3UN5A

Bacillus cereus phosphopentomutase t85e variant
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
Knots found
sequence length
391
structure length
391
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDEMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Molecular Differences between a Mutase and a Phosphatase: Investigations of the Activation Step in Bacillus cereus Phosphopentomutase.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 143
structure length 391
sequence length 391
chains with identical sequence B, C, D, E, F
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2011-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3un5A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3un5A01
3SZZA 5TJ3A 4LQYA 1HJKA 3T01A 5EGHA 3NKMA 1P49A 5L0KA 4B56A 5INHA 2XRGA 3B5QA 2RH6A 4CXKA 3TG0A 1ELZA 1B8JA 4N7TA 1EI6A 1ALIA 1ED9A 2XR9A 4LR8A 1KHJA 3NKRA 4LR7A 2W5QA 3WAYA 4MIVA 1ELXA 3T00A 5DLVA 1HDHA 1EW9A 4KM4A 1URAA 1Y6VA 2W5SA 3MK0A 2W5VA 1AJCA 2W5TA 1ZEDA 4UOOA 1N2KA 4NWXA 1N2LA 3BDGB 4UORA 5K4PA 4UPLA 3TX0A 2X98A 3CMRA 1O98A 3SZYA 2GSUA 5C66A 5L0BA 3NKOA 4CXSA 1AJAA 1EJJA 2W5WA 3NKQA 4ZGAA 1ZEBA 3BDFA 3DPCA 5KXAA 4KAYA 5GOVA 3M8WA 1EW8A 2W5XA 3WAXA 1SHQA 1KHNA 1KHKA 3LXQA 3WBHA 1ALKA 3WAWA 2IUCB 3Q3QA 1KHLA 1ZEFA 1KH5A 1SHNA 4LRAA 1HQAA 2G9YA 4CYSA 5L0EA 3M7VA 4GTXA 4LRFA 1ALHA 5DLWA 1E2SP 4GTYA 2W8SA 2GSOA 4UPKA 4TN0A 2D1GA 4CYRA 4FDJA 2ANHA 3KD8A 4NWJA 1E3CP 1E33P 1EQJA 3A52A 3BDGA 5LRMA 4GTZA 4ZG7A 1E1ZP 2IFYA 4UPHA 3OT9A 1AJBA 4YR1A 4MHXA 1KH4A 1ALJA 5LIAA 3WAVA 3ED4A 1Y7AA 5LRNA 1ED8A 2GA3A 2GLQA 4KJGA 3UNYA 3NKPA 2QZUA 2IUCA 2GSNA 3UN5A 2W5RA 1ANIA 1EW2A 4UOPA 3BDHA 4LRBA 1KH7A 2VQRA 1ELYA 5HRTA 3MK1A 4GTWA 3MK2A 3UN3A 4LRDA 4UPIA 5LQQA 3IDDA 4LR9A 1O99A 5IJSA 4ZG9A 1AUKA 4MY4A 2ZKTA 1AJDA 4FDIA 4KAVA 4LREA 1KH9A 5IJQA 3UN2A 4CXUA 4LR2A 4ZG6A 3M8YA 4QAXA 5GRRA 3DYCA 1FSUA 3TWZA 1URBA 2W8DA 5AJ9A 1K7HA 5EGEA 4KJDA 3T02A 3M8ZA 5DLTA 3UO0A 3IGYB 3NVLA 3NKNA 1ANJA 3IGZB 4LRCA 3E2DA
chains in the Genus database with same CATH superfamily
3JAMU 5KFMA 3MEDA 4KGMA 5HATA 1M5VC 3LP1B 3QJPA 2ADBA 2VJVA 2YPYA 3GU0A 2LU1A 5FD1A 1IM6A 5HANA 2X7IA 4NYZA 4FKYA 4QIVA 1FRHA 2B6AB 4E98A 4DF4A 3TZWA 2HQCA 3VAFA 1CJVA 4K8RA 2W9BB 4WCEQ 4JI3J 1V3ZA 2FPHX 4ZMMA 4F4WA 1E33P 1WKJA 2YPZA 4NCGB 3AA9A 1YBAA 1UAWA 2RHQB 2WSCC 3A8JA 3BSCA 2VG6B 2XSJB 1T94A 5LJ5Y 2EI5A 5DG8A 4DR1F 2QZUA 1IKVB 3PM9A 3WX8A 2GIQA 4C8ZA 3E8OA 1VQLS 4C8OA 2LA6A 2UVVA 2ZJPQ 1JXLA 4RW9B 1MMLA 2RRBA 1JIHA 5IT4A 1NCLA 1TAQA 1P49A 5K8MA 3KMSA 1HQUB 3T3FA 4RBTA 2DY1A 1M5HA 4KC5A 4I64A 2KRBA 2W7PA 4PWWA 2Z2MA 2R4FA 1NK8A 1RHMB 3SFGA 3R8YA 3GLJA 3TX8A 2LEAA 1WJ9A 4U95A 4M5LA 4PG6A 3C6UA 1RAHB 3MEGA 4A47A 2DT9A 1WHVA 1VCTA 4MYUA 1F5CA 4DMZA 5BR8F 1OSDA 2R8IA 4LF7J 4OHVA 3MMCB 1YX2A 4YR1A 4PRFA 1R6VA 4DUYJ 1RCXB 1JLAB 2ZE2A 3PRBA 3PV8A 4KJGA 2BR0A 4NMXA 3GYNA 5HRTA 3M1VA 1W2IA 4JI1F 2UUAF 1PILA 1O5JA 1HW8A 1HLWA 5E7OB 3AQPA 4KO0B 4C0HA 3AT1B 1TK0A 3IGYB 3J7ZT 3J7YU 3X3UA 4HI2A 3PVXA 4K4SA 1F60B 1FTRA 1YTYA 3FMBA 1FESA 4C8YA 4MIVA 1YG0A 3V5RA 2K1RB 3D67A 4ZITA 5C2GA 3R5DA 4ZPBA 2CJYB 1HNIA 3A8KA 3TAMB 2HHQA 2BEFA 1XJWB 5E33A 3I96A 3BN7A 1Q95G 1U2RA 2RS8A 2GVDA 3DN9A 4LRAA 1J5EF 4NXMF 3LGHA 1DHMA 2QRRA 5D4OA 1NKBA 4UPKA 4LF4J 1Y9OA 4Y2CA 4DU8A 4WWSA 3HZGA 3PW5A 1X4FA 2Z30B 5DDQC 4DV2J 1IBKJ 1SJ3P 1RI7A 1CVJA 1WOSA 4OV6A 4KQZA 2AEJA 2GA3A 3S6EA 4DCOB 3QGIA 5KT6A 2DTJA 1QTMA 5DETA 4BLGA 1UEUA 2E9TA 4X4UA 3QT8A 3GJTB 5D3GB 5KT5A 4NMLA 4EMDA 3ILLA 4P74A 2B9EA 2BE2A 2E5IA 3E2DA 2CPJA 2DHXA 3QRQA 3OJSA 4DXLA 3RBZA 4DR2J 1HQEB 3CEDA 4K59A 3CC7S 4KKOA 5DJBA 4TU9A 1YZ6A 1U2CA 2DCUB 2FDNA 4Q8EA 1S4EA 4URQU 2C2RA 5SZTA 1S0MA 3EICA 4LFAJ 1H3DA 3I6PA 5A8WB 2V34A 2KHDA 4DX8H 3KLHA 1S0NA 3M32A 2LKZA 1TAUA 2CQHA 1U24A 3C15B 2W8SA 1RTHA 2E44A 2XMAA 2VICA 3CSKA 2IVYA 3MI7X 3PW4A 3SEOA 3SCJE 4OX9F 2HVHA 3DRPA 1PYTA 3UN5A 1EX8A 4OHXA 3HVWA 1F3FA 4G6VB 5CYQB 4DFMA 4ANDA 3EGWB 3I56S 3EPIA 2WOMA 2V8HA 2VU5A 3M8SA 3CT9A 3MURP 1H2TZ 2QC3A 2QL5B 4R5PB 1IM4A 5I42A 3A8EA 4RUCA 2BQRA 1AZSA 4F4YA 1H7XA 1FD8A 1N0VC 3DHXA 3SYZA 1Y6VA 1LW2A 2AZ1A 2HGMA 2DRDA 3PR4A 5JJBA 2WHOA 4RKUC 1D3WA 2RDDA 2W5WA 4DUZJ 5B08A 1KHNA 4PUOB 3U27A 2HFUA 1GMWD 3MPWA 3I82A 1IR2A 2QLXA 3BEGB 2A3JA 2XLIA 4HHJA 3ZZUA 3KLEA 1FJCA 1S6OA 1ICEB 3K2YA 1IKYA 4F50A 1T05A 4TU8A 2NZ4A 4DQPA 4HYKA 3KLFA 4M95A 2ABYA 3QZ7A 5AE2A 4M5DA 2MZJA 2QLWA 4P52A 2RQMA 2HHUA 4P71A 3TO8A 1SL1A 4WPAA 1YI2S 2B4UA 1F2GA 1S5ZA 3WX4A 4CT9A 1RT2B 4TY8B 4HVZA 5BYQA 4DR3F 3J7Z5 1Z2LA 1HNVB 5H1SV 2W5QA 1WKLA 1X4GA 1LWFA 2OEKA 2BUNA 3E51A 2EK1A 2VDHA 1HHTP 4N8NA 3EE3A 4CDIA 4JV0A 4CTAB 4UY85 1M1GA 4NLOA 2V6AA 1WC4A 3GTYX 4LSLA 2FY1A 4C4WA 3JQMA 5AXLA 4Q8FA 2DNOA 2B4VA 2KFZA 4Y2IA 1T7PA 5GAGI 2HS0A 1IJFB 2VODA 4I7FB 2CG4A 3VZIA 1KS2A 3FQLA 3DKDA 2R7RA 5B0FA 3G2XA 3CJSA 3I0RB 3AD8C 4QU7A 1EARA 2VBYA 3Q8UA 2AYEA 2OD4A 2RJZA 5KFAA 2IAJB 3QRPA 2OSRA 2AYBA 1XTZA 2YTCA 2R3VA 1LK5A 3RRHA 1QAJA 4LREA 2CNNB 1ULRA 5GAEI 1KLMB 4DSIA 3IGZB 4E2FB 5HO4A 4EUVA 3POTA 3KOAA 3SZ2A 4X4TA 4OL8A 2HK2A 4C98A 1OY6A 2G1HA 5KFZA 4ETXA 3TW0A 3J81j 1EKRA 2DPJA 2ACYA 3A1YG 2ZD1A 4O4RA 4LF8F 3Q89A 3LP0B 3SZYA 2OPRB 3NKOA 4B9MA 3DPCA 1WC0A 3LXQA 2ZNYA 2FHOB 1S76D 1SL0A 2H54B 5A8KA 3GJRB 3B8HA 1H7WA 3I9V9 4DSLA 2VG5B 3B82A 2CDRB 3ZXWA 3ULHA 2Z8QA 4ECSA 1RHQB 1KTQA 3SV3A 3WHIA 2PO4A 4UOPA 2YWWA 3PG9A 4ILMA 4JB8B 5J2MA 1VQ8S 1S1VB 4GO7X 1HL6A 4RU2A 3TYTA 2W01A 3IP0A 2DNPA 3R3TA 5D8HB 4JI0F 4NASA 3JTPA 4UOCA 2FJWA 4DR4F 4DSEA 3PXGa 2QLFB 2C2KB 1PBAA 1PO6A 1FRMA 4UORA 3N28A 3PDNA 3KXDA 4OJ3A 4EFAC 2FTRA 4J9QA 3CXCR 4CYUB 2O67A 4HDGA 3UQSA 3M9MB 2X1AA 1JNRB 4F3QA 4EK2A 2HYIB 2BKNA 2IC3A 3M6UA 3V4MA 4AE5A 5DG9A 4WBFA 3Q83A 4ZCLA 2V4JB 2CAJA 3H42A 4X4SA 1N8RT 2W5RA 4KT0C 2VQFJ 1HBUB 1FFWB 4K7QA 2VQEF 1CJVB 3GIKA 2ROPA 1DLOB 1VC6A 3WZ0A 5D0EA 2FVCA 3HD2A 3OUYA 4RW8A 4JUZA 2EFVA 1K7HA 2PMWA 1KVJA 1XEZA 2OJ3A 1RLCL 2NCKL 3GPAA 3FBFA 1C1CA 3CJ5A 3HPOA 5J2PA 4RX6A 4QYZJ 3BR8A 3THVA 5H9FJ 1YBTA 5F8IA 3MWBA 1SIZA 3KJQB 2WAQD 1MU2A 2GQCA 4ITSA 3Q22A 5J1EB 4MFBA 5SUHA 3KG0A 1UFKA 4O3PA 1SV5B 3GV8B 4JP8A 3CJKA 2CVIA 1JQGA 4USIA 1HR0F 3BSNA 1GXTA 3QLHB 1T11A 1FFSB 2PA8D 4DX7A 4J9PA 3SI8A 3P3DA 2RH3A 4ZPAA 1S4FA 5DZ7A 2FUG9 3NCRA 1AJBA 4DX5A 4YQWA 1D09B 1NZAA 2I9SA 5AXNA 2GX8A 3L7OA 4A8QA 1WHYA 2PGCA 3ZTQA 4KV8B 3DGVA 5C24B 3OL6A 3KJVA 4FDIA 5CYMB 3MR5A 4ER8A 1A6LA 3BGUA 3FZBA 3S01A 1FSUA 2G1DA 1Y10A 3HFZB 3T5LA 4OHYA 1WD6A 5J2NB 4QWEA 2Z2LA 4L3NA 2LEPA 1CQMA 2Z56B 5INHA 2XBPA 2LFVA 2ZE2B 2WSEC 5KFGA 1RSCA 1SI9A 5K20B 2KVQE 1LKZA 3ZZPA 1URAA 3GZ7A 3CJTA 8AT1B 3JSMA 3VQTA 3PCOB 2W5TA 2AGOA 4LVNP 2IM1A 3NGDA 4F04B 1EETB 5D4NA 3LPEA 1T9XA 3C8YA 4K0KJ 2H1YA 4LF9J 2OD6A 4LSNA 1UJ6A 1UJ5A 1GT8A 4KE5A 4IKAA 3SBMA 3VTIA 1S1WB 1BXNA 2ILZA 4HT7A 1ZAWA 4QJVA 1OIAA 4C8NA 3HHLC 1GK8A 4LRDA 3HHEA 4NCAA 1CBKA 2GVDB 1RB0A 4AXIA 1IBLF 1XK8A 2LQBA 3DLGA 2OKQA 3CCJS 1HD1A 1RT4A 2R8JA 1FRJA 1HBMA 2OLWA 3ZTPA 1RHUB 1T03B 4WZQA 2ZJRQ 4DV0F 1S77D 1SUQA 3RB0A 1X4EA 4NA1A 4IO9Q 5G4DA 1H2UX 1S12A 4UOOA 1M5SA 2YKNA 1GTHA 1FK9B 2HHWA 4IG0B 2BE2B 2QTWA 2K7KA 1JLEB 5L0EA 3TZYA 4JI5J 4P7VA 2UUCJ 4Q2MA 2V68A 4DL6A 4I6AA 4QIGA 3D2WA 2XS5A 2JOQA 1R27B 2J9DE 3NGUA 2FLOA 3T1AA 1PYOB 2EK6A 1RA6A 3FQKA 4OZLA 3AQOA 1GMWA 2F9DA 4DFKA 1MMNA 2IMWP 5HVGA 2MQMA 3CMAS 2P6TA 3CE8A 3DU6A 1RLDA 3ZZ0A 5F9NA 3CCQS 1URNA 1RTHB 2W4DA 1XMBA 2AQ4A 3BDPA 1XERA 4IQMA 2MZQA 2DNYA 2AIRB 3DRPB 4QIWD 4UW2A 4CWBA 1EI6A 2PEBA 3F56A 4Q44A 1EW9A 2Q6CA 2HQIA 4M5NA 3ZZZA 2MY8A 4EZ9A 4W4MA 3NKQA 2WOMB 2OP5A 3SSQA 1KHKA 3QAEA 1AT1B 3BBCA 5I42B 2OTJS 3RGIA 2EC2A 1PJ7A 3I0SA 1FKOB 2BA9A 5CH7B 2ASLA 4IUFA 1N6QB 1PG5B 3J80Y 5KG4A 4QBUA 3PX6A 2RILA 1I94J 3GIMA 2NSBA 4ECUA 3BDEA 4OZ2A 1LW2B 4P2FA 3JYTB 4XDCA 1N56A 1GAOA 1X9WA 2MZSA 2NQPA 1SVDA 3EGZA 4NA2A 3UDCA 2J8AA 3FSYA 1SH2A 1SC3B 2MJUA 3I5AA 1VISA 3MPUB 5ETPA 8ATCB 3DRSA 2G0JA 1A7GE 4I6WA 3W9JA 4IO1A 3MCMA 1NH7A 3PRDA 7FD1A 1SKRA 4JI7J 2RUGA 3DCAA 4B9VA 2BYCA 2A6OA 2BJ7A 3T1YJ 4Y0FA 1VJQA 4OYPA 4OYAA 4XTTA 2SXLA 1EW8A 5KT4A 2J9DA 1JLGA 2CJKA 1EP4A 2IPOB 1JJ4A 1DFDA 2GIFA 3FNNA 3HVTA 1RISA 3J7YI 3TZZA 3GFYA 2UVRA 2YBVA 3BGLA 2VBZA 3NGRA 3MF5A 3D1OA 1NLKL 1TV6A 4I2QA 5LIAA 2HMIB 2CJXB 1X9SA 4C0OC 2HS4A 6FD1A 4LSLB 3L4BC 2GJFA 4LQ3A 3CCLS 3HF5A 1XMQJ 4A8OA 3EZUA 3M05A 2G2OA 2WVEA 7FDRA 1BE4A 2OSQA 1QM9A 4Q7AA 1K0VA 2OPPA 4ID8A 1TKTA 2AHOB 2YKOA 3M2VA 4ZHRB 1FRKA 1U1PA 3SCIE 3CJ2A 4KFBA 1QD1A 2J9EA 3CD5A 2VC1A 4DG1B 3OPKA 1FEEA 3MK0A 3KK3B 1U47A 2O5DA 5CD4A 1NXIA 4UQTA 5LOQA 2XCAA 2VIHA 2JEFA 3QSYB 3PTWA 2G9YA 2MKJA 4JV2A 4B02A 4LRFA 3W64A 3MFIA 3MGJA 2FVQA 4HR2A 3H5XA 2AX0A 3L7UA 3H4BA 1RTDA 3R5AA 2YXLA 2UVUA 5IS2A 4KHPF 1XBWA 2AKWB 3CCSS 1W2BR 3UFCX 4H4KA 1V3SA 1RABB 1YBUA 1WI8A 4ZP8A 3PEJA 5K8OA 1RTZA 1FDNA 3MTKA 4Y2MA 4ID5A 3U1MA 5F8MA 3W5ZA 2CWKA 3PR5B 4RNMA 3CCVS 2CQGA 3TWZA 4WFBQ 3M8ZA 2ZWPA 2AEMA 2MKSA 4IFVA 3SZZA 3ZZYA 1FTCA 4JOUA 2QEXS 4OI1A 1NH8A 4ZCKA 2XGPA 2WTFA 1UVLA 2KB2A 2PFFB 1ED9A 5LJ3Y 2RQCA 3H8YA 2L48A 2YNFA 2BJ3A 5J2MB 2KJVA 2RU3A 2Q6BA 5FJ4A 2GW8A 1Y5IB 4U7CA 2QFIA 2G2ZA 3G82B 2XYPB 3RBDA 2QLBB 3MHYA 4YB7A 3JSBA 1W25A 1ALKA 2BJDA 3KYLA 5T14A 4J9OA 2JRSA 1R89A 2KYXA 2H51B 5T41A 5HMZA 1KOHA 4V1Ak 4A48A 1JLBA 2LXFA 5FIIA 1QAYA 4QR2A 3MUMP 3PRVA 3W3SA 2R7TA 3CJ0A 5IM0B 1KSPA 1YZ7A 5KFVA 4GTWA 3AAWB 1HMVB 3BYRA 4ZVPB 1VLYA 3EDQB 2ZZMA 4KBIA 2J0WA 5HI7A 3OTOF 3HMJG 4M63A 1XNRJ 4LFBF 3VGUA 1TUVA 4IRDA 4OX7A 1UEKA 2YVSA 3TJ9A 3TG0A 2B0GA 4EO8A 1HNXJ 1OPZA 1YITS 1J5OA 3QZ8A 5CZXA 1H98A 3IAS9 4LT6A 1RT7A 2QG9B 4OZ1A 3DLEB 3CB4A 2ZH2A 1LNQA 2GVZA 4ANEA 3KLGB 4RUHA 4YS2A 3AHPA 5GAHU 3PFEA 3P96A 3DFEA 3PHEA 1C1CB 2YQ0A 1VQNS 5EGYA 3BBFA 1NKCA 3MPYA 5J2PB 3T5HA 4NEZA 1FVQA 4CLKA 1SJ4P 2I5JA 3VZHA 2HK3A 4KHRA 4JI2J 4QPTA 3MFHA 1R0AA 1S97A 3CD6S 3CJ4A 3IBCB 5HBMB 1P1LA 2YKAA 5C42A 3TZXA 4MFBB 4GKKJ 2VHGA 1S0OA 3N4WA 4DV6J 1C2PA 5LQQA 3RJMB 3CJKB 2WB1D 2XLJA 4N77A 5C25A 1HYSA 5J2QA 4J9UE 3JXOA 3J7AN 3W63A 1IUJA 2P9EA 3CJ8A 5HSPA 2W4PA 2MPUA 2LLZA 4IDKA 5ETSA 1XC9A 1FXDA 3Q8VA 2VD3A 2LXIA 2XMMA 2M7SA 1DRZA 2XY7A 1Y3KA 4LF5J 4CLTA 2V69A 4DV3J 4XDDA 1WEYA 4AXJA 3NGTA 2FHJA 1U25A 4HLBA 3MM9B 3V2UC 4UPLA 5HQMA 1UJ4A 2AJ0A 4Y65A 2J6TA 1WELA 4MJKA 4ZPVR 4CXSA 4ED5A 4Z7YA 2ROGA 3DDKA 1LV5A 1FJ7A 3W2VB 4TU7A 1I3OB 1BGXT 1FD2A 5CHCB 1C4CA 5I3QA 2DNKA 3N6LA 4GTXA 4DL0C 1JX4A 3F44A 2ZZTA 1NJZA 3CWJA 4B9TA 2Q43A 2X1BA 4X4VA 3CCES 1WOOA 4I4BA 4A46A 4PYDA 2VOPA 4Q43A 3PEHA 2V2QA 1FT8A 1SBRA 1N36J 1U1QA 4LBPA 5A0YA 1WF1A 4DCPB 5LXRA 3BO4A 2FZCB 4LSNB 3DYCA 2XI3A 1NJYA 3DLBA 4RUBA 2DCLA 3HDSA 3T6BA 3QT7A 5DM7Q 4PWUA 3NKMA 3RAMA 2XRGA 4P10A 1LWCA 3R1HA 2UXBF 1QAXA 4Z37A 1XNQJ 4WZMA 3D3BJ 2F65A 2QL7B 4XO0A 3H59A 1OO0B 1YDLA 2RB7A 2XM3A 1Q5VA 1AFJA 2HZVA 1JWWA 2QGFB 4FPRA 1GH8A 1UVIA 3VF0B 3DNCA 4ZVRB 3EZOA 1RT4B 4M5HA 2UXCF 1DTTA 4PG8A 1U1LA 3D1HA 1OMSA 2YKQA 1HBMB 4MAKA 1NPPA 4WU2A 4ELVA 4C3MA 2ZWOA 3KK2A 2JLFA 4GTZA 4OV1A 2W2QP 2H3EB 2YKNB 4OLOA 4B3TJ 3MAAB 4CO5A 3MR7A 1QAIA 5ETRA 2QO3A 2Y1RI 1N5SA 2C2OB 3L95X 2BJEA 3VAGA 1WG4A 2NYHA 3PACA 4M5IA 2J76E 1LFWA 2VDIA 3ZC4A 2VF3A 3PYGA 4ENOA 2M8HA 4A8XA 5LMNF 3H25A 4JV5F 3R97A 2HBQB 2XYGB 3O6QA 3HKWA 1N32J 4NWXA 5K5MA 4F0MA 3DDIA 2H5EA 3MM5B 2J6UA 3VGVA 4FNIA 1WDTA 5E3AA 2Q1LA 3LPYA 4X66F 1A0OB 3OXLA 2BOAA 4LFCJ 1KVIA 1R0CB 1X31C 3ITHA 4DF8A 2POKA 3NRBA 4ECZA 2YQ1A 2BVZA 2KN4A 1W26A 2G4BA 1LWXA 2R7QA 1N33F 1QDUB 4OHZA 3NY0A 4I0WA 3MK2A 2WB4A 3NLCA 5THWA 3KHHA 2KI2A 2GAHC 1LEOA 4FS1A 2KXNB 1D9DA 1SJRA 2C3MA 4CI0B 4FBUA 3G6YA 3ENQA 5FDLA 2UP1A 3HFVA 3DOLA 2VC0A 4WE1B 4EO6A 1WC5A 4FYXB 2M9KA 2L9NA 2FGCA 2JDJA 4GO5X 2PT0A 3EWGA 4ZVGA 2CPHA 4EEYA 3CUNA 4F7VA 1JK9B 2AJQA 4HHUA 4ECTA 2HIYA 4C9DA 2M0GB 1SJFA 4HH0A 3QWUA 2CUYA 4NA3A 3P5TL 2W5XA 2F4VF 4NXNJ 4R0JA 2CJBA 3LP1A 5I3PA 2UVWA 7AT1B 3TARA 3RB4A 1X5SA 5JXSA 1T9UA 1WC1A 1CJTA 1ALJA 2MMYA 1R8BA 2HBZB 5GVQA 3RG6A 3MM7A 1Q53A 1RWXB 5EHHA 4PKDB 2UV8A 3GONA 2W9BA 4QOTA 3CVKA 1EQ0A 1B0VA 3X1LB 4NCGA 3U1NA 3Q86A 5AT1B 2OAUA 4DQIA 4LQ9A 3W66A 2VG6A 4C97A 4CLZA 5TJ3A 2XCPA 3RUBL 2XB2D 1IKVA 4WIQA 2KM8B 2B7BB 4I2QB 3RTVA 3B4MA 2IJFA 4UUXA 4LVOP 1NSPA 1MN9A 4I68A 2DY9A 4A8WA 2CQCA 1M1KT 1D1UA 4RW9A 1C0TA 4OZJA 1KTVA 2V67A 2OH2A 2RAQA 3GJQB 3TA2A 2N3LA 1YJVA 1P8GA 5B0CA 4CZCA 1N48A 4NLTA 1S6PA 4RW6A 5HAOA 2OPPB 1TKTB 2PMZD 1RQ0A 2ZM6F 3M2VB 4Y6IA 5GADU 2W2MP 4TQSA 5ETKA 4RW7B 1XWLA 1RT1A 5E0OA 4W92B 3ZNJ1 1VRTB 4L6V3 4DR5F 3SDEA 2IDLA 3NOGA 3FFIA 3NWGA 1KWMA 1KEKA 1JMTA 2HBYB 1RU2A 1A9NB 4ZG9A 4F4KA 5RUBA 4DDFA 3MMCA 1YVFA 2C28A 4CLYA 4X4RA 4ZPCA 1RTDB 3W8PA 1JLAA 5DO2A 2MSSA 4KH0B 3W2WB 2HQ3A 4OJ1A 1SL2A 2ROEA 4X84A 3JSRA 2W9CA 2HHXA 1U0SA 5M2UA 1BWVA 1FRLA 2W5SA 1VIXA 5CQGA 2BJ8A 4KO0A 3MOZA 5B7WA 3Q0AA 5AE1A 2ZITA 4NLYA 4AQYJ 3H5SA 4ED6A 4DOZA 3DXBA 1B64A 2O66A 1Q78A 4IFVB 5HMYA 2CNOB 2FQQB 4B9UA 4QIFA 3UWTA 1QSYA 2MQQA 1C0UB 3OFFA 2DD8S 1FHTA 2K1RA 3DLKA 1FDDA 3MZIA 1FWPA 1KBRA 2YNFB 1ELOA 5U47A 1EZZB 1S7IA 1GFWB 4B3MF 4OFZA 2XNQA 2YWGA 3RAXA 1NB2A 4IQXA 5KT7A 4ZIWA 1XN9A 2HHPA 4KPYA 2C3PA 1HARA 3QFWA 2RSQA 5LRNA 2DITA 4WXWA 1YJWS 1JLBB 4DV5J 1VLOA 3AA8A 4DR7J 1NRKA 3AFGA 1S1TA 2QMWA 5LM7E 1SH0A 3T00A 5D3GA 1HDHA 3QAUA 4CM0A 2HWHA 1ZEDA 4Q2LA 3OL9A 3EYZA 2G0IA 3GCWP 3M2RA 1SQGA 1KC8T 2GNKA 2RKIA 4U7UD 5F0UA 2XZTB 5A6WA 1HQEA 3TQEA 3ONQA 2WCXA 5IFMA 3MD3A 2JEGA 4K5SA 4U8VA 2GVZB 3BYPA 5L1KA 2UXDJ 2UUTA 1FJGJ 3DGPA 2R2SA 2ZH9A 1FCAA 1FRXA 2D74B 4OIXA 4HL9A 1KNZA 1YIJS 1NSQA 1VS3A 2PDAA 2AZ3A 1Q86T 1JXEA 2F3JA 2I5JB 2E9RX 4USTA 4YR0A 3CJQA 3OR2B 3OD2A 5B0EA 1LXNA 3TUIC 5E41A 1S9EB 5CYQA 1RHRB 3UCGA 4F3OA 4MK8A 2AX1A 4KGZB 5DQHA 3VV2B 5KFDA 5J2QB 3TVYA 4RU9A 1OSCA 5EWEA 1O6XA 5A76A 2HQGA 3TVZA 1NB7A 4USWA 5IWAF 1Q4RA 4FZVA 4B3SF 3H40A 2UU9F 4IDKB 4OZ0A 4I6YA 4X2BA 4USJC 4X62J 1KD1T 2KT2A 5KFEA 1SQFA 3HI9A 2CZ9A 3AJ1A 1N5TA 5L1JA 1CJUB 3IRWP 2KXHA 3M8RA 4HACA 4PUOA 3Q23A 4ZJOA 3T9ZA 2R2RA 2VL1A 1EKSA 4ZA1A 1H72C 2GGPA 3N79A 4DI6A 2VBWA 1X4HA 4Z2XA 4YY3F 2E5LF 2XHWA 2NREA 1U0HB 1MWQA 5DS7A 1SKSA 3D0IE 1MWYA 1OWXA 5H9EK 2RE1A 1QSLA 1WC6A 3LGNA 1NJIT 1G2EA 2F4FA 4KR0B 1HD0A 3UCUP 3LF0A 2R2TA 3IRXA 4ED1A 3CDEA 4DR1J 1H74A 1TR0A 3OTBA 2HRTA 3CJRA 1QUPA 4CH0S 2NZCA 5B0AA 2KZZA 1RT2A 2OFHX 4CP5A 2AJFE 1M90T 3DM2B 3IS9A 2CFXA 4CLSA 2XS2A 3FKBA 2BE9B 3NKYA 4K4ZA 2N7CA 2ZFHA 4K2JA 4IOCQ 4TN0A 4FDJA 2L9WA 2Z0GA 1IQTA 4M5GA 4C48A 2OO4A 2BM1A 1IKWA 4QQBA 1QUVA 3OVSA 3O8WA 2B8QA 2G9OA 1N5YA 2HVEA 1NKEA 2HHHF 5EWGA 3SCLE 3PO4A 1DTTB 4I7FA 2LQ9A 5G0RA 3D6MB 4CXUA 2BACA 2LQ8A 2W8DA 4P73A 3H4DA 4ELUA 5HVFA 5BR8J 3I0RA 3GJSB 1ITPA 3KK2B 2WVDA 3D5MA 3UD5A 5EX0A 3V81B 1LXJA 2IAJA 4TY9A 4HI1A 2VASA 3VVTA 3NEKA 4ECQA 2DISA 1RTIA 2HPUA 1CULB 2YNHA 5CAAA 1U26A 4BS2A 2JLEA 4ZVSB 1KLMA 5KG2A 1SJ1A 2CJ9A 1D0EA 3VALA 4JI1J 2EVZA 4KRWA 4K4TA 2E5JA 3GMGA 2UUAJ 4A4JA 4ZVFA 4RNNA 2WZ1A 5DZ6A 2AYGA 2R2UA 2NPFA 4OJHA 1TL5A 4OJGA 4URSA 4B3RF 1RWOB 2OPRA 3HFKA 1HWLA 1ZM4A 4NZ6A 4ZLPA 3IR5B 3HT3A 2ZUGA 4JI6F 4KGKA 4E0DA 3IA0A 1CEZA 3PFOA 3AD7C 3IWXA 3RU0A 1BWEA 4IFYB 5GAHI 3BS9A 5K9FA 2J0QD 1BY9A 3OLAA 3C19A 1JXVA 2LA4A 2VFRA 3THPA 4QIEA 1J5EJ 3US5A 4NXMJ 1TK8A 2MQOA 3PIOQ 3T01A 5L0KA 1LK7A 2EWHA 3I5BA 3QBCA 4NYPA 1FWKA 3P5BP 4OI2A 1KHJA 2KHCA 3ETMA 3SIPB 2B9WA 2XEXA 1K9MT 2RVJA 1EAYC 3IM9A 3K5OA 2Q3PA 1JLFA 2RD5C 1CS4B 2IVMA 3MPVA 1P9YA 3RR7A 2XZWA 5AJ3F 4UZBA 1IKXB 1PYSB 3TR5A 1WHWA 3DMJA 4J9NA 2KDOA 3CCTA 1ALHA 1U1OA 3NS7B 1RAIB 2RF2B 4MKYA 3CULA 2C2EA 1SH3A 1EIYB 3OTDA 3ED4A 1T9TA 3QIPA 1HNZF 3SXLA 4CYUA 1ZA2B 1ANIA 4DPYA 1RA7A 3C6TA 5LT5A 3OTEA 2XY5A 3BKUA 1HFEL 2DR8A 4DN0A 4F4ZA 5JVGQ 1YRTA 1F9HA 2VFTA 1WUUA 2V8PA 2UUBF 1ZZFA 4PWDA 1SB6A 2KRRA 2KFYA 5ETQA 3N6MA 2V4JA 2V4RA 2LVWA 1CJTB 3DU5A 2VZ9A 3ILJA 4YEAA 1HBUA 2YKPA 2AJ2A 4N7TA 2HBRB 3MM7B 4OX9J 3L09A 1S9GA 1RU1A 1G4CA 1DLOA 2W5VA 1DQAA 4F2RA 4ZVOB 2EG1A 3AOCA 3KHLA 4FKXA 2VBXA 4K4WA 1K47A 3E01B 2CNKB 5C5JA 3GILA 2CPFA 1TVRB 2W24A 3ZZOA 1UL3A 3FGVA 1ZEFA 3H0PA 2BW2A 1VHIA 3QGGA 1V5VA 3TRGA 4O44B 3T1HF 5B09A 1GMUA 2ZH8A 3VAHA 5KG7A 1VMBA 5J1EA 1C0TB 2HQDA 2WSFC 4O3SA 4CLWA 4K50A 2V50A 1SV5A 1IBCB 3TA1A 2OMOA 1CLFA 4YUDA 1S6PB 4RW6B 3I4PA 1VQ6S 1BQXA 1REGX 4NPOA 3QLHA 1PJ5A 2EG2A 3M2UB 2FYXA 4U6PA 3PW2A 3BGRB 3OFGA 2RUSA 2X3GA 1RT1B 3KDOA 3R7BB 2QYCA 1X5OA 1TL4A 3SDEB 2XZDB 1KFSA 3FFIB 4EYIB 1T0TV 4N76A 5A6PA 5J1NA 4KV8A 5C24A 3GYGA 5CYMA 3ICLA 2P9GA 1Q81T 2HNDB 4XAKA 3NWRA 1PSDA 3FSXA 1FKAF 3PYDA 1RADB 2PA3A 1B7FA 5J2NA 3TUPA 2AU0A 4DLGA 4EBCA 2QFJA 2DH9A 1S49A 4NZ0A 3KDNA 2O3DA 3UDVA 3UR0A 1KHLA 2E9ZA 5KG3A 4HHHA 1KRPA 3ZNUA 2W9CB 4ZK7M 4NWJA 4DR3J 4WFAQ 4UPHA 3SCKE 1F5AA 4IR1A 1IXKA 3ZFVA 1EETA 1YJTA 2HWTA 1PC5A 3CO9A 5JMNA 3IAM9 4F4XA 1SQEA 3NOCA 3V6JA 1S6UA 1X5PA 4ZVUB 5HJXA 4MIWA 1S1WA 4LBIA 4UY8T 3DLKB 5DGAA 3J81Y 2Y8YA 3KUEA 4NLVA 4DQQA 2XMTA 3H98A 2XWXA 3CCZA 3ILIA 3HK2A 1O8BA 2BQUA 3VGTA 1N2KA 4QR0A 2HHTA 1AFIA 2V9WA 1RT6A 3O2IA 2DXFA 3LGMA 3BGFA 1T03A 2ZKUA 3FBCA 3PHTA 2DH7A 1MWZA 1NAQA 2Y1IA 5ETMA 3MXHP 4DSKA 3OFHA 2EBGA 1S1TB 1R3NA 3BM7A 1QE1A 1FK9A 4IG0A 2DK2A 1NBEB 3B78A 5F8NA 2CADA 1F2HA 1JLEA 3M2RB 4LF8J 1FX2A 3ZTRA 2CPZA 3PW7A 2H4WB 2RKIB 2L3MA 5I4MA 1RHJB 3MTJA 1ACMB 3EXYA 4WP8A 1VJWA 1S1UB 3TANA 2E29A 3OFEA 2GHWA 2QA4G 1BHNA 2E5GA 3RAQA 2RH6A 1H6KX 3GCXP 3DGPB 1JJCB 5CA5A 3EGVA 4CM2A 4I1TA 4TN2A 2CYYA 4OI3A 2VJUA 4USKA 1O0PA 2C2MB 1AJAA 2KG0A 1QY7A 3JQJA 3A13A 4EZ6A 2BMBA 2CQ0A 1HPZB 4XK8C 1HI1A 3FCHA 3UNGC 4ILLA 1WG1A 2A2DA 3CNQP 4JI0J 2DJWA 4AUKA 3A52A 4DR4J 1IN0A 2Z2ZA 4ZJQA 4PG4A 2WONA 4TLQA 3ENAA 2FY8A 4PPZA 2HWIA 2MKCA 3NCQA 3MK1A 4GKJF 2DGOA 3K17A 2HVDA 2V2KA 3DRYA 2CJQA 1FKOA 1AUSL 1AUKA 4C6AA 2W8LA 1N6QA 3O1LA 5E3PA 4YMEA 1GQEA 3HSJA 4DV7F 1YGYA 3DC2A 2CDQA 2O01C 3JYTA 1U7LA 1G6BA 3H20A 4QW9A 4P2MA 2MLYA 4X4NA 2DO0A 1Q7YT 4HACB 2HVZA 4ZLLA 4NE9C 1AA1B 5AXKA 4YHHF 4ZVTB 5ETOA 2GGPB 2AV5A 3FZ2A 5KOXA 1IBMF 4O23A 2P5VA 1O98A 2BV3A 3TA0A 5E3CA 3N5FA 2C3UA 5D4PA 2VG7A 4J9RA 2VQEJ 5D0RA 4RNHA 3GE9A 3K5NA 3W60A 3NXZA 2W7OA 1D9AA 2IVFB 4NLUA 4OLPA 2DGXA 2DHHA 3I9ZA 5F3ZA 4IOBA 2HHVA 4UOFA 3G9CA 2AF6A 3IRXB 4BC7A 1B3TA 1S48A 2WBMA 3IN5A 4Q0BB 1WG5A 4TLRA 3T41A 2IBOA 5KFWA 3U02A 3IS9B 2EXUA 3GYXB 8RUCA 3QQCD 1TL3A 1F9EB 3H2LA 1VBZA 4QWAA 4TYBA 4OX8A 1HR0J 3P45B 2HMIA 3HJFA 4MIBA 1IKWB 4NWBA 4F25A 2Z2YB 2N82B 4ZLNA 1LOUA 4OYWA 3NKRA 1NHKL 1XMOF 1WACA 1MLAA 1N5YB 2FJDB 3UW1A 1N88A 2CJAA 3AXMA 3IG1B 5HLFB 3PYEA 1YK9A 3M9NB 2QT7A 1RBLA 5K4PA 4RPFA 