;  4PQU A;  2GA3 A;  1U6Z A;  4YFU A;  4N56 A;  3Q8R B;  5K14 B;  4FS1 A;  3TI0 A;  2IUC A;  1N0V C;  3KD8 A;  2AGP A;  4OX6 A;  1TVR B;  2F8H A;  3DLB A;  3R2D J;  3OW2 R;  3OLB A;  2DHH A;  2OD4 A;  1VJW A;  2KG1 A;  2DR9 A;  1HNI B;  2J9D E;  2R4F A;  5C7P A;  1NSP A;  2C3U A;  4DEZ A;  1JLB A;  4LFB F;  1YJN S;  4HKQ A;  4WP8 A;  1S97 A;  4Q0B B;  1D9F A;  2FHK A;  3A8J A;  3QYY A;  3IDD A;  3I5B A;  1JKH A;  3KMS A;  4Z7Y A;  3RR7 A;  3PRB A;  4CLF A;  4X65 J;  2XZD B;  2ZHA A;  4BBY A;  2FVS A;  1S9G A;  3DI6 A;  1RSC A;  3MPW A;  3O2I A;  2HVD A;  4DXL A;  2O67 A;  5EHH A;  1S59 A;  1C0T A;  3SQG B;  4RW9 B;  4EYH B;  3V4I A;  3TQE A;  1ELO A;  2E7X A;  2W01 A;  1EZZ B;  3WHI A;  2ZH5 A;  3B82 A;  2HFZ A;  2IMW P;  2C2E A;  2W4D A;  1AW0 A;  1KQK A;  3N6M A;  2C3M A;  2VIH A;  5CHC B;  2V6A A;  4PXC A;  3W8P A;  5KG1 A;  4J9S A;  2JRS A;  2IFX A;  3JQM A;  1C0U B;  5ETV A;  3W2V B;  4EK2 A;  2XGQ A;  5CQG A;  3H4B A;  4EEY A;  1RTJ A;  4O3Q A;  4YDD B;  1JB0 C;  2L48 A;  4J9N A;  1RTZ A;  4EBD A;  2MHE A;  3CO0 P;  1ULR A;  4LRB A;  1Q8K A;  2DEJ A;  2O1P A;  2UUW A;  4KFB B;  5DET A;  4GKJ J;  1U1P A;  4QIG A;  4ZVF A;  1U8W A;  1F60 B;  1VFJ A;  3EVW A;  4OFZ A;  1RXO B;  2DNO A;  4ZVO B;  2E1C A;  1FJ7 A;  3PRV A;  3C16 A;  3CMQ A;  3D7S B;  1J2V A;  4ID5 B;  1HI0 P;  1URA A;  3J81 Y;  3GII A;  4RW7 A;  5CAB A;  3DN9 A;  2MB0 B;  3PDN A;  3HSD A;  4KT0 C;  4B17 A;  1RE1 B;  3BGU A;  4CLW A;  3KHG A;  4QU7 A;  3DRX A;  5HLF B;  3TO8 A;  5KG3 A;  4ZCK A;  3N28 A;  2Y8Y A;  1VQM S;  1TL5 A;  2RQM A;  1U0H A;  2EFO A;  4UST A;  1BQX A;  1BXN A;  3QRQ A;  2HHV A;  2DNZ A;  3IS9 A;  1HWU A;  5B09 A;  2VA3 A;  3GLJ A;  3S1T A;  2QA4 G;  3OQ2 A;  2Z2Y B;  2DHG A;  2BE7 D;  2XY6 A;  2QT7 A;  5H9E J;  2VPX B;  4OI0 A;  4ED4 A;  4P2X A;  3L3C A;  4NCA A;  2VON A;  1YJW S;  3GV7 B;  1P1T A;  4ELU A;  3M6W A;  3ZZT A;  1KEK A;  3FEZ A;  1SJ1 A;  2CDR B;  2XNR A;  3FC9 A;  3BGR B;  4DR5 F;  3RBD A;  2ZDO A;  1TL3 A;  1FKP B;  4B3O B;  3BDF A;  4DL7 A;  2HUR A;  1QSL A;  2BAC A;  4J9U E;  2UXC F;  3PW0 A;  1X60 A;  2RIJ A;  3BM7 A;  3M32 B;  4GVB A;  4NML A;  5F41 A;  3I9V 9;  3TZZ A;  3MED A;  4PXB A;  4I6W A;  5IZH A;  1RTJ B;  1VLY A;  2NXJ A;  1KOH A;  1FE4 A;  2BBE A;  5IV4 A;  4B9V A;  2DRA A;  3BDG A;  1GH8 A;  3HHL D;  4G65 A;  2CRL A;  3KG1 A;  2UXB J;  3PEJ A;  3ZTO A;  2VIC A;  1H38 A;  2ZJP Q;  1NK6 A;  4KAY A;  5CAA A;  2DNG A;  1HLW A;  1U09 A;  4DUT A;  3TZX A;  2CYY A;  4EMD A;  1F9F A;  1VQ6 S;  3KK1 B;  5L0K A;  2AGQ A;  2APO A;  4LF5 J;  1ZAW A;  4YDX A;  2AD9 A;  4HT5 A;  4MKA A;  4WE1 A;  3V4M A;  1YBA A;  1T0T V;  2MDA A;  2YNF B;  1Y9O A;  1XBW A;  5BXI A;  3M8Y A;  4XPE A;  2R7V A;  2XG8 A;  1RT2 B;  2EK1 A;  4K2J A;  5HLF A;  4PYA A;  4P71 A;  4DV0 F;  1NZ8 A;  1XNQ F;  4RBU A;  2U1A A;  2RB7 A;  2FJD B;  1S99 A;  4IG0 A;  5EGY A;  4ECR A;  2VFU A;  1NXI A;  3BDH A;  3H5U A;  1R8H A;  2Z4P A;  1DLO B;  4M5D A;  2IDE A;  4QZV B;  3OTC A;  2Q79 A;  5HK4 A;  2GAH C;  3QO9 B;  2HZA A;  2ZWP A;  2CPE A;  1H73 A;  2B7C B;  3SSR A;  4CZC A;  1O5J A;  3J7Z 5;  4DS5 A;  2OPQ B;  2GVZ A;  4K4V A;  1OPZ A;  3OL6 A;  4NEZ A;  2OUG A;  3THP A;  1WI8 A;  1IBK F;  1S6O A;  1U8S A;  1N6Q B;  3P6Y C;  2R8K A;  1S12 A;  2PI4 A;  2HEK A;  3M8Q B;  4WJB A;  2LYV A;  3MTK A;  2L08 A;  4CNY A;  3JYT B;  4WKY A;  5DG7 A;  2QTW A;  4N47 A;  2EKY A;  4UZB A;  2GQC A;  2ZBQ A;  4DL2 A;  1AJC A;  2MQO A;  2ROP A;  3BN4 A;  3PCO B;  3M9M B;  1S9F A;  5DLF A;  3PX6 A;  3K8V A;  4LMZ A;  2DJW A;  2VF3 A;  3L7U A;  4LSN B;  3WIU A;  2IVY A;  1WKJ A;  3QZ7 A;  3EYZ A;  2BE2 B;  2OPS A;  1MMN A;  2BRL A;  2VQE F;  2AJ1 A;  5KFY A;  2X1F A;  2CVE A;  1G7C B;  3G6X A;  2M2B A;  2WVF A;  2BJ9 A;  1VRT B;  1KP6 A;  4Y65 A;  5BR8 J;  1Q53 A;  4QU6 A;  2XSJ A;  3FFI A;  3HHL A;  4C11 B;  3LAN A;  3UCZ P;  1RWU A;  3C6T A;  5KFA A;  2YNF A;  5CD4 H;  4K0K F;  4FNI A;  3MM6 A;  5DLW A;  3C46 A;  1Q79 A;  1LEO A;  5DDR C;  1WJ9 A;  2AT1 B;  4CT8 A;  5K8N A;  4PWD A;  1RWP B;  4X66 F;  3Q8Y A;  4YR0 A;  4DV6 F;  3X1L B;  4DX6 A;  2NXN A;  5LMN J;  4Y2I A;  5A6P A;  3HX9 A;  4IR1 A;  4KR0 B;  4M5D B;  4DU7 A;  2AEM A;  1Q7Y T;  4LSZ B;  4CDI A;  5JUM A;  3H98 A;  2WB4 A;  4HHJ A;  1C1B A;  3VV2 B;  2ADB A;  4X64 F;  1ACM B;  3MAA A;  4URG A;  2HBQ B;  3ZNJ 1;  3P8B B;  3CXC R;  2NSB A;  3EPG A;  2XHC A;  3LQV A;  4IH5 A;  2RE1 A;  3UDE A;  2CUY A;  4KO0 A;  1RDR A;  2EW9 A;  1F3V A;  3OFE A;  1BQM B;  2XZT B;  3LTO A;  3Q8Q B;  4CLS A;  2CQB A;  1U02 A;  1SC1 B;  4DR4 J;  3KLG B;  4G3I A;  2RT3 A;  3NKQ A;  1NLK L;  3T1Y F;  4NXM J;  2ASL A;  3SBM A;  3HHE A;  1U6B A;  2EBE A;  2HVZ A;  2M9K A;  1M5S A;  2CQG A;  4L75 A;  4E2F B;  3DLK B;  5KG4 A;  3QSY B;  3AY0 A;  4LSN A;  2HBZ B;  1AJA A;  5IJQ A;  5HRT A;  2VUG A;  2FHJ D;  5K9F A;  2EC2 A;  4RX6 A;  1GAO A;  3B4M A;  2X3D A;  4F4Z A;  1WOO A;  4L3N A;  1GEH A;  5D0R A;  2ZM6 J;  2LEA A;  3OXG A;  1GMW D;  4NX9 A;  4ZP7 A;  3TZW A;  5F8M A;  4JI0 F;  2ADC A;  3DKD A;  1WG5 A;  3C6T B;  2DPJ A;  2ZIT A;  2IM0 A;  1TKX A;  1UAW A;  2FLN A;  1LXN A;  3MM6 B;  1D9D A;  1RT3 A;  1D09 B;  3GG1 A;  3ET6 B;  4HT7 A;  2GC8 A;  1NJI T;  4UOO A;  4KSE B;  4H4O A;  3QJL A;  1EAR A;  3BF4 A;  4G1Q A;  3HO1 A;  3JSR A;  3N9U C;  2EFQ A;  3QGG A;  2K7K A;  4B08 A;  4A8F A;  4WKR A;  3OR1 B;  2VAS A;  1FRX A;  1HDH A;  4B9T A;  2Q43 A;  1OY8 A;  3A13 A;  3O1L A;  3SDE A;  5KFU A;  5KG0 A;  1SXL A;  1Y4Z B;  4C9D A;  4MY4 A;  2V8G A;  3AJ2 A;  2IDL A;  2QSW A;  2ZE2 B;  3M4X A;  2J6S A;  2UUA J;  3OFH A;  4YR1 A;  2AGO A;  1DJ0 A;  5G4D A;  2W2O P;  4AL6 A;  2HQG A;  1JJC B;  1S1X B;  3PKY A;  1QSS A;  1Z4U A;  2WVC A;  3H59 A;  4RPF A;  3UWT A;  2ACY A;  3ZXW A;  1RTI B;  4U67 Q;  2I38 A;  2E66 A;  1RWX B;  1SV5 A;  1U25 A;  3EDQ B;  3FKB A;  3KLG A;  2CPH A;  1R8A A;  1FDB A;  4M5M A;  1HHT P;  5T41 A;  2HHT A;  2W5Q A;  1R6Y A;  3IGZ B;  1Q5V A;  5LRM A;  2MEW A;  1QVF R;  3HFK A;  3BR9 A;  4Y3C A;  3G6V A;  4M5I A;  1VQP S;  3K0J A;  2DGT A;  2ZHB A;  1LNQ A;  5LM7 E;  3D3C J;  2VKZ G;  1P9Y A;  4GC6 A;  3AA9 A;  4PWW A;  5F8I A;  1N36 J;  4WK1 A;  1NH7 A;  4C8L A;  1CJT A;  2AYB A;  4MKV A;  4DDF A;  3WX8 A;  1XER A;  3RYL A;  5F9N A;  2HHH J;  4ELV A;  2E5L J;  4CIO A;  4OZ0 A;  2J9D A;  4B3S J;  4Y34 A;  3M30 A;  4ALZ A;  3GB0 A;  1BGX T;  2LKZ A;  3G82 B;  3GSI A;  4RR5 A;  3Q8U A;  3EGZ A;  3RW6 A;  3HSJ A;  3NCQ A;  1R7I A;  2W9C A;  3TA2 A;  2H4W B;  4DR4 F;  3EZO A;  2B9X A;  1RAJ A;  1FXR A;  2QGF B;  2N3O A;  4YQW A;  4ZHR A;  4DLG A;  2J7U A;  3CCT A;  3E51 A;  3A52 A;  2P9E A;  4ZDN A;  2CNL B;  3M7V A;  4E98 A;  3MR6 A;  4U9R A;  1GX6 A;  3MM5 A;  3CIZ A;  4NA1 A;  1DTT A;  1RWO B;  1L3K A;  2A10 A;  2MLY A;  2XM3 A;  4X64 J;  3LP0 A;  5D3G A;  3HFV A;  4IRD A;  2ZE2 A;  3MHY A;  3VVT A;  1RTD A;  1UTA A;  1MNE A;  3ZTQ A;  4J9O A;  2OEK A;  2DGO A;  2PA3 A;  3B6B A;  5D78 A;  5LMU J;  1LV5 A;  1EW9 A;  2PDA A;  4JI4 J;  3FK4 A;  2ASD A;  2MKS A;  3EXC X;  1IKW B;  2MST A;  4H4M A;  4I69 A;  5H9F K;  2EFN A;  1RAB B;  5KFZ A;  4ZA1 A;  4LR8 A;  2AHO B;  5E3C A;  1YI2 S;  3AB4 B;  3NCP A;  2QL5 B;  2RKI B;  4LR9 A;  2ZZN A;  2CPX A;  1HNW F;  3SZZ A;  4L72 B;  2OPR B;  2J9C A;  3CE8 A;  2LXF A;  2LLZ A;  1SC6 A;  2Y8W A;  1WHY A;  1H3D A;  3I5A A;  2IAJ A;  5D0H A;  4RUC A;  1RT1 B;  5LMU F;  2FIU A;  1TL7 B;  2BJ3 A;  2HZC A;  1CJT B;  1RLC L;  1PJ6 A;  3LF0 A;  2J9E A;  1PAU B;  5DLV A;  1VK8 A;  2KT3 A;  2R8G A;  3KG4 A;  3BGL A;  3FCV A;  2VZ9 A;  3N6N A;  1C4A A;  3FMB A;  4MKB A;  1Y3K A;  3G82 A;  1REG X;  2ROG A;  5KG6 A;  1YBT A;  1Y5N B;  4MK7 A;  2CQP A;  2K1R B;  5LIA A;  1HA1 A;  1VR6 A;  2QMW A;  5HSP A;  2BA9 A;  