3UN5A

Bacillus cereus phosphopentomutase t85e variant
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
Knots found
sequence length
391
structure length
391
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDEMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Differences between a Mutase and a Phosphatase: Investigations of the Activation Step in Bacillus cereus Phosphopentomutase.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
molecule keywords Phosphopentomutase
total genus 143
structure length 391
sequence length 391
chains with identical sequence B, C, D, E, F
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2011-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3un5A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3un5A01
5L0EA 1SHNA 1KH9A 1KH7A 1Y7AA 1EW9A 2W8SA 1KHKA 5DLVA 4UPHA 4ZGAA 5DLTA 5K4PA 2RH6A 1AJAA 1ELYA 4KM4A 4UPKA 2QZUA 3MK1A 2W5WA 5INHA 3E2DA 3NKQA 3A52A 5LRMA 1N2LA 1ZEDA 3M8ZA 2XR9A 3MK2A 3NKMA 2D1GA 3IDDA 2XRGA 3M8WA 4MHXA 5GOVA 5LQQA 3DPCA 4GTZA 2GLQA 3SZZA 4LRAA 1ZEBA 1E2SP 5L0BA 1EW2A 3OT9A 1FSUA 5IJSA 2ANHA 3TWZA 4GTWA 5GRRA 3UNYA 3SZYA 3BDGB 3DYCA 1KHJA 3Q3QA 4KJDA 1K7HA 4UPLA 1ELZA 4LR9A 5L0KA 1KHNA 4ZG9A 1EQJA 5LIAA 1E33P 2W5XA 3B5QA 3WAVA 2W5QA 5AJ9A 1ALHA 4FDIA 4ZG6A 2GA3A 4CXKA 4GTXA 1URAA 1URBA 3IGZB 3M8YA 3MK0A 4GTYA 1B8JA 4NWXA 4LRCA 4CXSA 4MIVA 1AUKA 1AJCA 1KH4A 4LRFA 2W8DA 1ANIA 4UORA 4FDJA 4LR8A 3T02A 1AJBA 3TX0A 1ZEFA 1ALKA 3WAXA 1N2KA 2GSNA 2ZKTA 3UN2A 3NKNA 5EGEA 4LRBA 1ED9A 4QAXA 4UOPA 3NKPA 2IUCB 3BDFA 2W5VA 5HRTA 4LRDA 4UOOA 1EJJA 4KAVA 3M7VA 3WBHA 3NKRA 4MY4A 3UN5A 2G9YA 3KD8A 3T00A 2W5SA 1ELXA 5TJ3A 1ED8A 4LR7A 2GSUA 5KXAA 3IGYB 2X98A 1HQAA 4LQYA 5IJQA 3WAYA 1EW8A 4CXUA 3CMRA 3TG0A 4KJGA 3T01A 1ALIA 4N7TA 4LR2A 4CYSA 4NWJA 1E3CP 3LXQA 3WAWA 2W5TA 3ED4A 4UPIA 3NVLA 5C66A 1O98A 4B56A 1SHQA 2VQRA 1AJDA 4KAYA 4CYRA 1EI6A 2W5RA 1P49A 1O99A 2IUCA 1KH5A 1KHLA 1HJKA 1ANJA 3BDGA 4TN0A 2GSOA 3NKOA 5EGHA 4LREA 4ZG7A 1E1ZP 3UO0A 1Y6VA 2IFYA 1HDHA 3BDHA 4YR1A 5LRNA 1ALJA 5DLWA 3UN3A
chains in the Genus database with same CATH superfamily
4E8UA 2ZM6J 2WK4A 4RNMA 5DG7A 4RNFA 4YB6A 2SXLA 3IAS9 3VVUA 2LEBA 1WEYA 4ETXA 3TX8A 2IRXA 3T6BA 3E01A 5G0RA 3M9NB 2M88A 2XC9A 2R7XA 1HW9A 3M8QA 4C98A 4XAKA 4IRCA 1HBUA 3NWGA 4OYWA 5LMUF 4X4RA 2LDYA 3MD1A 5KFEA 2NUHA 2P6TA 4C11B 3R97A 4IOBA 5LSRA 2DNMA 3TAMB 1EQ0A 1C1CB 3MPUB 3LTOA 1VBKA 3B8HA 3FSYA 2R8HA 3O1LA 3T1YJ 3QJPA 2CZ4A 4DCOB 1YK9A 2H4YB 4YOEA 3NGUA 4P10A 2RUGA 3KOAA 3H59A 2QL9B 3PNIA 3DLKA 3DGVA 2FJBB 1OY6A 3PJXA 4NPOA 3FJ2A 3K5NA 1RHMB 1WHWA 2W9AA 3DU6A 2MKSA 3VAGA 3IM9A 1X4FA 3VAIA 4U96A 1RABB 4C3KA 4U8YA 2OEKA 1M1HA 3H42A 1HIYA 4DL0C 1S76D 4EO8A 2VA2A 4WU3A 2OMOA 2Z57B 3BM7A 2EBGA 3CCSS 2J9DE 2JL9A 2ZWOA 2NCKL 4GKKJ 3B5QA 1RCXB 1RTHB 1S1WB 2GA7A 1RT5A 1VC6A 1MWZA 1HBOB 3MUVP 3ENWA 2YNHA 4M94A 3MK0A 2BW2A 2EK1A 4EYIB 3DLGA 3CCES 3SZ2A 2KYXA 5D4NA 2QEXS 3BGLA 4NWXA 3F0NA 2HSEB 1JLAB 2A10A 3GJQB 4WTYA 3LGHA 5KFBA 2E9RX 5KT6A 1F5AA 4ZN1A 1F9EB 1W25A 2HLTA 1HI0P 1G2EA 4ES2A 4J9MA 2CQDA 4UQGA 4Z37A 2CQ3A 3WAXA 1FTCA 3J7YU 2WHOA 5SZTA 4B02A 1P27B 3BEGB 4OHYA 4DFJA 4QIGA 2UXBF 2BDPA 4ILRA 2UVRA 4OV6A 2O3DA 3LP0A 2V8PA 4NYPA 5E3CA 4D3HA 5GADI 1PCAA 3LP2A 1ZM2A 2FPHX 3R5GA 4PYAA 3QSYB 1RWUA 2OLWA 4CT9A 3NGKA 4DDFA 1JXEA 3PW5A 2C2RA 4I7FA 1L5UA 1NCLA 1I1GA 2HBZB 1KS2A 1YKWA 2ZE2B 2AKWB 5CYJA 2VZ9A 2BJ1A 2ZNYA 2CPIA 2KTQA 4DQQA 1JLQA 1P1LA 3IAM9 1I5OB 2GMHA 1CC8A 2W9CA 2W5SA 1NAQA 4FYYB 4DN9A 3M6XA 2PEBA 4F67A 2Y8WA 2KU7A 1QLNA 1T9XA 3MI7X 3IR5B 3PW7A 4DV6F 3CCVS 4GRSA 2WTFA 1EW8A 2E1CA 1DTQB 3ZZTA 1HI8A 3MWBA 4HHJA 5B0EA 4JI5F 1S6QA 2ZD1B 1HD1A 5AXKA 3PW2A 3VZHA 5D3GB 4R0EA 4NL5A 1XR5A 3MFIA 4LF9J 4CYRA 2WBRA 4HTJA 1UVMA 3IS9B 1FEHA 1OMSA 2B5JA 2EFGA 2VPYB 1U2CA 4PPDA 4UUXA 5KAKA 2OFGX 4Z7CA 1KHLA 1ACMB 2FJEB 3NKOA 1JJ4A 3G86A 2BOAA 2KXNB 1RQ0A 1Y9OA 2D3ZA 3BV8A 1VIXA 4K7QA 5D78A 4DX5A 1W2BR 3GLJA 3TZYA 4DUTA 2DNYA 1SJQA 4YR1A 3MPDA 2DNZA 4I2PA 3R2CJ 3IO1A 3IMQJ 3UN3A 1VRTA 5J1EA 5IS2A 1JLEA 2JOQA 3MAAA 3J7ZT 1UVKA 3FKBA 2NXNA 2DIUA 2DD8S 4DV2J 1JNZB 1SB6A 1SC4B 3JS9A 5DQGA 2CZ9A 5KG5A 3ZZRA 1IKXB 2BQ3A 1HBUB 1VQ7S 3SI8A 1VLOA 3I87A 1U45A 3GIIA 2HNYB 3GJSB 3RGIA 3GE9A 4RWWA 4MFBB 2R42A 1KQKA 1RAAB 2Y1LB 3OSPA 4B9NA 2G13A 5BYQA 4ILMA 4H4OA 2M4MA 4FYXB 2YX4A 1C0UA 1KBRA 2AYMA 2NSBA 3FMWA 3JQJA 3SIPB 4W92B 2NPIA 3CJKB 1HYSB 3KHGA 3N5BA 2BRKA 3DRRB 1LOUA 4UOHA 3CO9A 2D3O1 2DNGA 5A0YB 4L3KA 3HZEA 5K9FA 3UCGA 5GRRA 4K2XA 5DM6Q 2RAQA 3AT1B 4PG6A 1NDPA 4U7UD 1SC1B 4RWXA 3BDGB 2HBQB 1V5IB 1KHJA 2YH0A 3KMQA 2W2MP 1KWMA 3W1YC 3IGVA 3CEDA 1LEOA 2AJFE 4NI2B 2KJVA 5J1PA 5L38A 5F8MA 4NLYA 5CQGA 4MTPA 3MUTP 4X4SA 3PEJA 3D5MA 1ZTTA 2HNZA 5FLXU 1RT4A 3OVAA 2FHMA 5KG3A 2XGQA 3EVWA 1OYEA 2JLFA 4CLZA 1OIAA 3FK4A 3SSRA 2Y1JA 3CJ3A 3IRWP 5ITHA 3CD6S 2XMVA 3FCWA 1B7YB 3QT7A 1YJTA 1ROFA 5L1KA 5BYSA 2AD9A 5DGAA 1M5PC 2ASLA 5KFSA 4TY8B 5F8HA 2BR0A 1UAWA 3KDNA 3O5TB 4DR7F 2FHOB 4WXWA 2RU9A 2J6TA 5HBMB 1N56A 3GZ7A 1ZEFA 2FLOA 2M7SA 4QPTA 4Y2KA 2NPFA 3ISND 1Q81T 1KR4A 2COLA 3D3CJ 1M5OC 5EGEA 1ULRA 4QR2A 3LP2B 3VTIA 1ED9A 2UXBJ 5IXUA 4QAXA 3POTB 1PBUA 4JYAJ 2J8AA 1SL2A 3OPKA 4X65F 3QGGA 2FHKA 3DN9A 4LVNP 2EI5A 4C11A 3OLAA 3QFHA 4OYXA 1T94A 4LF4F 2CQ0A 2HVZA 2XNQA 2NSCA 3CDWA 3M7VA 2JWNA 4IUFA 1K47A 3IR6B 4I4BA 2DGSA 1ZAVA 2DGWA 2G9OA 2WVEA 1N33J 2F8MA 3DOLA 2BYCA 3DU5A 1RTJB 2DO4A 4KBIA 4DL4A 3A8IA 1F2GA 4B3RF 1S72S 4XDCA 3KHHA 4P6QA 1QY7A 2PMWA 2QA4G 1TK8A 1RT2A 2WSFC 1QSLA 2U1AA 4MKYA 3EGZA 1RJJA 2JLGA 2B3TB 2IM3A 2MZSA 3D28A 1H7WA 3CD0A 3P5TL 4DV3F 4C3MA 3Q8SB 1K8AT 2YH1A 4DR3F 4KAIA 4FDFA 3RAMA 1FE4A 3S8SA 4G6VB 3TAQA 2APOA 4I0WA 2HIYA 1EB0A 4W90B 1O98A 1VOMA 1LWXA 2DYAA 3P49B 5AJ3J 2A2CA 3W60A 1S1WA 4KH0B 1EI6A 1YG0A 2GIRA 2ZBPA 3ZO7A 3M32A 4KO0B 1ZAWA 3AD7C 1MLAA 3I5CA 4G3IA 4MKAA 3THPA 2LVWA 4K5RA 2CJBA 4ZP7A 1IKYA 2GSOA 5EGHA 3ZZUA 2MB0B 5C7PA 2MGZB 4JI1J 2JH3A 4IYQA 2EFVA 4JYAF 2VDIA 3OD2A 1JLEB 2HEKA 4LBIA 4WIIA 4DR5F 3HK2A 2PDAA 4I2QA 4M5KA 4ED3A 1U1OA 2VBWA 3QRPA 2VFRA 2JVOA 3ELHA 3M05A 2AEFA 3DGPB 2QC3A 3OTOF 1NJXA 2HGLA 2MHNA 3KYLA 3RW6A 3BKUA 5LMUJ 4K0KJ 1JLFA 3FSIA 2DGVA 5E0OA 2IC3A 3MTKA 2M3DA 1YX2A 2N7YA 4MIWA 2GNKA 4DV4J 2FLLA 1OSCA 5LIAA 3NCQA 1NK4A 1FHTA 2ZJPQ 5IM0B 1X0PA 4FYDA 3D0IE 2MLXA 5GAEU 1N5SA 3FBEA 1U0HA 2QX0A 3R5BA 4CH7A 5KG2A 1PC4A 4U7UK 5I4MA 5EWEA 1OJ4A 1IBKF 1XWLA 1WNEA 1HLWA 3NOGA 4CTAB 4P2XA 1TK5A 5DDPC 3DDIA 3FFIB 1JNRB 3ITHA 4A8SA 4O4GB 3PHEA 1RI7A 3VQSA 1VS3A 1LWCB 5AXLA 5KOXA 3V4IA 3RBDA 4DV5F 4DLGA 1T03B 1J5OA 2RNEA 2RSQA 3G8SA 4QR0A 1NH7A 2F3JA 3RB3A 3DPCA 3GFXA 5C2GA 1Y5IB 4QU7A 2MYFA 1R8BA 5EN1A 2IHR1 5GVQA 4DL6A 1NJZA 3FQLA 2XSJA 2DR5A 4WF9Q 3M2VA 1RK8A 4AL5A 2VFUA 3ILIA 1NDKA 3ETOA 3BO3A 2H48B 3FCHA 4IRDA 1VQYA 4FVCA 1S77D 2VODA 4OYMA 3KLFB 2CQBA 1HMVB 5D0EA 4JI3J 2PC6A 4DEZA 4LF4J 5L0KA 2AZ3A 1EQJA 3ZTSA 4A8MP 2XMJA 2J7UA 2AYEA 3BBCA 4GVBA 1YJ7A 2W25A 2HG4A 3GFHA 5FLXY 2OPRB 1GK8A 1QAYA 2CQHA 5BXIA 1FWKA 2QJ3A 4Y2IA 5LMNF 4OV1A 2JEJA 3U7JA 4QYRA 2FVCA 3L95X 1KNZA 1GXLA 1RSCA 4OJHA 1EX8A 3C19A 1Q1KA 3QWPA 3DLJA 4KV8B 1CQNA 3TVZA 1S6OA 5C25B 3A4TA 1XN9A 3K7RA 1VRTB 4LRFA 4OJ3A 4RW8A 5IT0A 3PIOQ 1HNZF 4CCHA 4M1KA 1WC6A 4X4OA 4DSJA 2XG8A 4FDJA 2ILZA 1S79A 4DZDA 3D1QA 4AE5A 1IM4A 4FYVB 4ZLLA 2VU5A 3V2UC 1GTHA 2OFHX 3CF5Q 1JMTA 1CVJA 5IT9U 3CJ2A 1Q82T 3HKZD 4A8WA 3A8KA 3X1LB 2RU3A 2CJQA 4DV3J 4G1IA 3OTOJ 5JVGQ 1HQUA 2ZBQA 3MUMP 1E33P 3BGUA 5CXTA 1NM2A 3R9LA 2P9GA 4NLTA 5EX3A 2HHPA 1QSSA 3THTA 2F9DA 2DXDA 4OHXA 3BDEA 5H9FJ 2PA3A 3DRPA 3BGFA 1CJVB 4CI0B 1EJ7L 5HMXA 1XNRJ 5IT9Y 4H4KC 3PYGA 1YI2S 4X2BA 3CJ5A 3KUHA 3NKRA 2Q6BA 2R7QA 4FXVA 3ZNJ1 4KGMA 3UDVA 5HN0A 4OZLA 4NXMF 1S1VA 2B9XA 3EPGA 1RP5A 1ZM4A 1GX6A 3AY0A 1FKOB 2I5JB 4IFVA 2DVIA 1ED8A 1RT2B 1S97A 4NLWA 4OYZA 5TJ3A 3ET6B 4M5DB 4X66F 1U48A 3GP9A 1U6BA 3G96A 4LSLA 3W2VB 2BANA 4O3SA 3M8RA 1YJVA 4WZQA 1JLCB 3CJRA 2CPDA 4DG1B 4Q44A 1WKKA 4WFZA 5EHHA 5EWGA 2XHWA 3TR5A 2OHDA 3OLBA 2PEHA 1YJ9S 1SHQA 4BDPA 1SXLA 4DJBA 4Q5VA 1Q0NA 3Q86A 1AJDA 4RBUA 2FJXA 3K8WA 1S12A 1T7PA 1MMLA 4J90A 2MGZA 1FDDA 2VFVA 2XSFA 1C1BA 4U8VA 1H2TZ 5HAOA 3NAIA 2HHXA 2KT3A 1EP4B 2GW8A 5HJXA 3ULHA 2N4CA 1ALJA 2EFQA 3NY0A 2WSEC 4ZPDA 1FXRA 1CULB 2NZCA 3KJNB 3PRBA 2UV8A 3OL7A 2ACMA 1Y7AA 1I6JA 4LQ3A 2PT0A 4ZIWA 1YBAA 2VD3A 2GVDB 1U6FA 1RT5B 1EIYB 4FF3A 2GC8A 2G9YA 3TQEA 4ZMMA 3POTA 6FD1A 4MMOA 1WKJA 2HWTA 1KFSA 2RH6A 2VKRA 2B9WA 1SL0A 2FC8A 3PX0A 1FRHA 1C2PA 3M1VB 3US5A 3ZXWA 4KGKA 1FD2A 4KKOA 5FD1A 2X1BA 1MU2B 2DR8A 3AXMA 2POKA 3EM1A 3EUNA 3F73A 4JI7F 2NS1B 2NXEA 1UJ5A 1T8EA 2I8EA 2FLPA 5F0UA 1HNIB 1RACB 2W2OP 3DFEA 4OIXA 2DHAA 4RL1A 3UD3P 4X64J 3ILLA 1R0AB 1PYOB 3JTPA 2J0SD 3T1HJ 3PRVA 5D8HB 4ICLA 2FY8A 2AW0A 3K5PA 2VG7A 4RJVA 5L9NA 3KLHB 2ZHAA 2CFXA 3IBFB 3UNYA 1VRQC 4UZCA 1T9UA 4LFBF 1G7CB 4DMZA 3RZAA 1VBZA 2Z2LA 3H4DA 4WKRA 2ZITA 3AODA 1L3TA 2IIHA 1FA0A 1FWPA 3DOMA 3RYLA 3SQGA 2X7IA 3HP6A 2W9CB 3JSYA 3VAKA 1N8RT 2XLKA 2VC0A 3D67A 3M8PA 3NGRA 1H72C 2EG2A 4CRJA 5I42B 3RU0A 2BMBA 3KLEB 3MMCB 1WELA 2RS2A 2AYBA 4PUOA 1URAA 2IJFA 4IRKA 1VDHA 4OI6A 1X4BA 5L8RC 2JLEA 3ZFVA 3QLHB 2HRUA 4OYBA 1NK7A 3GJTB 1GMVA 2DCUB 4WFYA 4C9DA 4F4YA 2YTCA 1ANIA 4DV7F 2HNDA 2L9WA 5HSPA 1TP7A 1CQMA 3PACA 4NOHA 1M1GA 3BGOP 3LALA 2IC3B 4X65J 4QWAA 1RWVB 4USUA 5AE2A 2FB0A 1RT3A 4F26A 5KFDA 2FJDB 2L9DA 3LANA 3SYZA 2BJ7A 4K4SA 1LXJA 1DLOB 3OQ2A 1V6HA 3IG1B 4LFCF 2KM8C 2DXFA 4USTA 2HFVA 2YNFA 2DKOB 5IQ6A 2LXIA 4TKTA 7FDRA 1FERA 4Z2XA 1R8PA 4IG0B 4DR4J 3ISNC 3K5MA 4JI7J 2QMWA 4KR0B 3ET6A 2KXHA 4KHPJ 4NEZA 2Z8QA 4LSLB 4PWUA 3VQTA 3W2VA 4UW2A 1HPZB 1HQAA 2XS2A 1RLCL 3AQOA 4WPAA 5LRMA 4OHWA 3BPDA 3TVYA 2HVHA 5MAOA 3DLEA 4LR2A 4DSFA 1TV6A 3C6UA 1C0UB 4LF6J 4A4JA 2PA8D 5H9EK 2JEFA 1EKSA 5E2QA 2IRUA 4LFAJ 3UR0A 1KRPA 3GYXB 2W4DA 2HRTA 3OR2A 3P96A 4HI1A 4KAYA 2CPFA 3W65A 5IT4A 4ZP9A 1S7HA 2LLZA 5A8RA 1IR0A 2WVFA 4ILLA 1YJRA 2HK3A 1HJKA 1Q79A 3VVTA 1DQ8A 2PI5A 4MJKA 1MG7A 1ZAXA 1KEKA 4A8KA 1UW9A 2YY3A 1FD8A 3S7RA 4XIUA 1CULA 1JJHA 1V5VA 1OY8A 5K8PA 3TAPA 2ALZA 2MQQA 4Q0BA 5ETOA 3UCUP 5HQ8A 3KKFA 2JNJA 1SH0A 4ES3A 3K57A 1S57A 4TYBA 4JI6J 3HF5A 2G2ZA 2KRBA 2LA4A 2RRAA 1KVJA 2FGCA 4H4MA 2EFOA 4OX9F 3RBEA 2J7WA 1RAHB 2D41A 2DHXA 4PAAA 1U1PA 3MZIA 1JX4A 2QZUA 5F8IA 3MM9A 4K4UA 3DI6A 3GV8B 1WI8A 4UQTA 2Z2YB 3RW7A 1HNVA 2KB2A 2VG6A 4I67A 5C42A 1R43A 3H4BA 1X0FA 1N2LA 3M8ZA 2AJQA 2XR9A 1SH2A 2DITA 2OEMA 4C8MA 1KSPA 1M5KC 4K4ZA 3CIMA 3W64A 4QOTA 1Y7PA 1SKSA 1Q86T 4TNOA 1JLGB 4OYOA 2XZTB 2G2YA 1VQLS 1NZ8A 4N8NA 4QW8A 2FVQA 4ZP8A 3OT9A 3MMAB 3HVTB 3WBZA 4ALZA 4A48A 2B8QA 4AT1B 1Q8IA 4UOGA 4M63A 2RHQB 3G71S 2OPPA 2ASDA 3G9CA 3TJ8A 1HQEA 3JTNA 1B70B 1BQXA 3FC9A 1RTZA 3GR1A 3IC1A 4AQYJ 2UXCF 2MY8A 2ZUGA 2QSWA 3QQCD 2GX8A 3I0SA 1TL5A 2CPYA 3PJ9A 5GMEA 5K8MA 1TAUA 4HH0A 5J2PA 2UVVA 3TUZC 1HBNB 2GA3A 4GKJJ 5E41A 4RNOA 3CWJA 5ETTA 1LV5A 1VCTA 5D6GA 5JXSA 2A3JA 4QW9A 3BGRA 3WC0A 3R1HA 3HHDA 1S0OA 3OXFA 3G6XA 1PSDA 1X5TA 2PMHA 5HK4A 2ADBA 3HHLB 3I31A 4MIVA 4AXIA 3DHWC 4F50A 1S10A 2X1AA 1APSA 4UORA 2D3UA 1NXIA 4DF8A 4B9TA 5KFZA 3KJQB 4AD6A 1FXLA 