1RACB 5GAGU 5G0RB 3HLUA 1RAEB 2BJ1A 2IM3A 1EJJA 2NLWA 3CDWA 3M8WA 5DRKA 2J7WA 4ZHRA 4DN9A 4WK3A 3HJVA 2EFQA 4N47A 4ED4A 1BUXA 4UOHA 5I3UA 4DG1A 2C2ZB 1GX6A 3BN4A 4C8KA 3H7HB 3KK3A 1RTIB 2OFGX 3AXKA 2YNHB 3LOUA 3K0JA 2RDIA 3UPFA 4CH1A 3FEZA 2HKEA 5IQQA 4KJIA 4C0BA 2VQRA 3KLIB 3MM8B 1X8DA 1AYEA 1VR6A 3W9IA 1RK8A 2FD2A 5L1IA 2JJ4D 4OYMA 3Q8YA 3W7BA 3MUTP 4ZLJA 5AJ9A 1ZTWA 5ETNA 1TZ0A 4OX6A 1NK4A 4ZVQB 2GC8A 4ZOSA 2N3OA 2E7XA 2DRAA 1GMVA 3NCPA 3C2PA 2YKMB 2KYZA 4TVAB 4LR8A 2KT5A 1ELXA 3L9ZA 1Y4ZB 1NPRA 4WFNQ 4CT8A 5LSLA 2FJXA 1JLQB 1IBLJ 3MMAB 2GO8A 3J81U 2BXJA 1VBYA 2OGUA 1KFDA 2QA2A 2YWFA 1T8EA 2VPWB 1Y00A 1NDKA 4O3NA 3M6WA 1FA0A 2XULA 2LEBA 1QVGR 4DV0J 3G82A 4F8RA 2J0SD 5D6GA 1JLFB 2QZ8A 4DX6A 2MXYA 2RRNA 4GVBB 1UP1A 1YLXA 2LCWA 2DNGA 3DMJB 1FE4A 3R5BA 2EFNA 2JEIA 4X65F 1X9MA 1ZM2A 1VBXA 2RU9A 3GQCA 4FYDA 2IDEA 2XMKA 3CDAA 4LRCA 2CQPA 4CNZA 5IM0A 4N41A 3QPIA 2CQ1A 1RWMB 3NS5A 1HMVA 3EXCX 1UFLA 1D9FA 3QIPB 2FVPA 2ZVIA 4MT1A 1NPKA 2NYIA 4BWJA 2R7UA 4NLXA 3C6TB 2E7VA 1F5BA 1RYSA 4ALZA 4F26A 2GHVC 2PSZA 3R2DJ 5KAKA 3OXGA 4DV4F 1HWUA 1U2FA 4EBEA 1Q0NA 2R7OA 3LP2B 4WJBA 4JI4F 4PWDB 2DNQA 4JI8F 3MUVP 5KFOA 1TFWA 2HZCA 4FF1A 3QMQA 2HNYA 3DLEA 3PO5A 3KHRA 4W90B 3DOMA 1NK7A 4BC9A 1S9GB 3KLGA 4GC7A 2RIJA 2ZBPA 2GZOA 5LSOA 2XG8A 4LF6F 1MROA 2DGWA 3NKPA 1SIWB 4ZCMA 4DZDA 1HW9A 2JL9A 4YDDB 4XPCA 2YWEA 4KAIA 1Q16B 4FVMA 1K44A 3UO0A 2O1PA 5HBMA 2ZOFA 2V8GA 3BB5A 4UUWA 3MAQA 3B5QA 4ED8A 4YR2A 1B8JA 2GCFA 4RLEA 3BKFA 2A6MA 1U8WA 2NXEA 3GFHA 3D68A 1AJCA 3UDLA 2AMCB 3K5MA 3N9UC 5T7LB 2BANA 1KKHA 1REVB 4PCQA 2W1BA 1U1MA 1UWBB 3BPSP 3OBIA 2AGPA 3HXMA 5F9LA 4K4XA 2R7XA 3D6TB 2X1GA 2K3IA 1WNEA 5F8GA 2ZZNA 4CYRA 3MM9A 1R8CA 4FVCA 3DYAB 3GFZA 4UZCA 1S57A 1FJEB 4DPOA 2CNLB 3WAVA 1MNEA 1NO8A 4KIAA 4F0KA 3W2VA 1R8HA 1DARA 4Y3CA 3VHQA 2EC0A 2AT1B 4DL7A 4YOEA 4NRUA 3A12A 3QFHA 2XLKA 2HAIA 1S6QB 5FLXY 5KFLA 3PX0A 3LAMA 4I69A 3W1YC 2MY7A 5KT2A 2DEIA 1UVKA 4X64F 5F8LA 2OPSB 1ANJA 1X5TA 1RWPB 3P8BB 2D9OA 2PFDA 2W2OP 2RT3A 4KSEB 4RJVA 1NSKL 3LWLA 4A8SA 2CQ3A 4KM4A 1WTBA 3MEEA 3ZZTA 3KTQA 3F0NA 1E6VB 1AUDA 2DKOB 1VQSA 3RRGA 3CF5Q 2R9LA 1HNWF 1RXOB 2N7YA 4M5JA 2HURA 5MAOA 4G1PA 3SFUA 4WU3A 3CO0P 2XYHB 3HCXA 1FNXH 1M5KC 2F8HA 1R6YA 1WDDA 2XS7A 4WTOB 4J9VA 4G3IA 2FHJD 4B9NA 1SJQA 1RT6B 2VA3A 4ZCIA 2H5IB 2L08A 3EMTA 4C2MA 1WTFA 4W98A 2DH8A 4ILRA 1QE1B 3FBEA 3MAAA 2EKNA 1Z2ZA 3CC4S 2MLXA 4KHPJ 2B8PA 5KG1A 4P9SA 1S7HA 1U45A 3QGHA 1U6BA 1R8AA 1PKUA 4DR6F 3FRYA 1JLCA 2XY6A 4IH7A 2ZH1A 3ISND 1IWGA 2YNIA 2KVIA 4MYTA 1C1BA 3KG4A 2RHSB 1UW4A 2ZBIA 3IXQA 3CDBA 2GO9A 3GWCA 2ZC3A 3MM5A 1NSAA 3IFEA 5DDPC 1ED8A 2DPIA 1KQGB 1N34F 1VYAA 5B0DA 3CMES 2FC9A 5J1PA 1RGVA 1X7VA 4TQRA 3QATA 1SKWA 1WF2A 2B56A 3NMRA 2FJEB 5IXUA 2GMLA 1VQYA 5DQIA 1L3UA 1TUGB 3FBBA 3GV5B 4PG7A 1N4LA 1X4CA 1YRUA 4ES1A 5LMUF 1U49A 2WONB 5D0HA 4BCAA 1UEVA 2E1CA 2QYGA 5KFIA 4H54A 3BO3A 4NZ7A 4WFZA 3V6HA 1CG2A 4DL4A 1DAXA 4ED3A 3AJDA 3TX0A 5C66A 5IC4B 2J5AA 5GOVA 4WE1A 1YSJA 3OTOJ 3IC1A 4URGA 4LFBJ 3WBZA 3N0VA 4WKYA 3HSZA 4DV1F 1OYDA 2G0CA 3NAIA 1S99A 4DUTA 1E3CP 4MKAA 2DIVA 4QWBA 4R8UA 5KFUA 3K89A 1VHFA 2EKYA 2FZKB 3AY0A 3OSNA 4NOHA 3LALA 2MQ8A 4YB5A 1IVZA 4NI2B 1U6ZA 5JVHQ 2RQKA 4P7TA 1NK6A 1D8YA 2VG7B 3RB3A 3E2EA 2C22A 3EDRB 3U7JA 2NXCA 3PKYA 4ZN1A 3S8SA 2V9KA 2HRUA 2XO7A 3VCDA 5KFKA 5KFSA 1HI8A 1SCJB 4NL5A 3QIDA 2ZVSA 2QMUB 3WAYA 2I38A 1BQMB 3R7SB 3TNVA 4JYAF 2VONA 3VWSA 1B70B 1VFJA 4DQRA 3N01A 3OQ2A 1TL3B 1SPBP 3FCWA 1ZEBA 3LWMA 1ZAXA 5CXTA 2I0XA 4ZPWR 1T9VA 5B0BA 4J5OA 1SHQA 2OTLS 3A8IA 1G7CB 1WSRA 3H2VE 3K59A 5F8JA 1N5VA 1BMQB 4ECWA 3IBWA 3M9OB 3WQPA 3KD8A 5LRMA 1NHVA 1VK8A 4TKTA 2Y8WA 4RWWA 4AL5A 2HG4A 2AD9A 2FHMA 5L38A 4UQGA 3UCZP 3IWLA 3D28A 2ZDOA 1ZAVA 2X1FA 4MY4A 4RW7A 5I3UB 2ZEJA 3UN2A 2JEJA 1VRTA 4RBUA 4H4MA 4F2SA 1E6YA 3TOQA 2EFGA 2RMLA 2CPYA 1WWHA 1LWEB 3FRZA 4CNYA 3HHDA 2K7JA 3NGKA 5ETTA 1RUSA 5KTQA 3CMQA 5HJYA 2F1FA 1HHQA 5FLXU 3K8WA 4Y34A 3W2WA 5DLGA 1QLNA 4A8KA 3IBFB 2AJ4A 3ETOA 4ECRA 3DLHA 2KFNA 2WRMA 4I2PB 1R8PA 1P9QC 4B3OB 1RWKB 1H0HB 1VRUA 2MGZB 2AWZA 2BKOA 3IO1A 1R0BG 3T5JA 2VA2A 1NDCA 2F9JA 5CZVA 3KK1A 2UXBJ 1I51B 3GG1A 3W8GA 3TAQA 3FC9A 4BBYA 1RAAB 3PNIA 2FLPA 1TKDA 1C0UA 3BH7B 2DNNA 3D0HE 2E7WA 5L1LA 3G71S 1M5OC 4LR2A 3RR8A 2BZ2A 2UXCJ 2BDPA 4JI3F 3VR1A 2DHAA 4M1KA 4NRTA 1FVSA 5IT9U 2BRLA 4CO3A 2LMIA 2PN6A 1TK5A 1Y5LB 1K8AT 4QU6A 1TMMA 4DU7A 1RTJB 4CQ1A 1IR1A 1N5QA 5A8RB 3AH6A 3HHKA 5HVHA 3QGPA 4U8YA 3WC0A 5KOWA 1F9FA 4DJBA 2QL9B 2IUCB 5KG6A 2A1BA 5E5NA 5DLWA 3QSIA 1WI6A 3QT6A 5LMNJ 2QV6A 4C8MA 2Y3YA 5K14A 4AD6A 5C2CA 4JV5J 1S10A 1H73A 2WVFA 3ET6B 5GMEA 2AP6A 2QMXA 3RB6A 3QJJA 1FE0A 4X4QA 3LQVA 1Q8IA 2IRYA 2C42A 2GV1A 4F02A 3TP2A 1NZ8A 1HWKA 2HNYB 2MHNA 2XHCA 4X66J 5EGEA 3AD9C 3D0GE 1TL7A 4ICLA 4LF7F 2V5HG 3DOMB 4DSFA 1FXLA 3OL8A 2CXEA 3QYYA 3HHLA 1OQ3A 5HROA 1MROB 4P72A 4LBHA 4DUYF 1TKZA 3AOAA 3DRRB 2PC6A 1M0SA 3RW6A 3VQSA 3EJMA 1N33J 3MM6B 4J9SA 2X98A 2NR0A 3OR2A 5KFJA 4USHA 2W2PP 2HAFA 1S9EA 5KG5A 2YH1A 4LJMA 4P2XA 3DXSX 2DYAA 1BQNB 3MMBB 1Q7LB 2D1GA 2PI4A 2YWHA 2RNEA 3RW7A 5CABA 3NAHA 3BJYA 1HBNA 9RUBA 4HTJA 1YHQS 3A3NB 2BANB 4M5MA 3Q2TC 2GSNA 2GFFA 3IDDA 3SQGA 1KHVA 3KFWX 4F36A 2F4VJ 4OZNA 1P27B 2BM0A 4C8LA 4Q45A 4OYIA 1CJUA 1APSA 4IG3A 4LF4F 4KAYA 1YJ9S 4PG5A 3SV4A 2F40A 2Q79A 1VQ5S 2B3TB 4DV2F 1IBKF 4HKQA 4S0MA 4FXDA 2VPXB 1RT5B 4LR7A 4CO1A 2ZOGA 3HKZD 2CPEA 1DZ5A 2LQ5A 1FRIA 3BDGB 3TJAA 4HDHA 1GX5A 4QZVB 1U48A 1U0HA 4KYZA 3S7RA 5CD4H 1VK3A 1DJ0A 1HA1A 3GSDA 3CCUS 5D15A 1HQAA 2CZ4A 1WEXA 1LFPA 3MR6A 4YR3A 2CA9A 2YQ3A 4KB7A 2RS2A 2NPIA 4LUBA 4DR2F 4FXWA 2NS1B 3MEEB 3DM2A 2JX2A 3I31A 2J0XA 3C16A 1EW2A 3H90A 4FDFA 3HVRA 4USVA 2D3OR 3R27A 4LFAF 2ZKTA 4KAVA 2FVRA 1RAOA 4CLFA 3R2CJ 4WP9A 1Q8KA 4A8FA 4N8OA 2MEWA 5L46A 2ACMA 2ZM6J 4DPTA 4CRJA 1T9WA 4EBDA 1UVJA 4C3KA 5EGHA 5IC6B 2AYMA 1AB8A 3FK4A 1WF0A 4L75A 1ALIA 2KU7A 4DR5J 2DNRA 2J8SA 2XSFA 1RWNB 2VFVA 1ROFA 2GAGC 4RL1A 5EN1A 3UD3P 5KFPA 4H4OA 1HBOA 2KM8C 3UVJB 3V81A 2IYGA 4TNOA 1FNMA 2A18A 2M3DA 2RRAA 2KL8A 3R5CA 2ZH4A 2FLNA 1CULA 1NDLA 4OI4A 1SC6A 3B54A 3NNAA 3DI6B 2Q66A 3EM1A 4XPEA 2HHSA 5HMWA 2Y9HA 1FWLA 2OUGA 5LXYA 3MEDB 1JLCB 4O3OA 4O0IA 1KDNA 1J27A 1MW7A 2YNIB 5D4LA 1C1BB 4DFJA 4DUZF 2P6SA 3BF4A 1UKUA 3LAKA 5KFYA 5IJQA 1Q1KA 3PY8A 2DBBA 2AGQA 3IR6B 1X4DA 2W25A 4CO4A 4WP3A 3UD4P 2CKWA 4YFUA 3PJWA 3A4TA 4MTPA 2R8HA 2DXEA 5KFQA 4MK7A 4IFYA 3FCVA 3G8TA 4B3MJ 4RW4A 4O0NA 1LW0A 4WTYA 4MIAA 5DLFA 4H4KC 2CQDA 3FEXB 2H4YB 4KPCA 4YDXA 3OVBA 4LF1A 4U67Q 3EVWA 3M7VA 3D6FB 1F0XA 4GTYA 3I4HX 5CCLA 4ZP7A 3NS6A 4NEYA 4EU0A 3E3XA 4ZG7A 2U2FA 1HWIA 3J7A1 1CS4A 1KH4A 3EUNA 3G6XA 4TYAA 2R7SA 1T3NA 1C4AA 1FDAA 3OXFA 5M2PA 1IKXA 5IV4A 2J6SA 3TAPA 4ZP6A 2JWNA 1UWAA 2QA1A 3OHAA 2XC9A 2OMLA 5EX3A 1KH9A 4P6QA 4RNFA 4MKVA 2RF2A 1G3OA 4DLEA 3C6UB 3KKFA 2VFUA 2QIFA 4R8UB 3R9LA 3WIVA 3MEGB 3FVYA 2WW4A 3FDSA 2C2DA 2XMJA 2CQIA 4LIWA 2UZAA 4DHVA 3Q2SC 2XR9A 3G6ES 3M8PA 1SC1B 4HEA9 1TU0B 1ZTTA 1I5OB 3BGOP 1D8ZA 1FO1A 3KNAA 3CMRA 2ZH3A 1UETA 2BBEA 2J7UA 4DPXA 1N0UA 3NNHA 2U1AA 4ES3A 2Y1JA 3FJ2A 2JSXA 2ZBCA 2EEYA 2L9DA 2A2CA 3CGIA 1V5IB 3GFXA 3LH2S 1UFWA 3M1VB 1GXLA 1LQ9A 5C7PA 3D9BA 1TTHB 4P75A 2ALYB 5IV3A 1S9FA 2DXDA 4RWXA 4QYRA 3E01A 2V2ZA 1ZS6A 4MHXA 2GMHA 1TVRA 3N5BA 3EZ5A 1KHWA 2N4DA 2DR5A 5H9EJ 1U4BA 3OTCA 4O44A 4LR9A 4PYAA 3HVAA 4TXSA 3C66A 1U1KA 2K06A 1S59A 5IWAJ 1YRXA 4B3SJ 2LECA 5ETLA 3IM8A 2UU9J 1HNIB 4X4PA 1UTAA 2QX0A 1X0FA 1L3SA 1TFYA 3KG1A 2E1AA 1IJEB 2F8MA 4NLWA 1ELZA 4GVLA 1YJRA 4O3RA 3M2UA 1L3TA 1U6FA 3NMAA 1BD6A 4NCBA 1N2LA 4JV1A 3BGRA 3C46A 3Q8PB 5ITHA 1X0PA 5DM6Q 3BDFA 4H4MB 2R8GA 1E6YB 4NX9A 2PEHA 2L41A 4YY3J 2KKHA 4FYYB 2E5LJ 2DRBA 4DFPA 2JHEA 1KQKA 1YKWA 2VFSA 2HNDA 1XR6A 5IT0A 3JB9k 1YJUA 1V6HA 3G6VA 2MHEA 1Y7AA 3KMQA 1RCOB 2FGOA 4K4UA 4ZPTR 2HFOA 2EW9A 1U09A 3VAMA 5CYJA 2VPYB 4KKOB 3M4XA 2MKYA 2YX7A 2R8KA 3M8YA 1VRUB 2DR7A 2W7AA 3K8VA 3L7PA 5HP1A 1VRQC 1K73T 3KK1B 3GV7B 4KH1B 4MKBA 1EB0A 3KLHB 3HP6A 1PAEX 1KONA 3M32B 2KXFA 1U8SA 1SXLA 4HTIA 4ANCA 3L3CA 1UPPA 2VQFF 2ILYA 2FC8A 3D1QA 5EUHA 1EJ7L 2JZ5A 2IMOA 2VPZB 1IR0A 2HHHJ 2X3DA 4V19X 4OI0A 2VH7A 4F0HA 1R43A 4ED0A 2LDIA 2YY3A 2ADCA 2HGNA 2E66A 3C14A 4F67A 1Q8LA 5M2RA 4UTGA 1UVNA 3B4DA 4OHWA 1R7IA 4DS5A 2CG8A 2ANHA 3BKTA 3CJ3A 1DQ9A 1OJ4A 3ISNC 3LTOA 2OPQA 4ECXA 3JQKA 2ZH6A 2OI2A 3UR3C 1WHXA 3GIJA 2DNZA 4U7UK 1AZSB 1HHSA 2C3YA 1AROP 2QN6B 4C11A 2HS3A 3HD1A 5IJSA 2HFVA 2GIRA 3OHBA 2IA0A 4DS4A 2HVIA 3OV7A 3TQ1A 1RYRA 2X51A 5K14B 3KUGA 3R6GB 4B3RJ 2W9AA 3OSPA 1VQ7S 3KUHA 2MZTA 1KQFB 1Y7PA 4FPIA 1WKKA 4JI6J 4QWCA 4RR5A 1RHKB 2FVSA 4GRSA 1CSJA 3KLEB 2D41A 4F3MA 1CQNA 2APOA 1IKYB 1S1UA 1T05B 2V94A 5L8RC 3BSAA 3KLFB 1TL7B 1WEZA 4ICLB 4M5DB 2Z4PA 2EFPA 5A2QY 3HHLB 4J7CA 4QYZK 1KOOA 4IOAQ 2QSWA 2QE5A 5HROB 5H9FK 2KH9A 1BC6A 6FDRA 2ATCB 1TKZB 4M5KA 4ES2A 1DQ8A 4AFFA 4OMFG 2WVCA 3D7SB 3OR1A 3AJ2A 1FNOA 2IRUA 3V6KA 2ZUAA 3NL0A 4DL2A 5GMDA 1HPZA 4UPIA 1P1TA 2VKZG 2PD1A 1LWFB 5LSRA 2A0FB 1VC0A 5AJ3J 6AT1B 4K0KF 2HIQA 4LF9F 1MMDA 1Q79A 5KFFA 2XNRA 3KWMA 1HBNB 2LXUA 3QT5A 1YJNS 1U1RA 3MMJA 1TMJA 1HNZJ 4OYOA 3SQGB 1WSVA 2JVOA 4AT1B 1NK5A 3MDFA 2GSUA 2JH3A 1QVFR 1NK0A 3C3LA 2BQ3A 4R25A 2V63A 4IG3B 2V8VA 4DSJA 2F5GA 1PCAA 3G8QA 2K8GA 1OY8A 2HRYA 1TELA 1XR5A 1VC5A 