3ELH A;  3EUN A;  2OFG X;  1Q5Y A;  4IDK A;  4MYU A;  3U02 A;  2R8I A;  5KFS A;  3BKU A;  5GVQ A;  2MQN A;  2ZC4 A;  3QGP A;  4MMO A;  2IPO B;  3W9I A;  3Q24 A;  4B3R F;  2OSR A;  1VHI A;  4OYM A;  4B3T F;  1TUG B;  2F1F A;  1S1T B;  1DTT B;  1S1U A;  3IC1 A;  1FKO A;  1XNR F;  1ICE B;  2YKQ A;  5D3G B;  4HLB A;  4R8U A;  3NWR A;  4UPK A;  1DAX A;  2RF2 A;  3T19 A;  2YPZ A;  1N5V A;  1MRO B;  3A4T A;  2BW2 A;  1TFY A;  2OTJ S;  4PG8 A;  1RAG B;  1WC3 A;  3AOD A;  1U24 A;  2BUN A;  1KOO A;  1REV A;  4LJM A;  1IR0 A;  5L9X A;  1ZAV A;  2OHD A;  2WBR A;  2W1B A;  2YH1 A;  2E7V A;  3ZZ0 A;  3H25 A;  3G4S S;  2PT0 A;  5I3U B;  5HJX A;  3IRX B;  1DRZ A;  4USJ C;  5CYQ A;  2HVI A;  2R2R A;  1JJ2 R;  4F26 A;  5L8R C;  4CH0 S;  2L41 A;  3TA0 A;  2BKO A;  4Z2X A;  1XJW B;  3CDE A;  4CO0 A;  3H2U B;  3KJV B;  1S0M A;  2DXF A;  3HVA A;  2Y0S D;  1HBO A;  4XDD A;  1TL7 A;  3R6L B;  2CJA A;  2RDJ A;  1FRL A;  1U1K A;  3MI7 X;  2B9E A;  3OFF A;  4DOZ A;  4I2P A;  1ZZN A;  4PQU B;  3EVM A;  2KFN A;  3RZA A;  3DNC A;  2ZJQ Q;  3R5G A;  3MCN A;  1NME B;  4C97 A;  2H1Y A;  1PJ5 A;  2KYZ A;  1W26 A;  4F7V A;  2VKR A;  4RKU C;  5D4O A;  5HBM B;  3OHA A;  1JLA A;  4LF6 J;  2JSX A;  4FF2 A;  2MLZ A;  4CO3 A;  4Q5V A;  4ER8 A;  3OVA A;  3JSY A;  1H98 A;  4MHX A;  1WC4 A;  3GJT B;  5J2N B;  4R5P A;  3OLA A;  1U45 A;  1HPZ B;  4FPR A;  2VPW B;  2F8E X;  3Q8P B;  5KT5 A;  3QT5 A;  3CJ8 A;  2V4J A;  4PYD A;  4L74 A;  3CGI A;  5K5M A;  1EIY B;  1ZBT A;  3D2W A;  1VQN S;  5IQ6 A;  2MQM A;  4TY8 A;  1IUJ A;  5CYM B;  2MZ1 A;  4QR2 A;  3T1A A;  1OPI A;  3HUL A;  3QBC A;  1YRT A;  1VRQ C;  4ZVU B;  2MXY A;  2EK6 A;  4USH A;  2CQI A;  3LP1 A;  2GCF A;  1VYA A;  2B4P A;  3MMJ A;  2AYE A;  4ZVS B;  3J7Z T;  3R1L A;  4YB6 A;  2KZZ A;  3BRE A;  3W5X A;  1URN A;  4UF4 A;  5KT7 A;  5HMZ A;  4B9L A;  4KAV A;  1M90 T;  4DG1 B;  1SPB P;  1C0U A;  3W2V A;  3TUZ C;  3WAV A;  2XR9 A;  3KJV A;  4Z37 A;  1FRH A;  4ZVH A;  3BQ2 A;  4P75 A;  4AQY F;  5HRO A;  4OYB A;  3VGV A;  1NSA A;  2DBB A;  1FNO A;  2XMV A;  4H54 A;  2HAF A;  4XPC A;  2R9L A;  5JVH Q;  3CD6 S;  3AH6 A;  4M5H A;  2R2U A;  4NCG A;  1IJF B;  2XC9 A;  2IY5 B;  3DLG A;  3AAW B;  4ECU A;  1NJY A;  1KRP A;  4ZS6 A;  2RRA A;  1FER A;  1CLF A;  1FDD A;  5HBM A;  1RA7 A;  3HD2 A;  2J5A A;  1IXK A;  2VJV A;  1PYT A;  3GCW P;  5AJ3 J;  2B56 A;  4R5P B;  5J2N A;  3MUT P;  5L0B A;  3UD5 A;  3G6E S;  3C14 B;  4DUY F;  1ZEF A;  2RHS B;  4QWC A;  3CC7 S;  3W5Y A;  4ICL B;  1PC5 A;  4V19 J;  1UVJ A;  1VI7 A;  3I96 A;  1N5Q A;  1YG0 A;  1WF1 A;  3BR8 A;  3KK3 B;  1LWE A;  4ILL A;  1TMM A;  3CD5 A;  5KT2 A;  3ILJ A;  2E5I A;  2ZKT A;  3M9N B;  4ZJL A;  4ZP9 A;  1HQE A;  2D9P A;  1TL3 B;  3HCX A;  3GV5 B;  2QA2 A;  5ETK A;  3D1H A;  2YX4 A;  1QUP A;  1E6V A;  3MR5 A;  2NPF A;  4CCH A;  2A2C A;  1DY3 A;  2W2M P;  2LP4 A;  3M32 A;  5E2Q A;  1CSJ A;  4PUO A;  4FYD A;  2Y1I A;  2BW7 A;  1FI4 A;  3PW7 A;  3AD8 C;  3K17 A;  1UVK A;  4HHU A;  2YY3 A;  2Y1J A;  4CWB A;  3B4D A;  2FHJ A;  4ZLL A;  3BDG B;  2NUH A;  1UP1 A;  3I87 A;  4AL5 A;  5HRO B;  2VBY A;  2R8J A;  1HFE L;  1AA1 B;  1QUV A;  1GMW A;  2WHO A;  4RNF A;  2LXI A;  2V69 A;  2M70 A;  1ZYQ A;  1B64 A;  4GTZ A;  5KFR A;  1H2T Z;  4ES2 A;  2AQ4 A;  3DM2 A;  2QV6 A;  2V2Q A;  1RHR B;  2XMT A;  4FKY A;  3LP2 A;  1P27 B;  2CQH A;  5DM6 Q;  4JI7 F;  3OL8 A;  4QPT A;  1CC7 A;  5CZX A;  1X5T A;  4P72 A;  5KFN A;  1PYO B;  3A1Y G;  2NYI A;  5L0E A;  5J2Q A;  5GAE I;  5U47 A;  4HH1 A;  2B7B B;  3BN7 A;  3LAL A;  4IFV B;  4UOH A;  4DHV A;  5CCM A;  4C8K A;  3R5C A;  4C0B A;  4C8Z A;  3AOB A;  2D74 B;  3J80 U;  1B4S A;  1LWF A;  2XI2 A;  2AF6 A;  1RWK B;  2MTL A;  5DDO C;  3OV7 A;  3KLV A;  3RAQ A;  2W7A A;  5IC4 B;  1DLO A;  1U2F A;  1UJ5 A;  3BYR A;  1PSD A;  2BV3 A;  3DOL A;  2UXB F;  3CJ3 A;  2LDI A;  3QO9 A;  3TEG A;  2MY7 A;  4A8O