3QATA 5ETMA 4YMEA 1CLFA 1N2KA 2C3UA 3K58A 4HACB 2GHVC 1D9FA 3F56A 3NP5A 2O5DA 4LRBA 1ZM3A 3H40A 2ZH5A 2F9JA 3S01A 2HHVA 5GAHI 2RVJA 1N32F 1VQPS 1FESA 3HVWA 1CSJA 4CNZA 4FZVA 2GO8A 3H2LA 4LRDA 4M5JA 4P2SA 4WFBQ 4DS4A 1Y11A 2CNLB 2VBZA 2XLJA 4KJIA 1AW0A 4KAVA 4UTGA 3MAAB 3PM9A 2C2MB 1HNIA 3M8SA 4MY4A 1DHMA 1H3DA 3A8JA 5CHCB 4N56A 4DS5A 1R0AA 4OMFG 2B7CB 4USVA 4DV1F 2VOOA 1HD0A 2HZVA 2CQ4A 1WJ9A 5F8NA 1QJHA 1V3ZA 4NA2A 1RTIA 3CGIA 3KK2A 1F0XA 4F4AA 3KLHA 5CZVA 2KJWA 1YSJA 3DXBA 2P2CB 3I6PA 6AT1B 1HR0J 3BO4A 5ETRA 3VCDA 2IM1A 3PW4A 3CULA 5IC4B 4YS2A 2F4FA 1LWFA 1WHVA 2FGOA 3CSKA 1ALIA 3I82A 3ZTOA 2R8JA 1TL4A 3G4SS 4O4GA 5JMNA 2PI4A 3OUYB 4CLSA 2VV5A 4DX8H 2DISA 4O44B 2GVZB 3N28A 1IQZA 1Q5YA 4Y34A 5GADU 4DF4A 5I42A 5JVHQ 3AD8C 3C6TB 2AU0A 4PXEA 1EETA 3AB4B 3H90A 2YWKA 5KFUA 1Y3JA 5HMWA 4X4UA 4ZVQB 3BDGA 2LU2A 1RWPB 1DURA 1K9MT 3HHLC 3H5XA 1HI1A 2AV5A 2QL7B 2XMWA 1VQ6S 1NK5A 4QYZK 4ECSA 1D3WA 3T5KA 1J5EJ 1OQ3A 2P8IA 3AOBA 5LXRA 4X62J 4WK3A 2DB1A 1FDNA 3KLIB 4MAKA 4QWCA 4IH5A 3Q8RB 1KH9A 1KHKA 2XMMA 5AT1B 5HJYA 1HNZJ 3U1LA 2OMLA 3C16A 3C15B 3QIPA 4L3NA 4IH6A 1L3VA 2KT5A 3AOCA 2BE7D 3RRHA 1B99A 2OPSB 2K3IA 4JBCA 3W63A 2V4JB 3A1YG 1MWQA 2YWGA 2XGPA 4BBYA 1WOOA 2NXCA 3HFZB 1VQ4S 2V68A 1SKUB 1IBLJ 2E9ZA 2MJNA 4LT6A 4L74A 3I4PA 1FX4A 3DM2B 4JP8A 4C8NA 4RZRA 2ZZNA 4MHXA 2BKPA 1B7FA 3HVTA 2BZ2A 3MD3A 2RRBA 2IM0A 3NXZA 5M2RA 2A2DA 4DU7A 1YQHA 2B4PA 5I3PA 4ECYA 2ANHA 4PWWA 4OYIA 3PR4A 2MSSA 3LP1A 5BR8F 5LOQA 3N6NA 3TAMA 3C6UB 4DUZJ 4I1TA 3TA2A 2UUCJ 4O23A 4RPFA 4F0MA 3G2XA 1TMJA 3O44A 1U25A 2CQ2A 2L08A 2RKIA 1T9TA 5KFRA 1JKHB 5DG8A 4DQRA 3DLLQ 4ID5B 4XK8C 3GILA 4FBTA 5EGYA 2UUWA 4JV5F 1EKRA 1TUGB 4YHHF 3PTWA 4O4RA 1N32J 5AJ9A 2MHEA 4EO6A 3DRYA 2PGCA 4OI1A 2W24A 3PIPQ 2NXUA 4AL7A 2EXUA 3PHTA 2VPZB 1WOPA 2WW4A 2XYPB 1MWYA 5CD4H 2ZH6A 4USMA 3D1OA 1Z2ZA 1PIEA 3HHLA 3CJTA 3L7UA 2CQCA 3J81j 4X4TA 1FO1A 4NZ6A 1YJNS 5KFXA 3JQMA 2J5AA 3HHNB 2PE8A 8ATCB 1AUKA 1AJCA 4V1Ak 5THWA 1NMEB 2AT1B 4JV5J 4O0NA 4FN5A 3W9IA 5HLFB 2FY1A 1AJBA 1HWIA 5KFKA 4H4MB 1VFJA 3KG1A 1H38A 1IKYB 4ZVRB 2YX7A 5D4LA 2CJ9A 2W2QP 2C3PA 3OL6A 3T41A 1DZ5A 2DY9A 2C42A 3DMJA 4IDKB 2KM8B 2W7AA 1KLMA 2VC1A 3PRDA 2JC1A 3IRXB 2OP5A 4RW4B 5L39A 3RAXA 2FJWA 1HQ2A 5C42B 1U1NA 4YQWA 1IBCB 2ZVIA 4HDHA 4EBCA 1EJJA 2UU9F 5HP1A 1F3VA 4M5IA 1UWBB 2MTLA 3BBBA 3QMQA 4NXNJ 3DGPA 3HD2A 3WC2A 1UCNA 1BHNA 1NDLA 4QWBA 3CJ4A 3UN5A 4F8RA 4ZPTR 2IVFB 1MROB 2FVSA 2GHWA 1YRUA 3H2UB 4LIRA 4F25A 5AXNA 2QGFB 1RT6A 1RYSA 2WRMA 3IWNC 2YKMB 2LQ9A 3KK3B 1P9YA 4QIVA 1U0HB 4ZVOB 4KT0C 2CWKA 4UY85 4UOOA 4KKOB 4H4KA 2LQJA 3T01A 3D9BA 4ZHRB 3FFIA 5F8GA 4B3SJ 5FJ4A 2FVPA 3LGMA 4PG8A 1G1XA 1S0MA 1YRXA 3A12A 1NZAA 4JUZA 4OZ2A 3WIVA 1H73A 3PYEA 1U1QA 3P5BP 1HBMA 4ZVTB 5DDRC 2XM3A 2IUCA 2W9BA 1FRLA 1AXQA 1R0CB 2ZHBA 1WI6A 1KDNA 1FKPB 5CZXA 1T3OA 3VF0B 4WP3A 1VQNS 2WB1D 5KG6A 4LREA 3CT9A 4USHA 4R0JA 4DR2F 1E1ZP 1Y6VA 1NHKL 2XMUA 1RHQB 4J9VA 2CDQA 2IDLA 1XNQJ 1HDHA 1FVQA 4WKYA 2LQ5A 1UKUA 1PC5A 2VF3A 3CDAA 2ZH8A 2DRDA 2VPXB 3CDUA 1ZETA 5A2QY 1IBKJ 1X4AA 4UPHA 3PYDA 1S1XA 2D9PA 1H2UX 3ONQA 1QVGR 3HXMA 4OFZA 2IM2A 1U47A 4GVLA 1AJAA 1ELYA 4I6WA 4KM4A 2H1YA 1N52B 4XPEA 5A8KB 1I94J 4KV8A 1SJ4P 2VBYA 2W7PA 1KQFB 4KGXB 5EDWA 1BLUA 4DR1J 3WZ0A 4E2FB 1QM9A 3OBIA 2GJ2A 3R7BB 5KFAA 1KVIA 2GJIA 4LF2A 2BUNA 1WF2A 3MM8B 2OSRA 4QBUA 3HO1A 1BQMB 1RXOB 2XEXA 3OTEA 2R7RA 2AGPA 2OPQB 1VHFA 3E51A 4RW6B 5E3RA 2DR7A 5M2PA 3LP1B 2UZAA 5F0WA 4DQPA 3R3TA 2NR0A 4DR7J 1AZSB 2KZZA 5A8WA 2WVCA 3BR9A 4URGA 4ECXA 2XS7A 1ZA2B 4DCJB 2E5LF 2LQBA 2IAJA 1WHXA 2HBYB 1FRJA 1LWFB 1TTHB 2WOMA 3CCWA 3EXCX 3HSDA 1X5OA 3MM5B 1CS4A 5D4PA 4GO5X 4BC7A 2DXEA 2HW3A 1IVZA 4ID5A 4CO0A 4UPLA 4O44A 2XY6A 2E9TA 2KG1A 4HHUA 1NO8A 3CCQS 1FKOA 5GAEI 4LFAF 4PQUA 2V69A 4LF5F 4C4WA 3R5AA 4ZPBA 1U0SA 2RDIA 2K1RB 1VLYA 1FEEA 2BANB 1FWLA 1RYRA 3NL0A 1HWUA 2R2SA 2LEAA 2JEIA 1DQAA 3IGZB 3ZTQA 3DDNA 2ROEA 4TY9A 3H25A 4Q7AA 4WCEQ 2PMZD 2M52A 4LSNA 1FCAA 1Q8KA 4CQ1A 1RAEB 4ECQA 5HLFA 3N5FA 4LUBA 4DPOA 1WEZA 1LKZA 4ATNA 3CMQA 1XMQJ 3DLBA 1Q4RA 3X3UA 4K4VA 1NPKA 2DGUA 2YNHB 4C6AA 1SPBP 5DQIA 2W2PP 4G1QB 3C3LA 2ZZTA 1RAJA 2QLJB 2PFFB 2QIFA 1WDDA 4NMXA 1N6QA 4TU7A 1KLMB 2MQPA 1BD6A 1RHUB 1JQGA 3EXYA 2ZH3A 1NU4A 4J9OA 4IOCQ 1YIJS 1U1MA 4RU2A 2V50A 1RA7A 2VH7A 4CO4A 2ATLA 4MK7A 2DPIA 4GKKF 2H51B 4L73A 3GFZA 1B0TA 1S6PA 2VFSA 4NLXA 5HBMA 5J2QA 2QE5A 3M30A 3GCWP 3SFUA 2IPOB 3WBHA 2E29A 1FNMA 5IFMA 1I3OB 2LXUA 3JSMA 1S5ZA 1F5CA 4LFBJ 3D4JA 3LGNA 2DH8A 4RNHA 3KK3A 3T00A 1Y5LB 1ELXA 2BQRA 4LR7A 5IC6B 2AHOB 2CDRB 2WONB 4ZOSA 1HWJA 2R7VA 5KXAA 4JI0J 3MM9B 2XO7A 3AB2B 1U2FA 2JJ4D 2EC0A 1UFLA 3NS5A 4P72A 4LF6F 5HMYA 1JLQB 4ZVEA 3EPIA 4NZ7A 2V9KA 4NWJA 3FZ2A 4NCGA 2BACA 1QD1A 3EICA 5GAGU 2CNOB 3CCRS 1NB7A 4LQ9A 3E8OA 2W01A 4DCPB 3QO9A 3FGVA 2IJNA 4OHVA 1N54B 3PO5A 4MKVA 4JI2F 3JAMY 2R2TA 2CVIA 3JXOA 2Y9HA 1O99A 1S0VA 1RT7A 2ZNZA 3OR1A 4DBQA 2VJUA 1F6TA 2YKAA 5KFCA 1VQ5S 4IFYA 1NEEA 4J9NA 1ICEB 1OYDA 2ZBCA 5HMZA 1UVLA 3EVMA 3HVRA 3NBPB 5LXYA 1CBKA 3N9UC 3RB4A 3U27A 1PJ7A 3JTOA 2CG8A 4EBEA 3P3DA 4PABA 1YDLA 5DLGA 3DOMB 4KO0A 3IN5A 4CO2A 1YTYA 3CJ0A 4B3MF 3FRZA 2B4VA 5DLVA 4NASA 4B9VA 4U95A 2A1BA 1BUXA 3HLUA 1X5PA 4Y00A 5L1JA 4RUAA 1WTBA 3PR5B 1HHTP 5A8KA 4IDKA 3KFWX 3AA9A 1W26A 3MM7A 1NHUA 4RKUC 1RAGB 1A6LA 1S6QB 2AJ1A 2FUG9 2V0NA 2DH9A 4NX9A 4PG7A 3Q83A 5HP1B 4LF1A 2VA3A 3CDEA 5D3GA 1YZ7A 4CLPA 2LEPA 3NKMA 3MHYA 4ANDA 3MM6B 3MFHA 3W2WB 3UDCA 4NMLA 2OPQA 1S6UA 3EDQB 4R25A 1NNDA 3K5OA 3TA0A 1FJGJ 1RT3B 3LAMA 4ZCKA 2YKMA 3K5LA 2DPJA 1Q78A 3W5YA 3H7HB 4BCAA 2KH9A 4GTWA 5I3UA 5CYMB 2J6SA 2ZC4A 4ZPAA 4I2PB 4BHQA 2HK2A 3FBFA 3O8WA 1VC5A 1YRTA 1TMMA 1XJWB 4CYUA 1X4DA 4IH7A 2OI2A 1ZA1B 2MKIA 3FDSA 3FEXB 1OO0B 1V3RA 4OLOA 3QPIA 4O3QA 3BYPA 1ELZA 3AFGA 1FRIA 2H5JB 2ROPA 4ZLJA 2DNRA 1TKZB 2E1RA 1PG5B 2LCWA 1BGXT 3NGSA 4Z7YA 2XMAA 2W8KA 4OI4A 2W9BB 2VB6A 4J9RA 2D9OA 4O3NA 3MR6A 2KDOA 4EU0A 2ZOFA 1EQMA 1N5YA 1UJ4A 2WW8A 8AT1B 3T1YF 1DJ0A 1IJEB 3B54A 3UD5A 3KLVA 1RBAA 1QTNB 3NWRA 1HMVA 2QV6A 4JI8J 3QGPA 3KNAA 1DTTB 1RDRA 3I0RA 4ZVFA 2XWYA 4NLPA 1VBYA 4CXSA 4MYTA 2BKNA 1HA1A 5F3ZA 3LWMA 1HW8A 2YXLA 2JRSA 3CXCR 4IO9Q 3T5HA 4NA3A 1KH4A 3OR2B 2HIQA 1V9OA 2GVZA 1RWXB 4DPUA 2C3OA 2D1CA 4DQIA 2XRGA 4JV1A 4ZKAA 2RE1A 1S1XB 3EWGA 4ED2A 2H9ZA 2KRRA 4I68A 5K14B 2HHUA 3BDPA 5CAAA 3PVXA 1BE4A 1RWNB 2BE9B 1WTFA 3AH6A 5M2UA 2RILA 2AX0A 5HROB 2F4VF 3PV8A 2PIIA 3MMBA 4JI0F 2XTJP 3S6EA 1S49A 2FZKB 2LDIA 4ZN3A 5LSOA 2CJAA 2DNLA 3MEDA 4FS1A 4D3GA 3T9NA 1H6KX 1UPMB 3DDKA 3KLIA 2HMIA 2HNZB 1HL6A 3PDNA 3KD8A 3BSNA 4J9LA 1UP1A 2QRRA 2RQMA 4KY3A 4OX7A 4QQBA 3DLGB 4BWJA 2XO6A 1K1SA 1Q95G 1I94F 2BOPA 1FRKA 1RE1B 1XTZA 3M6VA 2X98A 5LSLA 4TN2A 1E6YA 3AAWB 1FFGB 3N0VA 4KPCA 4DPTA 2V4JA 2P6SA 1CS4B 3GYGA 3I9ZA 5D0GA 1MMDA 3PG9A 4F3MA 1N36J 5FIIA 2GS8A 1IBMJ 1O8BA 3QO9B 2WVBA 3B82A 4NLUA 2K2PA 1T9WA 2EKNA 4KE5A 4I6YA 2EW9A 2GGPA 2RS8A 1PAUB 4PEOA 4USWA 4OZ1A 4Y65A 3MURP 2UUBJ 3TZZA 2CQPA 4CNYA 4B3TJ 3OL9A 2G4BA 4DPWA 1XEZA 4TU9A 3TARA 2J0XA 1NUEA 2R2UA 1JJ2R 4EK2A 4CLLA 1S9GA 1AYEA 4C7QA 4LSNB 5BR8J 1N0VC 1TZ0A 1IKWA 4NLOA 1AUDA 1M90T 1X9SA 1CJUA 4FP9A 4RW9A 3DOLB 3ICLA 1ZS6A 3OW2R 3C66A 4LMZA 5FDLA 5H9EJ 1WKLA 2E5GA 4DFMA 3Q8VA 4I64A 5J2PB 2A0FB 1N34J 5F8JA 1C1BB 1FDAA 1SV5B 1ZPVA 2DGTA 2DNHA 3ETMA 1HBNA 3FNNA 1F9FA 3KUEA 2OTJS 1BY9A 2YKQA 4NLRA 3FBCA 3MM7B 1TUWA 4RUHA 2VPWB 5EWFA 3UDLA 2CPZA 1VIOA 4S0MA 3H0PA 2W5WA 4RBVA 4NEYA 4EGLA 4TU8A 5LM7E 2XWXA 1WC3A 4ED0A 5J2QB 1NK6A 2IMWP 2HLUA 2MQMA 5F8LA 4KYZA 4LF5J 4X4QA 1WG1A 4CO3A 4N5SA 2AQ4A 4KGZB 1TL7A 4O3OA 1AA1B 4B9UA 3CCUS 1RTDB 3DRSB 4ZVPB 2YKNB 1U26A 3M9OB 4ECRA 5LQQA 4DR5J 4LRAA 1PAEX 1EW2A 5KFMA 3W66A 2HHHF 3TWZA 5J1NA 4K4TA 1Y0HA 2AYGA 2D7SA 3MK2A 4Y2AA 3WQPA 4I2QB 1LWCA 2BM0A 2HQCA 5DETA 4QWEA 5ADZA 2ZH7A 4ED1A 3V4IB 1T03A 4LF7J 3A3NB 4Q8EA 2MEWA 3DYAA 4LVOP 4YR3A 3GV5B 2JSXA 2WAQD 3QWUA 3GPAA 5KT3A 4K4YA 9ATCB 4CLWA 4RR5A 5EUHA 4O0IA 1WOSA 2GAGC 4ELUA 4NLQA 1LWEB 3TANA 1FK9A 2G0IA 1ALHA 3HX9A 1TUVA 1SH3A 2QL5B 2HS3A 2J0WA 4PCQA 3I0RB 2ZH2A 3IA0A 4Q8FA 2R7SA 4UT4A 1UFWA 2P9CA 3NOCA 4IKAA 3NG8A 3GB0A 2CJXB 1HKAA 3NCPA 3ZZ0A 1Y4ZB 3MEGB 3ZZZA 4BS2A 1SUQA 2EFPA 5E3QA 2XLIA 2I38A 4EWTA 4JV2A 2KI2A 1S7IA 5B0DA 3KLGB 1ZZNA 3QLHA 4RUBA 2WSCC 3UN2A 3SSQA 1Q8BA 5HROA 3RUBL 3MOJB 3AA8A 4GO7X 3MMJA 3VZIA 4R5PA 4C0BA 4FF1A 1TFWA 2RHSB 3MCOA 3P4UB 2R2RA 2CQGA 1ZZFA 3GU0A 4DHVA 4DXLA 3I56S 3MEEB 5HATA 1KFDA 3JYTB 4A8XA 1QDUB 3B6BA 1OSDA 2YWFA 1AT1B 1N5TA 3K8VA 1X5SA 4ENOA 4ZVSB 5C24A 5LL6d 3J80U 1GNKA 2L41A 1RKIA 4EUVA 2V5HG 5I3UB 4FPIA 3PX4A 5DG9A 4X4VA 2OPSA 2EBEA 5LMNJ 3KDOA 3WAYA 1X4GA 2KO1A 4M5MA 2BJEA 4RW8B 4HHHA 4CXUA 1S4FA 1UVJA 3IBWA 4IG0A 2UP1A 3FRYA 1HNWF 1RAIB 2J8SA 2GCFA 1N34F 3IFEA 2OIHA 3ZZPA 2GGPB 2E1PA 3Q89A 4UPIA 2NUUG 3NNHA 1HHSA 1F9HA 1S1UB 2O1PA 1JLBA 5AE1A 2YQ1A 3NCRA 3IXQA 1VGYA 2ZH1A 4J7CA 1PILA 4RW6A 2N3OA 4ECZA 1N5YB 3GR0A 1D09B 5CA5A 3V81B 4YN3B 3ENQA 3V6DA 4I56A 1ZOTA 1Y3KA 1W2IA 3KMSA 3S1TA 1URRA 4K8RA 4UOFA 1OPZA 4PR6A 4DR3J 1PYSB 1IKVB 2CG4A 1YBTA 3QFWA 3A8EA 4GMKA 2LKZA 2MKHA 2Y3YA 3PCOB 5FDLB 1N4LA 1RTJA 2XULA 2R7UA 1QUPA 2AJ2A 3TO8A 3R5CA 5IV4A 1U24A 3VWSA 2HS4A 2Q66A 1QAJA 1KN6A 5L0EA 2UXDF 3NKNA 2BX6A 5KG1A 3RRGA 3QT5A 4AFFA 3BZQA 4M5DA 3MAHA 4F2SA 4OI0A 4B3OA 4DFPA 1E6VB 1FNOA 1VRUA 2F40A 3LQVA 3K17A 2K1RA 4YB7A 3AXKA 4KTQA 3ZTRA 3ENAA 1YJWS 2ZOMA 5EX0A 2BABA 1SHNA 2PN6A 4FVMA 3UVJB 2UUAJ 2EK6A 3B78A 3SDEB 2DH7A 3KJVB 1N0UA 4F4XA 3Q8UA 3T6JA 5J2NA 4M5HA 1N5VA 4ITSA 4DV2F 3SFGA 3DRSA 3IM8A 5E3AA 3UNGC 3W62A 5JUMA 2VQFF 2D1GA 2OH2A 4Q45A 3BF4A 3AOAA 1ITPA 3IDDA 3U1NA 1U49A 5ETVA 1C0TA 1VHIA 1R89A 4TLRA 4GTZA 3BO2A 5D77A 4R8UA 1SIWB 1M0SA 1WDTA 4TYAA 1BWVA 5E3PA 4DUZF 3IRXA 4Y3CA 2QA2A 4PZVA 4O3PA 1Q7YT 1R0BG 1S6PB 2KKHA 3DYAB 3OSNA 4X84A 3LWLA 3DOKB 1R8AA 4F4ZA 2XB2D 1X31C 1QSYA 4DV0F 3MPVA 1L3SA 1F2HA 3GWCA 3MDFA 4K0KF 4LR9A 2VG7B 3GYNA 3MMAA 5IM0A 3RB0A 3GIJA 2F4VJ 2W5XA 1SQFA 3W5ZA 2ZBRA 3H98A 4IQXA 2ZOGA 2G0CA 2H5IB 3CNQP 4IR1A 2D74B 2CWXA 3ZNUA 3HPOA 4GTXA 3R2DJ 3EGVA 1SJ3P 2YNGA 1YITS 2V2ZA 1YZ6A 3CMES 4OZ5A 3QIDA 1WG5A 3D66A 2QO3A 4WJBA 1QTMA 3PY8A 4B9SA 4OHZA 4RW7B 2UVUA 4N41A 4KHPF 3VGVA 3KLEA 4Y0FA 4B3TF 1XC9A 3MTJA 3GJRB 3WIUA 2BJ8A 3N79A 4I6AA 1MN7A 4J9UE 3MR7A 5D4OA 2YPYA 4Y6IA 5AE3A 1VJQA 1BMQB 1RT7B 4N77A 4CLYA 1TVRB 5CABA 2PD1A 2OELA 2QYGA 2BKOA 4ZJOA 3TUJC 2Q3PA 3P45B 3EYZA 1U2RA 3VV2B 3MEKA 2G1HA 5CYQB 3HZGA 3FCVA 4CLUA 2H65B 2HRYA 1KQGB 1QAIA 2BRLA 3J7Z5 1WACA 4N8OA 4B9LA 2F5GA 2KFZA 4P52A 3RG6A 1KHVA 2GQCA 3D3BJ 3FZBA 4M5GA 3MMCA 5C24B 4A8QA 1RTDA 3DYCA 3T1AA 1GT8A 5L46A 3TZXA 1IR1A 4ECVA 4OX9J 1XMQF 2XCPA 1SKWA 1FE0A 4ZPCA 5DM7Q 2GSUA 3U1MA 1TL1B 3EVOA 3VAFA 1VYAA 2VDHA 5IJQA 2C1EB 2LQ8A 2QMXA 3MPWA 3NKYA 3VGSA 1TK0A 4OYAA 1U02A 3CMRA 1UZHA 2GQQA 1FKAF 3G6ES 2MJUA 3CCTA 1AROP 1CJTA 3CD7A 3M8QB 3OJSA 2AJ0A 1JLBB 3TEHB 2EVZA 1IUJA 4HL9A 4MFBA 3T19A 1U7LA 3EZ5A 3QJLA 4KC5A 3NVLA 5C66A 2ASJA 2VJVA 2V9WA 2VQRA 1NRKA 1RHKB 3V6JA 2ZDOA 4ED8A 1DLOA 3ADAC 2CQ1A 1YWXA 1SJRA 2PFDA 2OO4A 2ZHOA 4KHRA 4OI3A 1ANJA 3BB5A 3G87A 5CYMA 5B0GA 3MECA 3G8QA 