4NYOA 2UUBJ 1CC8A 3R5JB 3TUJC 2UUWA 1NM2A 2DIUA 3MEKA 2XMVA 5HQLA 5E2QA 2FJBB 2HNZA 4PABA 3G86A 2DVIA 2EPIA 3PYFA 2XWYA 2YH0A 3BO2A 3Q24A 2ZDPA 1FI4A 1YQHA 3NG8A 3CDUA 3POTB 3DLLQ 2IRXA 1UW9A 3MOJB 2MSTA 2GA7A 2ZD1B 2XQCA 4JI5F 5F41A 1TKXA 3I87A 4L74A 4IH6A 2UUCF 2DGQA 4Z7CA 4Q0BA 3T1HJ 3LW5C 3CIMA 4FYWB 4DBQA 3VAIA 3TUZC 4I67A 5DGBA 2DB1A 4EYHB 3C16B 3BBBA 1T3OA 2YNGA 3NP5A 3BPDA 5DLVA 1QSSA 3T19A 4CLLA 2B9XA 2DNHA 1Y3JA 1VIOA 2PMHA 3RYLA 5A8KB 3K57A 4ZS6A 1F3VA 2DGSA 3NBPA 2CQ2A 1Z4UA 1UA0A 4RUAA 3HZEA 4FS2A 1S0VA 1U1NA 2B5JA 2F7VA 2IA6A 2JFDA 3JTNA 3IG1A 1N52B 5HLFA 1FXRA 3SSRA 1RBOB 1ZYQA 4H4OB 1HBOB 4DZ6A 1ELYA 3D6HB 2KJWA 1ZM3A 4Y2AA 2QLJB 3MCOA 3WIUA 2VUGA 3WC2A 2B51A 2ZHAA 1RAGB 3ZTSA 5F8HA 2HQFA 2BRKA 3FUYA 3VAJA 4I56A 2MJNA 3MAHA 3U1LA 3OJUA 2IFXA 3KLIA 3MM8A 1I94F 1MN7A 3PW0A 4ZP9A 4UT4A 1GEHA 1O51A 5L39A 1OY9A 2QA4S 1VI7A 1DBDA 3TEGA 3S1TA 2IC3B 5D0GA 4AL7A 3QNWB 1DTQA 5EWFA 2E1RA 4GMKA 4DWIA 2IM0A 2ZBRA 3WAWA 3CC2S 2YKMA 1PAUB 3JSYA 4Q5VA 3UDEA 4R0EA 4QWDA 3KJNB 2D3UA 2B43A 3OUYB 4RW8B 1JLQA 4ETZA 2IM2A 3IR7B 4RW4B 2FJVA 4JI7F 1JB0C 2P9CA 4L76A 1LW0B 3MMAA 4BHQA 4O3QA 1FDBA 3T1YF 3M6XA 1KN6A 4X4OA 2XI2A 4CO0A 1AJDA 1V9OA 2D3ZA 4OYBA 4G1QA 4KJDA 1CC7A 2FHKA 2MTLA 3FEYB 4B9SA 1MU2B 2E1MC 5ADZA 1XR7A 5E3RA 2PI5A 4PQUA 2LU2A 5AE3A 4YB1P 1VDHA 4GVBA 4KTQA 3PJXA 3ISZA 1K1QA 3MECA 2CZVC 3J80U 2ALZA 2LYVA 4JBCA 1XMQF 4FN5A 3TVKA 2MLZA 3H2UB 3FSIA 1WOPA 1RWWB 2JFKA 2V8DA 1FERA 3TEHB 2IIHA 2R7WA 3DOKA 2VB6A 4FBTA 4RBVA 1JJ2R 2XGQA 2Z57B 3CIZA 3KJVB 3P6YC 3P4UB 3NNCA 1VOMA 3M8PB 4NLGA 1GNKA 3W5YA 4KY3A 4HH1A 1YWXA 3LP2A 2V0NA 1GTEA 2BE7D 4YP3A 4WK1A 1IWAA 4Y00A 2H65B 5K8NA 4F4AA 3OLBA 1ZH5A 5AXMA 5A2QU 4NLSA 4YB6A 2NUHA 3JSMB 2ZH7A 1AXQA 1CJKA 1UA1A 1U02A 4XIUA 2FJAB 4OYZA 1CPZA 2JC1A 2CPXA 2OEMA 2UV8G 1ZOTA 2HLUA 3V6DA 3VVUA 3DDNA 4L73A 1RJJA 4O4GA 4FP9A 1H2VZ 2GS8A 2XMUA 1S1XA 5E3QA 4GKJJ 3HX9A 2ZC4A 1UZDA 3JS9A 1MG7A 4WFYA 3H5UA 1FFGB 4DV7J 2WBRA 4J90A 4CYSA 3M8QA 2DGUA 1EHWA 2W8KA 4QR1A 5ETVA 5T7LA 1REVA 3DLGB 3KNGA 3GP9A 1RWVB 1UCNA 1ZPVA 1Y0HA 4YHHJ 1UWBA 2Y0SD 4IYQA 2W4CA 2LQJA 2DGTA 5F0WA 2M5YA 3LUYA 2WVBA 3VAKA 1KVKA 2IYIA 1JJHA 2D1CA 1IBMJ 1SUQB 1B99A 1RAJA 1VGYA 1O99A 3KJFB 1TL1A 3DYAA 1IQZA 3BQ0A 1PBUA 5JUMA 3T02A 3Q8RB 3W62A 3M30A 1YJ7A 2CQ4A 2OIHA 1X60A 2NUUG 3BQ1A 1S6QA 1ZZNA 1Q5YA 2H48B 5EDWA 4ECYA 3EPGA 1JKHA 2MQNA 5KFXA 2OPSA 3Q8QB 2DHSA 2B9YA 1FKPA 1XNRF 5L9XA 2I2YA 5HP1B 1ZPWX 4KGXB 3RZAA 2MQLA 2C2NA 2GSOA 3CCWA 3V4IA 4K5RA 1J2VA 2VOOA 1HNXF 1E6VA 3EVMA 2IFYA 3CW2C 3OT9A 4LMZA 4WYWA 5HMXA 1RT3A 1XMOJ 2WW8A 4CO2A 1K1SA 2ZHBA 3A3PB 3GR1A 2YWKA 5D77A 2I6WA 4NLPA 2BABA 2I1RA 3HHNB 2V2VA 4OZ3A 1RKIA 3C14B 2HZAA 1TQLA 4ZG6A 2E1PA 1KLNA 1B0PA 3CCMS 2DEJA 3WDOA 5DG7A 2OPQB 4LQYA 5KT3A 4JI2F 3DHWC 1VQMS 1G1XA 3OL7A 2HFZA 1VBKA 3O44A 2BX6A 3HULA 3I0SB 3B6BA 3SQOP 3LA0A 4GKKF 4LF2A 4MMOA 1HWJA 2K2PA 4FNHA 3I55S 1NNDA 2XMWA 4C11B 3BQ2A 4DV6F 1QTNB 3LANA 4DL5A 4ZVHA 2WK4A 3Q3QA 3AB4B 2FB0A 2CVEA 1TP7A 2MYFA 3QO9A 4G65A 2AW0A 2ASJA 1TUWA 4RNOA 4PEOA 2A10A 2FLLA 3KHGA 4B08A 2JC0A 4LF5F 1WC3A 3Q8SB 3GB0A 3A3OB 4DV3F 4NLDA 2BOPA 1OS5A 1B4SA 3I5CA 2F8EX 3AOBA 3BR9A 3HSGA 1EQMA 2VKRA 4D3HA 3EX7B 1K0TA 2PIIA 2Z58B 3DRSB 4AYBD 4M94A 3DLJA 1URRA 5DDRC 1Q82T 4NLRA 5BYSA 4ZJLA 1NHUA 2B6AA 3ZO7A 5IZHA 3M6VA 4DL3A 4P2SA 3T9NA 3HO1A 2AEFA 1BLUA 4B56A 4J91A 3OR1B 2J7KA 4C3LA 1JLGB 4UF4A 1L3KA 4CXKA 1EP4B 3F41A 3PZPA 3PJ9A 3HVTB 3HM9A 4WKRA 2MZ1A 3AODA 2XSJA 2DR9A 9ATCB 1N36F 3HSDA 4ZDNA 3HT0A 3NGSA 1TV6B 1NUEA 4PQAA 2J9CA 2EBEA 3WAXA 2JVRA 3G4SS 1JNZB 4X65J 3P49B 3K5PA 4PAAA 2H5JB 4U96A 1X4AA 4FYVB 3QRRA 1ZM9A 2B4OA 4DEZA 4PPDA 4IR9A 1HQUA 2QJ3A 1XNQF 3PKMA 3G87A 1OYEA 4PXBA 5GADI 1KH7A 3QWPA 4IH5A 1XIQA 4KFBB 1M1HA 1UMJA 2MDAA 4OYXA 4DV4J 2ERRA 2AJ1A 5BXIA 5HN0A 4JI4J 3TJ8A 4JI8J 3MD1A 1M5PC 2HNZB 3G96A 2KG1A 1P6TA 3KLVA 4NI2A 4AL6A 2DHGA 1VQOS 1PJ6A 4B17A 3O5TB 2CQBA 1UPMB 3ZZRA 3GSIA 3CD0A 2OHDA 5B0GA 4PR6A 2MZRA 3N6NA 1NJXA 4B3TF 4LF6J 3THTA 2MQPA 1HKAA 1S72S 4QW8A 1TKXB 1KH5A 2VV5A 4EI2A 1BQMA 4USMA 3W61A 4ID5B 2EFOA 1Y5NB 2D9PA 2YNGB 4FF4A 2HW3A 2IJRA 1Z1ZA 3G8SA 2V4QA 2HEKA 4C7QA 1HI0P 1N32F 3UE2A 2M4MA 1SC4B 4BDPA 3NBPB 1RWUA 1L3VA 1KP6A 3PIPQ 2P8IA 4N5SA 2M88A 5MLCV 3SSSA 3MCNA 3TAMA 3IWNC 2B5JB 2BJ9A 4QAXA 4LFCF 2IY5B 1F1BB 2OELA 1PC4A 5HL7Q 5KFNA 4K4VA 5GMKa 1OPIA 1Y11A 3ILOA 2KTQA 2CIMA 1GXUA 3K7RA 2PE8A 1AW0A 1FX4A 2DNMA 1B7YB 2JNJA 4LIRA 3T5KA 4CLPA 3BH6B 4FXVA 3OW2R 3R7NB 1ZETA 4PXCA 1VQKS 4ATNA 1LWEA 2OEJA 5GAEU 2HFSA 5KFTA 1FF2A 1Q8BA 4X64J 4N56A 4NLQA 4PXEA 2LP4A 3RBXA 3CD7A 1PGZA 5D78A 2KZMA 4B9LA 3JAMY 1OQ6A 3ADAC 3MR2A 5L9NA 2RQ4A 2FZGB 3D4JA 1DTQB 1T95A 5DQGA 3LO3A 3BDHA 4LRBA 3ENVA 4I2PA 1RDRA 4A8YA 3W9HA 2Y0BB 4CCHA 4Y2KA 4B3OA 1J5OB 4NXNF 2MGZA 1RT7B 1RP5A 1DURA 2MB0B 1HNWJ 5A8WA 2M2BA 2M70A 3R1LA 3C15A 4ZVEA 4ELTA 3K5LA 2NSCA 4ERDA 2LDYA 1S79A 2ZBQA 3UI3A 4ZPDA 1VQ4S 3EGNA 4MK9A 1R0AB 4G1QB 2MKHA 2DGVA 4LSZB 5C42B 5F3TA 4DPUA 1V3RA 1F6TA 1RTJA 4PQUB 2GJ2A 1PIEA 4M8LA 4WFXA 2ATLA 5C25B 1HYSB 5A8RA 4R5PA 2QSFA 1VQ9S 2IHR1 4CH7A 2HGLA 3MECB 2GQQA 5KFCA 4PZVA 4J37A 2IUCA 2ZHOA 2GMJA 3D66A 4DR6J 4Y28C 2Y1LB 3AB2B 1L5UA 3BREA 3DOKB 2M52A 3R6LB 1URBA 2ZJQQ 3GR0A 3ET6A 3SMZA 4MH8A 4U9RA 4D3GA 4KHMA 4ZKAA 3CPWR 5KG0A 2K3KA 1R31A 3IGNA 1WORA 3D3CJ 2NXNA 1NMEB 2B4PA 1N34J 1HQ2A 3ENWA 3T6JA 4BWMA 1RBAA 5L0BA 1NJWA 3GIIA 4CLUA 1CJKB 3WBHA 4WXOA 1QJHA 1UZHA 4CIOA 5CCMA 5HK4A 1SHNA 2NXJA 3DRRA 4WYLA 2CPIA 4K2XA 3TI0A 4OI6A 5A0YB 4ED7A 5LMUJ 2KT3A 3V6DB 4K4YA 1E1ZP 3MM6A 2HFNA 1ZBTA 4RZRA 2F63A 4TY8A 4FF2A 2HSEB 4O4GB 2GJIA 2DNLA 1XQIA 4ECVA 1NU4A 1HNVA 1S1XB 5KFHA 2MKKA 2ZH5A 4PXDA 2DR6A 2C3OA 3UN3A 3BZQA 3MCSA 2BKPA 1LWCB 2XTJP 1NK9A 1BQNA 3MMBA 4J9LA 4AQYF 3IMQJ 4L3KA 4CTAA 3M8QB 3R5GA 3FMWA 5GRRA 2MKIA 4A8MP 1I6JA 4J9MA 2FIUA 4DV1J 2JLGA 2CRLA 3K58A 4EWTA 1NEEA 2RDJA 5LL6d 4KGVB 3EVOA 4YN3B 2YX4A 2CPDA 1RAFB 3I32A 3IGVA 3OVAA 1TL1B 1MSWD 1N54B 4G1IA 4ZGAA 2ASDA 2G2YA 2D69A 2DO4A 1RZMA 3JTOA 3M30B 2C1EB 4WF9Q 4EGLA 2D7SA 3W5XA 1RT5A 2N4CA 3HHLD 5IOLA 1E2SP 4DV5F 2P2CB 5KFRA 1T9YA 5HQ8A 4DR7F 3RRKA 4WIIA 3BDGA 4GC6A 2IJNA 1KR4A 1DY3A 5K8PA 4RO0A 2GLQA 1JKHB 3ELHA 1H38A 3QJLA 1KQSR 4JYAJ 1RE1B 1RKJA 2R7VA 2M8DB 1FKPB 4QPXA 1T02A 3LP0A 3MPDA 2I8EA 4DQSA 3MR3A 1I1GA 2NXUA 5DLTA 4DPWA 4IRKA 5BJRA 3NVLA 3V4IB 1UVMA 2E5HA 4V19J 4ED2A 3CTRA 3H5YA 1HJKA 4USUA 1RT3B 2IBKA 2XO6A 5KFBA 1ZA1B 3D54A 4HT5A 2UXDF 2VG5A 3ITHB 1FJGF 1NDPA 4E8UA 2H9ZA 5KXAA 3ZTOA 5IT9Y 2GQ2A 1HIYA 2R42A 1S1VA 1X4BA 1W7WA 2W2NP 1B0TA 2B7CB 3F73A 5DDOC 4UOGA 2ZNZA 3O3LA 1VQPS 1EQJA 4QCLA 4ZN3A 3W65A 2ZOMA 2ASYA 2HLTA 3UVJA 5FDLB 2KO1A 3PX4A 3DOLB 2BW7A 3UNYA 4FF3A 1FEHA 2G13A 3BV8A 1SKUB 3DRXA 5IQ6A 4L72B 5BYRA 3GIRA 2YX1A 2CWXA 4ZIVA 2GHPA 4OZ5A 3DI6A 3QO9B 3GG0A 2D3O1 3CCRS 3BSOA 3RBEA 2COLA 4DCJB 4X62F 4OQJA 4IRCA 3NKNA 4J9KA 3VGSA
chains in the Genus database with same CATH topology
3SZZA 5TJ3A 4LQYA 1HJKA 3T01A 5EGHA 3NKMA 1P49A 5L0KA 4B56A 5INHA 2XRGA 3B5QA 2RH6A 4CXKA 3TG0A 1ELZA 1B8JA 4N7TA 1EI6A 1ALIA 1ED9A 2XR9A 4LR8A 1KHJA 3NKRA 4LR7A 2W5QA 3WAYA 4MIVA 1ELXA 3T00A 5DLVA 1HDHA 1EW9A 4KM4A 1URAA 1Y6VA 2W5SA 3MK0A 2W5VA 1AJCA 2W5TA 1ZEDA 4UOOA 1N2KA 4NWXA 1N2LA 3BDGB 4UORA 5K4PA 4UPLA 3TX0A 2X98A 3CMRA 1O98A 3SZYA 2GSUA 5C66A 5L0BA 3NKOA 4CXSA 1AJAA 1EJJA 2W5WA 3NKQA 4ZGAA 1ZEBA 3BDFA 3DPCA 5KXAA 4KAYA 5GOVA 3M8WA 1EW8A 2W5XA 3WAXA 1SHQA 1KHNA 1KHKA 3LXQA 3WBHA 1ALKA 3WAWA 2IUCB 3Q3QA 1KHLA 1ZEFA 1KH5A 1SHNA 4LRAA 1HQAA 2G9YA 4CYSA 5L0EA 3M7VA 4GTXA 4LRFA 1ALHA 5DLWA 1E2SP 4GTYA 2W8SA 2GSOA 4UPKA 4TN0A 2D1GA 4CYRA 4FDJA 2ANHA 3KD8A 4NWJA 1E3CP 1E33P 1EQJA 3A52A 3BDGA 5LRMA 4GTZA 4ZG7A 1E1ZP 2IFYA 4UPHA 3OT9A 1AJBA 4YR1A 4MHXA 1KH4A 1ALJA 5LIAA 3WAVA 3ED4A 1Y7AA 5LRNA 1ED8A 2GA3A 2GLQA 4KJGA 3UNYA 3NKPA 2QZUA 2IUCA 2GSNA 3UN5A 2W5RA 1ANIA 1EW2A 4UOPA 3BDHA 4LRBA 1KH7A 2VQRA 1ELYA 5HRTA 3MK1A 4GTWA 3MK2A 3UN3A 4LRDA 4UPIA 5LQQA 3IDDA 4LR9A 1O99A 5IJSA 4ZG9A 1AUKA 4MY4A 2ZKTA 1AJDA 4FDIA 4KAVA 4LREA 1KH9A 5IJQA 3UN2A 4CXUA 4LR2A 4ZG6A 3M8YA 4QAXA 5GRRA 3DYCA 1FSUA 3TWZA 1URBA 2W8DA 5AJ9A 1K7HA 5EGEA 4KJDA 3T02A 3M8ZA 5DLTA 3UO0A 3IGYB 3NVLA 3NKNA 1ANJA 3IGZB 4LRCA 3E2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SZZ A;  5TJ3 A;  4LQY A;  1HJK A;  3T01 A;  5EGH A;  3NKM A;  1P49 A;  5L0K A;  4B56 A;  5INH A;  2XRG A;  3B5Q A;  2RH6 A;  4CXK A;  3TG0 A;  1ELZ A;  1B8J A;  4N7T A;  1EI6 A;  1ALI A;  1ED9 A;  2XR9 A;  4LR8 A;  1KHJ A;  3NKR A;  4LR7 A;  2W5Q A;  3WAY A;  4MIV A;  1ELX A;  3T00 A;  5DLV A;  1HDH A;  1EW9 A;  4KM4 A;  1URA A;  1Y6V A;  2W5S A;  3MK0 A;  2W5V A;  1AJC A;  2W5T A;  1ZED A;  4UOO A;  1N2K A;  4NWX A;  1N2L A;  3BDG B;  4UOR A;  5K4P A;  4UPL A;  3TX0 A;  2X98 A;  3CMR A;  1O98 A;  3SZY A;  2GSU A;  5C66 A;  5L0B A;  3NKO A;  4CXS A;  1AJA A;  1EJJ A;  2W5W A;  3NKQ A;  4ZGA A;  1ZEB A;  3BDF A;  3DPC A;  5KXA A;  4KAY A;  5GOV A;  3M8W A;  1EW8 A;  2W5X A;  3WAX A;  1SHQ A;  1KHN A;  1KHK A;  3LXQ A;  3WBH A;  1ALK A;  3WAW A;  2IUC B;  3Q3Q A;  1KHL A;  1ZEF A;  1KH5 A;  1SHN A;  4LRA A;  1HQA A;  2G9Y A;  4CYS A;  5L0E A;  3M7V A;  4GTX A;  4LRF A;  1ALH A;  5DLW A;  1E2S P;  4GTY A;  2W8S A;  2GSO A;  4UPK A;  4TN0 A;  2D1G A;  4CYR A;  4FDJ A;  2ANH A;  3KD8 A;  4NWJ A;  1E3C P;  1E33 P;  1EQJ A;  3A52 A;  3BDG A;  5LRM A;  4GTZ A;  4ZG7 A;  1E1Z P;  2IFY A;  4UPH A;  3OT9 A;  1AJB A;  4YR1 A;  4MHX A;  1KH4 A;  1ALJ A;  5LIA A;  3WAV A;  3ED4 A;  1Y7A A;  5LRN A;  1ED8 A;  2GA3 A;  2GLQ A;  4KJG A;  3UNY A;  3NKP A;  2QZU A;  2IUC A;  2GSN A;  3UN5 A;  2W5R A;  1ANI A;  1EW2 A;  4UOP A;  3BDH A;  4LRB A;  1KH7 A;  2VQR A;  1ELY A;  5HRT A;  3MK1 A;  4GTW A;  3MK2 A;  3UN3 A;  4LRD A;  4UPI A;  5LQQ A;  3IDD A;  4LR9 A;  1O99 A;  5IJS A;  4ZG9 A;  1AUK A;  4MY4 A;  2ZKT A;  1AJD A;  4FDI A;  4KAV A;  4LRE A;  1KH9 A;  5IJQ A;  3UN2 A;  4CXU A;  4LR2 A;  4ZG6 A;  3M8Y A;  4QAX A;  5GRR A;  3DYC A;  1FSU A;  3TWZ A;  1URB A;  2W8D A;  5AJ9 A;  1K7H A;  5EGE A;  4KJD A;  3T02 A;  3M8Z A;  5DLT A;  3UO0 A;  3IGY B;  3NVL A;  3NKN A;  1ANJ A;  3IGZ B;  4LRC A;  3E2D A; 