A;  5DQI A;  3RB4 A;  2RHQ B;  2R7X A;  1JX4 A;  2XZW A;  3BH6 B;  3DRP B;  2PMH A;  1NCL A;  4ZKA A;  3KLE B;  1HBM A;  1UEK A;  3PJW A;  4NZ7 A;  1EP4 B;  1UFW A;  3DLL Q;  5AJ9 A;  3Q89 A;  4USU A;  4OI6 A;  4XK8 C;  1NH8 A;  1T9T A;  4PUO B;  2DT9 A;  5B0B A;  4WBF A;  3FEY B;  4PXE A;  1YX2 A;  3EM1 A;  1DQA A;  4UTG A;  2PMW A;  3D0H E;  3UI3 A;  2A6O A;  3CME S;  1HWJ A;  1PC4 A;  1WF2 A;  2B3T B;  1L3T A;  2FJX A;  2E1M C;  2P6S A;  4TVA B;  4Q45 A;  1PGZ A;  5G0R A;  2B4U A;  1N32 J;  3KNA A;  1S1W B;  5DLT A;  1V5I B;  1NK7 A;  1NKC A;  3WBZ A;  1MMD A;  1WTB A;  4B3S F;  3Q86 A;  2XCP A;  2RQC A;  4C0H A;  2DHX A;  4JV5 J;  4FVM A;  1DBD A;  4L6V 3;  4M5L A;  2DTJ A;  3KTQ A;  5C24 B;  3CPW R;  4DSK A;  2AJ2 A;  4J9L A;  4PWD B;  3SZY A;  1DUR A;  2FC9 A;  3TUJ C;  1FRI A;  4M5N A;  2K8G A;  2AJF E;  1S72 S;  5LL6 d;  3ITH A;  5KOW A;  3OL9 A;  5AXN A;  3MGJ A;  2VQR A;  5I3P A;  3OTO F;  1FX2 A;  1Y10 A;  3D1O A;  1VQ9 S;  2ZDP A;  3FBE A;  3DU6 A;  4PG5 A;  1V3S A;  1FWK A;  4PZV A;  5F3Z A;  2QLX A;  4UUX A;  3MMA A;  1C1B B;  1EB0 A;  4AD6 A;  4AFF A;  1NHU A;  2YKN B;  4A8Y A;  2KFZ A;  4I56 A;  5J2M A;  5DGB A;  3HT0 A;  4I2Q B;  4IG3 B;  2P8I A;  3K5O A;  4TXS A;  1Z1Z A;  3G86 A;  4KO0 B;  4X4N A;  5B0A A;  1OQ6 A;  1X8D A;  3A3N B;  1ZTW A;  5L9N A;  1CS4 A;  1LW0 A;  4LFC F;  2FZG B;  2Z2Z A;  4NA3 A;  2B0G A;  1YRX A;  4UPH A;  3PKM A;  2FVP A;  3DLK A;  5K14 A;  2EBG A;  4EBC A;  3D68 A;  1RTH B;  3UVJ B;  2Z30 B;  5FDL A;  2IC3 B;  1Q8B A;  4OV6 A;  4X65 F;  4NYP A;  2BQR A;  1KR4 A;  3J81 j;  4MIW A;  4OZL A;  2DIS A;  3QFH A;  4M5K A;  1JLB B;  1TKX B;  1V5V A;  3H8Y A;  1O0P A;  3FBB A;  3MMB B;  1NHK L;  1RT3 B;  2X3G A;  4I4B A;  3ET6 A;  4NLQ A;  4OLP A;  2VQF J;  4F4K A;  3NMA A;  4UPL A;  4A4J A;  4UQG A;  3GR1 A;  4ENO A;  2M8H A;  4LBI A;  1N34 J;  2HQF A;  3AQO A;  4IOC Q;  5SUH A;  3RB3 A;  4DR1 J;  2CQ2 A;  3LAK A;  3DI6 B;  4OHV A;  5FLX U;  4G6V B;  1B8J A;  4P2M A;  4Y2A A;  3W1Y C;  5BJR A;  5L38 A;  4Q44 A;  3SDE B;  1IKV B;  3MMA B;  1VCT A;  4OI1 A;  4TYA A;  3MUV P;  3G87 A;  4Y2K A;  1E1Z P;  2PEB A;  1N88 A;  2A6M A;  4NWB A;  1AUK A;  5B08 A;  3CO9 A;  1UVM A;  2H5I B;  3TZY A;  1LFP A;  1JLG B;  5D4P A;  1H6K X;  2ZBP A;  1HAR A;  2JZ5 A;  2VFT A;  3P5T L;  4S0M A;  2BVZ A;  3C15 A;  1PCA A;  4KFB A;  4CO2 A;  3Q23 A;  1NB2 A;  1RWV B;  3K7R A;  3SCL E;  3IAS 9;  4UT4 A;  3V81 B;  1RT5 B;  3O44 A;  3IM9 A;  2VJU A;  3CDA A;  3TNV A;  3G2X A;  1VC6 A;  3GIR A;  2MQP A;  4DV6 J;  2E5G A;  4KGX B;  1ZM9 A;  2MQQ A;  1U26 A;  3ENQ A;  2MZS A;  5FDL B;  4RUA A;  3PX4 A;  4G1I A;  3Q0A A;  2UVV A;  4UOP A;  1ANI A;  2C1E B;  1TL1 A;  2DK2 A;  2GVD B;  3A8K A;  4DFM A;  1T03 B;  3PYG A;  3PY8 A;  1KHV A;  1U2C A;  1AFJ A;  4WCE Q;  2H48 B;  1D1U A;  1MG7 A;  3OTB A;  2ZFH A;  2BMB A;  3ADA C;  4ZPD A;  4AUK A;  3PIP Q;  1FTR A;  4A8Q A;  2W8D A;  4ZJO A;  5HAT A;  4QIW D;  1TTH B;  2M4M A;  2NPI A;  4C7Q A;  3BO3 A;  3KNG A;  2DPI A;  4TU8 A;  1DTQ B;  1PIE A;  1ZM4 A;  3MOZ A;  1DZ5 A;  5JMN A;  4B02 A;  8ATC B;  4JV5 F;  4NYO A;  5H1S V;  3M6V A;  1TK8 A;  4QW8 A;  2XYH B;  4AXJ A;  1N48 A;  2JEJ A;  3T6B A;  3GMG A;  1IBK J;  2A0F B;  1Q8L A;  1TU0 B;  3OT9 A;  3QJJ A;  4B9S A;  5A0Y A;  1OIA A;  3A3O B;  1SI9 A;  2CPY A;  3OD2 A;  2OJ3 A;  5D8H B;  3DPC A;  2R8H A;  5ITH A;  2CJX B;  4NXN F;  3IGV A;  3KYL A;  3ENV A;  4DR2 F;  5GMD A;  4TU7 A;  2DD8 S;  4OZ3 A;  1AZS A;  3QFW A;  4UOF A;  1T05 B;  3K5N A;  2NQP A;  2XMU A;  4B9N A;  4K50 A;  3L7P A;  4UY8 5;  1BWV A;  1AB8 A;  2DHS A;  4QIV A;  3G8Q A;  2F5G A;  2UP1 A;  2FGO A;  3MEG B;  2GJF A;  5ETQ A;  1N34 F;  4ZPV R;  4ED0 A;  1NDC A;  2Y3Y A;  1LOU A;  3M1V A;  1S9E A;  5ETS A;  3TX8 A;  4KGK A;  2OPR A;  3VQT A;  3H5X A;  4C4W A;  3N0V A;  3TX0 A;  2V5H G;  3WBH A;  2MKY A;  