4Y2MA 1RAOA 3OUYA 4WIQA 5B7WA 3HMJG 1FI4A 2QG9B 2CXEA 4CT8A 4YB1P 4OLPA 4K4XA 1M1KT 1UL3A 2HZCA 5KFHA 2XYGB 1R8HA 5KTQA 4C8ZA 2QN6B 2B4UA 4DN0A 3ISZA 5E7OB 2V67A 5K8OA 3NMAA 2WCXA 4WWSA 2V6AA 3F41A 2OTLS 1EETB 1TKZA 3LF0A 2GMLA 1RLDA 4J91A 4CDIA 2ADCA 4WYLA 1EW9A 1FT8A 1QUVA 3TNVA 1YJUA 4U9RA 1RBOB 1RISA 1T02A 4DR4F 1XBWA 1JLCA 3UVJA 4R5PB 2FHJD 2GIFA 3O3LA 1C1CA 1D9AA 3PZPA 2XY7A 4ED5A 4F0HA 2RD5C 1RTHA 1UEVA 1KD1T 3I5BA 3NLCA 2I0XA 4NRTA 4P75A 2DR9A 3DC2A 3R7SB 3GSIA 4LFCJ 3EGWB 4UY8T 3HVAA 4C8LA 1ZEDA 2MKCA 4C48A 4XPCA 1ZPWX 1JLAA 1N6QB 3QT8A 2HHWA 2UV8G 2DNNA 1EP4A 3D6HB 3HD1A 1GX5A 1HNVB 2J9CA 3RJMB 3KK1B 4DSLA 2Z0GA 4NYOA 3TOQA 2EPIA 2R9LA 4FF2A 3CTRA 3OFGA 1J27A 3EDRB 4E0DA 4DPXA 2NYHA 3FUYA 3SCJE 3Q3QA 3DM2A 2K8GA 3Q2SC 2YWWA 3D6FB 3LP0B 5HANA 3THVA 1S48A 5G4DA 4L75A 2HFNA 5GAHU 1D9DA 1S1UA 2HGNA 4JOUA 3LPYA 3MF5A 1VC0A 1N36F 2IBKA 2PO4A 5KG0A 4I7FB 3NGDA 3DLHA 3NNAA 4QU6A 5K20B 2E5JA 3V81A 3T9ZA 3WAVA 4DV6J 1IWGA 1HQEB 2ATCB 3DI6B 3CW2C 3C14B 3JSRA 3TRGA 2MZ1A 2C28A 2LFVA 2MKJA 1OQ6A 3MAQA 3UQSA 2V2VA 1KLNA 4NCGB 5KFJA 2CUYA 1H74A 1GMWA 4GC7A 4E98A 3T3FA 1R31A 2HBRB 2IVMA 2K7KA 2DNQA 3O6QA 4G1PA 1REGX 4FNIA 1R7IA 5F9NA 2V4RA 4DOZA 3V6KA 1S0NA 1DY3A 1UZDA 1X4HA 3CJ8A 4OZNA 2B51A 3TUIC 2HAFA 2GQ2A 2ZD1A 4J9SA 3R8YA 2ZH9A 4HDGA 1S9GB 1AB8A 1LW0B 1NDCA 4K59A 4Q2LA 2C2OB 4CLTA 5DO2A 2VKZG 3IS9A 4YDXA 3BDFA 1FJCA 1CJUB 5E33A 1H98A 2GIQA 4FBUA 2ZJRQ 2RIJA 4WP9A 4PWDB 1B0VA 3ZZOA 1PBAA 2GV1A 5B0BA 3E3XA 1P8GA 4DL3A 4KQZA 1S1TB 3IP0A 2V8VA 4W4MA 2MQLA 3R27A 5HI7A 3BQ1A 2XNRA 4JI8F 2D3OR 2BJDA 2M0GB 3HJVA 1FRXA 3RBZA 1JXLA 1DBDA 2OKQA 3IGYB 2CVEA 1EARA 1VJWA 2BE2A 1FX2A 1S9EB 2IMOA 2CJKA 4TXSA 3K0JA 3LPEA 4KJGA 1R6VA 2B5JB 3HHEA 1WHYA 1T3NA 1LFWA 4V19J 2ZZMA 5D0HA 2VQFJ 1REVA 2W4CA 1MN9A 2XYHB 3MM6A 5IV3A 3SBMA 3DRXA 3BBFA 2A18A 3M2UB 3W9HA 1SCJB 1F60B 2YKOA 2J9EA 1HFEL 4TQRA 1V3SA 2IA0A 2ZH4A 1KH5A 3LA0A 4PXBA 4K2JA 4WXOA 3W8GA 5DQHA 4WP8A 4DSEA 1PO6A 2UUCF 1NSAA 1NKCA 3GIRA 1O5JA 4OZ3A 1WC0A 3Q8PB 2FJVA 3CC4S 1Y10A 5A0YA 1SI9A 4RW7A 3HT0A 3RRKA 5KT5A 2N82B 1SIZA 1ZH5A 5DLWA 3UCZP 5LJ5Y 1Y00A 4DWIA 1HWKA 3PKMA 5IWAJ 2RH3A 2QFJA 1UJ6A 1LWEA 5ETNA 5ETKA 4GKJF 2H54B 4H4OB 2V8HA 2DBBA 2ZC3A 2BBEA 3AJ2A 3OTDA 4ZDNA 2I1RA 1JK9B 1FRMA 2CKWA 5IZHA 2NQPA 4H54A 5DLTA 2HGMA 3Q2TC 3MK1A 2G1DA 4GVBB 4FXWA 1EAYC 1X60A 1X7VA 4ELTA 3FVYA 2MQOA 2JDJA 3LOUA 1RAFB 1HHQA 4AUKA 3R1LA 1SUQB 2QLXA 2R7TA 2XMKA 1CEZA 5B09A 4CM2A 1WG4A 1MSWD 1XNRF 1G3OA 1RWOB 1TELA 3SV3A 4IG3A 3H5YA 2FDNA 4URQU 5ETQA 2Y1IA 4NI2A 1D8YA 5ETLA 4WBFA 2CQIA 3H20A 3MCNA 1N5QA 5CH7B 4DZ6A 3PFOA 3TEGA 2A6OA 2EC2A 2IVYA 2V2QA 3MGJA 3OXGA 1H7XA 2HHTA 3MEDB 1OY9A 4EEYA 2VG5A 4J9KA 4KJDA 2R3VA 2DNPA 4F3QA 2JHEA 3A3PB 4XO0A 5AJ3F 3ENVA 4A8OA 2KN4A 2V8GA 3UD4P 2UXDJ 2WOMB 3FEYB 4C2MA 1ZTWA 2HFSA 3GIKA 2QTWA 3CCLS 1E6YB 4FDIA 3G6VA 1XNQF 4DR2J 4AXJA 5HO4A 1I51B 1RZMA 5KFFA 2I5JA 5B0FA 4RNNA 2J0QD 4PXDA 1JLGA 2Y0SD 3CB4A 3QYYA 4HVZA 3M6UA 2DNKA 2UUAF 2CZVC 2OD6A 4Y28C 5CD4A 1RT1B 4M5LA 5KFWA 5KFLA 1ALKA 5A2QU 1GMUA 3EE3A 3RTVA 2G2OA 2H5EA 1R27B 1VR6A 2ZDPA 2ZVSA 1NJIT 2BEFA 2Q43A 1ELOA 2J9DA 3GMGA 4NE9C 4NYZA 4B3SF 2OUGA 4CLKA 2C2DA 4M95A 4UOPA 3ILOA 2OD4A 5ETPA 1SL1A 1UA0A 3NKPA 1T95A 3LO3A 4RW9B 4ZVGA 4N47A 2HS0A 2FHJA 4KHMA 4P2MA 3AD9C 4YFUA 2KHDA 1S4EA 2MZJA 2KFYA 2GFFA 4C3LA 4FS2A 2B8PA 2M8HA 2JEGA 2YNIB 1Q53A 4JI4J 8RUCA 1M5VC 2R7OA 1VMBA 2DEJA 2DNOA 3D68A 5HVFA 2E7WA 4CH1A 4EZ6A 2HFZA 2HQ3A 4AL6A 2XBPA 3SV4A 3CCZA 1RWMB 4KB7A 4DR6J 4DQSA 1UWBA 3BH6B 2XMTA 3M30B 3QNWB 1VQ8S 2X1FA 1MNEA 3QRRA 1N88A 1U1RA 1U1LA 3AJ1A 4N7TA 2E66A 2YVSA 4QJVA 5KFNA 4U6PA 4TQSA 3OV7A 1SJFA 3NS7B 3LXQA 4QIWD 4DV0J 1WSRA 2QYCA 3M1VA 2WONA 3C8YA 5DDOC 1QE1B 2QLWA 3IGNA 7FD1A 3OHAA 1MU2A 1UPPA 2L48A 1CPZA 3EJMA 4EFAC 1NSQA 2E5LJ 2VOPA 2W5RA 2Q1LA 3H5SA 1J5OB 2IY5B 2VBXA 2HPUA 1JJCB 2CAJA 2GHPA 4WYWA 4QPXA 1WF0A 1JB0C 3OXLA 4TVAB 1GEHA 3GFYA 5F41A 1JLFB 3TZWA 5KT4A 4LF8J 4ICLB 9RUBA 1NHVA 5DZ7A 2MY7A 2L3MA 1K44A 1IM6A 1HBMB 1MROA 1D8ZA 3RR7A 2HNYA 1BC6A 1NH8A 3ZZYA 3PEHA 4DU8A 4A8YA 4HH1A 2O66A 2V2KA 4ZG7A 1SJ1A 1KH7A 2ZWPA 2WZ1A 2X3DA 4BLGA 2GAHC 2DO0A 3KLFA 3G8TA 5A6WA 4J5OA 1N33F 1TU0B 3DRRA 1J2VA 3P6YC 4LF7F 2AGQA 4B3RJ 4QCLA 4QWDA 2RQCA 2AX1A 2CPJA 2QMUB 2QZ8A 1WC1A 4WU2A 2MZTA 3QRQA 4IOAQ 5KFQA 3JAMU 4DI6A 2MZRA 2F63A 1LW2B 3UDEA 2HQFA 3IR7B 4NCAA 1L3KA 3J7AN 1TL3B 2IDEA 3EX7B 4IG3B 1X4CA 3M8WA 2V63A 1CG2A 2MZQA 4NLVA 4P7VA 3W7BA 5C25A 3I55S 1G6BA 2AF6A 2CADA 3B4MA 3K59A 3C2PA 2B43A 1E2SP 2JC0A 5B08A 5IJSA 1IXKA 1XQIA 5DGBA 5IOLA 2EKYA 1T9VA 3SZYA 4ZPVR 1RHRB 3J7YI 2D69A 4QIEA 3D2WA 3VGUA 3Q0AA 1BQMA 3JYTA 1P9QC 3HULA 2E44A 4FYWB 4HYKA 1BQNB 1K7HA 1LK7A 2BXJA 3D7SB 3C15A 2XS5A 1AZSA 2ACYA 2DHGA 4EYHB 2BV3A 2R8GA 2DGQA 3T5LA 1NJWA 2I2YA 4YP3A 2ZEJA 2Y8YA 1NSKL 1LNQA 3MM5A 2C22A 3EZUA 3G82A 1QAXA 4TY8A 2E5IA 2ILYA 4DL5A 2CNKB 3JQKA 3N6LA 2A6MA 2I6WA 2XI2A 3QGIA 3M8YA 1FDBA 1WF1A 4IFVB 2VHGA 4X4NA 2JX2A 1T05B 4M8LA 1U09A 1TKXB 2LXFA 3AQPA 1ZYQA 2OJ3A 4JI4F 1T0TV 4HKQA 5JJBA 5LJ3Y 2OEJA 4WZMA 2W8DA 4KIAA 1RHJB 3BKFA 1HQUB 3BSCA 3CJSA 2F65A 3J81Y 4LR8A 1NPPA 2XY5A 2UXCJ 1O51A 1UVNA 3DRPB 3PXGa 1CJVA 2M8DB 1SVDA 5B0AA 2GSNA 4F04B 3RB6A 3HFKA 3TA1A 4J9PA 5RUBA 3BH7B 5F3TA 1HNXJ 3CD5A 4RBTA 3KTQA 1WC4A 1K73T 1HARA 4J9QA 3PX6A 1U6ZA 2ZKUA 5A8RB 1WWHA 4USIA 4IR9A 2BJ3A 4UOCA 2W5VA 2C2KB 4G1QA 3ED4A 2HVEA 1M5SA 2U2FA 2RT3A 3GSDA 1PGZA 1SC3B 4KGVB 3SXLA 2UUBF 3BPSP 2M2BA 2CA9A 2P9EA 1KOOA 4CZCA 4B08A 4ZCMA 4OI2A 4Q0BB 4DSKA 2B6AB 3M2RB 1NKEA 2Z58B 3L09A 5KFYA 1VQ9S 2XZWA 3KWMA 3U02A 3OVSA 1HR0F 3QZ8A 2KL8A 2BQUA 3BQ0A 2QLBB 5MLCV 1HBOA 3SDEA 2HVDA 3JSMB 3Q23A 2IBOA 2HMIB 4HR2A 3M32B 2IA6A 2DIVA 4WK1A 2IRYA 4JB8B 4MKBA 3BJYA 3V4MA 3GV7B 2AGOA 1NK8A 1K0VA 1E3CP 1Q7LB 4MIBA 3ZC4A 1K1QA 3W9JA 1KOHA 1IN0A 1RB0A 2DK2A 3SEOA 3QZ7A 1AFJA 1AFIA 2JFDA 5E5NA 2RB7A 4B56A 4ES1A 4R8UB 4F4WA 2E7XA 1M5HA 3CE8A 4A47A 4NA1A 1TFYA 1RWWB 4DL2A 2HWHA 3NAHA 4TN0A 1JWWA 5INHA 1UEUA 1F3FA 1IJFB 2G0JA 1YLXA 2CRLA 3I32A 1UTAA 3I96A 4MK9A 2DT9A 3UO0A 4NLGA 3AHPA 4L72B 2BW7A 4ZJLA 3VAJA 4PQAA 3PO4A 3NMRA 2UVWA 4AYBD 3UR3C 6FDRA 3ILJA 4EBDA 4P73A 1KHWA 2MPUA 3CDBA 1GTEA 4IFYB 3UE2A 2F8HA 4CTAA 3RR8A 3DXSX 1UEKA 2B9EA 4AQYF 1NSPA 1XIQA 2GO9A 3MOZA 4OX6A 4CP5A 3CC7S 1DRZA 3M4XA 5K4PA 4OQJA 2VFTA 1GXTA 2B9YA 3I0SB 2OAUA 3BSAA 3OFEA 4M5NA 3M8PB 5IQQA 2Q6CA 4JI2J 1DFDA 2YWEA 3E2DA 1NLKL 1O6XA 1LXNA 2X1GA 3NKQA 3MPYA 1A7GE 1KONA 1SV5A 1T9YA 3L7OA 5KG7A 4QYZJ 2R7WA 1DTQA 3IBCB 5CCMA 1J5EF 1CC7A 2AP6A 4U7CA 3R5DA 3W61A 1FKPA 3OR1B 2ABYA 4NLDA 3ZTPA 4USJC 1TVRA 2B56A 3TJAA 2BA9A 1IQTA 2W2NP 4NZ0A 4JV0A 2KHCA 5HL7Q 1ZEBA 1VI7A 2IYIA 3QAUA 2DTJA 1VQOS 4HT5A 5L1LA 3CJQA 3W2WA 2OPRA 1RBLA 3TUPA 4HACA 1UWAA 3CC2S 4NLSA 3CMAS 3VR1A 2AMCB 4CO5A 1RU1A 5KFTA 3LUYA 5HQLA 2CYYA 4C8YA 4ZG9A 5SUHA 4U67Q 1FVSA 4NWBA 2VICA 5J1EB 5F9LA 2KZMA 2UUTA 4ED6A 2W4PA 4DX6A 4RO0A 2YPZA 4KSEB 2LECA 2HNDB 3B4DA 1UA1A 1JIHA 2MLZA 4CXKA 5K8NA 1FJGF 1WSVA 1IKXA 2GMJA 1TKXA 1FFSB 1WORA 3PYFA 1VK3A 4ANEA 5U47A 2XQCA 3H2VE 1CJTB 2MMYA 1RA6A 4HLBA 2LYVA 4HTIA 4C8KA 1A9NB 4I69A 3J7A1 2HQDA 2CIMA 3CO0P 1B64A 1B0PA 5K5MA 5A8WB 2F1FA 4UF4A 4GC6A 2DRBA 2VONA 5KOWA 2OGUA 3BR8A 1R6YA 1VISA 2YNFB 4JI5J 4NXNF 2ZKTA 4X64F 3QBCA 2Q79A 3MECB 4CYUB 1QVFR 4OJGA 1S1VB 2E5HA 5DDQC 1T11A 4HEA9 4CM0A 3L7PA 2RF2A 1FTRA 2HQIA 3DLKB 3N4WA 3PFEA 4MK8A 3OVBA 5HRTA 3OTBA 3OTCA 3SQOP 1Q5VA 5GMDA 3BS9A 2PSZA 3BKTA 1HPZA 2E1AA 4ID8A 3JSBA 4KFBA 4CO1A 4ZJQA 3MR5A 4F4KA 4LF9F 2KG0A 4NCBA 4C97A 2B6AA 4LBPA 5KFOA 3FMBA 1Z4UA 4DG1A 3DLEB 3PW0A 4ECUA 1FFWB 3HHKA 3I4HX 1S9FA 3KUGA 4PG4A 1A0OB 1SBRA 3HJFA 3NRBA 5J2MB 1RUSA 1GH8A 5A6PA 3MEEA 4XDDA 2FD2A 2FIUA 1IWAA 1RT4B 2DEIA 3O2IA 4LIWA 4ECTA 2FQQB 3T1HF 1NKBA 1YGYA 1KVKA 4BC9A 1SC6A 1TAQA 2WBMA 2NXJA 3C16B 3QIPB 3SMZA 4DPYA 3QJJA 3FQKA 1GXUA 3WX8A 2W5TA 2CPXA 2VASA 1VQSA 1NK9A 2HZAA 2ALYB 2FTRA 4C0OC 1TQLA 2AJ4A 2VG6B 2ZUAA 4HI2A 2KFNA 1K0TA 2KYZA 1P6TA 3D0HE 3G82B 3A3OB 3G6YA 2XI3A 3WDOA 1RGVA 1Y5NB 4F02A 1GFWB 5I3QA 1OWXA 3PKYA 4A46A 4WFNQ 3CPWR 4Q2MA 2GVDA 4QZVB 1T05A 4ZCIA 3H5UA 1H0HB 2IJRA 2VG5B 1CJKA 1RADB 2MLYA 5GMKa 1KC8T 2YQ0A 3BDHA 2OPPB 4P7TA 4ZPWR 5D0RA 4EI2A 3W8PA 3W5XA 2ZE2A 1UMJA 2FYXA 4LF8F 2F8EX 1EZZB 2C2EA 4DV7J 1N48A 1IBLF 3DHXA 3PJWA 2AEMA 2N3LA 2R8IA 4RX6A 4YR2A 2Z30B 4PXCA 3BSOA 2Z4PA 2HHQA 2RKIB 1NJYA 1FJEB 2MQ8A 5L0BA 1DAXA 1F5BA 5KFGA 3VHQA 2RDJA 2P5VA 3HKWA 4PG5A 1R8CA 4Q43A 1UFKA 4P9SA 4B17A 4DV1J 3E2EA 4B3OB 1E6VA 3A52A 2E7VA 2VIHA 3BGRB 4USKA 3TW0A 1AUSL 5HQMA 1X9WA 5C2CA 2R4FA 3BQ2A 2YX1A 4YR0A 3K2YA 3NBPA 2Y0BB 5KFVA 1IKWB 2RMLA 2FZGB 5T7LA 1UW4A 3UW1A 3J80Y 1FSUA 4BWMA 3DCAA 3F44A 4FKXA 2O67A 5J2NB 1FF2A 2R8KA 4ANCA 1TL7B 4IQMA 4DX7A 2HYIB 3Q8YA 4PUOB 1HWLA 4MYUA 1FNXH 4OL8A 4TLQA 1RKJA 1P1TA 5HVHA 3VAMA 4ELVA 3AJDA 2EEYA 4LJMA 4RW4A 1KHNA 2M70A 3D54A 5DJBA 4O3RA 2C2ZB 2HFUA 1VQKS 2L9NA 2BVZA 2ZM6F 2BM1A 2W5QA 3QSIA 3TI0A 3BYRA 3KJFB 3LW5C 2N7CA 4EZ9A 3SSSA 1U4BA 4PRFA 2J6UA 2BE2B 1S9EA 4NRUA 2HAIA 2KXFA 2V8DA 2E1MC 2ZBIA 2B7BB 4YEAA 2ASYA 2YBVA 2HQGA 3MR3A 4OX8A 3GIMA 1REVB 3IWXA 4WTOB 2ERRA 4A8FA 1O0PA 1W7WA 1R3NA 1Q16B 2OSQA 1FK9B 2YKNA 3HFVA 4UUWA 3R5JB 1WUUA 3M2UA 3NEKA 1QE1A 1HYSA 4K5SA 3CJKA 2X51A 3ITHB 3NS6A 4P2FA 3TX0A 5BYRA 4DUYF 3V6HA 2NLWA 1U1KA 1C4CA 4CH0S 3BN4A 3KXDA 2IYGA 2YNGB 1KTQA 1RU2A 2RF2B 2YWHA 5DRKA 1VBXA 4W98A 3MEGA 5G0RB 4DFKA 3I9V9 4ZA1A 2XSJB 3NNCA 4KFBB 1H2VZ 1XMOF 1TR0A 1RTIB 3D1HA 3FEZA 4X66J 3KLGA 1LK5A 3KK2B 3L3CA 4ECWA 5KT2A 2Z2ZA 2AEJA 3CVKA 2H4WB 2DGOA 2C2NA 1WEXA 1TV6B 4FNHA 3BN7A 1L3UA 1U8WA 1LQ9A 5GAGI 5J2MA 1GQEA 1DTTA 2X3GA 3P8BB 2Z56B 3QGHA 4FPRA 5CYQA 5T41A 5KFIA 4DL7A 1HNWJ 3Q24A 2ZJQQ 2HVIA 1YBUA 4YY3J 3MCSA 4LQYA 1ZM9A 3N01A 4MH8A 1IR2A 3CUNA 2EG1A 3TG0A 4ZCLA 2AZ1A 3OL8A 3HSGA 3C6TA 3FBBA 2DHSA 5C5JA 1VQMS 2ZFHA 1XK8A 1HNXF 2LMIA 3HHLD 4ED4A 4C8OA 1TL3A 2RRNA 4OJ1A 5H9FK 5K14A 1B4SA 5ETSA 3UFCX 5BJRA 2Z2MA 1TL1A 4L6V3 4WE1A 4NXMJ 1TKTB 2LU1A 2RUSA 4FF4A 5GOVA 5HVGA 4DSIA 3D6MB 3Q22A 1XR7A 3MMBB 4WFXA 2C3MA 1BXNA 2BJ9A 2RQ4A 3DKDA 3VALA 1FJ7A 2AWZA 1YVFA 1JXVA 4DV4F 4OYPA 1CJKB 4EMDA 3RAQA 2I9SA 4FKYA 1D0EA 2UU9J 1FXDA 3KG0A 4KRWA 2NREA 2IFYA 1BWEA 4CLFA 2WVDA 3KHRA 3L9ZA 5LRNA 1SQEA 3KNGA 3FSXA 4YHHJ 1S59A 4DR1F 4DR6F 2W8SA 2FZCB 2MXYA 5L9XA 4JI3F 2HKEA 4ZGAA 5L1IA 2MKYA 4L76A 1JKHA 4G65A 3J81U 3IWLA 2B4OA 3DNCA 4UPKA 3GONA 5D15A 5LT5A 4PQUB 5KG4A 3E01B 3HI9A 2GZOA 3EMTA 4XTTA 2W8LA 2NZ4A 4ER8A 3A13A 1VRUB 2N4DA 2MKKA 1KP6A 4OZJA 3EGNA 1RT1A 2DR6A 4F0KA 1GMWD 1PYTA 1RWKB 2YQ3A 3HDSA 5B0CA 5KFPA 3Q8QB 1UETA 3I5AA 4Y2CA 3V6DB 5IWAF 4C0HA 5CCLA 1XMOJ 2VQEF 2LA6A 1MW7A 4ZS6A 2GLQA 3SZZA 3M6WA 1IKVA 4YB5A 2K7JA 1LFPA 5DS7A 5DZ6A 4CWBA 3UPFA 3KJVA 1WD6A 1Z1ZA 1NK0A 4F3OA 2NYIA 4P74A 3MXHP 3OJUA 3VGTA 2MQNA 3MCMA 4MT1A 3TJ9A 2F7VA 3GQCA 3GCXP 3BREA 3TP2A 4ZK7M 1KKHA 3M9MB 4F36A 3HM9A 4P71A 3DMJB 2DJWA 3KG4A 2YNIA 5T14A 4RUCA 2VQEJ 1NPRA 2JFKA 2W1BA 2C3YA 3UWTA 1MMNA 4J37A 3MR2A 2IFXA 3KK1A 2QSFA 3M2RA 4OZ0A 3OHBA 1KQSR 4ETZA 4X62F 1U8SA 3LH2S 1TKDA 2RQKA 3GG0A 4ZG6A 2DY1A 3SCKE 1DARA 3SCLE 1URBA 2YKPA 4ZIVA 2LP4A 5H1SV 2V34A 3QT6A 4K4WA 1YHQS 1SKRA 1B8JA 4GTYA 1RT6B 1D1UA 1NBEB 3R6GB 2CNNB 4RLEA 3EZOA 3JB9k 4LRCA 2HURA 4URSA 4F7VA 1C0TB 2M5YA 4DLEA 2GJFA 1X9MA 1B3TA 4V19X 1S99A 2K06A 2QA1A 3C14A 2DGXA 1F1BB 1OS5A 2J76E 2HHHJ 2M9KA 3T02A 4LBHA 3R6LB 1RCOB 3QAEA 3T5JA 1NB2A 3K89A 4ED7A 3N6MA 2JZ5A 2HWIA 3D6TB 3DOKA 3OFHA 1PKUA 2WB4A 3GG1A 3V5RA 4ZP6A 4ZLPA 2FC9A 3L4BC 4LSZB 4JI1F 2O01C 2QFIA 3H8YA 3M2VB 4YDDB 4F2RA 2QA4S 2IUCB 1X8DA 3OFFA 3CCJS 2J7KA 4YY3F 1XMBA 2EFNA 4X4PA 4N76A 1URNA 4UZBA 2XZDB 3TVKA 4HT7A 2EWHA 2Y1RI 1ZBTA 2CPEA 4PPZA 3D0GE 4PYDA 1XR6A 2H3EB 3HSZA 3VAHA 1GAOA 3HT3A 3TQ1A 2JVRA 2QLFB 4KPYA 1LW0A 1OPIA 4ZVUB 4ZHRA 5KT7A 5T7LB 5AXMA 3SQGB 5A76A 3KHLA 3R7NB 2ROGA 2MDAA 2XHCA 4ZLNA 4KH1B 3C46A 1UVIA 4B9MA 2B0GA 3GTYX 3W3SA 4PWDA 4QR1A 2CJYB 1VK8A 4WFAQ 2HHSA 1PJ5A 3HSJA 2FLNA 2DRAA 1G4CA 1X4EA 2XCAA 2V4QA 1IBMF 3NGTA 4IO1A 3LAKA 1LW2A 1KTVA 1S1TA 2K3KA 5DLFA 4CYSA 4YUDA 4B3MJ 4PKDB 3WAWA 1SQGA 4WE1B 1TKTA 1EHWA 1PJ6A 1WC5A 1XERA 2AIRB 2HFOA 2KVIA 3RBXA 3SCIE 3WHIA 3WX4A 2FJAB 3CIZA 2VUGA 3CCMS 4DUYJ 3HCXA 4ZVHA 2VL1A 3TYTA 4RU9A 7AT1B 2CPHA 4QIFA 4CIOA 1P49A 3UI3A 3MM8A 2DHHA 4ZITA 2MSTA 4K50A 1C4AA 2FVRA 2RJZA 2W7OA 2V94A 4ERDA 2DCLA 2KT2A 1BQNA 4FXDA 2RDDA 4DV5J 1Q8LA 4JI6F 1DQ9A 3IG1A 2KVQE 4MIAA 1Z2LA 2IAJB 2QT7A