#chains in the Genus database with same CATH topology
 3JAM U;  5KFM A;  3MED A;  4KGM A;  5HAT A;  1M5V C;  3LP1 B;  3QJP A;  2ADB A;  2VJV A;  2YPY A;  3GU0 A;  2LU1 A;  5FD1 A;  1IM6 A;  5HAN A;  2X7I A;  4NYZ A;  4FKY A;  4QIV A;  1FRH A;  2B6A B;  4E98 A;  4DF4 A;  3TZW A;  2HQC A;  3VAF A;  1CJV A;  4K8R A;  2W9B B;  4WCE Q;  4JI3 J;  1V3Z A;  2FPH X;  4ZMM A;  4F4W A;  1E33 P;  1WKJ A;  2YPZ A;  4NCG B;  3AA9 A;  1YBA A;  1UAW A;  2RHQ B;  2WSC C;  3A8J A;  3BSC A;  2VG6 B;  2XSJ B;  1T94 A;  5LJ5 Y;  2EI5 A;  5DG8 A;  4DR1 F;  2QZU A;  1IKV B;  3PM9 A;  3WX8 A;  2GIQ A;  4C8Z A;  3E8O A;  1VQL S;  4C8O A;  2LA6 A;  2UVV A;  2ZJP Q;  1JXL A;  4RW9 B;  1MML A;  2RRB A;  1JIH A;  5IT4 A;  1NCL A;  1TAQ A;  1P49 A;  5K8M A;  3KMS A;  1HQU B;  3T3F A;  4RBT A;  2DY1 A;  1M5H A;  4KC5 A;  4I64 A;  2KRB A;  2W7P A;  4PWW A;  2Z2M A;  2R4F A;  1NK8 A;  1RHM B;  3SFG A;  3R8Y A;  3GLJ A;  3TX8 A;  2LEA A;  1WJ9 A;  4U95 A;  4M5L A;  4PG6 A;  3C6U A;  1RAH B;  3MEG A;  4A47 A;  2DT9 A;  1WHV A;  1VCT A;  4MYU A;  1F5C A;  4DMZ A;  5BR8 F;  1OSD A;  2R8I A;  4LF7 J;  4OHV A;  3MMC B;  1YX2 A;  4YR1 A;  4PRF A;  1R6V A;  4DUY J;  1RCX B;  1JLA B;  2ZE2 A;  3PRB A;  3PV8 A;  4KJG A;  2BR0 A;  4NMX A;  3GYN A;  5HRT A;  3M1V A;  1W2I A;  4JI1 F;  2UUA F;  1PIL A;  1O5J A;  1HW8 A;  1HLW A;  5E7O B;  3AQP A;  4KO0 B;  4C0H A;  3AT1 B;  1TK0 A;  3IGY B;  3J7Z T;  3J7Y U;  3X3U A;  4HI2 A;  3PVX A;  4K4S A;  1F60 B;  1FTR A;  1YTY A;  3FMB A;  1FES A;  4C8Y A;  4MIV A;  1YG0 A;  3V5R A;  2K1R B;  3D67 A;  4ZIT A;  5C2G A;  3R5D A;  4ZPB A;  2CJY B;  1HNI A;  3A8K A;  3TAM B;  2HHQ A;  2BEF A;  1XJW B;  5E33 A;  3I96 A;  3BN7 A;  1Q95 G;  1U2R A;  2RS8 A;  2GVD A;  3DN9 A;  4LRA A;  1J5E F;  4NXM F;  3LGH A;  1DHM A;  2QRR A;  5D4O A;  1NKB A;  4UPK A;  4LF4 J;  1Y9O A;  4Y2C A;  4DU8 A;  4WWS A;  3HZG A;  3PW5 A;  1X4F A;  2Z30 B;  5DDQ C;  4DV2 J;  1IBK J;  1SJ3 P;  1RI7 A;  1CVJ A;  1WOS A;  4OV6 A;  4KQZ A;  2AEJ A;  2GA3 A;  3S6E A;  4DCO B;  3QGI A;  5KT6 A;  2DTJ A;  1QTM A;  5DET A;  4BLG A;  1UEU A;  2E9T A;  4X4U A;  3QT8 A;  3GJT B;  5D3G B;  5KT5 A;  4NML A;  4EMD A;  3ILL A;  4P74 A;  2B9E A;  2BE2 A;  2E5I A;  3E2D A;  2CPJ A;  2DHX A;  3QRQ A;  3OJS A;  4DXL A;  3RBZ A;  4DR2 J;  1HQE B;  3CED A;  4K59 A;  3CC7 S;  4KKO A;  5DJB A;  4TU9 A;  1YZ6 A;  1U2C A;  2DCU B;  2FDN A;  4Q8E A;  1S4E A;  4URQ U;  2C2R A;  5SZT A;  1S0M A;  3EIC A;  4LFA J;  1H3D A;  3I6P A;  5A8W B;  2V34 A;  2KHD A;  4DX8 H;  3KLH A;  1S0N A;  3M32 A;  2LKZ A;  1TAU A;  2CQH A;  1U24 A;  3C15 B;  2W8S A;  1RTH A;  2E44 A;  2XMA A;  2VIC A;  3CSK A;  2IVY A;  3MI7 X;  3PW4 A;  3SEO A;  3SCJ E;  4OX9 F;  2HVH A;  3DRP A;  1PYT A;  3UN5 A;  1EX8 A;  4OHX A;  3HVW A;  1F3F A;  4G6V B;  5CYQ B;  4DFM A;  4AND A;  3EGW B;  3I56 S;  3EPI A;  2WOM A;  2V8H A;  2VU5 A;  3M8S A;  3CT9 A;  3MUR P;  1H2T Z;  2QC3 A;  2QL5 B;  4R5P B;  1IM4 A;  5I42 A;  3A8E A;  4RUC A;  2BQR A;  1AZS A;  4F4Y A;  1H7X A;  1FD8 A;  1N0V C;  3DHX A;  3SYZ A;  1Y6V A;  1LW2 A;  2AZ1 A;  2HGM A;  2DRD A;  3PR4 A;  5JJB A;  2WHO A;  4RKU C;  1D3W A;  2RDD A;  2W5W A;  4DUZ J;  5B08 A;  1KHN A;  4PUO B;  3U27 A;  2HFU A;  1GMW D;  3MPW A;  3I82 A;  1IR2 A;  2QLX A;  3BEG B;  2A3J A;  2XLI A;  4HHJ A;  3ZZU A;  3KLE A;  1FJC A;  1S6O A;  1ICE B;  3K2Y A;  1IKY A;  4F50 A;  1T05 A;  4TU8 A;  2NZ4 A;  4DQP A;  4HYK A;  3KLF A;  4M95 A;  2ABY A;  3QZ7 A;  5AE2 A;  4M5D A;  2MZJ A;  2QLW A;  4P52 A;  2RQM A;  2HHU A;  4P71 A;  3TO8 A;  1SL1 A;  4WPA A;  1YI2 S;  2B4U A;  1F2G A;  1S5Z A;  3WX4 A;  4CT9 A;  1RT2 B;  4TY8 B;  4HVZ A;  5BYQ A;  4DR3 F;  3J7Z 5;  1Z2L A;  1HNV B;  5H1S V;  2W5Q A;  1WKL A;  1X4G A;  1LWF A;  2OEK A;  2BUN A;  3E51 A;  2EK1 A;  2VDH A;  1HHT P;  4N8N A;  3EE3 A;  4CDI A;  4JV0 A;  4CTA B;  4UY8 5;  1M1G A;  4NLO A;  2V6A A;  1WC4 A;  3GTY X;  4LSL A;  2FY1 A;  4C4W A;  3JQM A;  5AXL A;  4Q8F A;  2DNO A;  2B4V A;  2KFZ A;  4Y2I A;  1T7P A;  5GAG I;  2HS0 A;  1IJF B;  2VOD A;  4I7F B;  2CG4 A;  3VZI A;  1KS2 A;  3FQL A;  3DKD A;  2R7R A;  5B0F A;  3G2X A;  3CJS A;  3I0R B;  3AD8 C;  4QU7 A;  1EAR A;  2VBY A;  3Q8U A;  2AYE A;  2OD4 A;  2RJZ A;  5KFA A;  2IAJ B;  3QRP A;  2OSR A;  2AYB A;  1XTZ A;  2YTC A;  2R3V A;  1LK5 A;  3RRH A;  1QAJ A;  4LRE A;  2CNN B;  1ULR A;  5GAE I;  1KLM B;  4DSI A;  3IGZ B;  4E2F B;  5HO4 A;  4EUV A;  3POT A;  3KOA A;  3SZ2 A;  4X4T A;  4OL8 A;  2HK2 A;  4C98 A;  1OY6 A;  2G1H A;  5KFZ A;  4ETX A;  3TW0 A;  3J81 j;  1EKR A;  2DPJ A;  2ACY A;  3A1Y G;  2ZD1 A;  4O4R A;  4LF8 F;  3Q89 A;  3LP0 B;  3SZY A;  2OPR B;  3NKO A;  4B9M A;  3DPC A;  1WC0 A;  3LXQ A;  2ZNY A;  2FHO B;  1S76 D;  1SL0 A;  2H54 B;  5A8K A;  3GJR B;  3B8H A;  1H7W A;  3I9V 9;  4DSL A;  2VG5 B;  3B82 A;  2CDR B;  3ZXW A;  3ULH A;  2Z8Q A;  4ECS A;  1RHQ B;  1KTQ A;  3SV3 A;  3WHI A;  2PO4 A;  4UOP A;  2YWW A;  3PG9 A;  4ILM A;  4JB8 B;  5J2M A;  1VQ8 S;  1S1V B;  4GO7 X;  1HL6 A;  4RU2 A;  3TYT A;  2W01 A;  3IP0 A;  2DNP A;  3R3T A;  5D8H B;  4JI0 F;  4NAS A;  3JTP A;  4UOC A;  2FJW A;  4DR4 F;  4DSE A;  3PXG a;  2QLF B;  2C2K B;  1PBA A;  1PO6 A;  1FRM A;  4UOR A;  3N28 A;  3PDN A;  3KXD A;  4OJ3 A;  4EFA C;  2FTR A;  4J9Q A;  3CXC R;  4CYU B;  2O67 A;  4HDG A;  3UQS A;  3M9M B;  2X1A A;  1JNR B;  4F3Q A;  4EK2 A;  2HYI B;  2BKN A;  2IC3 A;  3M6U A;  3V4M A;  4AE5 A;  5DG9 A;  4WBF A;  3Q83 A;  4ZCL A;  2V4J B;  2CAJ A;  3H42 A;  4X4S A;  1N8R T;  2W5R A;  4KT0 C;  2VQF J;  1HBU B;  1FFW B;  4K7Q A;  2VQE F;  1CJV B;  3GIK A;  2ROP A;  1DLO B;  1VC6 A;  3WZ0 A;  5D0E A;  2FVC A;  3HD2 A;  3OUY A;  4RW8 A;  4JUZ A;  2EFV A;  1K7H A;  2PMW A;  1KVJ A;  1XEZ A;  2OJ3 A;  1RLC L;  2NCK L;  3GPA A;  3FBF A;  1C1C A;  3CJ5 A;  3HPO A;  5J2P A;  4RX6 A;  4QYZ J;  3BR8 A;  3THV A;  5H9F J;  1YBT A;  5F8I A;  3MWB A;  1SIZ A;  3KJQ B;  2WAQ D;  1MU2 A;  2GQC A;  4ITS A;  3Q22 A;  5J1E B;  4MFB A;  5SUH A;  3KG0 A;  1UFK A;  4O3P A;  1SV5 B;  3GV8 B;  4JP8 A;  3CJK A;  2CVI A;  1JQG A;  4USI A;  1HR0 F;  3BSN A;  1GXT A;  3QLH B;  1T11 A;  1FFS B;  2PA8 D;  4DX7 A;  4J9P A;  3SI8 A;  3P3D A;  2RH3 A;  4ZPA A;  1S4F A;  5DZ7 A;  2FUG 9;  3NCR A;  1AJB A;  4DX5 A;  4YQW A;  1D09 B;  1NZA A;  2I9S A;  5AXN A;  2GX8 A;  3L7O A;  4A8Q A;  1WHY A;  2PGC A;  3ZTQ A;  4KV8 B;  3DGV A;  5C24 B;  3OL6 A;  3KJV A;  4FDI A;  5CYM B;  3MR5 A;  4ER8 A;  1A6L A;  3BGU A;  3FZB A;  3S01 A;  1FSU A;  2G1D A;  1Y10 A;  3HFZ B;  3T5L A;  4OHY A;  1WD6 A;  5J2N B;  4QWE A;  2Z2L A;  4L3N A;  2LEP A;  1CQM A;  2Z56 B;  5INH A;  2XBP A;  2LFV A;  2ZE2 B;  2WSE C;  5KFG A;  1RSC A;  1SI9 A;  5K20 B;  2KVQ E;  1LKZ A;  3ZZP A;  1URA A;  3GZ7 A;  3CJT A;  8AT1 B;  3JSM A;  3VQT A;  3PCO B;  2W5T A;  2AGO A;  4LVN P;  2IM1 A;  3NGD A;  4F04 B;  1EET B;  5D4N A;  3LPE A;  1T9X A;  3C8Y A;  4K0K J;  2H1Y A;  4LF9 J;  2OD6 A;  4LSN A;  1UJ6 A;  1UJ5 A;  1GT8 A;  4KE5 A;  4IKA A;  3SBM A;  3VTI A;  1S1W B;  1BXN A;  2ILZ A;  4HT7 A;  1ZAW A;  4QJV A;  1OIA A;  4C8N A;  3HHL C;  1GK8 A;  4LRD A;  3HHE A;  4NCA A;  1CBK A;  2GVD B;  1RB0 A;  4AXI A;  1IBL F;  1XK8 A;  2LQB A;  3DLG A;  2OKQ A;  3CCJ S;  1HD1 A;  1RT4 A;  2R8J A;  1FRJ A;  1HBM A;  2OLW A;  3ZTP A;  1RHU B;  1T03 B;  4WZQ A;  2ZJR Q;  4DV0 F;  1S77 D;  1SUQ A;  3RB0 A;  1X4E A;  4NA1 A;  4IO9 Q;  5G4D A;  1H2U X;  1S12 A;  4UOO A;  1M5S A;  2YKN A;  1GTH A;  1FK9 B;  2HHW A;  4IG0 B;  2BE2 B;  2QTW A;  2K7K A;  1JLE B;  5L0E A;  3TZY A;  4JI5 J;  4P7V A;  2UUC J;  4Q2M A;  2V68 A;  4DL6 A;  4I6A A;  4QIG A;  3D2W A;  2XS5 A;  2JOQ A;  1R27 B;  2J9D E;  3NGU A;  2FLO A;  3T1A A;  1PYO B;  2EK6 A;  1RA6 A;  3FQK A;  4OZL A;  3AQO A;  1GMW A;  2F9D A;  4DFK A;  1MMN A;  2IMW P;  5HVG A;  2MQM A;  3CMA S;  2P6T A;  3CE8 A;  3DU6 A;  1RLD A;  3ZZ0 A;  5F9N A;  3CCQ S;  1URN A;  1RTH B;  2W4D A;  1XMB A;  2AQ4 A;  3BDP A;  1XER A;  4IQM A;  2MZQ A;  2DNY A;  2AIR B;  3DRP B;  4QIW D;  4UW2 A;  4CWB A;  1EI6 A;  2PEB A;  3F56 A;  4Q44 A;  1EW9 A;  2Q6C A;  2HQI A;  4M5N A;  3ZZZ A;  2MY8 A;  4EZ9 A;  4W4M