2V8V A;  3DU5 A;  4DU8 A;  3ISN D;  5ETP A;  2HRU A;  3RAM A;  3M8P B;  2XS7 A;  2Y0B B;  2IVF B;  5KT6 A;  4JYA F;  4L76 A;  3PR4 A;  5J1N A;  1WI6 A;  1ZPW X;  2LXU A;  4JI6 F;  3CNQ P;  3PO5 A;  2UU9 F;  1SUQ A;  4C8N A;  4B9M A;  2BYC A;  2GQ2 A;  4DPW A;  1R0A A;  1BUX A;  1IKY A;  2QX0 A;  3HVT B;  2M0G B;  3I6P A;  3GCX P;  3MF5 A;  3IP0 A;  3ZZZ A;  3G71 S;  4U7U K;  4ZVG A;  1QAI A;  2ZZM A;  3CMR A;  1X7V A;  3EGW B;  3VQS A;  2BJ7 A;  2I6W A;  2W4P A;  1S1T A;  2WCX A;  4A8S A;  3GYN A;  3SXL A;  2FVR A;  2HVH A;  1S1U B;  3FDS A;  4M1K A;  3R3T A;  1H2U X;  2CNK B;  3BQ1 A;  4JI6 J;  3AOC A;  2LU2 A;  1FD8 A;  2AX0 A;  2OEL A;  2YBV A;  3DC2 A;  1UL3 A;  2FD2 A;  3MAQ A;  3W65 A;  2KHC A;  3K58 A;  1Q16 B;  4ED6 A;  4WIQ A;  5A8R B;  1YLX A;  2JLE A;  4WII A;  1S79 A;  3GP9 A;  5IWA J;  1UZD A;  5DG8 A;  1YZ7 A;  1FRJ A;  3WAY A;  1D3W A;  1AZS B;  1RJJ A;  1YIJ S;  1SH2 A;  2B6A B;  2PII A;  2FYX A;  1GTH A;  1WOR A;  2I2Y A;  1Z2L A;  3D0I E;  4N5S A;  2C3Y A;  3OTO J;  3M6U A;  2R2S A;  1TUW A;  4ID8 A;  4HHH A;  3M1V B;  1VRT A;  3K57 A;  2VU5 A;  2VB6 A;  4RU2 A;  3OHB A;  1MWY A;  3HHN B;  4LR2 A;  3CW2 C;  2HPU A;  1GXT A;  2F9J A;  5DJB A;  3SFU A;  4KGV B;  1WHW A;  2F63 A;  3BKF A;  2W5R A;  3H42 A;  3CCW A;  2LQJ A;  2V34 A;  3ETM A;  3M8S A;  1RU1 A;  2DR5 A;  4FF1 A;  1KH5 A;  3MR7 A;  1KHW A;  3H0P A;  1E2S P;  3PG9 A;  5HVH A;  1YK9 A;  4HVZ A;  1R0A B;  5HAN A;  1RCX B;  1L3S A;  5I4M A;  3N5B A;  1S6P B;  1YJ9 S;  2C2R A;  4NZ0 A;  5J2P B;  3MR2 A;  4X4R A;  3SV4 A;  4A47 A;  4DQI A;  2HS4 A;  3HVW A;  9ATC B;  4DX8 H;  3CCR S;  1S49 A;  3C6U B;  1TKZ A;  3TAM A;  5KFT A;  1B7F A;  4RJV A;  1R6V A;  2CDQ A;  2L3M A;  3AHP A;  3M8R A;  2IYG A;  3FRZ A;  3MPY A;  5D0G A;  3AA8 A;  3WAW A;  3UQS A;  1Q4R A;  2XYG B;  1CJV A;  1TKT A;  2RU3 A;  4I6A A;  5B7W A;  4FP9 A;  2DR7 A;  4KM4 A;  2J0W A;  3VCD A;  2UU9 J;  2B6A A;  3R2C J;  2K3I A;  1XMB A;  5IC6 B;  4GTY A;  3RRK A;  4NLX A;  2JLF A;  2GJ2 A;  2IJR A;  2QFJ A;  1E6Y B;  3AT1 B;  3CB4 A;  3IBW A;  4ZPC A;  3WDO A;  1ZM3 A;  4YHH F;  2CQ1 A;  1TK0 A;  4JOU A;  2W8L A;  3SV3 A;  1RAH B;  1LXJ A;  1WHV A;  1X5S A;  2BM1 A;  3HJF A;  2MKI A;  2R7T A;  4Q8F A;  1CG2 A;  1FF2 A;  1FEH A;  4RL1 A;  1VBX A;  4Y28 C;  2UXD J;  1BC6 A;  5F8G A;  1T02 A;  1TUV A;  1WD6 A;  2WRM A;  4CO5 A;  2DRD A;  2GSO A;  1KSP A;  4H4O B;  5LSL A;  2G13 A;  4JI8 F;  4BDP A;  1VMB A;  2FVC A;  4OI4 A;  3RUB L;  5IWA F;  4HDG A;  1JLQ A;  2L9N A;  2R7W A;  4ECT A;  2EXU A;  2AW0 A;  4DFJ A;  4JI8 J;  1JLE B;  5KFW A;  2Z2M A;  4CLK A;  7AT1 B;  4NXN J;  4U7C A;  3BH7 B;  4RU9 A;  1TZ0 A;  2RNE A;  4HL9 A;  4Y0F A;  3Q3Q A;  4PQA A;  1KFD A;  1PBA A;  2W4C A;  2MZJ A;  2UXD F;  1R3N A;  5I3Q A;  2WVD A;  4KH0 B;  5EGH A;  4I68 A;  5GAH I;  3N6L A;  1RUS A;  1KHL A;  4NYZ A;  1S6U A;  3LPE A;  3IBC B;  2V4R A;  5C42 B;  1BD6 A;  1S1X A;  5LMN F;  4QW9 A;  3UD3 P;  1MML A;  2YKM A;  2MZT A;  3D6H B;  2I5J B;  3N79 A;  2R2T A;  3P45 B;  4UPI A;  3GU0 A;  2NLW A;  4WFY A;  2WK4 A;  3TJA A;  3CSK A;  1PBU A;  4MTP A;  1FNX H;  2E1P A;  1HNX F;  3MM9 A;  1TP7 A;  4NLO A;  3OBI A;  1HMV A;  2WOM A;  4JYA J;  1UPM B;  4CH1 A;  1TAU A;  5FII A;  4JV0 A;  2EC0 A;  4F02 A;  3D28 A;  2EFV A;  2M3D A;  4F0K A;  5IT0 A;  2BOP A;  3PJX A;  3EWG A;  4FDF A;  4DBQ A;  1UFL A;  2PC6 A;  2YXL A;  3TUI C;  2BRK A;  5K20 B;  1T3N A;  2UVR A;  1KHN A;  4CYR A;  3MCS A;  1DHM A;  4RZR A;  4IYQ A;  5DRK A;  3VZI A;  4DV2 J;  2WZ1 A;  1IQZ A;  4NL5 A;  4PKD B;  3HHL C;  3I0R A;  4ED1 A;  1YQH A;  5ETR A;  4QQB A;  4WF9 Q;  4QAX A;  3S01 A;  4ED7 A;  1FTC A;  4M95 A;  2QRR A;  1YHQ S;  2DIT A;  4EI2 A;  1KLM A;  4PPD A;  3MCO A;  5A8W B;  3CJK A;  2XMA A;  1UCN A;  1JLQ B;  5B0G A;  1RYR A;  1JLE A;  1KON A;  2DNN A;  2Y1R I;  4RW4 B;  1I6J A;  2LQ9 A;  