chains in the Genus database with same CATH topology
5L0EA 1SHNA 1KH9A 1KH7A 1Y7AA 1EW9A 2W8SA 1KHKA 5DLVA 4UPHA 4ZGAA 5DLTA 5K4PA 2RH6A 1AJAA 1ELYA 4KM4A 4UPKA 2QZUA 3MK1A 2W5WA 5INHA 3E2DA 3NKQA 3A52A 5LRMA 1N2LA 1ZEDA 3M8ZA 2XR9A 3MK2A 3NKMA 2D1GA 3IDDA 2XRGA 3M8WA 4MHXA 5GOVA 5LQQA 3DPCA 4GTZA 2GLQA 3SZZA 4LRAA 1ZEBA 1E2SP 5L0BA 1EW2A 3OT9A 1FSUA 5IJSA 2ANHA 3TWZA 4GTWA 5GRRA 3UNYA 3SZYA 3BDGB 3DYCA 1KHJA 3Q3QA 4KJDA 1K7HA 4UPLA 1ELZA 4LR9A 5L0KA 1KHNA 4ZG9A 1EQJA 5LIAA 1E33P 2W5XA 3B5QA 3WAVA 2W5QA 5AJ9A 1ALHA 4FDIA 4ZG6A 2GA3A 4CXKA 4GTXA 1URAA 1URBA 3IGZB 3M8YA 3MK0A 4GTYA 1B8JA 4NWXA 4LRCA 4CXSA 4MIVA 1AUKA 1AJCA 1KH4A 4LRFA 2W8DA 1ANIA 4UORA 4FDJA 4LR8A 3T02A 1AJBA 3TX0A 1ZEFA 1ALKA 3WAXA 1N2KA 2GSNA 2ZKTA 3UN2A 3NKNA 5EGEA 4LRBA 1ED9A 4QAXA 4UOPA 3NKPA 2IUCB 3BDFA 2W5VA 5HRTA 4LRDA 4UOOA 1EJJA 4KAVA 3M7VA 3WBHA 3NKRA 4MY4A 3UN5A 2G9YA 3KD8A 3T00A 2W5SA 1ELXA 5TJ3A 1ED8A 4LR7A 2GSUA 5KXAA 3IGYB 2X98A 1HQAA 4LQYA 5IJQA 3WAYA 1EW8A 4CXUA 3CMRA 3TG0A 4KJGA 3T01A 1ALIA 4N7TA 4LR2A 4CYSA 4NWJA 1E3CP 3LXQA 3WAWA 2W5TA 3ED4A 4UPIA 3NVLA 5C66A 1O98A 4B56A 1SHQA 2VQRA 1AJDA 4KAYA 4CYRA 1EI6A 2W5RA 1P49A 1O99A 2IUCA 1KH5A 1KHLA 1HJKA 1ANJA 3BDGA 4TN0A 2GSOA 3NKOA 5EGHA 4LREA 4ZG7A 1E1ZP 3UO0A 1Y6VA 2IFYA 1HDHA 3BDHA 4YR1A 5LRNA 1ALJA 5DLWA 3UN3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L0E A;  1SHN A;  1KH9 A;  1KH7 A;  1Y7A A;  1EW9 A;  2W8S A;  1KHK A;  5DLV A;  4UPH A;  4ZGA A;  5DLT A;  5K4P A;  2RH6 A;  1AJA A;  1ELY A;  4KM4 A;  4UPK A;  2QZU A;  3MK1 A;  2W5W A;  5INH A;  3E2D A;  3NKQ A;  3A52 A;  5LRM A;  1N2L A;  1ZED A;  3M8Z A;  2XR9 A;  3MK2 A;  3NKM A;  2D1G A;  3IDD A;  2XRG A;  3M8W A;  4MHX A;  5GOV A;  5LQQ A;  3DPC A;  4GTZ A;  2GLQ A;  3SZZ A;  4LRA A;  1ZEB A;  1E2S P;  5L0B A;  1EW2 A;  3OT9 A;  1FSU A;  5IJS A;  2ANH A;  3TWZ A;  4GTW A;  5GRR A;  3UNY A;  3SZY A;  3BDG B;  3DYC A;  1KHJ A;  3Q3Q A;  4KJD A;  1K7H A;  4UPL A;  1ELZ A;  4LR9 A;  5L0K A;  1KHN A;  4ZG9 A;  1EQJ A;  5LIA A;  1E33 P;  2W5X A;  3B5Q A;  3WAV A;  2W5Q A;  5AJ9 A;  1ALH A;  4FDI A;  4ZG6 A;  2GA3 A;  4CXK A;  4GTX A;  1URA A;  1URB A;  3IGZ B;  3M8Y A;  3MK0 A;  4GTY A;  1B8J A;  4NWX A;  4LRC A;  4CXS A;  4MIV A;  1AUK A;  1AJC A;  1KH4 A;  4LRF A;  2W8D A;  1ANI A;  4UOR A;  4FDJ A;  4LR8 A;  3T02 A;  1AJB A;  3TX0 A;  1ZEF A;  1ALK A;  3WAX A;  1N2K A;  2GSN A;  2ZKT A;  3UN2 A;  3NKN A;  5EGE A;  4LRB A;  1ED9 A;  4QAX A;  4UOP A;  3NKP A;  2IUC B;  3BDF A;  2W5V A;  5HRT A;  4LRD A;  4UOO A;  1EJJ A;  4KAV A;  3M7V A;  3WBH A;  3NKR A;  4MY4 A;  3UN5 A;  2G9Y A;  3KD8 A;  3T00 A;  2W5S A;  1ELX A;  5TJ3 A;  1ED8 A;  4LR7 A;  2GSU A;  5KXA A;  3IGY B;  2X98 A;  1HQA A;  4LQY A;  5IJQ A;  3WAY A;  1EW8 A;  4CXU A;  3CMR A;  3TG0 A;  4KJG A;  3T01 A;  1ALI A;  4N7T A;  4LR2 A;  4CYS A;  4NWJ A;  1E3C P;  3LXQ A;  3WAW A;  2W5T A;  3ED4 A;  4UPI A;  3NVL A;  5C66 A;  1O98 A;  4B56 A;  1SHQ A;  2VQR A;  1AJD A;  4KAY A;  4CYR A;  1EI6 A;  2W5R A;  1P49 A;  1O99 A;  2IUC A;  1KH5 A;  1KHL A;  1HJK A;  1ANJ A;  3BDG A;  4TN0 A;  2GSO A;  3NKO A;  5EGH A;  4LRE A;  4ZG7 A;  1E1Z P;  3UO0 A;  1Y6V A;  2IFY A;  1HDH A;  3BDH A;  4YR1 A;  5LRN A;  1ALJ A;  5DLW A;  3UN3 A; 
#chains in the Genus database with same CATH topology
 4E8U A;  2ZM6 J;  2WK4 A;  4RNM A;  5DG7 A;  4RNF A;  4YB6 A;  2SXL A;  3IAS 9;  3VVU A;  2LEB A;  1WEY A;  4ETX A;  3TX8 A;  2IRX A;  3T6B A;  3E01 A;  5G0R A;  3M9N B;  2M88 A;  2XC9 A;  2R7X A;  1HW9 A;  3M8Q A;  4C98 A;  4XAK A;  4IRC A;  1HBU A;  3NWG A;  4OYW A;  5LMU F;  4X4R A;  2LDY A;  3MD1 A;  5KFE A;  2NUH A;  2P6T A;  4C11 B;  3R97 A;  4IOB A;  5LSR A;  2DNM A;  3TAM B;  1EQ0 A;  1C1C B;  3MPU B;  3LTO A;  1VBK A;  3B8H A;  3FSY A;  2R8H A;  3O1L A;  3T1Y J;  3QJP A;  2CZ4 A;  4DCO B;  1YK9 A;  2H4Y B;  4YOE A;  3NGU A;  4P10 A;  2RUG A;  3KOA A;  3H59 A;  2QL9 B;  3PNI A;  3DLK A;  3DGV A;  2FJB B;  1OY6 A;  3PJX A;  4NPO A;  3FJ2 A;  3K5N A;  1RHM B;  1WHW A;  2W9A A;  3DU6 A;  2MKS A;  3VAG A;  3IM9 A;  1X4F A;  3VAI A;  4U96 A;  1RAB B;  4C3K A;  4U8Y A;  2OEK A;  1M1H A;  3H42 A;  1HIY A;  4DL0 C;  1S76 D;  4EO8 A;  2VA2 A;  4WU3 A;  2OMO A;  2Z57 B;  3BM7 A;  2EBG A;  3CCS S;  2J9D E;  2JL9 A;  2ZWO A;  2NCK L;  4GKK J;  3B5Q A;  1RCX B;  1RTH B;  1S1W B;  2GA7 A;  1RT5 A;  1VC6 A;  1MWZ A;  1HBO B;  3MUV P;  3ENW A;  2YNH A;  4M94 A;  3MK0 A;  2BW2 A;  2EK1 A;  4EYI B;  3DLG A;  3CCE S;  3SZ2 A;  2KYX A;  5D4N A;  2QEX S;  3BGL A;  4NWX A;  3F0N A;  2HSE B;  1JLA B;  2A10 A;  3GJQ B;  4WTY A;  3LGH A;  5KFB A;  2E9R X;  5KT6 A;  1F5A A;  4ZN1 A;  1F9E B;  1W25 A;  2HLT A;  1HI0 P;  1G2E A;  4ES2 A;  4J9M A;  2CQD A;  4UQG A;  4Z37 A;  2CQ3 A;  3WAX A;  1FTC A;  3J7Y U;  2WHO A;  5SZT A;  4B02 A;  1P27 B;  3BEG B;  4OHY A;  4DFJ A;  4QIG A;  2UXB F;  2BDP A;  4ILR A;  2UVR A;  4OV6 A;  2O3D A;  3LP0 A;  2V8P A;  4NYP A;  5E3C A;  4D3H A;  5GAD I;  1PCA A;  3LP2 A;  1ZM2 A;  2FPH X;  3R5G A;  4PYA A;  3QSY B;  1RWU A;  2OLW A;  4CT9 A;  3NGK A;  4DDF A;  1JXE A;  3PW5 A;  2C2R A;  4I7F A;  1L5U A;  1NCL A;  1I1G A;  2HBZ B;  1KS2 A;  1YKW A;  2ZE2 B;  2AKW B;  5CYJ A;  2VZ9 A;  2BJ1 A;  2ZNY A;  2CPI A;  2KTQ A;  4DQQ A;  1JLQ A;  1P1L A;  3IAM 9;  1I5O B;  2GMH A;  1CC8 A;  2W9C A;  2W5S A;  1NAQ A;  4FYY B;  4DN9 A;  3M6X A;  2PEB A;  4F67 A;  2Y8W A;  2KU7 A;  1QLN A;  1T9X A;  3MI7 X;  3IR5 B;  3PW7 A;  4DV6 F;  3CCV S;  4GRS A;  2WTF A;  1EW8 A;  2E1C A;  1DTQ B;  3ZZT A;  1HI8 A;  3MWB A;  4HHJ A;  5B0E A;  4JI5 F;  1S6Q A;  2ZD1 B;  1HD1 A;  5AXK A;  3PW2 A;  3VZH A;  5D3G B;  4R0E A;  4NL5 A;  1XR5 A;  3MFI A;  4LF9 J;  4CYR A;  2WBR A;  4HTJ A;  1UVM A;  3IS9 B;  1FEH A;  1OMS A;  2B5J A;  2EFG A;  2VPY B;  1U2C A;  4PPD A;  4UUX A;  5KAK A;  2OFG X;  4Z7C A;  1KHL A;  1ACM B;  2FJE B;  3NKO A;  1JJ4 A;  3G86 A;  2BOA A;  2KXN B;  1RQ0 A;  1Y9O A;  2D3Z A;  3BV8 A;  1VIX A;  4K7Q A;  5D78 A;  4DX5 A;  1W2B R;  3GLJ A;  3TZY A;  4DUT A;  2DNY A;  1SJQ A;  4YR1 A;  3MPD A;  2DNZ A;  4I2P A;  3R2C J;  3IO1 A;  3IMQ J;  3UN3 A;  1VRT A;  5J1E A;  5IS2 A;  1JLE A;  2JOQ A;  3MAA A;  3J7Z T;  1UVK A;  3FKB A;  2NXN A;  2DIU A;  2DD8 S;  4DV2 J;  1JNZ B;  1SB6 A;  1SC4 B;  3JS9 A;  5DQG A;  2CZ9 A;  5KG5 A;  3ZZR A;  1IKX B;  2BQ3 A;  1HBU B;  1VQ7 S;  3SI8 A;  1VLO A;  3I87 A;  1U45 A;  3GII A;  2HNY B;  3GJS B;  3RGI A;  3GE9 A;  4RWW A;  4MFB B;  2R42 A;  1KQK A;  1RAA B;  2Y1L B;  3OSP A;  4B9N A;  2G13 A;  5BYQ A;  4ILM A;  4H4O A;  2M4M A;  4FYX B;  2YX4 A;  1C0U A;  1KBR A;  2AYM A;  2NSB A;  3FMW A;  3JQJ A;  3SIP B;  4W92 B;  2NPI A;  3CJK B;  1HYS B;  3KHG A;  3N5B A;  2BRK A;  3DRR B;  1LOU A;  4UOH A;  3CO9 A;  2D3O 1;  2DNG A;  5A0Y B;  4L3K A;  3HZE A;  5K9F A;  3UCG A;  5GRR A;  4K2X A;  5DM6 Q;  2RAQ A;  3AT1 B;  4PG6 A;  1NDP A;  4U7U D;  1SC1 B;  4RWX A;  3BDG B;  2HBQ B;  1V5I B;  1KHJ A;  2YH0 A;  3KMQ A;  2W2M P;  1KWM A;  3W1Y C;  3IGV A;  3CED A;  1LEO A;  2AJF E;  4NI2 B;  2KJV A;  5J1P A;  5L38 A;  5F8M A;  4NLY A;  5CQG A;  4MTP A;  3MUT P;  4X4S A;  3PEJ A;  3D5M A;  1ZTT A;  2HNZ A;  5FLX U;  1RT4 A;  3OVA A;  2FHM A;  5KG3 A;  2XGQ A;  3EVW A;  1OYE A;  2JLF A;  4CLZ A;  1OIA A;  3FK4 A;  3SSR A;  2Y1J A;  3CJ3 A;  3IRW P;  5ITH A;  3CD6 S;  2XMV A;  3FCW A;  1B7Y B;  3QT7 A;  1YJT A;  1ROF A;  5L1K A;  5BYS A;  2AD9 A;  5DGA A;  1M5P C;  2ASL A;  5KFS A;  4TY8 B;  5F8H A;  2BR0 A;  1UAW A;  3KDN A;  3O5T B;  4DR7 F;  2FHO B;  4WXW A;  2RU9 A;  2J6T A;  5HBM B;  1N56 A;  3GZ7 A;  1ZEF A;  2FLO A;  2M7S A;  4QPT A;  4Y2K A;  2NPF A;  3ISN D;  1Q81 T;  1KR4 A;  2COL A;  3D3C J;  1M5O C;  5EGE A;  1ULR A;  4QR2 A;  3LP2 B;  3VTI A;  1ED9 A;  2UXB J;  5IXU A;  4QAX A;  3POT B;  1PBU A;  4JYA J;  2J8A A;  1SL2 A;  3OPK A;  4X65 F;  3QGG A;  2FHK A;  3DN9 A;  4LVN P;  2EI5 A;  4C11 A;  3OLA A;  3QFH A;  4OYX A;  1T94 A;  4LF4 F;  2CQ0 A;  2HVZ A;  2XNQ A;  2NSC A;  3CDW A;  3M7V A;  2JWN A;  4IUF A;  1K47 A;  3IR6 B;  4I4B A;  2DGS A;  1ZAV A;  2DGW A;  2G9O A;  2WVE A;  1N33 J;  2F8M A;  3DOL A;  2BYC A;  3DU5 A;  1RTJ B;  2DO4 A;  4KBI A;  4DL4 A;  3A8I A;  1F2G A;  4B3R F;  1S72 S;  4XDC A;  3KHH A;  4P6Q A;  1QY7 A;  2PMW A;  2QA4 G;  1TK8 A;  1RT2 A;  2WSF C;  1QSL A;  2U1A A;  4MKY A;  3EGZ A;  1RJJ A;  2JLG A;  2B3T B;  2IM3 A;  2MZS A;  3D28 A;  1H7W A;  3CD0 A;  3P5T L;  4DV3 F;  4C3M A;  3Q8S B;  1K8A T;  2YH1 A;  4DR3 F;  4KAI A;  4FDF A;  3RAM A;  1FE4 A;  3S8S A;  4G6V B;  3TAQ A;  2APO A;  4I0W A;  2HIY A;  1EB0 A;  4W90 B;  1O98 A;  1VOM A;  1LWX A;  2DYA A;  3P49 B;  5AJ3 J;  2A2C A;  3W60 A;  1S1W A;  4KH0 B;  1EI6 A;  1YG0 A;  2GIR A;  2ZBP A;  3ZO7 A;  3M32 A;  4KO0 B;  1ZAW A;  3AD7 C;  1MLA A;  3I5C A;  4G3I A;  4MKA A;  3THP A;  2LVW A;  4K5R A;  2CJB A;  4ZP7 A;  1IKY A;  2GSO A;  5EGH A;  3ZZU A;  2MB0 B;  5C7P A;  2MGZ B;  4JI1 J;  2JH3 A;  4IYQ A;  2EFV A;  4JYA F;  2VDI A;  3OD2 A;  1JLE B;  2HEK A;  4LBI A;  4WII A;  4DR5 F;  3HK2 A;  2PDA A;  4I2Q A;  4M5K A;  4ED3 A;  1U1O A;  2VBW A;  3QRP A;  2VFR A;  2JVO A;  3ELH A;  3M05 A;  2AEF A;  3DGP B;  2QC3 A;  3OTO F;  1NJX A;  2HGL A;  2MHN A;  3KYL A;  3RW6 A;  3BKU A;  5LMU J;  4K0K J;  1JLF A;  3FSI A;  2DGV A;  5E0O A;  2IC3 A;  3MTK A;  2M3D A;  1YX2 A;  2N7Y A;  4MIW A;  2GNK A;  4DV4 J;  2FLL A;  1OSC A;  5LIA A;  3NCQ A;  1NK4 A;  1FHT A;  2ZJP Q;  5IM0 B;  1X0P A;  4FYD A;  3D0I E;  2MLX A;  5GAE U;  1N5S A;  3FBE A;  1U0H A;  2QX0 A;  3R5B A;  4CH7 A;  5KG2 A;  1PC4 A;  4U7U K;  5I4M A;  5EWE A;  1OJ4 