A;  3NKQ A;  2WOM B;  2OP5 A;  3SSQ A;  1KHK A;  3QAE A;  1AT1 B;  3BBC A;  5I42 B;  2OTJ S;  3RGI A;  2EC2 A;  1PJ7 A;  3I0S A;  1FKO B;  2BA9 A;  5CH7 B;  2ASL A;  4IUF A;  1N6Q B;  1PG5 B;  3J80 Y;  5KG4 A;  4QBU A;  3PX6 A;  2RIL A;  1I94 J;  3GIM A;  2NSB A;  4ECU A;  3BDE A;  4OZ2 A;  1LW2 B;  4P2F A;  3JYT B;  4XDC A;  1N56 A;  1GAO A;  1X9W A;  2MZS A;  2NQP A;  1SVD A;  3EGZ A;  4NA2 A;  3UDC A;  2J8A A;  3FSY A;  1SH2 A;  1SC3 B;  2MJU A;  3I5A A;  1VIS A;  3MPU B;  5ETP A;  8ATC B;  3DRS A;  2G0J A;  1A7G E;  4I6W A;  3W9J A;  4IO1 A;  3MCM A;  1NH7 A;  3PRD A;  7FD1 A;  1SKR A;  4JI7 J;  2RUG A;  3DCA A;  4B9V A;  2BYC A;  2A6O A;  2BJ7 A;  3T1Y J;  4Y0F A;  1VJQ A;  4OYP A;  4OYA A;  4XTT A;  2SXL A;  1EW8 A;  5KT4 A;  2J9D A;  1JLG A;  2CJK A;  1EP4 A;  2IPO B;  1JJ4 A;  1DFD A;  2GIF A;  3FNN A;  3HVT A;  1RIS A;  3J7Y I;  3TZZ A;  3GFY A;  2UVR A;  2YBV A;  3BGL A;  2VBZ A;  3NGR A;  3MF5 A;  3D1O A;  1NLK L;  1TV6 A;  4I2Q A;  5LIA A;  2HMI B;  2CJX B;  1X9S A;  4C0O C;  2HS4 A;  6FD1 A;  4LSL B;  3L4B C;  2GJF A;  4LQ3 A;  3CCL S;  3HF5 A;  1XMQ J;  4A8O A;  3EZU A;  3M05 A;  2G2O A;  2WVE A;  7FDR A;  1BE4 A;  2OSQ A;  1QM9 A;  4Q7A A;  1K0V A;  2OPP A;  4ID8 A;  1TKT A;  2AHO B;  2YKO A;  3M2V A;  4ZHR B;  1FRK A;  1U1P A;  3SCI E;  3CJ2 A;  4KFB A;  1QD1 A;  2J9E A;  3CD5 A;  2VC1 A;  4DG1 B;  3OPK A;  1FEE A;  3MK0 A;  3KK3 B;  1U47 A;  2O5D A;  5CD4 A;  1NXI A;  4UQT A;  5LOQ A;  2XCA A;  2VIH A;  2JEF A;  3QSY B;  3PTW A;  2G9Y A;  2MKJ A;  4JV2 A;  4B02 A;  4LRF A;  3W64 A;  3MFI A;  3MGJ A;  2FVQ A;  4HR2 A;  3H5X A;  2AX0 A;  3L7U A;  3H4B A;  1RTD A;  3R5A A;  2YXL A;  2UVU A;  5IS2 A;  4KHP F;  1XBW A;  2AKW B;  3CCS S;  1W2B R;  3UFC X;  4H4K A;  1V3S A;  1RAB B;  1YBU A;  1WI8 A;  4ZP8 A;  3PEJ A;  5K8O A;  1RTZ A;  1FDN A;  3MTK A;  4Y2M A;  4ID5 A;  3U1M A;  5F8M A;  3W5Z A;  2CWK A;  3PR5 B;  4RNM A;  3CCV S;  2CQG A;  3TWZ A;  4WFB Q;  3M8Z A;  2ZWP A;  2AEM A;  2MKS A;  4IFV A;  3SZZ A;  3ZZY A;  1FTC A;  4JOU A;  2QEX S;  4OI1 A;  1NH8 A;  4ZCK A;  2XGP A;  2WTF A;  1UVL A;  2KB2 A;  2PFF B;  1ED9 A;  5LJ3 Y;  2RQC A;  3H8Y A;  2L48 A;  2YNF A;  2BJ3 A;  5J2M B;  2KJV A;  2RU3 A;  2Q6B A;  5FJ4 A;  2GW8 A;  1Y5I B;  4U7C A;  2QFI A;  2G2Z A;  3G82 B;  2XYP B;  3RBD A;  2QLB B;  3MHY A;  4YB7 A;  3JSB A;  1W25 A;  1ALK A;  2BJD A;  3KYL A;  5T14 A;  4J9O A;  2JRS A;  1R89 A;  2KYX A;  2H51 B;  5T41 A;  5HMZ A;  1KOH A;  4V1A k;  4A48 A;  1JLB A;  2LXF A;  5FII A;  1QAY A;  4QR2 A;  3MUM P;  3PRV A;  3W3S A;  2R7T A;  3CJ0 A;  5IM0 B;  1KSP A;  1YZ7 A;  5KFV A;  4GTW A;  3AAW B;  1HMV B;  3BYR A;  4ZVP B;  1VLY A;  3EDQ B;  2ZZM A;  4KBI A;  2J0W A;  5HI7 A;  3OTO F;  3HMJ G;  4M63 A;  1XNR J;  4LFB F;  3VGU A;  1TUV A;  4IRD A;  4OX7 A;  1UEK A;  2YVS A;  3TJ9 A;  3TG0 A;  2B0G A;  4EO8 A;  1HNX J;  1OPZ A;  1YIT S;  1J5O A;  3QZ8 A;  5CZX A;  1H98 A;  3IAS 9;  4LT6 A;  1RT7 A;  2QG9 B;  4OZ1 A;  3DLE B;  3CB4 A;  2ZH2 A;  1LNQ A;  2GVZ A;  4ANE A;  3KLG B;  4RUH A;  4YS2 A;  3AHP A;  5GAH U;  3PFE A;  3P96 A;  3DFE A;  3PHE A;  1C1C B;  2YQ0 A;  1VQN S;  5EGY A;  3BBF A;  1NKC A;  3MPY A;  5J2P B;  3T5H A;  4NEZ A;  1FVQ A;  4CLK A;  1SJ4 P;  2I5J A;  3VZH A;  2HK3 A;  4KHR A;  4JI2 J;  4QPT A;  3MFH A;  1R0A A;  1S97 A;  3CD6 S;  3CJ4 A;  3IBC B;  5HBM B;  1P1L A;  2YKA A;  5C42 A;  3TZX A;  4MFB B;  4GKK J;  2VHG A;  1S0O A;  3N4W A;  4DV6 J;  1C2P A;  5LQQ A;  3RJM B;  3CJK B;  2WB1 D;  2XLJ A;  4N77 A;  5C25 A;  1HYS A;  5J2Q A;  4J9U E;  3JXO A;  3J7A N;  3W63 A;  1IUJ A;  2P9E A;  3CJ8 A;  5HSP A;  2W4P A;  2MPU A;  2LLZ A;  4IDK A;  5ETS A;  1XC9 A;  1FXD A;  3Q8V A;  2VD3 A;  2LXI A;  2XMM A;  2M7S A;  1DRZ A;  2XY7 A;  1Y3K A;  4LF5 J;  4CLT A;  2V69 A;  4DV3 J;  4XDD A;  1WEY A;  4AXJ A;  3NGT A;  2FHJ A;  1U25 A;  4HLB A;  3MM9 B;  3V2U C;  4UPL A;  5HQM A;  1UJ4 A;  2AJ0 A;  4Y65 A;  2J6T A;  1WEL A;  4MJK A;  4ZPV R;  4CXS A;  4ED5 A;  4Z7Y A;  2ROG A;  3DDK A;  1LV5 A;  1FJ7 A;  3W2V B;  4TU7 A;  1I3O B;  1BGX T;  1FD2 A;  5CHC B;  1C4C A;  5I3Q A;  2DNK A;  3N6L A;  4GTX A;  4DL0 C;  1JX4 A;  3F44 A;  2ZZT A;  1NJZ A;  3CWJ A;  4B9T A;  2Q43 A;  2X1B A;  4X4V A;  3CCE S;  1WOO A;  4I4B A;  4A46 A;  4PYD A;  2VOP A;  4Q43 A;  3PEH A;  2V2Q A;  1FT8 A;  1SBR A;  1N36 J;  1U1Q A;  4LBP A;  5A0Y A;  1WF1 A;  4DCP B;  5LXR A;  3BO4 A;  2FZC B;  4LSN B;  3DYC A;  2XI3 A;  1NJY A;  3DLB A;  4RUB A;  2DCL A;  3HDS A;  3T6B A;  3QT7 A;  5DM7 Q;  4PWU A;  3NKM A;  3RAM A;  2XRG A;  4P10 A;  1LWC A;  3R1H A;  2UXB F;  1QAX A;  4Z37 A;  1XNQ J;  4WZM A;  3D3B J;  2F65 A;  2QL7 B;  4XO0 A;  3H59 A;  1OO0 B;  1YDL A;  2RB7 A;  2XM3 A;  1Q5V A;  1AFJ A;  2HZV A;  1JWW A;  2QGF B;  4FPR A;  1GH8 A;  1UVI A;  3VF0 B;  3DNC A;  4ZVR B;  3EZO A;  1RT4 B;  4M5H A;  2UXC F;  1DTT A;  4PG8 A;  1U1L A;  3D1H A;  1OMS A;  2YKQ A;  1HBM B;  4MAK A;  1NPP A;  4WU2 A;  4ELV A;  4C3M A;  2ZWO A;  3KK2 A;  2JLF A;  4GTZ A;  4OV1 A;  2W2Q P;  2H3E B;  2YKN B;  4OLO A;  4B3T J;  3MAA B;  4CO5 A;  3MR7 A;  1QAI A;  5ETR A;  2QO3 A;  2Y1R I;  1N5S A;  2C2O B;  3L95 X;  2BJE A;  3VAG A;  1WG4 A;  2NYH A;  3PAC A;  4M5I A;  2J76 E;  1LFW A;  2VDI A;  3ZC4 A;  2VF3 A;  3PYG A;  4ENO A;  2M8H A;  4A8X A;  5LMN F;  3H25 A;  4JV5 F;  3R97 A;  2HBQ B;  2XYG B;  3O6Q A;  3HKW A;  1N32 J;  4NWX A;  5K5M A;  4F0M A;  3DDI A;  2H5E A;  3MM5 B;  2J6U A;  3VGV A;  4FNI A;  1WDT A;  5E3A A;  2Q1L A;  3LPY A;  4X66 F;  1A0O B;  3OXL A;  2BOA A;  4LFC J;  1KVI A;  1R0C B;  1X31 C;  3ITH A;  4DF8 A;  2POK A;  3NRB A;  4ECZ A;  2YQ1 A;  2BVZ A;  2KN4 A;  1W26 A;  2G4B A;  1LWX A;  2R7Q A;  1N33 F;  1QDU B;  4OHZ A;  3NY0 A;  4I0W A;  3MK2 A;  2WB4 A;  3NLC A;  5THW A;  3KHH A;  2KI2 A;  2GAH C;  1LEO A;  4FS1 A;  2KXN B;  1D9D A;  1SJR A;  2C3M A;  4CI0 B;  4FBU A;  3G6Y A;  3ENQ A;  5FDL A;  2UP1 A;  3HFV A;  3DOL A;  2VC0 A;  4WE1 B;  4EO6 A;  1WC5 A;  4FYX B;  2M9K A;  2L9N A;  2FGC A;  2JDJ A;  4GO5 X;  2PT0 A;  3EWG A;  4ZVG A;  2CPH A;  4EEY A;  3CUN A;  4F7V A;  1JK9 B;  2AJQ A;  4HHU A;  4ECT A;  2HIY A;  4C9D A;  2M0G B;  1SJF A;  4HH0 A;  3QWU A;  2CUY A;  4NA3 A;  3P5T L;  2W5X A;  2F4V F;  4NXN J;  4R0J A;  2CJB A;  3LP1 A;  5I3P A;  2UVW A;  7AT1 B;  3TAR A;  3RB4 A;  1X5S A;  5JXS A;  1T9U A;  1WC1 A;  1CJT A;  1ALJ A;  2MMY A;  1R8B A;  2HBZ B;  5GVQ A;  3RG6 A;  3MM7 A;  1Q53 A;  1RWX B;  5EHH A;  4PKD B;  2UV8 A;  3GON A;  2W9B A;  4QOT A;  3CVK A;  1EQ0 A;  1B0V A;  3X1L B;  4NCG A;  3U1N A;  3Q86 A;  5AT1 B;  2OAU A;  4DQI A;  4LQ9 A;  3W66 A;  2VG6 A;  4C97 A;  4CLZ A;  5TJ3 A;  2XCP A;  3RUB L;  2XB2 D;  1IKV A;  4WIQ A;  2KM8 B;  2B7B B;  4I2Q B;  3RTV A;  3B4M A;  2IJF A;  4UUX A;  4LVO P;  1NSP A;  1MN9 A;  4I68 A;  2DY9 A;  4A8W A;  2CQC A;  1M1K T;  1D1U A;  4RW9 A;  1C0T A;  4OZJ A;  1KTV A;  2V67 A;  2OH2 A;  2RAQ A;  3GJQ B;  3TA2 A;  2N3L A;  1YJV A;  1P8G A;  5B0C A;  4CZC A;  1N48 A;  4NLT A;  1S6P A;  4RW6 A;  5HAO A;  2OPP B;  1TKT B;  2PMZ D;  1RQ0 A;  2ZM6 F;  3M2V B;  4Y6I A;  5GAD U;  2W2M P;  4TQS A;  5ETK A;  4RW7 B;  1XWL A;  1RT1 A;  5E0O A;  4W92 B;  3ZNJ 1;  1VRT B;  4L6V 3;  4DR5 F;  3SDE A;  2IDL A;  3NOG A;  3FFI A;  3NWG A;  1KWM A;  1KEK A;  1JMT A;  2HBY B;  1RU2 A;  1A9N B;  4ZG9 A;  4F4K A;  5RUB A;  4DDF A;  3MMC A;  1YVF A;  2C28 A;  4CLY A;  4X4R A;  4ZPC A;  1RTD B;  3W8P A;  1JLA A;  5DO2 A;  2MSS A;  4KH0 B;  3W2W B;  2HQ3 A;  4OJ1 A;  1SL2 A;  2ROE A;  4X84 A;  3JSR A;  2W9C A;  2HHX A;  1U0S A;  5M2U A;  1BWV A;  1FRL A;  2W5S A;  1VIX A;  5CQG A;  2BJ8 A;  4KO0 A;  3MOZ A;  5B7W A;  3Q0A A;  5AE1 A;  2ZIT A;  4NLY A;  4AQY J;  3H5S A;  4ED6 A;  4DOZ A;  3DXB A;  1B64 A;  2O66 A;  1Q78 A;  4IFV B;  5HMY A;  2CNO B;  2FQQ B;  4B9U A;  4QIF A;  3UWT A;  1QSY A;  2MQQ A;  1C0U B;  3OFF A;  2DD8 S;  1FHT A;  2K1R A;  3DLK A;  1FDD A;  3MZI A;  1FWP A;  1KBR A;  2YNF B;  1ELO A;  5U47 A;  1EZZ B;  1S7I A;  1GFW B;  4B3M F;  4OFZ A;  2XNQ A;  2YWG A;  3RAX A;  1NB2 A;  4IQX A;  5KT7 A;  4ZIW A;  1XN9 A;  2HHP A;  4KPY A;  2C3P A;  1HAR A;  3QFW A;  2RSQ A;  5LRN A;  2DIT A;  4WXW A;  1YJW S;  1JLB B;  4DV5 J;  1VLO A;  3AA8 A;  4DR7 J;  1NRK A;  3AFG A;  1S1T A;  2QMW A;  5LM7 E;  1SH0 A;  3T00 A;  5D3G A;  1HDH A;  3QAU A;  4CM0 A;  2HWH A;  1ZED A;  4Q2L A;  3OL9 A;  3EYZ A;  2G0I A;  3GCW P;  3M2R A;  1SQG A;  1KC8 T;  2GNK A;  2RKI A;  4U7U D;  5F0U A;  2XZT B;  5A6W A;  1HQE A;  3TQE A;  3ONQ A;  2WCX A;  5IFM A;  3MD3 A;  2JEG A;  4K5S A;  4U8V A;  2GVZ B;  3BYP A;  5L1K A;  2UXD J;  2UUT A;  1FJG J;  3DGP A;  2R2S A;  2ZH9 A;  1FCA A;  1FRX A;  2D74 B;  4OIX A;  4HL9 A;  1KNZ A;  1YIJ S;  1NSQ A;  1VS3 A;  2PDA A;  2AZ3 A;  1Q86 T;  1JXE A;  2F3J A;  2I5J B;  2E9R X;  4UST A;  4YR0 A;  3CJQ A;  3OR2 B;  3OD2 A;  5B0E A;  1LXN A;  3TUI C;  5E41 A;  1S9E B;  5CYQ A;  1RHR B;  3UCG A;  4F3O A;  4MK8 A;  2AX1 A;  4KGZ B;  5DQH A;  3VV2 B;  5KFD A;  5J2Q B;  3TVY A;  4RU9 A;  1OSC A;  5EWE A;  1O6X A;  5A76 A;  2HQG A;  3TVZ A;  1NB7 A;  4USW A;  5IWA F;  1Q4R A;  4FZV A;  4B3S F;  3H40 A;  2UU9 F;  4IDK B;  4OZ0 A;  4I6Y A;  4X2B A;  4USJ C;  4X62 J;  1KD1 T;  2KT2 A;  5KFE A;  1SQF A;  3HI9 A;  2CZ9 A;  3AJ1 A;  1N5T A;  5L1J A;  1CJU B;  3IRW P;  2KXH A;  3M8R A;  4HAC A;  4PUO A;  3Q23 A;  4ZJO A;  3T9Z A;  2R2R A;  2VL1 A;  1EKS A;  4ZA1 A;  1H72 C;  2GGP A;  3N79 A;  4DI6 A;  2VBW A;  1X4H A;  4Z2X A;  4YY3 F;  2E5L F;  2XHW A;  2NRE A;  1U0H B;  1MWQ A;  5DS7 A;  1SKS A;  3D0I E;  1MWY A;  1OWX A;  5H9E K;  2RE1 A;  1QSL A;  1WC6 A;  3LGN A;  1NJI T;  1G2E A;  2F4F A;  4KR0 B;  1HD0 A;  3UCU P;  3LF0 A;  2R2T A;  3IRX A;  4ED1 A;  3CDE A;  4DR1 J;  1H74 A;  1TR0 A;  3OTB A;  2HRT A;  3CJR A;  1QUP A;  4CH0 S;  2NZC A;  5B0A A;  2KZZ A;  1RT2 A;  2OFH X;  4CP5 A;  2AJF E;  1M90 T;  3DM2 B;  3IS9 A;  2CFX A;  4CLS A;  2XS2 A;  3FKB A;  2BE9 B;  3NKY A;  4K4Z A;  2N7C A;  2ZFH A;  4K2J A;  4IOC Q;  4TN0 A;  4FDJ A;  2L9W A;  2Z0G A;  1IQT A;  4M5G A;  4C48 A;  2OO4 A;  2BM1 A;  1IKW A;  4QQB A;  1QUV A;  3OVS A;  3O8W A;  2B8Q A;  2G9O A;  1N5Y A;  2HVE A;  1NKE A;  2HHH F;  5EWG A;  3SCL E;  3PO4 A;  1DTT B;  4I7F A;  2LQ9 A;  5G0R A;  3D6M B;  4CXU A;  2BAC A;  2LQ8 A;  2W8D A;  4P73 A;  3H4D A;  4ELU A;  5HVF A;  5BR8 J;  3I0R A;  3GJS B;  1ITP A;  3KK2 B;  2WVD A;  3D5M A;  3UD5 A;  5EX0 A;  3V81 B;  1LXJ A;  2IAJ A;  4TY9 A;  4HI1 A;  2VAS A;  3VVT A;  3NEK A;  4ECQ A;  2DIS A;  1RTI A;  2HPU A;  1CUL B;  2YNH A;  5CAA A;  1U26 A;  4BS2 A;  2JLE A;  4ZVS B;  1KLM A;  5KG2 A;  1SJ1 A;  2CJ9 A;  1D0E A;  3VAL A;  4JI1 J;  2EVZ A;  4KRW A;  4K4T A;  2E5J A;  3GMG A;  2UUA J;  4A4J A;  4ZVF A;  4RNN A;  2WZ1 A;  5DZ6 A;  2AYG A;  2R2U A;  2NPF A;  4OJH A;  1TL5 A;  4OJG A;  4URS A;  4B3R F;  1RWO B;  2OPR A;  3HFK A;  1HWL A;  1ZM4 A;  4NZ6 A;  4ZLP A;  3IR5 B;  3HT3 A;  2ZUG A;  4JI6 F;  4KGK A;  4E0D A;  3IA0 A;  1CEZ A;  3PFO A;  3AD7 C;  3IWX A;  3RU0 A;  1BWE A;  4IFY B;  5GAH I;  3BS9 A;  5K9F A;  2J0Q D;  1BY9 A;  3OLA A;  3C19 A;  1JXV A;  2LA4 A;  2VFR A;  3THP A;  4QIE A;  1J5E J;  3US5 A;  4NXM J;  1TK8 A;  2MQO A;  3PIO Q;  3T01 A;  5L0K A;  1LK7 A;  2EWH A;  3I5B A;  3QBC A;  4NYP A;  1FWK A;  3P5B P;  4OI2 A;  1KHJ A;  2KHC A;  3ETM A;  3SIP B;  2B9W A;  2XEX A;  1K9M T;  2RVJ A;  1EAY C;  3IM9 A;  3K5O A;  2Q3P A;  1JLF A;  2RD5 C;  1CS4 B;  2IVM A;  3MPV A;  1P9Y A;  3RR7 A;  2XZW A;  5AJ3 F;  4UZB A;  1IKX B;  1PYS B;  3TR5 A;  1WHW A;  3DMJ A;  4J9N A;  2KDO A;  3CCT A;  1ALH A;  1U1O A;  3NS7 B;  1RAI B;  2RF2 B;  4MKY A;  3CUL A;  2C2E A;  1SH3 A;  1EIY B;  3OTD A;  3ED4 A;  1T9T A;  3QIP A;  1HNZ F;  3SXL A;  4CYU A;  1ZA2 B;  1ANI A;  4DPY A;  1RA7 A;  3C6T A;  5LT5 A;  3OTE A;  2XY5 A;  3BKU A;  1HFE L;  2DR8 A;  4DN0 A;  4F4Z A;  5JVG Q;  1YRT A;  1F9H A;  2VFT A;  1WUU A;  2V8P A;  2UUB F;  1ZZF A;  4PWD A;  1SB6 A;  2KRR A;  2KFY A;  5ETQ A;  3N6M A;  2V4J A;  2V4R A;  2LVW A;  1CJT B;  3DU5 A;  2VZ9 A;  3ILJ A;  4YEA A;  1HBU A;  2YKP A;  2AJ2 A;  4N7T A;  2HBR B;  3MM7 B;  4OX9 J;  3L09 A;  1S9G A;  1RU1 A;  1G4C A;  1DLO A;  2W5V A;  1DQA A;  4F2R A;  4ZVO B;  2EG1 A;  3AOC A;  3KHL A;  4FKX A;  2VBX A;  4K4W A;  1K47 A;  3E01 B;  2CNK B;  5C5J A;  3GIL A;  2CPF A;  1TVR B;  2W24 A;  3ZZO A;  1UL3 A;  3FGV A;  1ZEF A;  3H0P A;  2BW2 A;  1VHI A;  3QGG A;  1V5V A;  3TRG A;  4O44 B;  3T1H F;  5B09 A;  1GMU A;  2ZH8 A;  3VAH A;  5KG7 A;  1VMB A;  5J1E A;  1C0T B;  2HQD A;  2WSF C;  4O3S A;  4CLW A;  4K50 A;  2V50 A;  1SV5 A;  1IBC B;  3TA1 A;  2OMO A;  1CLF A;  4YUD A;  1S6P B;  4RW6 B;  3I4P A;  1VQ6 S;  1BQX A;  1REG X;  4NPO A;  3QLH A;  1PJ5 A;  2EG2 A;  3M2U B;  2FYX A;  4U6P A;  3PW2 A;  3BGR B;  3OFG A;  2RUS A;  2X3G A;  1RT1 B;  3KDO A;  3R7B B;  2QYC A;  1X5O A;  1TL4 A;  3SDE B;  2XZD B;  1KFS A;  3FFI B;  4EYI B;  1T0T V;  4N76 A;  5A6P A;  5J1N A;  4KV8 A;  5C24 A;  3GYG A;  5CYM A;  3ICL A;  2P9G A;  1Q81 T;  2HND B;  4XAK A;  3NWR A;  1PSD A;  3FSX A;  1FKA F;  3PYD A;  1RAD B;  2PA3 A;  1B7F A;  5J2N A;  3TUP A;  2AU0 A;  4DLG A;  4EBC A;  2QFJ A;  2DH9 A;  1S49 A;  4NZ0 A;  3KDN A;  2O3D A;  3UDV A;  3UR0 A;  1KHL A;  2E9Z A;  5KG3 A;  4HHH A;  1KRP A;  3ZNU A;  2W9C B;  4ZK7 M;  4NWJ A;  4DR3 J;  4WFA Q;  4UPH A;  3SCK E;  1F5A A;  4IR1 A;  1IXK A;  3ZFV A;  1EET A;  1YJT A;  2HWT A;  1PC5 A;  3CO9 A;  5JMN A;  3IAM 9;  4F4X A;  1SQE A;  3NOC A;  3V6J A;  1S6U A;  1X5P A;  4ZVU B;  5HJX A;  4MIW A;  1S1W A;  4LBI A;  4UY8 T;  3DLK B;  5DGA A;  3J81 Y;  2Y8Y A;  3KUE A;  4NLV A;  4DQQ A;  2XMT A;  3H98 A;  2XWX A;  3CCZ A;  3ILI A;  3HK2 A;  1O8B A;  2BQU A;  3VGT A;  1N2K A;  4QR0 A;  2HHT A;  1AFI A;  2V9W A;  1RT6 A;  3O2I A;  2DXF A;  3LGM A;  3BGF A;  1T03 A;  2ZKU A;  3FBC A;  3PHT A;  2DH7 A;  1MWZ A;  1NAQ A;  2Y1I A;  5ETM A;  3MXH P;  4DSK A;  3OFH A;  2EBG A;  1S1T B;  1R3N A;  3BM7 A;  1QE1 A;  1FK9 A;  4IG0 A;  2DK2 A;  1NBE B;  3B78 A;  5F8N A;  2CAD A;  1F2H A;  1JLE A;  3M2R B;  4LF8 J;  1FX2 A;  3ZTR A;  2CPZ A;  3PW7 A;  2H4W B;  2RKI B;  2L3M A;  5I4M A;  1RHJ B;  3MTJ A;  1ACM B;  3EXY A;  4WP8 A;  1VJW A;  1S1U B;  3TAN A;  2E29 A;  3OFE A;  2GHW A;  2QA4 G;  1BHN A;  2E5G A;  3RAQ A;  2RH6 A;  1H6K X;  3GCX P;  3DGP B;  1JJC B;  5CA5 A;  3EGV A;  4CM2 A;  4I1T A;  4TN2 A;  2CYY A;  4OI3 A;  2VJU A;  4USK A;  1O0P A;  2C2M B;  1AJA A;  2KG0 A;  1QY7 A;  3JQJ A;  3A13 A;  4EZ6 A;  2BMB A;  2CQ0 A;  1HPZ B;  4XK8 C;  1HI1 A;  3FCH A;  3UNG C;  4ILL A;  1WG1 A;  2A2D A;  3CNQ P;  4JI0 J;  2DJW A;  4AUK A;  3A52 A;  4DR4 J;  1IN0 A;  2Z2Z A;  4ZJQ A;  4PG4 A;  2WON A;  4TLQ A;  3ENA A;  2FY8 A;  4PPZ A;  2HWI A;  2MKC A;  3NCQ A;  3MK1 A;  4GKJ F;  2DGO A;  3K17 A;  2HVD A;  2V2K A;  3DRY A;  2CJQ A;  1FKO A;  1AUS L;  1AUK A;  4C6A A;  2W8L A;  1N6Q A;  3O1L A;  5E3P A;  4YME A;  1GQE A;  3HSJ A;  4DV7 F;  1YGY A;  3DC2 A;  2CDQ A;  2O01 C;  3JYT A;  1U7L A;  1G6B A;  3H20 A;  4QW9 A;  4P2M A;  2MLY A;  4X4N A;  2DO0 A;  1Q7Y T;  4HAC B;  2HVZ A;  4ZLL A;  4NE9 C;  1AA1 B;  5AXK A;  4YHH F;  4ZVT B;  5ETO A;  2GGP B;  2AV5 A;  3FZ2 A;  5KOX A;  1IBM F;  4O23 A;  2P5V A;  1O98 A;  2BV3 A;  3TA0 A;  5E3C A;  3N5F A;  2C3U A;  5D4P A;  2VG7 A;  4J9R A;  2VQE J;  5D0R A;  4RNH A;  3GE9 A;  3K5N A;  3W60 A;  3NXZ A;  2W7O A;  1D9A A;  2IVF B;  4NLU A;  4OLP A;  2DGX A;  2DHH A;  3I9Z A;  5F3Z A;  4IOB A;  2HHV A;  4UOF A;  3G9C A;  2AF6 A;  3IRX B;  4BC7 A;  1B3T A;  1S48 A;  2WBM A;  3IN5 A;  4Q0B B;  1WG5 A;  4TLR A;  3T41 A;  2IBO A;  5KFW A;  3U02 A;  3IS9 B;  2EXU A;  3GYX B;  8RUC A;  3QQC D;  1TL3 A;  1F9E B;  3H2L A;  1VBZ A;  4QWA A;  4TYB A;  4OX8 A;  1HR0 J;  3P45 B;  2HMI A;  3HJF A;  4MIB A;  1IKW B;  4NWB A;  4F25 A;  2Z2Y B;  2N82 B;  4ZLN A;  1LOU A;  4OYW A;  3NKR A;  1NHK L;  1XMO F;  1WAC A;  1MLA A;  1N5Y B;  2FJD B;  3UW1 A;  1N88 A;  2CJA A;  3AXM A;  3IG1 B;  5HLF B;  3PYE A;  1YK9 A;  3M9N B;  2QT7 A;  1RBL A;  5K4P A;  4RPF A;  1RAC B;  5GAG U;  5G0R B;  3HLU A;  1RAE B;  2BJ1 A;  2IM3 A;  1EJJ A;  2NLW A;  3CDW A;  3M8W A;  5DRK A;  2J7W A;  4ZHR A;  4DN9 A;  4WK3 A;  3HJV A;  2EFQ A;  4N47 A;  4ED4 A;  1BUX A;  4UOH A;  5I3U A;  4DG1 A;  2C2Z B;  1GX6 A;  3BN4 A;  4C8K A;  3H7H B;  3KK3 A;  1RTI B;  2OFG X;  3AXK A;  2YNH B;  3LOU A;  3K0J A;  2RDI A;  3UPF A;  4CH1 A;  3FEZ A;  2HKE A;  5IQQ A;  4KJI A;  4C0B A;  2VQR A;  3KLI B;  3MM8 B;  1X8D A;  1AYE A;  1VR6 A;  3W9I A;  1RK8 A;  2FD2 A;  5L1I A;  2JJ4 D;  4OYM A;  3Q8Y A;  3W7B A;  3MUT P;  4ZLJ A;  5AJ9 A;  1ZTW A;  5ETN A;  1TZ0 A;  4OX6 A;  1NK4 A;  4ZVQ B;  2GC8 A;  4ZOS A;  2N3O A;  2E7X A;  2DRA A;  1GMV A;  3NCP A;  3C2P A;  2YKM B;  2KYZ A;  4TVA B;  4LR8 A;  2KT5 A;  1ELX A;  3L9Z A;  1Y4Z B;  1NPR A;  4WFN Q;  4CT8 A;  5LSL A;  2FJX A;  1JLQ B;  1IBL J;  3MMA B;  2GO8 A;  3J81 U;  2BXJ A;  1VBY A;  2OGU A;  1KFD A;  2QA2 A;  2YWF A;  1T8E A;  2VPW B;  1Y00 A;  1NDK A;  4O3N A;  3M6W A;  1FA0 A;  2XUL A;  2LEB A;  1QVG R;  4DV0 J;  3G82 A;  4F8R A;  2J0S D;  5D6G A;  1JLF B;  2QZ8 A;  4DX6 A;  2MXY A;  2RRN A;  4GVB B;  1UP1 A;  1YLX A;  2LCW A;  2DNG A;  3DMJ B;  1FE4 A;  3R5B A;  2EFN A;  2JEI A;  4X65 F;  1X9M A;  1ZM2 A;  1VBX A;  2RU9 A;  3GQC A;  4FYD A;  2IDE A;  2XMK A;  3CDA A;  4LRC A;  2CQP A;  4CNZ A;  5IM0 A;  4N41 A;  3QPI A;  2CQ1 A;  1RWM B;  3NS5 A;  1HMV A;  3EXC X;  1UFL A;  1D9F A;  3QIP B;  2FVP A;  2ZVI A;  4MT1 A;  1NPK A;  2NYI A;  4BWJ A;  2R7U A;  4NLX A;  3C6T B;  2E7V A;  1F5B A;  1RYS A;  4ALZ A;  4F26 A;  2GHV C;  2PSZ A;  3R2D J;  5KAK A;  3OXG A;  4DV4 F;  1HWU A;  1U2F A;  4EBE A;  1Q0N A;  2R7O A;  3LP2 B;  4WJB A;  4JI4 F;  4PWD B;  2DNQ A;  4JI8 F;  3MUV P;  5KFO A;  1TFW A;  2HZC A;  4FF1 A;  3QMQ A;  2HNY A;  3DLE A;  3PO5 A;  3KHR A;  4W90 B;  3DOM A;  1NK7 A;  4BC9 A;  1S9G B;  3KLG A;  4GC7 A;  2RIJ A;  2ZBP A;  2GZO A;  5LSO A;  2XG8 A;  4LF6 F;  1MRO A;  2DGW A;  3NKP A;  1SIW B;  4ZCM A;  4DZD A;  1HW9 A;  2JL9 A;  4YDD B;  4XPC A;  2YWE A;  4KAI A;  1Q16 B;  4FVM A;  1K44 A;  3UO0 A;  2O1P A;  5HBM A;  2ZOF