2UUT A;  2VFS A;  1GXU A;  4KE5 A;  2CG8 A;  4OJG A;  4FXV A;  4QR0 A;  4RBT A;  2YWG A;  4USK A;  3IN5 A;  1RTD B;  1KVK A;  4JI5 J;  4AE5 A;  1LWF B;  1H74 A;  1WEX A;  4CLZ A;  2V0N A;  5A8K B;  3MPU B;  1QAX A;  1ZEB A;  5H9F J;  3X3U A;  2YKM B;  3DOL B;  2I5J A;  1OSC A;  3LH2 S;  4O23 A;  1SQF A;  1ZPV A;  3BJY A;  3QT6 A;  4JB8 B;  2VH7 A;  1GQE A;  1P9Q C;  3M2U B;  4C3K A;  4U6P A;  3DGP B;  2ZBC A;  1IM4 A;  2RKI A;  3U1N A;  3HM9 A;  3KLE A;  3UR0 A;  2HGM A;  4DR7 J;  4KHP F;  1EET A;  3CED A;  1EP4 A;  2H5J B;  4RW8 A;  4XTT A;  4WWS A;  3OJS A;  4CLY A;  4JI1 J;  1RT1 A;  1NZA A;  2KO1 A;  2ZH6 A;  3NWG A;  4LF5 F;  2BJD A;  3T41 A;  1WC1 A;  2AJ0 A;  5M2P A;  1KVI A;  2YX7 A;  2QYG A;  4DV1 F;  4MFB B;  3F73 A;  1UEU A;  2G2Y A;  2HFV A;  5KFV A;  3D66 A;  2J76 E;  3DHX A;  4ILR A;  4X4S A;  3UPF A;  5HQ8 A;  2UUB J;  4OYZ A;  3CD7 A;  1KNZ A;  1W7W A;  2KM8 C;  1S7I A;  2MLX A;  2H65 B;  4F3M A;  4F8R A;  2QLB B;  2BOA A;  5C25 B;  4RW4 A;  5DGA A;  4KJD A;  2QN6 B;  1K1S A;  5C24 A;  3CCZ A;  4JI3 J;  3QAU A;  2XLK A;  4K7Q A;  3Q8S B;  4R8U B;  3OJU A;  3GTY X;  2IFY A;  2CPI A;  1B3T A;  4L73 A;  1UPP A;  1MRO A;  1XR6 A;  2GJI A;  5FLX Y;  3BGO P;  2H51 B;  3NNC A;  2LU1 A;  3F44 A;  2KN4 A;  4FYY B;  3I32 A;  4MIB A;  1X9S A;  5FJ4 A;  1REV B;  4WXW A;  1SCJ B;  2W5X A;  4FDI A;  1WDT A;  2VD3 A;  4B9U A;  1C0T B;  3SQG A;  3O3L A;  1PYS B;  4GRS A;  1AXQ A;  1OYD A;  3KLI A;  1Q78 A;  3QIP A;  2VBX A;  2WSC C;  3M2U A;  4E8U A;  2ASJ A;  4LQY A;  4TN0 A;  3I9Z A;  5CYQ B;  3GYG A;  1HI1 A;  5HP1 B;  4IG3 A;  5JVG Q;  1EET B;  2RAQ A;  2VL1 A;  1X4A A;  4LF9 F;  3B54 A;  1WG4 A;  2IJF A;  2MMY A;  1Y00 A;  1RAD B;  4KBI A;  2QC3 A;  2HHX A;  2PFD A;  5KFD A;  4DZD A;  1VQL S;  5KOX A;  1KS2 A;  1LWC A;  2V8D A;  5CA5 A;  4LF6 F;  2DIV A;  1MW7 A;  4A8W A;  4DR6 F;  2X1A A;  5IM0 B;  5FD1 A;  4MFB A;  4PPZ A;  3JTP A;  5DQG A;  2K3K A;  1RHK B;  3PAC A;  4ETX A;  1X0F A;  4GKJ F;  1S4F A;  1RBO B;  4TYB A;  3DGV A;  3DHW C;  4H4K A;  2QEX S;  1PIL A;  1U0S A;  4NMX A;  4RW7 B;  1OO0 B;  1S0O A;  4LF9 J;  3GJS B;  3JSB A;  3QAT A;  4ZPA A;  2J8S A;  1N5T A;  3EJM A;  1KBR A;  5C25 A;  3LUY A;  1FDA A;  5HAO A;  4HI2 A;  4RWW A;  4O4G B;  5KFP A;  4DV0 J;  1FD2 A;  1U0H B;  2G9Y A;  1C2P A;  2B9W A;  3I4P A;  1EKS A;  1QY7 A;  4G1P A;  4I6Y A;  3PO4 A;  4ERD A;  1KWM A;  2CJK A;  1ELY A;  3M8Z A;  2XB2 D;  2E5J A;  3MEE A;  2HGN A;  2GNK A;  1FFS B;  2LEP A;  3OR2 A;  5BYQ A;  5THW A;  5GAG U;  1Y11 A;  2ATC B;  2C2K B;  3AD7 C;  2BE9 B;  3B78 A;  3FQK A;  1FKP A;  4HI1 A;  3MEK A;  4KY3 A;  4QWE A;  2E5H A;  4B3O A;  2GIF A;  1U48 A;  4IOA Q;  1MLA A;  3NKM A;  4QPX A;  2HYI B;  1KVJ A;  1VBK A;  2GIQ A;  4GVB B;  4WYL A;  4CO1 A;  1RB0 A;  1VC0 A;  3G9C A;  2OKQ A;  2YVS A;  4A8M P;  3PXG a;  1RKI A;  4NLG A;  1N8R T;  2AV5 A;  1KHK A;  1JLG A;  3IGN A;  3KDN A;  2DCU B;  2HFO A;  2NS1 B;  1LWC B;  2HQD A;  4ZLN A;  3TP2 A;  5AE3 A;  5T14 A;  2X98 A;  3FNN A;  1WF0 A;  2FC8 A;  3V81 A;  2LEB A;  2MJU A;  4N7T A;  1QDU B;  1R31 A;  2NSC A;  5E41 A;  5INH A;  2DHA A;  2KI2 A;  2XLI A;  3KK2 A;  1QVG R;  2XCA A;  3DLG B;  4OZN A;  3P5B P;  2XUL A;  4QWA A;  1QAJ A;  4ZPT R;  4PG6 A;  3V6D A;  3FJ2 A;  3N5F A;  1IM6 A;  1RT2 A;  2HFS A;  4CM0 A;  5AE2 A;  4Q2L A;  1F3F A;  3EVO A;  1NK4 A;  2E5L F;  3UDL A;  3AD9 C;  2JLG A;  5DM7 Q;  5E0O A;  3C14 A;  5T7L A;  3D6M B;  3JXO A;  3JTN A;  4XO0 A;  4TQR A;  3D6T B;  2VFR A;  2DNR A;  4ICL A;  2JFK A;  1QAY A;  2NXE A;  2XWX A;  3FUY A;  3H2V E;  1V3R A;  1D8Z A;  2MHN A;  2O66 A;  4FXW A;  2PMZ D;  4TLR A;  4V1A k;  3UNY A;  1MN9 A;  3GPA A;  1BLU A;  2PA8 D;  2QMU B;  4CNZ A;  3JAM U;  2FLP A;  1JNZ B;  7FDR A;  2VPY B;  1SC3 B;  8RUC A;  3MTJ A;  3PFE A;  1RI7 A;  2QA1 A;  3DOM B;  1QTN B;  1JLC B;  5HL7 Q;  1XC9 