A;  1IBK F;  1XWL A;  1WNE A;  1HLW A;  3NOG A;  4CTA B;  4P2X A;  1TK5 A;  5DDP C;  3DDI A;  3FFI B;  1JNR B;  3ITH A;  4A8S A;  4O4G B;  3PHE A;  1RI7 A;  3VQS A;  1VS3 A;  1LWC B;  5AXL A;  5KOX A;  3V4I A;  3RBD A;  4DV5 F;  4DLG A;  1T03 B;  1J5O A;  2RNE A;  2RSQ A;  3G8S A;  4QR0 A;  1NH7 A;  2F3J A;  3RB3 A;  3DPC A;  3GFX A;  5C2G A;  1Y5I B;  4QU7 A;  2MYF A;  1R8B A;  5EN1 A;  2IHR 1;  5GVQ A;  4DL6 A;  1NJZ A;  3FQL A;  2XSJ A;  2DR5 A;  4WF9 Q;  3M2V A;  1RK8 A;  4AL5 A;  2VFU A;  3ILI A;  1NDK A;  3ETO A;  3BO3 A;  2H48 B;  3FCH A;  4IRD A;  1VQY A;  4FVC A;  1S77 D;  2VOD A;  4OYM A;  3KLF B;  2CQB A;  1HMV B;  5D0E A;  4JI3 J;  2PC6 A;  4DEZ A;  4LF4 J;  5L0K A;  2AZ3 A;  1EQJ A;  3ZTS A;  4A8M P;  2XMJ A;  2J7U A;  2AYE A;  3BBC A;  4GVB A;  1YJ7 A;  2W25 A;  2HG4 A;  3GFH A;  5FLX Y;  2OPR B;  1GK8 A;  1QAY A;  2CQH A;  5BXI A;  1FWK A;  2QJ3 A;  4Y2I A;  5LMN F;  4OV1 A;  2JEJ A;  3U7J A;  4QYR A;  2FVC A;  3L95 X;  1KNZ A;  1GXL A;  1RSC A;  4OJH A;  1EX8 A;  3C19 A;  1Q1K A;  3QWP A;  3DLJ A;  4KV8 B;  1CQN A;  3TVZ A;  1S6O A;  5C25 B;  3A4T A;  1XN9 A;  3K7R A;  1VRT B;  4LRF A;  4OJ3 A;  4RW8 A;  5IT0 A;  3PIO Q;  1HNZ F;  4CCH A;  4M1K A;  1WC6 A;  4X4O A;  4DSJ A;  2XG8 A;  4FDJ A;  2ILZ A;  1S79 A;  4DZD A;  3D1Q A;  4AE5 A;  1IM4 A;  4FYV B;  4ZLL A;  2VU5 A;  3V2U C;  1GTH A;  2OFH X;  3CF5 Q;  1JMT A;  1CVJ A;  5IT9 U;  3CJ2 A;  1Q82 T;  3HKZ D;  4A8W A;  3A8K A;  3X1L B;  2RU3 A;  2CJQ A;  4DV3 J;  4G1I A;  3OTO J;  5JVG Q;  1HQU A;  2ZBQ A;  3MUM P;  1E33 P;  3BGU A;  5CXT A;  1NM2 A;  3R9L A;  2P9G A;  4NLT A;  5EX3 A;  2HHP A;  1QSS A;  3THT A;  2F9D A;  2DXD A;  4OHX A;  3BDE A;  5H9F J;  2PA3 A;  3DRP A;  3BGF A;  1CJV B;  4CI0 B;  1EJ7 L;  5HMX A;  1XNR J;  5IT9 Y;  4H4K C;  3PYG A;  1YI2 S;  4X2B A;  3CJ5 A;  3KUH A;  3NKR A;  2Q6B A;  2R7Q A;  4FXV A;  3ZNJ 1;  4KGM A;  3UDV A;  5HN0 A;  4OZL A;  4NXM F;  1S1V A;  2B9X A;  3EPG A;  1RP5 A;  1ZM4 A;  1GX6 A;  3AY0 A;  1FKO B;  2I5J B;  4IFV A;  2DVI A;  1ED8 A;  1RT2 B;  1S97 A;  4NLW A;  4OYZ A;  5TJ3 A;  3ET6 B;  4M5D B;  4X66 F;  1U48 A;  3GP9 A;  1U6B A;  3G96 A;  4LSL A;  3W2V B;  2BAN A;  4O3S A;  3M8R A;  1YJV A;  4WZQ A;  1JLC B;  3CJR A;  2CPD A;  4DG1 B;  4Q44 A;  1WKK A;  4WFZ A;  5EHH A;  5EWG A;  2XHW A;  3TR5 A;  2OHD A;  3OLB A;  2PEH A;  1YJ9 S;  1SHQ A;  4BDP A;  1SXL A;  4DJB A;  4Q5V A;  1Q0N A;  3Q86 A;  1AJD A;  4RBU A;  2FJX A;  3K8W A;  1S12 A;  1T7P A;  1MML A;  4J90 A;  2MGZ A;  1FDD A;  2VFV A;  2XSF A;  1C1B A;  4U8V A;  1H2T Z;  5HAO A;  3NAI A;  2HHX A;  2KT3 A;  1EP4 B;  2GW8 A;  5HJX A;  3ULH A;  2N4C A;  1ALJ A;  2EFQ A;  3NY0 A;  2WSE C;  4ZPD A;  1FXR A;  1CUL B;  2NZC A;  3KJN B;  3PRB A;  2UV8 A;  3OL7 A;  2ACM A;  1Y7A A;  1I6J A;  4LQ3 A;  2PT0 A;  4ZIW A;  1YBA A;  2VD3 A;  2GVD B;  1U6F A;  1RT5 B;  1EIY B;  4FF3 A;  2GC8 A;  2G9Y A;  3TQE A;  4ZMM A;  3POT A;  6FD1 A;  4MMO A;  1WKJ A;  2HWT A;  1KFS A;  2RH6 A;  2VKR A;  2B9W A;  1SL0 A;  2FC8 A;  3PX0 A;  1FRH A;  1C2P A;  3M1V B;  3US5 A;  3ZXW A;  4KGK A;  1FD2 A;  4KKO A;  5FD1 A;  2X1B A;  1MU2 B;  2DR8 A;  3AXM A;  2POK A;  3EM1 A;  3EUN A;  3F73 A;  4JI7 F;  2NS1 B;  2NXE A;  1UJ5 A;  1T8E A;  2I8E A;  2FLP A;  5F0U A;  1HNI B;  1RAC B;  2W2O P;  3DFE A;  4OIX A;  2DHA A;  4RL1 A;  3UD3 P;  4X64 J;  3ILL A;  1R0A B;  1PYO B;  3JTP A;  2J0S D;  3T1H J;  3PRV A;  5D8H B;  4ICL A;  2FY8 A;  2AW0 A;  3K5P A;  2VG7 A;  4RJV A;  5L9N A;  3KLH B;  2ZHA A;  2CFX A;  3IBF B;  3UNY A;  1VRQ C;  4UZC A;  1T9U A;  4LFB F;  1G7C B;  4DMZ A;  3RZA A;  1VBZ A;  2Z2L A;  3H4D A;  4WKR A;  2ZIT A;  3AOD A;  1L3T A;  2IIH A;  1FA0 A;  1FWP A;  3DOM A;  3RYL A;  3SQG A;  2X7I A;  3HP6 A;  2W9C B;  3JSY A;  3VAK A;  1N8R T;  2XLK A;  2VC0 A;  3D67 A;  3M8P A;  3NGR A;  1H72 C;  2EG2 A;  4CRJ A;  5I42 B;  3RU0 A;  2BMB A;  3KLE B;  3MMC B;  1WEL A;  2RS2 A;  2AYB A;  4PUO A;  1URA A;  2IJF A;  4IRK A;  1VDH A;  4OI6 A;  1X4B A;  5L8R C;  2JLE A;  3ZFV A;  3QLH B;  2HRU A;  4OYB A;  1NK7 A;  3GJT B;  1GMV A;  2DCU B;  4WFY A;  4C9D A;  4F4Y A;  2YTC A;  1ANI A;  4DV7 F;  2HND A;  2L9W A;  5HSP A;  1TP7 A;  1CQM A;  3PAC A;  4NOH A;  1M1G A;  3BGO P;  3LAL A;  2IC3 B;  4X65 J;  4QWA A;  1RWV B;  4USU A;  5AE2 A;  2FB0 A;  1RT3 A;  4F26 A;  5KFD A;  2FJD B;  2L9D A;  3LAN A;  3SYZ A;  2BJ7 A;  4K4S A;  1LXJ A;  1DLO B;  3OQ2 A;  1V6H A;  3IG1 B;  4LFC F;  2KM8 C;  2DXF A;  4UST A;  2HFV A;  2YNF A;  2DKO B;  5IQ6 A;  2LXI A;  4TKT A;  7FDR A;  1FER A;  4Z2X A;  1R8P A;  4IG0 B;  4DR4 J;  3ISN C;  3K5M A;  4JI7 J;  2QMW A;  4KR0 B;  3ET6 A;  2KXH A;  4KHP J;  4NEZ A;  2Z8Q A;  4LSL B;  4PWU A;  3VQT A;  3W2V A;  4UW2 A;  1HPZ B;  1HQA A;  2XS2 A;  1RLC L;  3AQO A;  4WPA A;  5LRM A;  4OHW A;  3BPD A;  3TVY A;  2HVH A;  5MAO A;  3DLE A;  4LR2 A;  4DSF A;  1TV6 A;  3C6U A;  1C0U B;  4LF6 J;  4A4J A;  2PA8 D;  5H9E K;  2JEF A;  1EKS A;  5E2Q A;  2IRU A;  4LFA J;  3UR0 A;  1KRP A;  3GYX B;  2W4D A;  2HRT A;  3OR2 A;  3P96 A;  4HI1 A;  4KAY A;  2CPF A;  3W65 A;  5IT4 A;  4ZP9 A;  1S7H A;  2LLZ A;  5A8R A;  1IR0 A;  2WVF A;  4ILL A;  1YJR A;  2HK3 A;  1HJK A;  1Q79 A;  3VVT A;  1DQ8 A;  2PI5 A;  4MJK A;  1MG7 A;  1ZAX A;  1KEK A;  4A8K A;  1UW9 A;  2YY3 A;  1FD8 A;  3S7R A;  4XIU A;  1CUL A;  1JJH A;  1V5V A;  1OY8 A;  5K8P A;  3TAP A;  2ALZ A;  2MQQ A;  4Q0B A;  5ETO A;  3UCU P;  5HQ8 A;  3KKF A;  2JNJ A;  1SH0 A;  4ES3 A;  3K57 A;  1S57 A;  4TYB A;  4JI6 J;  3HF5 A;  2G2Z A;  2KRB A;  2LA4 A;  2RRA A;  1KVJ A;  2FGC A;  4H4M A;  2EFO A;  4OX9 F;  3RBE A;  2J7W A;  1RAH B;  2D41 A;  2DHX A;  4PAA A;  1U1P A;  3MZI A;  1JX4 A;  2QZU A;  5F8I A;  3MM9 A;  4K4U A;  3DI6 A;  3GV8 B;  1WI8 A;  4UQT A;  2Z2Y B;  3RW7 A;  1HNV A;  2KB2 A;  2VG6 A;  4I67 A;  5C42 A;  1R43 A;  3H4B A;  1X0F A;  1N2L A;  3M8Z A;  2AJQ A;  2XR9 A;  1SH2 A;  2DIT A;  2OEM A;  4C8M A;  1KSP A;  1M5K C;  4K4Z A;  3CIM A;  3W64 A;  4QOT A;  1Y7P A;  1SKS A;  1Q86 T;  4TNO A;  1JLG B;  4OYO A;  2XZT B;  2G2Y A;  1VQL S;  1NZ8 A;  4N8N A;  4QW8 A;  2FVQ A;  4ZP8 A;  3OT9 A;  3MMA B;  3HVT B;  3WBZ A;  4ALZ A;  4A48 A;  2B8Q A;  4AT1 B;  1Q8I A;  4UOG A;  4M63 A;  2RHQ B;  3G71 S;  2OPP A;  2ASD A;  3G9C A;  3TJ8 A;  1HQE A;  3JTN A;  1B70 B;  1BQX A;  3FC9 A;  1RTZ A;  3GR1 A;  3IC1 A;  4AQY J;  2UXC F;  2MY8 A;  2ZUG A;  2QSW A;  3QQC D;  2GX8 A;  3I0S A;  1TL5 A;  2CPY A;  3PJ9 A;  5GME A;  5K8M A;  1TAU A;  4HH0 A;  5J2P A;  2UVV A;  3TUZ C;  1HBN B;  2GA3 A;  4GKJ J;  5E41 A;  4RNO A;  3CWJ A;  5ETT A;  1LV5 A;  1VCT A;  5D6G A;  5JXS A;  2A3J A;  4QW9 A;  3BGR A;  3WC0 A;  3R1H A;  3HHD A;  1S0O A;  3OXF A;  3G6X A;  1PSD A;  1X5T A;  2PMH A;  5HK4 A;  2ADB A;  3HHL B;  3I31 A;  4MIV A;  4AXI A;  3DHW C;  4F50 A;  1S10 A;  2X1A A;  1APS A;  4UOR A;  2D3U A;  1NXI A;  4DF8 A;  4B9T A;  5KFZ A;  3KJQ B;  4AD6 A;  1FXL A;  3QAT A;  5ETM A;  4YME A;  1CLF A;  1N2K A;  2C3U A;  3K58 A;  4HAC B;  2GHV C;  1D9F A;  3F56 A;  3NP5 A;  2O5D A;  4LRB A;  1ZM3 A;  3H40 A;  2ZH5 A;  2F9J A;  3S01 A;  2HHV A;  5GAH I;  2RVJ A;  1N32 F;  1VQP S;  1FES A;  3HVW A;  1CSJ A;  4CNZ A;  4FZV A;  2GO8 A;  3H2L A;  4LRD A;  4M5J A;  4P2S A;  4WFB Q;  4DS4 A;  1Y11 A;  2CNL B;  2VBZ A;  2XLJ A;  4KJI A;  1AW0 A;  4KAV A;  4UTG A;  3MAA B;  3PM9 A;  2C2M B;  1HNI A;  3M8S A;  4MY4 A;  1DHM A;  1H3D A;  3A8J A;  5CHC B;  4N56 A;  4DS5 A;  1R0A A;  4OMF G;  2B7C B;  4USV A;  4DV1 F;  2VOO A;  1HD0 A;  2HZV A;  2CQ4 A;  1WJ9 A;  5F8N A;  1QJH A;  1V3Z A;  4NA2 A;  1RTI A;  3CGI A;  3KK2 A;  1F0X A;  4F4A A;  3KLH A;  5CZV A;  2KJW A;  1YSJ A;  3DXB A;  2P2C B;  3I6P A;  6AT1 B;  1HR0 J;  3BO4 A;  5ETR A;  3VCD A;  2IM1 A;  3PW4 A;  3CUL A;  5IC4 B;  4YS2 A;  2F4F A;  1LWF A;  1WHV A;  2FGO A;  3CSK A;  1ALI A;  3I82 A;  3ZTO A;  2R8J A;  1TL4 A;  3G4S S;  4O4G A;  5JMN A;  2PI4 A;  3OUY B;  4CLS A;  2VV5 A;  4DX8 H;  2DIS A;  4O44 B;  2GVZ B;  3N28 A;  1IQZ A;  1Q5Y A;  4Y34 A;  5GAD U;  4DF4 A;  5I42 A;  5JVH Q;  3AD8 C;  3C6T B;  2AU0 A;  4PXE A;  1EET A;  3AB4 B;  3H90 A;  2YWK A;  5KFU A;  1Y3J A;  5HMW A;  4X4U A;  4ZVQ B;  3BDG A;  2LU2 A;  1RWP B;  1DUR A;  1K9M T;  3HHL C;  3H5X A;  1HI1 A;  2AV5 A;  2QL7 B;  2XMW A;  1VQ6 S;  1NK5 A;  4QYZ K;  4ECS A;  1D3W A;  3T5K A;  1J5E J;  1OQ3 A;  2P8I A;  3AOB A;  5LXR A;  4X62 J;  4WK3 A;  2DB1 A;  1FDN A;  3KLI B;  4MAK A;  4QWC A;  4IH5 A;  3Q8R B;  1KH9 A;  1KHK A;  2XMM A;  5AT1 B;  5HJY A;  1HNZ J;  3U1L A;  2OML A;  3C16 A;  3C15 B;  3QIP A;  4L3N A;  4IH6 A;  1L3V A;  2KT5 A;  3AOC A;  2BE7 D;  3RRH A;  1B99 A;  2OPS B;  2K3I A;  4JBC A;  3W63 A;  2V4J B;  3A1Y G;  1MWQ A;  2YWG A;  2XGP A;  4BBY A;  1WOO A;  2NXC A;  3HFZ B;  1VQ4 S;  2V68 A;  1SKU B;  1IBL J;  2E9Z A;  2MJN A;  4LT6 A;  4L74 A;  3I4P A;  1FX4 A;  3DM2 B;  4JP8 A;  4C8N A;  4RZR A;  2ZZN A;  4MHX A;  2BKP A;  1B7F A;  3HVT A;  2BZ2 A;  3MD3 A;  2RRB A;  2IM0 A;  3NXZ A;  5M2R A;  2A2D A;  4DU7 A;  1YQH A;  2B4P A;  5I3P A;  4ECY A;  2ANH A;  4PWW A;  4OYI A;  3PR4 A;  2MSS A;  3LP1 A;  5BR8 F;  5LOQ A;  3N6N A;  3TAM A;  3C6U B;  4DUZ J;  4I1T A;  3TA2 A;  2UUC J;  4O23 A;  4RPF A;  4F0M A;  3G2X A;  1TMJ A;  3O44 A;  1U25 A;  2CQ2 A;  2L08 A;  2RKI A;  1T9T A;  5KFR A;  1JKH B;  5DG8 A;  4DQR A;  3DLL Q;  4ID5 B;  4XK8 C;  3GIL A;  4FBT A;  5EGY A;  2UUW A;  4JV5 F;  1EKR A;  1TUG B;  4YHH F;  3PTW A;  4O4R A;  1N32 J;  5AJ9 A;  2MHE A;  4EO6 A;  3DRY A;  2PGC A;  4OI1 A;  2W24 A;  3PIP Q;  2NXU A;  4AL7 A;  2EXU A;  3PHT A;  2VPZ B;  1WOP A;  2WW4 A;  2XYP B;  1MWY A;  5CD4 H;  2ZH6 A;  4USM A;  3D1O A;  1Z2Z A;  1PIE A;  3HHL A;  3CJT A;  3L7U A;  2CQC A;  3J81 j;  4X4T A;  1FO1 A;  4NZ6 A;  1YJN S;  5KFX A;  3JQM A;  2J5A A;  3HHN B;  2PE8 A;  8ATC B;  1AUK A;  1AJC A;  4V1A k;  5THW A;  1NME B;  2AT1 B;  4JV5 J;  4O0N A;  4FN5 A;  3W9I A;  5HLF B;  2FY1 A;  1AJB A;  1HWI A;  5KFK A;  4H4M B;  1VFJ A;  3KG1 A;  1H38 A;  1IKY B;  4ZVR B;  2YX7 A;  5D4L A;  2CJ9 A;  2W2Q P;  2C3P A;  3OL6 A;  3T41 A;  1DZ5 A;  2DY9 A;  2C42 A;  3DMJ A;  4IDK B;  2KM8 B;  2W7A A;  1KLM A;  2VC1 A;  3PRD A;  2JC1 A;  3IRX B;  2OP5 A;  4RW4 B;  5L39 A;  3RAX A;  2FJW A;  1HQ2 A;  5C42 B;  1U1N A;  4YQW A;  1IBC B;  2ZVI A;  4HDH A;  4EBC A;  1EJJ A;  2UU9 F;  5HP1 A;  1F3V A;  4M5I A;  1UWB B;  2MTL A;  3BBB A;  3QMQ A;  4NXN J;  3DGP A;  3HD2 A;  3WC2 A;  1UCN A;  1BHN A;  1NDL A;  4QWB A;  3CJ4 A;  3UN5 A;  4F8R A;  4ZPT R;  2IVF B;  1MRO B;  2FVS A;  2GHW A;  1YRU A;  3H2U B;  4LIR A;  4F25 A;  5AXN A;  2QGF B;  1RT6 A;  1RYS A;  2WRM A;  3IWN C;  2YKM B;  2LQ9 A;  3KK3 B;  1P9Y A;  4QIV A;  1U0H B;  4ZVO B;  4KT0 C;  2CWK A;  4UY8 5;  4UOO A;  4KKO B;  4H4K A;  2LQJ A;  3T01 A;  3D9B A;  4ZHR B;  3FFI A;  5F8G A;  4B3S J;  5FJ4 A;  2FVP A;  3LGM A;  4PG8 A;  1G1X A;  1S0M A;  1YRX A;  3A12 A;  1NZA A;  4JUZ A;  4OZ2 A;  3WIV A;  1H73 A;  3PYE A;  1U1Q A;  3P5B P;  1HBM A;  4ZVT B;  5DDR C;  2XM3 A;  2IUC A;  2W9B A;  1FRL A;  1AXQ A;  1R0C B;  2ZHB A;  1WI6 A;  1KDN A;  1FKP B;  5CZX A;  1T3O A;  3VF0 B;  4WP3 A;  1VQN S;  2WB1 D;  5KG6 A;  4LRE A;  3CT9 A;  4USH A;  4R0J A;  4DR2 F;  1E1Z P;  1Y6V A;  1NHK L;  2XMU A;  1RHQ B;  4J9V A;  2CDQ A;  2IDL A;  1XNQ J;  1HDH A;  1FVQ A;  4WKY A;  2LQ5 A;  1UKU A;  1PC5 A;  2VF3 A;  3CDA A;  2ZH8 A;  2DRD A;  2VPX B;  3CDU A;  1ZET A;  5A2Q Y;  1IBK J;  1X4A A;  4UPH A;  3PYD A;  1S1X A;  2D9P A;  1H2U X;  3ONQ A;  1QVG R;  3HXM A;  4OFZ A;  2IM2 A;  1U47 A;  4GVL A;  1AJA A;  1ELY A;  4I6W A;  4KM4 A;  2H1Y A;  1N52 B;  4XPE A;  5A8K B;  1I94 J;  4KV8 A;  1SJ4 P;  2VBY A;  2W7P A;  1KQF B;  4KGX B;  5EDW A;  1BLU A;  4DR1 J;  3WZ0 A;  4E2F B;  1QM9 A;  3OBI A;  2GJ2 A;  3R7B B;  5KFA A;  1KVI A;  2GJI A;  4LF2 A;  2BUN A;  1WF2 A;  3MM8 B;  2OSR A;  4QBU A;  3HO1 A;  1BQM B;  1RXO B;  2XEX A;  3OTE A;  2R7R A;  2AGP A;  2OPQ B;  1VHF A;  3E51 A;  4RW6 B;  5E3R A;  2DR7 A;  5M2P A;  3LP1 B;  2UZA A;  5F0W A;  4DQP A;  3R3T A;  2NR0 A;  4DR7 J;  1AZS B;  2KZZ A;  5A8W A;  2WVC A;  3BR9 A;  4URG A;  4ECX A;  2XS7 A;  1ZA2 B;  4DCJ B;  2E5L F;  2LQB A;  2IAJ A;  1WHX A;  2HBY B;  1FRJ A;  1LWF B;  1TTH B;  2WOM A;  3CCW A;  3EXC X;  3HSD A;  1X5O A;  3MM5 B;  1CS4 A;  5D4P A;  4GO5 X;  4BC7 A;  2DXE A;  2HW3 A;  1IVZ A;  4ID5 A;  4CO0 A;  4UPL A;  4O44 A;  2XY6 A;  2E9T A;  2KG1 A;  4HHU A;  1NO8 A;  3CCQ S;  1FKO A;  5GAE I;  4LFA F;  4PQU A;  2V69 A;  4LF5 F;  4C4W A;  3R5A A;  4ZPB A;  1U0S A;  2RDI A;  2K1R B;  1VLY A;  1FEE A;  2BAN B;  1FWL A;  1RYR A;  3NL0 A;  1HWU A;  2R2S A;  2LEA A;  2JEI A;  1DQA A;  3IGZ B;  3ZTQ A;  3DDN A;  2ROE A;  4TY9 A;  3H25 A;  4Q7A A;  4WCE Q;  2PMZ D;  2M52 A;  4LSN A;  1FCA A;  1Q8K A;  4CQ1 A;  1RAE B;  4ECQ A;  5HLF A;  3N5F A;  4LUB A;  4DPO A;  1WEZ A;  1LKZ A;  4ATN A;  3CMQ A;  1XMQ J;  3DLB A;  1Q4R A;  3X3U A;  4K4V A;  1NPK A;  2DGU A;  2YNH B;  4C6A A;  1SPB P;  5DQI A;  2W2P P;  4G1Q B;  3C3L A;  2ZZT A;  1RAJ A;  2QLJ B;  2PFF B;  2QIF A;  1WDD A;  4NMX A;  1N6Q A;  4TU7 A;  1KLM B;  2MQP A;  1BD6 A;  1RHU B;  1JQG A;  3EXY A;  2ZH3 A;  1NU4 A;  4J9O A;  4IOC Q;  1YIJ S;  1U1M A;  4RU2 A;  2V50 A;  1RA7 A;  2VH7 A;  4CO4 A;  2ATL A;  4MK7 A;  2DPI A;  4GKK F;  2H51 B;  4L73 A;  3GFZ A;  1B0T A;  1S6P A;  2VFS A;  4NLX A;  5HBM A;  5J2Q A;  2QE5 A;  3M30 A;  3GCW P;  3SFU A;  2IPO B;  3WBH A;  2E29 A;  1FNM A;  5IFM A;  1I3O B;  2LXU A;  3JSM A;  1S5Z A;  1F5C A;  4LFB J;  3D4J A;  3LGN A;  2DH8 A;  4RNH A;  3KK3 A;  3T00 A;  1Y5L B;  1ELX A;  2BQR A;  4LR7 A;  5IC6 B;  2AHO B;  2CDR B;  2WON B;  4ZOS A;  1HWJ A;  2R7V A;  5KXA A;  4JI0 J;  3MM9 B;  2XO7 A;  3AB2 B;  1U2F A;  2JJ4 D;  2EC0 A;  1UFL A;  3NS5 A;  4P72 A;  4LF6 F;  5HMY A;  1JLQ B;  4ZVE A;  3EPI A;  4NZ7 A;  2V9K A;  4NWJ A;  3FZ2 A;  4NCG A;  2BAC A;  1QD1 A;  3EIC A;  5GAG U;  2CNO B;  3CCR S;  1NB7 A;  4LQ9 A;  3E8O A;  2W01 A;  4DCP B;  3QO9 A;  3FGV A;  2IJN A;  4OHV A;  1N54 B;  3PO5 A;  4MKV A;  4JI2 F;  3JAM Y;  2R2T A;  2CVI A;  3JXO A;  2Y9H A;  1O99 A;  1S0V A;  1RT7 A;  2ZNZ A;  3OR1 A;  4DBQ A;  2VJU A;  1F6T A;  2YKA A;  5KFC A;  1VQ5 S;  4IFY A;  1NEE A;  4J9N A;  1ICE B;  1OYD A;  2ZBC A;  5HMZ A;  1UVL A;  3EVM A;  3HVR A;  3NBP B;  5LXY A;  1CBK A;  3N9U C;  3RB4 A;  3U27 A;  1PJ7 A;  3JTO A;  2CG8 A;  4EBE A;  3P3D A;  4PAB A;  1YDL A;  5DLG A;  3DOM B;  4KO0 A;  3IN5 A;  4CO2 A;  1YTY A;  3CJ0 A;  4B3M F;  3FRZ A;  2B4V A;  5DLV A;  4NAS A;  4B9V A;  4U95 A;  2A1B A;  1BUX A;  3HLU A;  1X5P A;  4Y00 A;  5L1J A;  4RUA A;  1WTB A;  3PR5 B;  1HHT P;  5A8K A;  4IDK A;  3KFW X;  3AA9 A;  1W26 A;  3MM7 A;  1NHU A;  4RKU C;  1RAG B;  1A6L A;  1S6Q B;  2AJ1 A;  2FUG 9;  2V0N A;  2DH9 A;  4NX9 A;  4PG7 A;  3Q83 A;  5HP1 B;  4LF1 A;  2VA3 A;  3CDE A;  5D3G A;  1YZ7 A;  4CLP A;  2LEP A;  3NKM A;  3MHY A;  4AND A;  3MM6 B;  3MFH A;  3W2W B;  3UDC A;  4NML A;  2OPQ A;  1S6U A;  3EDQ B;  4R25 A;  1NND A;  3K5O A;  3TA0 A;  1FJG J;  1RT3 B;  3LAM A;  4ZCK A;  2YKM A;  3K5L A;  2DPJ A;  1Q78 A;  3W5Y A;  3H7H B;  4BCA A;  2KH9 A;  4GTW A;  5I3U A;  5CYM B;  2J6S A;  2ZC4 A;  4ZPA A;  4I2P B;  4BHQ A;  2HK2 A;  3FBF A;  3O8W A;  1VC5 A;  1YRT A;  1TMM A;  1XJW B;  4CYU A;  1X4D A;  4IH7 A;  2OI2 A;  1ZA1 B;  2MKI A;  3FDS A;  3FEX B;  1OO0 B;  1V3R A;  4OLO A;  3QPI A;  4O3Q A;  3BYP A;  1ELZ A;  3AFG A;  1FRI A;  2H5J B;  2ROP A;  4ZLJ A;  2DNR A;  1TKZ B;  2E1R A;  1PG5 B;  2LCW A;  1BGX T;  3NGS A;  4Z7Y A;  2XMA A;  2W8K A;  4OI4 A;  2W9B B;  2VB6 A;  4J9R A;  2D9O A;  4O3N A;  3MR6 A;  2KDO A;  4EU0 A;  2ZOF A;  1EQM A;  1N5Y A;  1UJ4 A;  2WW8 A;  8AT1 B;  3T1Y F;  1DJ0 A;  1IJE B;  3B54 A;  3UD5 A;  3KLV A;  1RBA A;  1QTN B;  3NWR A;  1HMV A;  2QV6 A;  4JI8 J;  3QGP A;  3KNA A;  1DTT B;  1RDR A;  3I0R A;  4ZVF A;  2XWY A;  4NLP A;  1VBY A;  4CXS A;  4MYT A;  2BKN A;  1HA1 A;  5F3Z A;  3LWM A;  1HW8 A;  2YXL A;  2JRS A;  3CXC R;  4IO9 Q;  3T5H A;  4NA3 A;  1KH4 A;  3OR2 B;  2HIQ A;  1V9O A;  2GVZ A;  1RWX B;  4DPU A;  2C3O A;  2D1C A;  4DQI A;  2XRG A;  4JV1 A;  4ZKA A;  2RE1 A;  1S1X B;  3EWG A;  4ED2 A;  2H9Z A;  2KRR A;  4I68 A;  5K14 B;  2HHU A;  3BDP A;  5CAA A;  3PVX A;  1BE4 A;  1RWN B;  2BE9 B;  1WTF A;  3AH6 A;  5M2U A;  2RIL A;  2AX0 A;  5HRO B;  2F4V F;  3PV8 A;  2PII A;  3MMB A;  4JI0 F;  2XTJ P;  3S6E A;  1S49 A;  2FZK B;  2LDI A;  4ZN3 A;  5LSO A;  2CJA A;  2DNL A;  3MED A;  4FS1 A;  4D3G A;  3T9N A;  1H6K X;  1UPM B;  3DDK A;  3KLI A;  2HMI A;  2HNZ B;  1HL6 A;  3PDN A;  3KD8 A;  3BSN A;  4J9L A;  1UP1 A;  2QRR A;  2RQM A;  4KY3 A;  4OX7 A;  4QQB A;  3DLG B;  4BWJ A;  2XO6 A;  1K1S A;  1Q95 G;  1I94 F;  2BOP A;  1FRK A;  1RE1 B;  1XTZ A;  3M6V A;  2X98 A;  5LSL A;  4TN2 A;  1E6Y A;  3AAW B;  1FFG B;  3N0V A;  4KPC A;  4DPT A;  2V4J A;  2P6S A;  1CS4 B;  3GYG A;  3I9Z A;  5D0G A;  1MMD A;  3PG9 A;  4F3M A;  1N36 J;  5FII A;  2GS8 A;  1IBM J;  1O8B A;  3QO9 B;  2WVB A;  3B82 A;  4NLU A;  2K2P A;  1T9W A;  2EKN A;  4KE5 A;  4I6Y A;  2EW9 A;  2GGP A;  2RS8 A;  1PAU B;  4PEO A;  4USW A;  4OZ1 A;  4Y65 A;  3MUR P;  2UUB J;  3TZZ A;  2CQP A;  4CNY A;  4B3T J;  3OL9 A;  2G4B A;  4DPW A;  1XEZ A;  4TU9 A;  3TAR A;  2J0X A;  1NUE A;  2R2U A;  1JJ2 R;  4EK2 A;  4CLL A;  1S9G A;  1AYE A;  4C7Q A;  4LSN B;  5BR8 J;  1N0V C;  1TZ0 A;  1IKW A;  4NLO A;  1AUD A;  1M90 T;  1X9S A;  1CJU A;  4FP9 A;  4RW9 A;  3DOL B;  3ICL A;  1ZS6 A;  3OW2 R;  3C66 A;  4LMZ A;  5FDL A;  5H9E J;  1WKL A;  2E5G A;  4DFM A;  3Q8V A;  4I64 A;  5J2P B;  2A0F B;  1N34 J;  5F8J A;  1C1B B;  1FDA A;  1SV5 B;  1ZPV A;  2DGT A;  2DNH A;  3ETM A;  1HBN A;  3FNN A;  1F9F A;  3KUE A;  2OTJ S;  1BY9 A;  2YKQ A;  4NLR A;  3FBC A;  3MM7 B;  1TUW A;  4RUH A;  2VPW B;  5EWF A;  3UDL A;  2CPZ A;  1VIO A;  4S0M A;  3H0P A;  2W5W A;  4RBV A;  4NEY A;  4EGL A;  4TU8 A;  5LM7 E;  2XWX A;  1WC3 A;  4ED0 A;  5J2Q B;  1NK6 A;  2IMW P;  2HLU A;  2MQM A;  5F8L A;  4KYZ A;  4LF5 J;  4X4Q A;  1WG1 A;  4CO3 A;  4N5S A;  2AQ4 A;  4KGZ B;  1TL7 A;  4O3O A;  1AA1 B;  4B9U A;  3CCU S;  1RTD B;  3DRS B;  4ZVP B;  2YKN B;  1U26 A;  3M9O B;  4ECR A;  5LQQ A;  4DR5 J;  4LRA A;  1PAE X;  1EW2 A;  5KFM A;  3W66 A;  2HHH F;  3TWZ A;  5J1N A;  4K4T A;  1Y0H A;  2AYG A;  2D7S A;  3MK2 A;  4Y2A A;  3WQP A;  4I2Q B;  1LWC A;  2BM0 A;  2HQC A;  5DET A;  4QWE A;  5ADZ A;  2ZH7 A;  4ED1 A;  3V4I B;  1T03 A;  4LF7 J;  3A3N B;  4Q8E A;  2MEW A;  3DYA A;  4LVO P;  4YR3 A;  3GV5 B;  2JSX A;  2WAQ D;  3QWU A;  3GPA A;  5KT3 A;  4K4Y A;  9ATC B;  4CLW A;  4RR5 A;  5EUH A;  4O0I A;  1WOS A;  2GAG C;  4ELU A;  4NLQ A;  1LWE B;  3TAN A;  1FK9 A;  2G0I A;  1ALH A;  3HX9 A;  1TUV A;  1SH3 A;  2QL5 B;  2HS3 A;  2J0W A;  4PCQ A;  3I0R B;  2ZH2 A;  3IA0 A;  4Q8F A;  2R7S A;  4UT4 A;  1UFW A;  2P9C A;  3NOC A;  4IKA A;  3NG8 A;  3GB0 A;  2CJX B;  1HKA A;  3NCP A;  3ZZ0 A;  1Y4Z B;  3MEG B;  3ZZZ A;  4BS2 A;  1SUQ A;  2EFP A;  5E3Q A;  2XLI A;  2I38 A;  4EWT A;  4JV2 A;  2KI2 A;  1S7I A;  5B0D A;  3KLG B;  1ZZN A;  3QLH A;  4RUB A;  2WSC C;  3UN2 A;  3SSQ A;  1Q8B A;  5HRO A;  3RUB L;  3MOJ B;  3AA8 A;  4GO7 X;  3MMJ A;  3VZI A;  4R5P A;  4C0B A;  4FF1 A;  1TFW A;  2RHS B;  3MCO A;  3P4U B;  2R2R A;  2CQG A;  1ZZF A;  3GU0 A;  4DHV A;  4DXL A;  3I56 S;  3MEE B;  5HAT A;  1KFD A;  3JYT B;  4A8X A;  1QDU B;  3B6B A;  1OSD A;  2YWF A;  1AT1 B;  1N5T A;  3K8V A;  1X5S A;  4ENO A;  4ZVS B;  5C24 A;  5LL6 d;  3J80 U;  1GNK A;  2L41 A;  1RKI A;  4EUV A;  2V5H G;  5I3U B;  4FPI A;  3PX4 A;  5DG9 A;  4X4V A;  2OPS A;  2EBE A;  5LMN J;  3KDO A;  3WAY A;  1X4G A;  2KO1 A;  4M5M A;  2BJE A;  4RW8 B;  4HHH A;  4CXU A;  1S4F A;  1UVJ A;  3IBW A;  4IG0 A;  2UP1 A;  3FRY A;  1HNW F;  1RAI B;  2J8S A;  2GCF A;  1N34 F;  3IFE A;  2OIH A;  3ZZP A;  2GGP B;  2E1P A;  3Q89 A;  4UPI A;  2NUU G;  3NNH A;  1HHS A;  1F9H A;  1S1U B;  2O1P A;  1JLB A;  5AE1 A;  2YQ1 A;  3NCR A;  3IXQ A;  1VGY A;  2ZH1 A;  4J7C A;  1PIL A;  4RW6 A;  2N3O A;  4ECZ A;  1N5Y B;  3GR0 A;  1D09 B;  5CA5 A;  3V81 B;  4YN3 B;  3ENQ A;  3V6D A;  4I56 A;  1ZOT A;  1Y3K A;  1W2I A;  3KMS A;  3S1T A;  1URR A;  4K8R A;  4UOF A;  1OPZ A;  4PR6 A;  4DR3 J;  1PYS B;  1IKV B;  2CG4 A;  1YBT A;  3QFW A;  3A8E A;  4GMK A;  2LKZ A;  2MKH A;  2Y3Y A;  3PCO B;  5FDL B;  1N4L A;  1RTJ A;  2XUL A;  2R7U A;  1QUP A;  2AJ2 A;  3TO8 A;  3R5C A;  5IV4 A;  1U24 A;  3VWS A;  2HS4 A;  2Q66 A;  1QAJ A;  1KN6 A;  5L0E A;  2UXD F;  3NKN A;  2BX6 A;  5KG1 A;  3RRG A;  3QT5 A;  4AFF A;  3BZQ A;  4M5D A;  3MAH A;  4F2S A;  4OI0 A;  4B3O A;  4DFP A;  1E6V B;  1FNO A;  1VRU A;  2F40 A;  3LQV A;  3K17 A;  2K1R A;  4YB7 A;  3AXK A;  4KTQ A;  3ZTR A;  3ENA A;  1YJW S;  2ZOM A;  5EX0 A;  2BAB A;  1SHN A;  2PN6 A;  4FVM A;  3UVJ B;  2UUA J;  2EK6 A;  3B78 A;  3SDE B;  2DH7 A;  3KJV B;  1N0U A;  4F4X A;  3Q8U A;  3T6J A;  5J2N A;  4M5H A;  1N5V A;  4ITS A;  4DV2 F;  3SFG A;  3DRS A;  3IM8 A;  5E3A A;  3UNG C;  3W62 A;  5JUM A;  2VQF F;  2D1G A;  2OH2 A;  4Q45 A;  3BF4 A;  3AOA A;  1ITP A;  3IDD A;  3U1N A;  1U49 A;  5ETV A;  1C0T A;  1VHI A;  1R89 A;  4TLR A;  4GTZ A;  3BO2 A;  5D77 A;  4R8U A;  1SIW B;  1M0S A;  1WDT A;  4TYA A;  1BWV A;  5E3P A;  4DUZ F;  3IRX A;  4Y3C A;  2QA2 A;  4PZV A;  4O3P A;  1Q7Y T;  1R0B G;  1S6P B;  2KKH A;  3DYA B;  3OSN A;  4X84 A;  3LWL A;  3DOK B;  1R8A A;  4F4Z A;  2XB2 D;  1X31 C;  1QSY A;  4DV0 F;  3MPV A;  1L3S A;  1F2H A;  3GWC A;  3MDF A;  4K0K F;  4LR9 A;  2VG7 B;  3GYN A;  3MMA A;  5IM0 A;  3RB0 A;  3GIJ A;  2F4V J;  2W5X A;  1SQF A;  3W5Z A;  2ZBR A;  3H98 A;  4IQX A;  2ZOG A;  2G0C A;  2H5I B;  3CNQ P;  4IR1 A;  2D74 B;  2CWX A;  3ZNU A;  3HPO A;  4GTX A;  3R2D J;  3EGV A;  1SJ3 P;  2YNG A;  1YIT S;  2V2Z A;  1YZ6 A;  3CME S;  4OZ5 A;  3QID A;  1WG5 A;  3D66 A;  