A;  4LF7 J;  1U1L A;  4NLU A;  1E6V B;  3EZ5 A;  5A76 A;  3LO3 A;  2J7K A;  1YSJ A;  2QO3 A;  1A9N B;  3M6X A;  3ZZR A;  2UUA F;  2BX6 A;  3DLE A;  2VG6 A;  2CWX A;  2P9C A;  1LW2 B;  1T9Y A;  3PYD A;  4OQJ A;  2YWW A;  5DS7 A;  3GFZ A;  3CJS A;  4LRF A;  3HXM A;  2F7V A;  4NRT A;  3DYC A;  2B5J A;  3MEG A;  1VQ7 S;  4DX7 A;  1SKR A;  4OHY A;  3KUG A;  3TEH B;  3PFO A;  4KYZ A;  1RGV A;  3W60 A;  1SC4 B;  4J5O A;  3ZZU A;  2LEC A;  5J1P A;  5KFQ A;  4LF7 F;  4F0H A;  3KK2 B;  3T1H F;  4C8Y A;  4LRC A;  1RT4 A;  2HLU A;  3BS9 A;  4WFB Q;  1U1N A;  4FN5 A;  2HQI A;  4MK9 A;  1RAE B;  3V6D B;  3HSG A;  4LRE A;  4KPY A;  3CCL S;  4QIF A;  3LWL A;  1ZET A;  3WC2 A;  1EJJ A;  2E1A A;  5GOV A;  1CEZ A;  4ECQ A;  4GKK J;  4P6Q A;  1XMO J;  1KTQ A;  1KTV A;  2DH7 A;  2YQ3 A;  2G4B A;  4CLT A;  3PZP A;  2DH9 A;  2EEY A;  5C2G A;  4P10 A;  1BE4 A;  2IM3 A;  5EX0 A;  4CM2 A;  2DGW A;  1VQS A;  5KTQ A;  4K4X A;  1YTY A;  3HHD A;  1I94 J;  3NKN A;  2BJ1 A;  7FD1 A;  2YKA A;  5GAD U;  4LT6 A;  3G8S A;  1FE0 A;  2PEH A;  3NGT A;  3MAA B;  5F0U A;  3RU0 A;  3DRP A;  4CQ1 A;  3SSQ A;  4GTW A;  1S48 A;  1N32 F;  3GJQ B;  1JLF B;  2EG2 A;  1U1Q A;  4X84 A;  1JNR B;  2D1G A;  3J7Y I;  5LJ5 Y;  1N2K A;  5TJ3 A;  3MK0 A;  2OML A;  1BQM A;  2MQ8 A;  3PHE A;  3JSM B;  2DR8 A;  2RDI A;  4WFA Q;  4ED8 A;  1FX4 A;  4QJV A;  2G2Z A;  1M5P C;  1P6T A;  3D3B J;  3MM7 B;  2VG7 A;  2OFH X;  2A1B A;  2KT2 A;  4OYO A;  1X4D A;  4K4W A;  1K44 A;  1UVI A;  1VJQ A;  3D5M A;  4O3O A;  2PI5 A;  4FBT A;  5KFJ A;  1VHF A;  1HBN B;  4URS A;  1GMV A;  4DSF A;  4ED5 A;  1JXE A;  2XMK A;  4ZPB A;  1VGY A;  2ZKU A;  1UKU A;  4DR5 J;  3KUH A;  4OIX A;  3W66 A;  1IN0 A;  3BO2 A;  1QSY A;  4KJG A;  4DFK A;  3KJF B;  2V50 A;  4OI3 A;  5GRR A;  2X7I A;  2G1H A;  3BSC A;  2DNM A;  4EGL A;  5ETN A;  3R5B A;  2UVU A;  4IQX A;  4QYZ J;  2KRB A;  4CRJ A;  4PG4 A;  4OYA A;  2ZM6 F;  3VAI A;  1HWL A;  3T01 A;  2CG4 A;  4LQ3 A;  5M2U A;  3TRG A;  4ZPW R;  2N4D A;  1N4L A;  4FDJ A;  3IXQ A;  3K5L A;  5ETT A;  1WUU A;  4BS2 A;  1SJ3 P;  2W5S A;  3IR5 B;  1BHN A;  2JL9 A;  4G1Q B;  4K59 A;  4DLE A;  2FQQ B;  1HBU A;  3MDF A;  1Y0H A;  3MUM P;  1RYS A;  4F2S A;  2V8H A;  3OR1 A;  4DL5 A;  2DGV A;  1NKB A;  2YWE A;  3V6J A;  5RUB A;  4WFN Q;  1AUD A;  2V2V A;  2LQ8 A;  4C3M A;  2YKN A;  1BWE A;  1D0E A;  3W64 A;  3C6U A;  1RLD A;  1U1M A;  3CCU S;  2IRU A;  4KB7 A;  2BKP A;  2AMC B;  4DI6 A;  2A3J A;  2CQ0 A;  2W5W A;  4M94 A;  2F3J A;  2XMM A;  3I31 A;  4LSL A;  2YNI B;  2Z0G A;  2E1R A;  2V68 A;  1YWX A;  4D3G A;  1RTI A;  1H0H B;  1Q0N A;  2B4V A;  2GFF A;  1SV5 B;  4F50 A;  2VFV A;  1MWQ A;  3MM7 A;  1RWM B;  3KWM A;  4NLW A;  4UOC A;  3CT9 A;  4NRU A;  3TR5 A;  1N0U A;  1RU2 A;  3C8Y A;  1RAC B;  3QMQ A;  4QR1 A;  4AYB D;  4HTJ A;  4C6A A;  1XMO F;  2DVI A;  1MU2 A;  2DXE A;  2HNY A;  3WQP A;  2DCL A;  2KU7 A;  2J6T A;  1YKW A;  1SKU B;  5E5N A;  2XI3 A;  3JAM Y;  3MFH A;  1TKD A;  3IWL A;  1NUE A;  2OI2 A;  1F9H A;  4ZVE A;  2XY7 A;  2OTL S;  3ZZY A;  2H9Z A;  3BV8 A;  1RBL A;  4AT1 B;  4ZLP A;  3SCK E;  4FKX A;  3I56 S;  2RH6 A;  2F65 A;  2XTJ P;  2LDY A;  3Q83 A;  4HR2 A;  1R8C A;  2HFN A;  2ZNY A;  4RLE A;  4CP5 A;  1X4H A;  4PG7 A;  4DS4 A;  5LT5 A;  2HHS A;  1XWL A;  3IBF B;  4C3L A;  2K7J A;  2W7O A;  4FYX B;  5KFG A;  3IR6 B;  4Y2C A;  2GGP B;  4DV3 F;  3NXZ A;  2FJA B;  4KKO B;  4DPY A;  3W62 A;  4QCL A;  1W25 A;  4YUD A;  3TVY A;  3VAF A;  3NVL A;  5C66 A;  2MJN A;  5BYS A;  1NJZ A;  1EJ7 L;  1HBU B;  2VBZ A;  4J9K A;  1HL6 A;  3BGF A;  3ENA A;  4ED2 A;  2R7S A;  3IR7 B;  1N33 J;  2AZ3 A;  3D6F B;  2HRY A;  2GV1 A;  4ZCI A;  2DRB A;  2FJV A;  5CZV A;  1L3V A;  2UUB F;  1J5E F;  2D9O A;  3DOK A;  3SEO A;  5KFK A;  3TOQ A;  1SJQ A;  3RG6 A;  2ZVI A;  2QLF B;  3NGD A;  3SMZ A;  4RBV A;  1Q7L B;  2YH0 A;  2SXL A;  3R1H A;  2J7W A;  