2QO3 A;  4WJB A;  1QTM A;  3PY8 A;  4B9S A;  4OHZ A;  4RW7 B;  2UVU A;  4N41 A;  4KHP F;  3VGV A;  3KLE A;  4Y0F A;  4B3T F;  1XC9 A;  3MTJ A;  3GJR B;  3WIU A;  2BJ8 A;  3N79 A;  4I6A A;  1MN7 A;  4J9U E;  3MR7 A;  5D4O A;  2YPY A;  4Y6I A;  5AE3 A;  1VJQ A;  1BMQ B;  1RT7 B;  4N77 A;  4CLY A;  1TVR B;  5CAB A;  2PD1 A;  2OEL A;  2QYG A;  2BKO A;  4ZJO A;  3TUJ C;  2Q3P A;  3P45 B;  3EYZ A;  1U2R A;  3VV2 B;  3MEK A;  2G1H A;  5CYQ B;  3HZG A;  3FCV A;  4CLU A;  2H65 B;  2HRY A;  1KQG B;  1QAI A;  2BRL A;  3J7Z 5;  1WAC A;  4N8O A;  4B9L A;  2F5G A;  2KFZ A;  4P52 A;  3RG6 A;  1KHV A;  2GQC A;  3D3B J;  3FZB A;  4M5G A;  3MMC A;  5C24 B;  4A8Q A;  1RTD A;  3DYC A;  3T1A A;  1GT8 A;  5L46 A;  3TZX A;  1IR1 A;  4ECV A;  4OX9 J;  1XMQ F;  2XCP A;  1SKW A;  1FE0 A;  4ZPC A;  5DM7 Q;  2GSU A;  3U1M A;  1TL1 B;  3EVO A;  3VAF A;  1VYA A;  2VDH A;  5IJQ A;  2C1E B;  2LQ8 A;  2QMX A;  3MPW A;  3NKY A;  3VGS A;  1TK0 A;  4OYA A;  1U02 A;  3CMR A;  1UZH A;  2GQQ A;  1FKA F;  3G6E S;  2MJU A;  3CCT A;  1ARO P;  1CJT A;  3CD7 A;  3M8Q B;  3OJS A;  2AJ0 A;  1JLB B;  3TEH B;  2EVZ A;  1IUJ A;  4HL9 A;  4MFB A;  3T19 A;  1U7L A;  3EZ5 A;  3QJL A;  4KC5 A;  3NVL A;  5C66 A;  2ASJ A;  2VJV A;  2V9W A;  2VQR A;  1NRK A;  1RHK B;  3V6J A;  2ZDO A;  4ED8 A;  1DLO A;  3ADA C;  2CQ1 A;  1YWX A;  1SJR A;  2PFD A;  2OO4 A;  2ZHO A;  4KHR A;  4OI3 A;  1ANJ A;  3BB5 A;  3G87 A;  5CYM A;  5B0G A;  3MEC A;  3G8Q A;  4Y2M A;  1RAO A;  3OUY A;  4WIQ A;  5B7W A;  3HMJ G;  1FI4 A;  2QG9 B;  2CXE A;  4CT8 A;  4YB1 P;  4OLP A;  4K4X A;  1M1K T;  1UL3 A;  2HZC A;  5KFH A;  2XYG B;  1R8H A;  5KTQ A;  4C8Z A;  2QN6 B;  2B4U A;  4DN0 A;  3ISZ A;  5E7O B;  2V67 A;  5K8O A;  3NMA A;  2WCX A;  4WWS A;  2V6A A;  3F41 A;  2OTL S;  1EET B;  1TKZ A;  3LF0 A;  2GML A;  1RLD A;  4J91 A;  4CDI A;  2ADC A;  4WYL A;  1EW9 A;  1FT8 A;  1QUV A;  3TNV A;  1YJU A;  4U9R A;  1RBO B;  1RIS A;  1T02 A;  4DR4 F;  1XBW A;  1JLC A;  3UVJ A;  4R5P B;  2FHJ D;  2GIF A;  3O3L A;  1C1C A;  1D9A A;  3PZP A;  2XY7 A;  4ED5 A;  4F0H A;  2RD5 C;  1RTH A;  1UEV A;  1KD1 T;  3I5B A;  3NLC A;  2I0X A;  4NRT A;  4P75 A;  2DR9 A;  3DC2 A;  3R7S B;  3GSI A;  4LFC J;  3EGW B;  4UY8 T;  3HVA A;  4C8L A;  1ZED A;  2MKC A;  4C48 A;  4XPC A;  1ZPW X;  1JLA A;  1N6Q B;  3QT8 A;  2HHW A;  2UV8 G;  2DNN A;  1EP4 A;  3D6H B;  3HD1 A;  1GX5 A;  1HNV B;  2J9C A;  3RJM B;  3KK1 B;  4DSL A;  2Z0G A;  4NYO A;  3TOQ A;  2EPI A;  2R9L A;  4FF2 A;  3CTR A;  3OFG A;  1J27 A;  3EDR B;  4E0D A;  4DPX A;  2NYH A;  3FUY A;  3SCJ E;  3Q3Q A;  3DM2 A;  2K8G A;  3Q2S C;  2YWW A;  3D6F B;  3LP0 B;  5HAN A;  3THV A;  1S48 A;  5G4D A;  4L75 A;  2HFN A;  5GAH U;  1D9D A;  1S1U A;  2HGN A;  4JOU A;  3LPY A;  3MF5 A;  1VC0 A;  1N36 F;  2IBK A;  2PO4 A;  5KG0 A;  4I7F B;  3NGD A;  3DLH A;  3NNA A;  4QU6 A;  5K20 B;  2E5J A;  3V81 A;  3T9Z A;  3WAV A;  4DV6 J;  1IWG A;  1HQE B;  2ATC B;  3DI6 B;  3CW2 C;  3C14 B;  3JSR A;  3TRG A;  2MZ1 A;  2C28 A;  2LFV A;  2MKJ A;  1OQ6 A;  3MAQ A;  3UQS A;  2V2V A;  1KLN A;  4NCG B;  5KFJ A;  2CUY A;  1H74 A;  1GMW A;  4GC7 A;  4E98 A;  3T3F A;  1R31 A;  2HBR B;  2IVM A;  2K7K A;  2DNQ A;  3O6Q A;  4G1P A;  1REG X;  4FNI A;  1R7I A;  5F9N A;  2V4R A;  4DOZ A;  3V6K A;  1S0N A;  1DY3 A;  1UZD A;  1X4H A;  3CJ8 A;  4OZN A;  2B51 A;  3TUI C;  2HAF A;  2GQ2 A;  2ZD1 A;  4J9S A;  3R8Y A;  2ZH9 A;  4HDG A;  1S9G B;  1AB8 A;  1LW0 B;  1NDC A;  4K59 A;  4Q2L A;  2C2O B;  4CLT A;  5DO2 A;  2VKZ G;  3IS9 A;  4YDX A;  3BDF A;  1FJC A;  1CJU B;  5E33 A;  1H98 A;  2GIQ A;  4FBU A;  2ZJR Q;  2RIJ A;  4WP9 A;  4PWD B;  1B0V A;  3ZZO A;  1PBA A;  2GV1 A;  5B0B A;  3E3X A;  1P8G A;  4DL3 A;  4KQZ A;  1S1T B;  3IP0 A;  2V8V A;  4W4M A;  2MQL A;  3R27 A;  5HI7 A;  3BQ1 A;  2XNR A;  4JI8 F;  2D3O R;  2BJD A;  2M0G B;  3HJV A;  1FRX A;  3RBZ A;  1JXL A;  1DBD A;  2OKQ A;  3IGY B;  2CVE A;  1EAR A;  1VJW A;  2BE2 A;  1FX2 A;  1S9E B;  2IMO A;  2CJK A;  4TXS A;  3K0J A;  3LPE A;  4KJG A;  1R6V A;  2B5J B;  3HHE A;  1WHY A;  1T3N A;  1LFW A;  4V19 J;  2ZZM A;  5D0H A;  2VQF J;  1REV A;  2W4C A;  1MN9 A;  2XYH B;  3MM6 A;  5IV3 A;  3SBM A;  3DRX A;  3BBF A;  2A18 A;  3M2U B;  3W9H A;  1SCJ B;  1F60 B;  2YKO A;  2J9E A;  1HFE L;  4TQR A;  1V3S A;  2IA0 A;  2ZH4 A;  1KH5 A;  3LA0 A;  4PXB A;  4K2J A;  4WXO A;  3W8G A;  5DQH A;  4WP8 A;  4DSE A;  1PO6 A;  2UUC F;  1NSA A;  1NKC A;  3GIR A;  1O5J A;  4OZ3 A;  1WC0 A;  3Q8P B;  2FJV A;  3CC4 S;  1Y10 A;  5A0Y A;  1SI9 A;  4RW7 A;  3HT0 A;  3RRK A;  5KT5 A;  2N82 B;  1SIZ A;  1ZH5 A;  5DLW A;  3UCZ P;  5LJ5 Y;  1Y00 A;  4DWI A;  1HWK A;  3PKM A;  5IWA J;  2RH3 A;  2QFJ A;  1UJ6 A;  1LWE A;  5ETN A;  5ETK A;  4GKJ F;  2H54 B;  4H4O B;  2V8H A;  2DBB A;  2ZC3 A;  2BBE A;  3AJ2 A;  3OTD A;  4ZDN A;  2I1R A;  1JK9 B;  1FRM A;  2CKW A;  5IZH A;  2NQP A;  4H54 A;  5DLT A;  2HGM A;  3Q2T C;  3MK1 A;  2G1D A;  4GVB B;  4FXW A;  1EAY C;  1X60 A;  1X7V A;  4ELT A;  3FVY A;  2MQO A;  2JDJ A;  3LOU A;  1RAF B;  1HHQ A;  4AUK A;  3R1L A;  1SUQ B;  2QLX A;  2R7T A;  2XMK A;  1CEZ A;  5B09 A;  4CM2 A;  1WG4 A;  1MSW D;  1XNR F;  1G3O A;  1RWO B;  1TEL A;  3SV3 A;  4IG3 A;  3H5Y A;  2FDN A;  4URQ U;  5ETQ A;  2Y1I A;  4NI2 A;  1D8Y A;  5ETL A;  4WBF A;  2CQI A;  3H20 A;  3MCN A;  1N5Q A;  5CH7 B;  4DZ6 A;  3PFO A;  3TEG A;  2A6O A;  2EC2 A;  2IVY A;  2V2Q A;  3MGJ A;  3OXG A;  1H7X A;  2HHT A;  3MED B;  1OY9 A;  4EEY A;  2VG5 A;  4J9K A;  4KJD A;  2R3V A;  2DNP A;  4F3Q A;  2JHE A;  3A3P B;  4XO0 A;  5AJ3 F;  3ENV A;  4A8O A;  2KN4 A;  2V8G A;  3UD4 P;  2UXD J;  2WOM B;  3FEY B;  4C2M A;  1ZTW A;  2HFS A;  3GIK A;  2QTW A;  3CCL S;  1E6Y B;  4FDI A;  3G6V A;  1XNQ F;  4DR2 J;  4AXJ A;  5HO4 A;  1I51 B;  1RZM A;  5KFF A;  2I5J A;  5B0F A;  4RNN A;  2J0Q D;  4PXD A;  1JLG A;  2Y0S D;  3CB4 A;  3QYY A;  4HVZ A;  3M6U A;  2DNK A;  2UUA F;  2CZV C;  2OD6 A;  4Y28 C;  5CD4 A;  1RT1 B;  4M5L A;  5KFW A;  5KFL A;  1ALK A;  5A2Q U;  1GMU A;  3EE3 A;  3RTV A;  2G2O A;  2H5E A;  1R27 B;  1VR6 A;  2ZDP A;  2ZVS A;  1NJI T;  2BEF A;  2Q43 A;  1ELO A;  2J9D A;  3GMG A;  4NE9 C;  4NYZ A;  4B3S F;  2OUG A;  4CLK A;  2C2D A;  4M95 A;  4UOP A;  3ILO A;  2OD4 A;  5ETP A;  1SL1 A;  1UA0 A;  3NKP A;  1T95 A;  3LO3 A;  4RW9 B;  4ZVG A;  4N47 A;  2HS0 A;  2FHJ A;  4KHM A;  4P2M A;  3AD9 C;  4YFU A;  2KHD A;  1S4E A;  2MZJ A;  2KFY A;  2GFF A;  4C3L A;  4FS2 A;  2B8P A;  2M8H A;  2JEG A;  2YNI B;  1Q53 A;  4JI4 J;  8RUC A;  1M5V C;  2R7O A;  1VMB A;  2DEJ A;  2DNO A;  3D68 A;  5HVF A;  2E7W A;  4CH1 A;  4EZ6 A;  2HFZ A;  2HQ3 A;  4AL6 A;  2XBP A;  3SV4 A;  3CCZ A;  1RWM B;  4KB7 A;  4DR6 J;  4DQS A;  1UWB A;  3BH6 B;  2XMT A;  3M30 B;  3QNW B;  1VQ8 S;  2X1F A;  1MNE A;  3QRR A;  1N88 A;  1U1R A;  1U1L A;  3AJ1 A;  4N7T A;  2E66 A;  2YVS A;  4QJV A;  5KFN A;  4U6P A;  4TQS A;  3OV7 A;  1SJF A;  3NS7 B;  3LXQ A;  4QIW D;  4DV0 J;  1WSR A;  2QYC A;  3M1V A;  2WON A;  3C8Y A;  5DDO C;  1QE1 B;  2QLW A;  3IGN A;  7FD1 A;  3OHA A;  1MU2 A;  1UPP A;  2L48 A;  1CPZ A;  3EJM A;  4EFA C;  1NSQ A;  2E5L J;  2VOP A;  2W5R A;  2Q1L A;  3H5S A;  1J5O B;  2IY5 B;  2VBX A;  2HPU A;  1JJC B;  2CAJ A;  2GHP A;  4WYW A;  4QPX A;  1WF0 A;  1JB0 C;  3OXL A;  4TVA B;  1GEH A;  3GFY A;  5F41 A;  1JLF B;  3TZW A;  5KT4 A;  4LF8 J;  4ICL B;  9RUB A;  1NHV A;  5DZ7 A;  2MY7 A;  2L3M A;  1K44 A;  1IM6 A;  1HBM B;  1MRO A;  1D8Z A;  3RR7 A;  2HNY A;  1BC6 A;  1NH8 A;  3ZZY A;  3PEH A;  4DU8 A;  4A8Y A;  4HH1 A;  2O66 A;  2V2K A;  4ZG7 A;  1SJ1 A;  1KH7 A;  2ZWP A;  2WZ1 A;  2X3D A;  4BLG A;  2GAH C;  2DO0 A;  3KLF A;  3G8T A;  5A6W A;  4J5O A;  1N33 F;  1TU0 B;  3DRR A;  1J2V A;  3P6Y C;  4LF7 F;  2AGQ A;  4B3R J;  4QCL A;  4QWD A;  2RQC A;  2AX1 A;  2CPJ A;  2QMU B;  2QZ8 A;  1WC1 A;  4WU2 A;  2MZT A;  3QRQ A;  4IOA Q;  5KFQ A;  3JAM U;  4DI6 A;  2MZR A;  2F63 A;  1LW2 B;  3UDE A;  2HQF A;  3IR7 B;  4NCA A;  1L3K A;  3J7A N;  1TL3 B;  2IDE A;  3EX7 B;  4IG3 B;  1X4C A;  3M8W A;  2V63 A;  1CG2 A;  2MZQ A;  4NLV A;  4P7V A;  3W7B A;  5C25 A;  3I55 S;  1G6B A;  2AF6 A;  2CAD A;  3B4M A;  3K59 A;  3C2P A;  2B43 A;  1E2S P;  2JC0 A;  5B08 A;  5IJS A;  1IXK A;  1XQI A;  5DGB A;  5IOL A;  2EKY A;  1T9V A;  3SZY A;  4ZPV R;  1RHR B;  3J7Y I;  2D69 A;  4QIE A;  3D2W A;  3VGU A;  3Q0A A;  1BQM A;  3JYT A;  1P9Q C;  3HUL A;  2E44 A;  4FYW B;  4HYK A;  1BQN B;  1K7H A;  1LK7 A;  2BXJ A;  3D7S B;  3C15 A;  2XS5 A;  1AZS A;  2ACY A;  2DHG A;  4EYH B;  2BV3 A;  2R8G A;  2DGQ A;  3T5L A;  1NJW A;  2I2Y A;  4YP3 A;  2ZEJ A;  2Y8Y A;  1NSK L;  1LNQ A;  3MM5 A;  2C22 A;  3EZU A;  3G82 A;  1QAX A;  4TY8 A;  2E5I A;  2ILY A;  4DL5 A;  2CNK B;  3JQK A;  3N6L A;  2A6M A;  2I6W A;  2XI2 A;  3QGI A;  3M8Y A;  1FDB A;  1WF1 A;  4IFV B;  2VHG A;  4X4N A;  2JX2 A;  1T05 B;  4M8L A;  1U09 A;  1TKX B;  2LXF A;  3AQP A;  1ZYQ A;  2OJ3 A;  4JI4 F;  1T0T V;  4HKQ A;  5JJB A;  5LJ3 Y;  2OEJ A;  4WZM A;  2W8D A;  4KIA A;  1RHJ B;  3BKF A;  1HQU B;  3BSC A;  3CJS A;  2F65 A;  3J81 Y;  4LR8 A;  1NPP A;  2XY5 A;  2UXC J;  1O51 A;  1UVN A;  3DRP B;  3PXG a;  1CJV A;  2M8D B;  1SVD A;  5B0A A;  2GSN A;  4F04 B;  3RB6 A;  3HFK A;  3TA1 A;  4J9P A;  5RUB A;  3BH7 B;  5F3T A;  1HNX J;  3CD5 A;  4RBT A;  3KTQ A;  1WC4 A;  1K73 T;  1HAR A;  4J9Q A;  3PX6 A;  1U6Z A;  2ZKU A;  5A8R B;  1WWH A;  4USI A;  4IR9 A;  2BJ3 A;  4UOC A;  2W5V A;  2C2K B;  4G1Q A;  3ED4 A;  2HVE A;  1M5S A;  2U2F A;  2RT3 A;  3GSD A;  1PGZ A;  1SC3 B;  4KGV B;  3SXL A;  2UUB F;  3BPS P;  2M2B A;  2CA9 A;  2P9E A;  1KOO A;  4CZC A;  4B08 A;  4ZCM A;  4OI2 A;  4Q0B B;  4DSK A;  2B6A B;  3M2R B;  1NKE A;  2Z58 B;  3L09 A;  5KFY A;  1VQ9 S;  2XZW A;  3KWM A;  3U02 A;  3OVS A;  1HR0 F;  3QZ8 A;  2KL8 A;  2BQU A;  3BQ0 A;  2QLB B;  5MLC V;  1HBO A;  3SDE A;  2HVD A;  3JSM B;  3Q23 A;  2IBO A;  2HMI B;  4HR2 A;  3M32 B;  2IA6 A;  2DIV A;  4WK1 A;  2IRY A;  4JB8 B;  4MKB A;  3BJY A;  3V4M A;  3GV7 B;  2AGO A;  1NK8 A;  1K0V A;  1E3C P;  1Q7L B;  4MIB A;  3ZC4 A;  1K1Q A;  3W9J A;  1KOH A;  1IN0 A;  1RB0 A;  2DK2 A;  3SEO A;  3QZ7 A;  1AFJ A;  1AFI A;  2JFD A;  5E5N A;  2RB7 A;  4B56 A;  4ES1 A;  4R8U B;  4F4W A;  2E7X A;  1M5H A;  3CE8 A;  4A47 A;  4NA1 A;  1TFY A;  1RWW B;  4DL2 A;  2HWH A;  3NAH A;  4TN0 A;  1JWW A;  5INH A;  1UEU A;  1F3F A;  1IJF B;  2G0J A;  1YLX A;  2CRL A;  3I32 A;  1UTA A;  3I96 A;  4MK9 A;  2DT9 A;  3UO0 A;  4NLG A;  3AHP A;  4L72 B;  2BW7 A;  4ZJL A;  3VAJ A;  4PQA A;  3PO4 A;  3NMR A;  2UVW A;  4AYB D;  3UR3 C;  6FDR A;  3ILJ A;  4EBD A;  4P73 A;  1KHW A;  2MPU A;  3CDB A;  1GTE A;  4IFY B;  3UE2 A;  2F8H A;  4CTA A;  3RR8 A;  3DXS X;  1UEK A;  2B9E A;  4AQY F;  1NSP A;  1XIQ A;  2GO9 A;  3MOZ A;  4OX6 A;  4CP5 A;  3CC7 S;  1DRZ A;  3M4X A;  5K4P A;  4OQJ A;  2VFT A;  1GXT A;  2B9Y A;  3I0S B;  2OAU A;  3BSA A;  3OFE A;  4M5N A;  3M8P B;  5IQQ A;  2Q6C A;  4JI2 J;  1DFD A;  