4ED3 A;  2VHG A;  4DSJ A;  2HHP A;  2YNI A;  3BSN A;  1IKW A;  1Q8I A;  1UWB A;  3CVK A;  1TQL A;  2LQB A;  2WW4 A;  2YNG A;  3NGU A;  4H4M B;  3SCI E;  3SYZ A;  3C15 B;  4DV7 J;  4LFA F;  5KFM A;  2QE5 A;  2HKE A;  3CWJ A;  2HMI B;  1FNM A;  1CBK A;  2RUG A;  2D7S A;  3D0G E;  3DCA A;  3MM9 B;  2ZOG A;  3GZ7 A;  2IUC B;  1BMQ B;  1JMT A;  3VAK A;  4DUZ F;  1B0V A;  2VDI A;  4KHP J;  3FVY A;  1L5U A;  4ZLJ A;  3IGY B;  1XNQ J;  4LF8 F;  2JNJ A;  1HQ2 A;  1RHU B;  5L1L A;  3V6H A;  2HHH F;  2E9R X;  2FLO A;  4Q0B A;  1FJG F;  4EBE A;  3GR0 A;  4C0O C;  2ZD1 B;  2IA6 A;  3NGS A;  3E8O A;  3I4H X;  3TAP A;  2ZBI A;  1GK8 A;  4FBU A;  1FES A;  2DIU A;  1A0O B;  5D15 A;  5A6W A;  3ILI A;  4NI2 B;  4X62 J;  3T5L A;  3JB9 k;  1S10 A;  4IO1 A;  2KH9 A;  4KKO A;  3V4I B;  1OWX A;  2ALZ A;  1HKA A;  2DO4 A;  2N3L A;  2QIF A;  3GFY A;  3KLF B;  1N5Y B;  2YWF A;  1M5O C;  1FWL A;  4WYW A;  1QLN A;  2L9D A;  2RML A;  1YDL A;  2ILY A;  2KVQ E;  1FKO B;  1FXL A;  3VAM A;  1M1H A;  1WEL A;  2D3Z A;  3OVS A;  1T94 A;  4FF3 A;  1FK9 B;  2P2C B;  2YX1 A;  3DMJ B;  1SH0 A;  4X66 J;  3GIJ A;  4DPX A;  2OEJ A;  2ZH3 A;  2E9Z A;  4ZG6 A;  4MJK A;  3TVK A;  3LGN A;  2IA0 A;  3QT7 A;  4J91 A;  3R8Y A;  3OSN A;  1EI6 A;  1ZED A;  3RB6 A;  2Z58 B;  4A48 A;  4OLO A;  3TWZ A;  1T9U A;  2XS2 A;  3B5Q A;  4RNM A;  5LRN A;  4CLL A;  5EWE A;  2P5V A;  3LWM A;  1X4F A;  1YJU A;  1JXL A;  3EGV A;  2VA2 A;  3CF5 Q;  1ELX A;  3PVX A;  2CPD A;  5KFI A;  4EWT A;  4F0M A;  2V63 A;  4J7C A;  4YME A;  2RUS A;  1HNZ F;  4RW8 B;  5L1I A;  1F2G A;  4KAI A;  5E3R A;  1RHJ B;  3UN5 A;  5CCL A;  2JDJ A;  1HBO B;  3N4W A;  2UVW A;  4ZG7 A;  5KT3 A;  2EWH A;  3J81 U;  2FY1 A;  4X2B A;  4WPA A;  2EPI A;  2OSQ A;  4WFX A;  1EKR A;  3MMC A;  2LQ5 A;  1HW9 A;  2MKJ A;  3PEH A;  4KGZ B;  4RUB A;  1XR5 A;  4F3O A;  1YRU A;  4PWU A;  3KJQ B;  1V9O A; 
#chains in the Genus database with same CATH homology
 1E2S P;  3BDG A;  3LXQ A;  3NKP A;  4KAY A;  1ED8 A;  3UN2 A;  1KH4 A;  2W5V A;  3NKR A;  1HDH A;  2GLQ A;  3DYC A;  4MY4 A;  3E2D A;  4YR1 A;  3MK2 A;  1FSU A;  1E3C P;  5L0K A;  3UNY A;  1Y7A A;  5KXA A;  4LR7 A;  4UOP A;  2XR9 A;  3M8Y A;  1EW8 A;  2RH6 A;  3NKM A;  3WAW A;  4LRA A;  4ZG9 A;  5AJ9 A;  4KM4 A;  2W5Q A;  2W8D A;  3BDH A;  3IGZ B;  5L0E A;  2G9Y A;  4MHX A;  2W8S A;  4NWX A;  1P49 A;  4LRD A;  4KJD A;  5LRM A;  4GTY A;  2XRG A;  5C66 A;  3NVL A;  1HQA A;  1HJK A;  2IFY A;  4UOR A;  1SHN A;  2GA3 A;  4CXS A;  5DLT A;  3UO0 A;  4LRF A;  1ALJ A;  2IUC A;  3KD8 A;  3OT9 A;  2W5X A;  3DPC A;  4LRC A;  1URB A;  2GSO A;  4TN0 A;  4LQY A;  1N2L A;  4CXK A;  3A52 A;  4KAV A;  1AJC A;  4LRE A;  1EJJ A;  4ZG7 A;  1EQJ A;  3SZY A;  5GOV A;  3M7V A;  3IDD A;  2QZU A;  3WAV A;  1AJB A;  1ALI A;  2VQR A;  2IUC B;  3Q3Q A;  2GSN A;  5EGH A;  1ALK A;  3NKN A;  5DLW A;  3TX0 A;  3WBH A;  1KHL A;  1EW9 A;  3ED4 A;  4CYS A;  4GTW A;  4GTX A;  1KHJ A;  2D1G A;  4UPI A;  4LR8 A;  3UN3 A;  5LQQ A;  4MIV A;  1N2K A;  5TJ3 A;  3MK0 A;  4LR9 A;  4LRB A;  3SZZ A;  5L0B A;  1SHQ A;  3CMR A;  1EW2 A;  4B56 A;  1AJD A;  1E33 P;  4UPH A;  1ZEF A;  5DLV A;  1ELY A;  1O98 A;  3M8Z A;  4CYR A;  5EGE A;  5K4P A;  3WAX A;  1URA A;  1K7H A;  2ZKT A;  4KJG A;  4QAX A;  4ZG6 A;  1KHN A;  4CXU A;  4ZGA A;  1KH7 A;  5LIA A;  3TG0 A;  1EI6 A;  5GRR A;  1ZED A;  2W5T A;  3NKQ A;  4FDI A;  3TWZ A;  1ANI A;  3WAY A;  3IGY B;  3B5Q A;  4FDJ A;  1Y6V A;  4NWJ A;  3T01 A;  4UPL A;  5LRN A;  1ELX A;  1AJA A;  5IJQ A;  1KHK A;  2W5S A;  3BDG B;  5HRT A;  5IJS A;  1ED9 A;  4UPK A;  1KH9 A;  1B8J A;  4GTZ A;  3UN5 A;  3NKO A;  2X98 A;  3BDF A;  4LR2 A;  2GSU A;  3M8W A;  1ZEB A;  3T00 A;  4N7T A;  5INH A;  1E1Z P;  2W5R A;  3T02 A;  1ALH A;  3MK1 A;  1AUK A;  4UOO A;  1O99 A;  1KH5 A;  2ANH A;  2W5W A;  1ELZ A;  1ANJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...