2YWE A;  3E2D A;  1NLK L;  1O6X A;  1LXN A;  2X1G A;  3NKQ A;  3MPY A;  1A7G E;  1KON A;  1SV5 A;  1T9Y A;  3L7O A;  5KG7 A;  4QYZ J;  2R7W A;  1DTQ A;  3IBC B;  5CCM A;  1J5E F;  1CC7 A;  2AP6 A;  4U7C A;  3R5D A;  3W61 A;  1FKP A;  3OR1 B;  2ABY A;  4NLD A;  3ZTP A;  4USJ C;  1TVR A;  2B56 A;  3TJA A;  2BA9 A;  1IQT A;  2W2N P;  4NZ0 A;  4JV0 A;  2KHC A;  5HL7 Q;  1ZEB A;  1VI7 A;  2IYI A;  3QAU A;  2DTJ A;  1VQO S;  4HT5 A;  5L1L A;  3CJQ A;  3W2W A;  2OPR A;  1RBL A;  3TUP A;  4HAC A;  1UWA A;  3CC2 S;  4NLS A;  3CMA S;  3VR1 A;  2AMC B;  4CO5 A;  1RU1 A;  5KFT A;  3LUY A;  5HQL A;  2CYY A;  4C8Y A;  4ZG9 A;  5SUH A;  4U67 Q;  1FVS A;  4NWB A;  2VIC A;  5J1E B;  5F9L A;  2KZM A;  2UUT A;  4ED6 A;  2W4P A;  4DX6 A;  4RO0 A;  2YPZ A;  4KSE B;  2LEC A;  2HND B;  3B4D A;  1UA1 A;  1JIH A;  2MLZ A;  4CXK A;  5K8N A;  1FJG F;  1WSV A;  1IKX A;  2GMJ A;  1TKX A;  1FFS B;  1WOR A;  3PYF A;  1VK3 A;  4ANE A;  5U47 A;  2XQC A;  3H2V E;  1CJT B;  2MMY A;  1RA6 A;  4HLB A;  2LYV A;  4HTI A;  4C8K A;  1A9N B;  4I69 A;  3J7A 1;  2HQD A;  2CIM A;  3CO0 P;  1B64 A;  1B0P A;  5K5M A;  5A8W B;  2F1F A;  4UF4 A;  4GC6 A;  2DRB A;  2VON A;  5KOW A;  2OGU A;  3BR8 A;  1R6Y A;  1VIS A;  2YNF B;  4JI5 J;  4NXN F;  2ZKT A;  4X64 F;  3QBC A;  2Q79 A;  3MEC B;  4CYU B;  1QVF R;  4OJG A;  1S1V B;  2E5H A;  5DDQ C;  1T11 A;  4HEA 9;  4CM0 A;  3L7P A;  2RF2 A;  1FTR A;  2HQI A;  3DLK B;  3N4W A;  3PFE A;  4MK8 A;  3OVB A;  5HRT A;  3OTB A;  3OTC A;  3SQO P;  1Q5V A;  5GMD A;  3BS9 A;  2PSZ A;  3BKT A;  1HPZ A;  2E1A A;  4ID8 A;  3JSB A;  4KFB A;  4CO1 A;  4ZJQ A;  3MR5 A;  4F4K A;  4LF9 F;  2KG0 A;  4NCB A;  4C97 A;  2B6A A;  4LBP A;  5KFO A;  3FMB A;  1Z4U A;  4DG1 A;  3DLE B;  3PW0 A;  4ECU A;  1FFW B;  3HHK A;  3I4H X;  1S9F A;  3KUG A;  4PG4 A;  1A0O B;  1SBR A;  3HJF A;  3NRB A;  5J2M B;  1RUS A;  1GH8 A;  5A6P A;  3MEE A;  4XDD A;  2FD2 A;  2FIU A;  1IWA A;  1RT4 B;  2DEI A;  3O2I A;  4LIW A;  4ECT A;  2FQQ B;  3T1H F;  1NKB A;  1YGY A;  1KVK A;  4BC9 A;  1SC6 A;  1TAQ A;  2WBM A;  2NXJ A;  3C16 B;  3QIP B;  3SMZ A;  4DPY A;  3QJJ A;  3FQK A;  1GXU A;  3WX8 A;  2W5T A;  2CPX A;  2VAS A;  1VQS A;  1NK9 A;  2HZA A;  2ALY B;  2FTR A;  4C0O C;  1TQL A;  2AJ4 A;  2VG6 B;  2ZUA A;  4HI2 A;  2KFN A;  1K0T A;  2KYZ A;  1P6T A;  3D0H E;  3G82 B;  3A3O B;  3G6Y A;  2XI3 A;  3WDO A;  1RGV A;  1Y5N B;  4F02 A;  1GFW B;  5I3Q A;  1OWX A;  3PKY A;  4A46 A;  4WFN Q;  3CPW R;  4Q2M A;  2GVD A;  4QZV B;  1T05 A;  4ZCI A;  3H5U A;  1H0H B;  2IJR A;  2VG5 B;  1CJK A;  1RAD B;  2MLY A;  5GMK a;  1KC8 T;  2YQ0 A;  3BDH A;  2OPP B;  4P7T A;  4ZPW R;  5D0R A;  4EI2 A;  3W8P A;  3W5X A;  2ZE2 A;  1UMJ A;  2FYX A;  4LF8 F;  2F8E X;  1EZZ B;  2C2E A;  4DV7 J;  1N48 A;  1IBL F;  3DHX A;  3PJW A;  2AEM A;  2N3L A;  2R8I A;  4RX6 A;  4YR2 A;  2Z30 B;  4PXC A;  3BSO A;  2Z4P A;  2HHQ A;  2RKI B;  1NJY A;  1FJE B;  2MQ8 A;  5L0B A;  1DAX A;  1F5B A;  5KFG A;  3VHQ A;  2RDJ A;  2P5V A;  3HKW A;  4PG5 A;  1R8C A;  4Q43 A;  1UFK A;  4P9S A;  4B17 A;  4DV1 J;  3E2E A;  4B3O B;  1E6V A;  3A52 A;  2E7V A;  2VIH A;  3BGR B;  4USK A;  3TW0 A;  1AUS L;  5HQM A;  1X9W A;  5C2C A;  2R4F A;  3BQ2 A;  2YX1 A;  4YR0 A;  3K2Y A;  3NBP A;  2Y0B B;  5KFV A;  1IKW B;  2RML A;  2FZG B;  5T7L A;  1UW4 A;  3UW1 A;  3J80 Y;  1FSU A;  4BWM A;  3DCA A;  3F44 A;  4FKX A;  2O67 A;  5J2N B;  1FF2 A;  2R8K A;  4ANC A;  1TL7 B;  4IQM A;  4DX7 A;  2HYI B;  3Q8Y A;  4PUO B;  1HWL A;  4MYU A;  1FNX H;  4OL8 A;  4TLQ A;  1RKJ A;  1P1T A;  5HVH A;  3VAM A;  4ELV A;  3AJD A;  2EEY A;  4LJM A;  4RW4 A;  1KHN A;  2M70 A;  3D54 A;  5DJB A;  4O3R A;  2C2Z B;  2HFU A;  1VQK S;  2L9N A;  2BVZ A;  2ZM6 F;  2BM1 A;  2W5Q A;  3QSI A;  3TI0 A;  3BYR A;  3KJF B;  3LW5 C;  2N7C A;  4EZ9 A;  3SSS A;  1U4B A;  4PRF A;  2J6U A;  2BE2 B;  1S9E A;  4NRU A;  2HAI A;  2KXF A;  2V8D A;  2E1M C;  2ZBI A;  2B7B B;  4YEA A;  2ASY A;  2YBV A;  2HQG A;  3MR3 A;  4OX8 A;  3GIM A;  1REV B;  3IWX A;  4WTO B;  2ERR A;  4A8F A;  1O0P A;  1W7W A;  1R3N A;  1Q16 B;  2OSQ A;  1FK9 B;  2YKN A;  3HFV A;  4UUW A;  3R5J B;  1WUU A;  3M2U A;  3NEK A;  1QE1 A;  1HYS A;  4K5S A;  3CJK A;  2X51 A;  3ITH B;  3NS6 A;  4P2F A;  3TX0 A;  5BYR A;  4DUY F;  3V6H A;  2NLW A;  1U1K A;  1C4C A;  4CH0 S;  3BN4 A;  3KXD A;  2IYG A;  2YNG B;  1KTQ A;  1RU2 A;  2RF2 B;  2YWH A;  5DRK A;  1VBX A;  4W98 A;  3MEG A;  5G0R B;  4DFK A;  3I9V 9;  4ZA1 A;  2XSJ B;  3NNC A;  4KFB B;  1H2V Z;  1XMO F;  1TR0 A;  1RTI B;  3D1H A;  3FEZ A;  4X66 J;  3KLG A;  1LK5 A;  3KK2 B;  3L3C A;  4ECW A;  5KT2 A;  2Z2Z A;  2AEJ A;  3CVK A;  2H4W B;  2DGO A;  2C2N A;  1WEX A;  1TV6 B;  4FNH A;  3BN7 A;  1L3U A;  1U8W A;  1LQ9 A;  5GAG I;  5J2M A;  1GQE A;  1DTT A;  2X3G A;  3P8B B;  2Z56 B;  3QGH A;  4FPR A;  5CYQ A;  5T41 A;  5KFI A;  4DL7 A;  1HNW J;  3Q24 A;  2ZJQ Q;  2HVI A;  1YBU A;  4YY3 J;  3MCS A;  4LQY A;  1ZM9 A;  3N01 A;  4MH8 A;  1IR2 A;  3CUN A;  2EG1 A;  3TG0 A;  4ZCL A;  2AZ1 A;  3OL8 A;  3HSG A;  3C6T A;  3FBB A;  2DHS A;  5C5J A;  1VQM S;  2ZFH A;  1XK8 A;  1HNX F;  2LMI A;  3HHL D;  4ED4 A;  4C8O A;  1TL3 A;  2RRN A;  4OJ1 A;  5H9F K;  5K14 A;  1B4S A;  5ETS A;  3UFC X;  5BJR A;  2Z2M A;  1TL1 A;  4L6V 3;  4WE1 A;  4NXM J;  1TKT B;  2LU1 A;  2RUS A;  4FF4 A;  5GOV A;  5HVG A;  4DSI A;  3D6M B;  3Q22 A;  1XR7 A;  3MMB B;  4WFX A;  2C3M A;  1BXN A;  2BJ9 A;  2RQ4 A;  3DKD A;  3VAL A;  1FJ7 A;  2AWZ A;  1YVF A;  1JXV A;  4DV4 F;  4OYP A;  1CJK B;  4EMD A;  3RAQ A;  2I9S A;  4FKY A;  1D0E A;  2UU9 J;  1FXD A;  3KG0 A;  4KRW A;  2NRE A;  2IFY A;  1BWE A;  4CLF A;  2WVD A;  3KHR A;  3L9Z A;  5LRN A;  1SQE A;  3KNG A;  3FSX A;  4YHH J;  1S59 A;  4DR1 F;  4DR6 F;  2W8S A;  2FZC B;  2MXY A;  5L9X A;  4JI3 F;  2HKE A;  4ZGA A;  5L1I A;  2MKY A;  4L76 A;  1JKH A;  4G65 A;  3J81 U;  3IWL A;  2B4O A;  3DNC A;  4UPK A;  3GON A;  5D15 A;  5LT5 A;  4PQU B;  5KG4 A;  3E01 B;  3HI9 A;  2GZO A;  3EMT A;  4XTT A;  2W8L A;  2NZ4 A;  4ER8 A;  3A13 A;  1VRU B;  2N4D A;  2MKK A;  1KP6 A;  4OZJ A;  3EGN A;  1RT1 A;  2DR6 A;  4F0K A;  1GMW D;  1PYT A;  1RWK B;  2YQ3 A;  3HDS A;  5B0C A;  5KFP A;  3Q8Q B;  1UET A;  3I5A A;  4Y2C A;  3V6D B;  5IWA F;  4C0H A;  5CCL A;  1XMO J;  2VQE F;  2LA6 A;  1MW7 A;  4ZS6 A;  2GLQ A;  3SZZ A;  3M6W A;  1IKV A;  4YB5 A;  2K7J A;  1LFP A;  5DS7 A;  5DZ6 A;  4CWB A;  3UPF A;  3KJV A;  1WD6 A;  1Z1Z A;  1NK0 A;  4F3O A;  2NYI A;  4P74 A;  3MXH P;  3OJU A;  3VGT A;  2MQN A;  3MCM A;  4MT1 A;  3TJ9 A;  2F7V A;  3GQC A;  3GCX P;  3BRE A;  3TP2 A;  4ZK7 M;  1KKH A;  3M9M B;  4F36 A;  3HM9 A;  4P71 A;  3DMJ B;  2DJW A;  3KG4 A;  2YNI A;  5T14 A;  4RUC A;  2VQE J;  1NPR A;  2JFK A;  2W1B A;  2C3Y A;  3UWT A;  1MMN A;  4J37 A;  3MR2 A;  2IFX A;  3KK1 A;  2QSF A;  3M2R A;  4OZ0 A;  3OHB A;  1KQS R;  4ETZ A;  4X62 F;  1U8S A;  3LH2 S;  1TKD A;  2RQK A;  3GG0 A;  4ZG6 A;  2DY1 A;  3SCK E;  1DAR A;  3SCL E;  1URB A;  2YKP A;  4ZIV A;  2LP4 A;  5H1S V;  2V34 A;  3QT6 A;  4K4W A;  1YHQ S;  1SKR A;  1B8J A;  4GTY A;  1RT6 B;  1D1U A;  1NBE B;  3R6G B;  2CNN B;  4RLE A;  3EZO A;  3JB9 k;  4LRC A;  2HUR A;  4URS A;  4F7V A;  1C0T B;  2M5Y A;  4DLE A;  2GJF A;  1X9M A;  1B3T A;  4V19 X;  1S99 A;  2K06 A;  2QA1 A;  3C14 A;  2DGX A;  1F1B B;  1OS5 A;  2J76 E;  2HHH J;  2M9K A;  3T02 A;  4LBH A;  3R6L B;  1RCO B;  3QAE A;  3T5J A;  1NB2 A;  3K89 A;  4ED7 A;  3N6M A;  2JZ5 A;  2HWI A;  3D6T B;  3DOK A;  3OFH A;  1PKU A;  2WB4 A;  3GG1 A;  3V5R A;  4ZP6 A;  4ZLP A;  2FC9 A;  3L4B C;  4LSZ B;  4JI1 F;  2O01 C;  2QFI A;  3H8Y A;  3M2V B;  4YDD B;  4F2R A;  2QA4 S;  2IUC B;  1X8D A;  3OFF A;  3CCJ S;  2J7K A;  4YY3 F;  1XMB A;  2EFN A;  4X4P A;  4N76 A;  1URN A;  4UZB A;  2XZD B;  3TVK A;  4HT7 A;  2EWH A;  2Y1R I;  1ZBT A;  2CPE A;  4PPZ A;  3D0G E;  4PYD A;  1XR6 A;  2H3E B;  3HSZ A;  3VAH A;  1GAO A;  3HT3 A;  3TQ1 A;  2JVR A;  2QLF B;  4KPY A;  1LW0 A;  1OPI A;  4ZVU B;  4ZHR A;  5KT7 A;  5T7L B;  5AXM A;  3SQG B;  5A76 A;  3KHL A;  3R7N B;  2ROG A;  2MDA A;  2XHC A;  4ZLN A;  4KH1 B;  3C46 A;  1UVI A;  4B9M A;  2B0G A;  3GTY X;  3W3S A;  4PWD A;  4QR1 A;  2CJY B;  1VK8 A;  4WFA Q;  2HHS A;  1PJ5 A;  3HSJ A;  2FLN A;  2DRA A;  1G4C A;  1X4E A;  2XCA A;  2V4Q A;  1IBM F;  3NGT A;  4IO1 A;  3LAK A;  1LW2 A;  1KTV A;  1S1T A;  2K3K A;  5DLF A;  4CYS A;  4YUD A;  4B3M J;  4PKD B;  3WAW A;  1SQG A;  4WE1 B;  1TKT A;  1EHW A;  1PJ6 A;  1WC5 A;  1XER A;  2AIR B;  2HFO A;  2KVI A;  3RBX A;  3SCI E;  3WHI A;  3WX4 A;  2FJA B;  3CIZ A;  2VUG A;  3CCM S;  4DUY J;  3HCX A;  4ZVH A;  2VL1 A;  3TYT A;  4RU9 A;  7AT1 B;  2CPH A;  4QIF A;  4CIO A;  1P49 A;  3UI3 A;  3MM8 A;  2DHH A;  4ZIT A;  2MST A;  4K50 A;  1C4A A;  2FVR A;  2RJZ A;  2W7O A;  2V94 A;  4ERD A;  2DCL A;  2KT2 A;  1BQN A;  4FXD A;  2RDD A;  4DV5 J;  1Q8L A;  4JI6 F;  1DQ9 A;  3IG1 A;  2KVQ E;  4MIA A;  1Z2L A;  2IAJ B;  2QT7 A; 
#chains in the Genus database with same CATH homology
 5L0E A;  1SHN A;  1KH9 A;  1KH7 A;  1Y7A A;  1EW9 A;  2W8S A;  1KHK A;  5DLV A;  4UPH A;  4ZGA A;  5DLT A;  5K4P A;  2RH6 A;  1AJA A;  1ELY A;  4KM4 A;  4UPK A;  2QZU A;  3MK1 A;  2W5W A;  5INH A;  3E2D A;  3NKQ A;  3A52 A;  5LRM A;  1N2L A;  1ZED A;  3M8Z A;  2XR9 A;  3MK2 A;  3NKM A;  2D1G A;  3IDD A;  2XRG A;  3M8W A;  4MHX A;  5GOV A;  5LQQ A;  3DPC A;  4GTZ A;  2GLQ A;  3SZZ A;  4LRA A;  1ZEB A;  1E2S P;  5L0B A;  1EW2 A;  3OT9 A;  1FSU A;  5IJS A;  2ANH A;  3TWZ A;  4GTW A;  5GRR A;  3UNY A;  3SZY A;  3BDG B;  3DYC A;  1KHJ A;  3Q3Q A;  4KJD A;  1K7H A;  4UPL A;  1ELZ A;  4LR9 A;  5L0K A;  1KHN A;  4ZG9 A;  1EQJ A;  5LIA A;  1E33 P;  2W5X A;  3B5Q A;  3WAV A;  2W5Q A;  5AJ9 A;  1ALH A;  4FDI A;  4ZG6 A;  2GA3 A;  4CXK A;  4GTX A;  1URA A;  1URB A;  3IGZ B;  3M8Y A;  3MK0 A;  4GTY A;  1B8J A;  4NWX A;  4LRC A;  4CXS A;  4MIV A;  1AUK A;  1AJC A;  1KH4 A;  4LRF A;  2W8D A;  1ANI A;  4UOR A;  4FDJ A;  4LR8 A;  3T02 A;  1AJB A;  3TX0 A;  1ZEF A;  1ALK A;  3WAX A;  1N2K A;  2GSN A;  2ZKT A;  3UN2 A;  3NKN A;  5EGE A;  4LRB A;  1ED9 A;  4QAX A;  4UOP A;  3NKP A;  2IUC B;  3BDF A;  2W5V A;  5HRT A;  4LRD A;  4UOO A;  1EJJ A;  4KAV A;  3M7V A;  3WBH A;  3NKR A;  4MY4 A;  3UN5 A;  2G9Y A;  3KD8 A;  3T00 A;  2W5S A;  1ELX A;  5TJ3 A;  1ED8 A;  4LR7 A;  2GSU A;  5KXA A;  3IGY B;  2X98 A;  1HQA A;  4LQY A;  5IJQ A;  3WAY A;  1EW8 A;  4CXU A;  3CMR A;  3TG0 A;  4KJG A;  3T01 A;  1ALI A;  4N7T A;  4LR2 A;  4CYS A;  4NWJ A;  1E3C P;  3LXQ A;  3WAW A;  2W5T A;  3ED4 A;  4UPI A;  3NVL A;  5C66 A;  1O98 A;  4B56 A;  1SHQ A;  2VQR A;  1AJD A;  4KAY A;  4CYR A;  1EI6 A;  2W5R A;  1P49 A;  1O99 A;  2IUC A;  1KH5 A;  1KHL A;  1HJK A;  1ANJ A;  3BDG A;  4TN0 A;  2GSO A;  3NKO A;  5EGH A;  4LRE A;  4ZG7 A;  1E1Z P;  3UO0 A;  1Y6V A;  2IFY A;  1HDH A;  3BDH A;  4YR1 A;  5LRN A;  1ALJ A;  5DLW A;  3UN3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...