A;  2V8G A;  3BB5 A;  4UUW A;  3MAQ A;  3B5Q A;  4ED8 A;  4YR2 A;  1B8J A;  2GCF A;  4RLE A;  3BKF A;  2A6M A;  1U8W A;  2NXE A;  3GFH A;  3D68 A;  1AJC A;  3UDL A;  2AMC B;  3K5M A;  3N9U C;  5T7L B;  2BAN A;  1KKH A;  1REV B;  4PCQ A;  2W1B A;  1U1M A;  1UWB B;  3BPS P;  3OBI A;  2AGP A;  3HXM A;  5F9L A;  4K4X A;  2R7X A;  3D6T B;  2X1G A;  2K3I A;  1WNE A;  5F8G A;  2ZZN A;  4CYR A;  3MM9 A;  1R8C A;  4FVC A;  3DYA B;  3GFZ A;  4UZC A;  1S57 A;  1FJE B;  4DPO A;  2CNL B;  3WAV A;  1MNE A;  1NO8 A;  4KIA A;  4F0K A;  3W2V A;  1R8H A;  1DAR A;  4Y3C A;  3VHQ A;  2EC0 A;  2AT1 B;  4DL7 A;  4YOE A;  4NRU A;  3A12 A;  3QFH A;  2XLK A;  2HAI A;  1S6Q B;  5FLX Y;  5KFL A;  3PX0 A;  3LAM A;  4I69 A;  3W1Y C;  2MY7 A;  5KT2 A;  2DEI A;  1UVK A;  4X64 F;  5F8L A;  2OPS B;  1ANJ A;  1X5T A;  1RWP B;  3P8B B;  2D9O A;  2PFD A;  2W2O P;  2RT3 A;  4KSE B;  4RJV A;  1NSK L;  3LWL A;  4A8S A;  2CQ3 A;  4KM4 A;  1WTB A;  3MEE A;  3ZZT A;  3KTQ A;  3F0N A;  1E6V B;  1AUD A;  2DKO B;  1VQS A;  3RRG A;  3CF5 Q;  2R9L A;  1HNW F;  1RXO B;  2N7Y A;  4M5J A;  2HUR A;  5MAO A;  4G1P A;  3SFU A;  4WU3 A;  3CO0 P;  2XYH B;  3HCX A;  1FNX H;  1M5K C;  2F8H A;  1R6Y A;  1WDD A;  2XS7 A;  4WTO B;  4J9V A;  4G3I A;  2FHJ D;  4B9N A;  1SJQ A;  1RT6 B;  2VA3 A;  4ZCI A;  2H5I B;  2L08 A;  3EMT A;  4C2M A;  1WTF A;  4W98 A;  2DH8 A;  4ILR A;  1QE1 B;  3FBE A;  3MAA A;  2EKN A;  1Z2Z A;  3CC4 S;  2MLX A;  4KHP J;  2B8P A;  5KG1 A;  4P9S A;  1S7H A;  1U45 A;  3QGH A;  1U6B A;  1R8A A;  1PKU A;  4DR6 F;  3FRY A;  1JLC A;  2XY6 A;  4IH7 A;  2ZH1 A;  3ISN D;  1IWG A;  2YNI A;  2KVI A;  4MYT A;  1C1B A;  3KG4 A;  2RHS B;  1UW4 A;  2ZBI A;  3IXQ A;  3CDB A;  2GO9 A;  3GWC A;  2ZC3 A;  3MM5 A;  1NSA A;  3IFE A;  5DDP C;  1ED8 A;  2DPI A;  1KQG B;  1N34 F;  1VYA A;  5B0D A;  3CME S;  2FC9 A;  5J1P A;  1RGV A;  1X7V A;  4TQR A;  3QAT A;  1SKW A;  1WF2 A;  2B56 A;  3NMR A;  2FJE B;  5IXU A;  2GML A;  1VQY A;  5DQI A;  1L3U A;  1TUG B;  3FBB A;  3GV5 B;  4PG7 A;  1N4L A;  1X4C A;  1YRU A;  4ES1 A;  5LMU F;  1U49 A;  2WON B;  5D0H A;  4BCA A;  1UEV A;  2E1C A;  2QYG A;  5KFI A;  4H54 A;  3BO3 A;  4NZ7 A;  4WFZ A;  3V6H A;  1CG2 A;  4DL4 A;  1DAX A;  4ED3 A;  3AJD A;  3TX0 A;  5C66 A;  5IC4 B;  2J5A A;  5GOV A;  4WE1 A;  1YSJ A;  3OTO J;  3IC1 A;  4URG A;  4LFB J;  3WBZ A;  3N0V A;  4WKY A;  3HSZ A;  4DV1 F;  1OYD A;  2G0C A;  3NAI A;  1S99 A;  4DUT A;  1E3C P;  4MKA A;  2DIV A;  4QWB A;  4R8U A;  5KFU A;  3K89 A;  1VHF A;  2EKY A;  2FZK B;  3AY0 A;  3OSN A;  4NOH A;  3LAL A;  2MQ8 A;  4YB5 A;  1IVZ A;  4NI2 B;  1U6Z A;  5JVH Q;  2RQK A;  4P7T A;  1NK6 A;  1D8Y A;  2VG7 B;  3RB3 A;  3E2E A;  2C22 A;  3EDR B;  3U7J A;  2NXC A;  3PKY A;  4ZN1 A;  3S8S A;  2V9K A;  2HRU A;  2XO7 A;  3VCD A;  5KFK A;  5KFS A;  1HI8 A;  1SCJ B;  4NL5 A;  3QID A;  2ZVS A;  2QMU B;  3WAY A;  2I38 A;  1BQM B;  3R7S B;  3TNV A;  4JYA F;  2VON A;  3VWS A;  1B70 B;  1VFJ A;  4DQR A;  3N01 A;  3OQ2 A;  1TL3 B;  1SPB P;  3FCW A;  1ZEB A;  3LWM A;  1ZAX A;  5CXT A;  2I0X A;  4ZPW R;  1T9V A;  5B0B A;  4J5O A;  1SHQ A;  2OTL S;  3A8I A;  1G7C B;  1WSR A;  3H2V E;  3K59 A;  5F8J A;  1N5V A;  1BMQ B;  4ECW A;  3IBW A;  3M9O B;  3WQP A;  3KD8 A;  5LRM A;  1NHV A;  1VK8 A;  4TKT A;  2Y8W A;  4RWW A;  4AL5 A;  2HG4 A;  2AD9 A;  2FHM A;  5L38 A;  4UQG A;  3UCZ P;  3IWL A;  3D28 A;  2ZDO A;  1ZAV A;  2X1F A;  4MY4 A;  4RW7 A;  5I3U B;  2ZEJ A;  3UN2 A;  2JEJ A;  1VRT A;  4RBU A;  4H4M A;  4F2S A;  1E6Y A;  3TOQ A;  2EFG A;  2RML A;  2CPY A;  1WWH A;  1LWE B;  3FRZ A;  4CNY A;  3HHD A;  2K7J A;  3NGK A;  5ETT A;  1RUS A;  5KTQ A;  3CMQ A;  5HJY A;  2F1F A;  1HHQ A;  5FLX U;  3K8W A;  4Y34 A;  3W2W A;  5DLG A;  1QLN A;  4A8K A;  3IBF B;  2AJ4 A;  3ETO A;  4ECR A;  3DLH A;  2KFN A;  2WRM A;  4I2P B;  1R8P A;  1P9Q C;  4B3O B;  1RWK B;  1H0H B;  1VRU A;  2MGZ B;  2AWZ A;  2BKO A;  3IO1 A;  1R0B G;  3T5J A;  2VA2 A;  1NDC A;  2F9J A;  5CZV A;  3KK1 A;  2UXB J;  1I51 B;  3GG1 A;  3W8G A;  3TAQ A;  3FC9 A;  4BBY A;  1RAA B;  3PNI A;  2FLP A;  1TKD A;  1C0U A;  3BH7 B;  2DNN A;  3D0H E;  2E7W A;  5L1L A;  3G71 S;  1M5O C;  4LR2 A;  3RR8 A;  2BZ2 A;  2UXC J;  2BDP A;  4JI3 F;  3VR1 A;  2DHA A;  4M1K A;  4NRT A;  1FVS A;  5IT9 U;  2BRL A;  4CO3 A;  2LMI A;  2PN6 A;  1TK5 A;  1Y5L B;  1K8A T;  4QU6 A;  1TMM A;  4DU7 A;  1RTJ B;  4CQ1 A;  1IR1 A;  1N5Q A;  5A8R B;  3AH6 A;  3HHK A;  5HVH A;  3QGP A;  4U8Y A;  3WC0 A;  5KOW A;  1F9F A;  4DJB A;  2QL9 B;  2IUC B;  5KG6 A;  2A1B A;  5E5N A;  5DLW A;  3QSI A;  1WI6 A;  3QT6 A;  5LMN J;  2QV6 A;  4C8M A;  2Y3Y A;  5K14 A;  4AD6 A;  5C2C A;  4JV5 J;  1S10 A;  1H73 A;  2WVF A;  3ET6 B;  5GME A;  2AP6 A;  2QMX A;  3RB6 A;  3QJJ A;  1FE0 A;  4X4Q A;  3LQV A;  1Q8I A;  2IRY A;  2C42 A;  2GV1 A;  4F02 A;  3TP2 A;  1NZ8 A;  1HWK A;  2HNY B;  2MHN A;  2XHC A;  4X66 J;  5EGE A;  3AD9 C;  3D0G E;  1TL7 A;  4ICL A;  4LF7 F;  2V5H G;  3DOM B;  4DSF A;  1FXL A;  3OL8 A;  2CXE A;  3QYY A;  3HHL A;  1OQ3 A;  5HRO A;  1MRO B;  4P72 A;  4LBH A;  4DUY F;  1TKZ A;  3AOA A;  3DRR B;  2PC6 A;  1M0S A;  3RW6 A;  3VQS A;  3EJM A;  1N33 J;  3MM6 B;  4J9S A;  2X98 A;  2NR0 A;  3OR2 A;  5KFJ A;  4USH A;  2W2P P;  2HAF A;  1S9E A;  5KG5 A;  2YH1 A;  4LJM A;  4P2X A;  3DXS X;  2DYA A;  1BQN B;  3MMB B;  1Q7L B;  2D1G A;  2PI4 A;  2YWH A;  2RNE A;  3RW7 A;  5CAB A;  3NAH A;  3BJY A;  1HBN A;  9RUB A;  4HTJ A;  1YHQ S;  3A3N B;  2BAN B;  4M5M A;  3Q2T C;  2GSN A;  2GFF A;  3IDD A;  3SQG A;  1KHV A;  3KFW X;  4F36 A;  2F4V J;  4OZN A;  1P27 B;  2BM0 A;  4C8L A;  4Q45 A;  4OYI A;  1CJU A;  1APS A;  4IG3 A;  4LF4 F;  4KAY A;  1YJ9 S;  4PG5 A;  3SV4 A;  2F40 A;  2Q79 A;  1VQ5 S;  2B3T B;  4DV2 F;  1IBK F;  4HKQ A;  4S0M A;  4FXD A;  2VPX B;  1RT5 B;  4LR7 A;  4CO1 A;  2ZOG A;  3HKZ D;  2CPE A;  1DZ5 A;  2LQ5 A;  1FRI A;  3BDG B;  3TJA A;  4HDH A;  1GX5 A;  4QZV B;  1U48 A;  1U0H A;  4KYZ A;  3S7R A;  5CD4 H;  1VK3 A;  1DJ0 A;  1HA1 A;  3GSD A;  3CCU S;  5D15 A;  1HQA A;  2CZ4 A;  1WEX A;  1LFP A;  3MR6 A;  4YR3 A;  2CA9 A;  2YQ3 A;  4KB7 A;  2RS2 A;  2NPI A;  4LUB A;  4DR2 F;  4FXW A;  2NS1 B;  3MEE B;  3DM2 A;  2JX2 A;  3I31 A;  2J0X A;  3C16 A;  1EW2 A;  3H90 A;  4FDF A;  3HVR A;  4USV A;  2D3O R;  3R27 A;  4LFA F;  2ZKT A;  4KAV A;  2FVR A;  1RAO A;  4CLF A;  3R2C J;  4WP9 A;  1Q8K A;  4A8F A;  4N8O A;  2MEW A;  5L46 A;  2ACM A;  2ZM6 J;  4DPT A;  4CRJ A;  1T9W A;  4EBD A;  1UVJ A;  4C3K A;  5EGH A;  5IC6 B;  2AYM A;  1AB8 A;  3FK4 A;  1WF0 A;  4L75 A;  1ALI A;  2KU7 A;  4DR5 J;  2DNR A;  2J8S A;  2XSF A;  1RWN B;  2VFV A;  1ROF A;  2GAG C;  4RL1 A;  5EN1 A;  3UD3 P;  5KFP A;  4H4O A;  1HBO A;  2KM8 C;  3UVJ B;  3V81 A;  2IYG A;  4TNO A;  1FNM A;  2A18 A;  2M3D A;  2RRA A;  2KL8 A;  3R5C A;  2ZH4 A;  2FLN A;  1CUL A;  1NDL A;  4OI4 A;  1SC6 A;  3B54 A;  3NNA A;  3DI6 B;  2Q66 A;  3EM1 A;  4XPE A;  2HHS A;  5HMW A;  2Y9H A;  1FWL A;  2OUG A;  5LXY A;  3MED B;  1JLC B;  4O3O A;  4O0I A;  1KDN A;  1J27 A;  1MW7 A;  2YNI B;  5D4L A;  1C1B B;  4DFJ A;  4DUZ F;  2P6S A;  3BF4 A;  1UKU A;  3LAK A;  5KFY A;  5IJQ A;  1Q1K A;  3PY8 A;  2DBB A;  2AGQ A;  3IR6 B;  1X4D A;  2W25 A;  4CO4 A;  4WP3 A;  3UD4 P;  2CKW A;  4YFU A;  3PJW A;  3A4T A;  4MTP A;  2R8H A;  2DXE A;  5KFQ A;  4MK7 A;  4IFY A;  3FCV A;  3G8T A;  4B3M J;  4RW4 A;  4O0N A;  1LW0 A;  4WTY A;  4MIA A;  5DLF A;  4H4K C;  2CQD A;  3FEX B;  2H4Y B;  4KPC A;  4YDX A;  3OVB A;  4LF1 A;  4U67 Q;  3EVW A;  3M7V A;  3D6F B;  1F0X A;  4GTY A;  3I4H X;  5CCL A;  4ZP7 A;  3NS6 A;  4NEY A;  4EU0 A;  3E3X A;  4ZG7 A;  2U2F A;  1HWI A;  3J7A 1;  1CS4 A;  1KH4 A;  3EUN A;  3G6X A;  4TYA A;  2R7S A;  1T3N A;  1C4A A;  1FDA A;  3OXF A;  5M2P A;  1IKX A;  5IV4 A;  2J6S A;  3TAP A;  4ZP6 A;  2JWN A;  1UWA A;  2QA1 A;  3OHA A;  2XC9 A;  2OML A;  5EX3 A;  1KH9 A;  4P6Q A;  4RNF A;  4MKV A;  2RF2 A;  1G3O A;  4DLE A;  3C6U B;  3KKF A;  2VFU A;  2QIF A;  4R8U B;  3R9L A;  3WIV A;  3MEG B;  3FVY A;  2WW4 A;  3FDS A;  2C2D A;  2XMJ A;  2CQI A;  4LIW A;  2UZA A;  4DHV A;  3Q2S C;  2XR9 A;  3G6E S;  3M8P A;  1SC1 B;  4HEA 9;  1TU0 B;  1ZTT A;  1I5O B;  3BGO P;  1D8Z A;  1FO1 A;  3KNA A;  3CMR A;  2ZH3 A;  1UET A;  2BBE A;  2J7U A;  4DPX A;  1N0U A;  3NNH A;  2U1A A;  4ES3 A;  2Y1J A;  3FJ2 A;  2JSX A;  2ZBC A;  2EEY A;  2L9D A;  2A2C A;  3CGI A;  1V5I B;  3GFX A;  3LH2 S;  1UFW A;  3M1V B;  1GXL A;  1LQ9 A;  5C7P A;  3D9B A;  1TTH B;  4P75 A;  2ALY B;  5IV3 A;  1S9F A;  2DXD A;  4RWX A;  4QYR A;  3E01 A;  2V2Z A;  1ZS6 A;  4MHX A;  2GMH A;  1TVR A;  3N5B A;  3EZ5 A;  1KHW A;  2N4D A;  2DR5 A;  5H9E J;  1U4B A;  3OTC A;  4O44 A;  4LR9 A;  4PYA A;  3HVA A;  4TXS A;  3C66 A;  1U1K A;  2K06 A;  1S59 A;  5IWA J;  1YRX A;  4B3S J;  2LEC A;  5ETL A;  3IM8 A;  2UU9 J;  1HNI B;  4X4P A;  1UTA A;  2QX0 A;  1X0F A;  1L3S A;  1TFY A;  3KG1 A;  2E1A A;  1IJE B;  2F8M A;  4NLW A;  1ELZ A;  4GVL A;  1YJR A;  4O3R A;  3M2U A;  1L3T A;  1U6F A;  3NMA A;  1BD6 A;  4NCB A;  1N2L A;  4JV1 A;  3BGR A;  3C46 A;  3Q8P B;  5ITH A;  1X0P A;  5DM6 Q;  3BDF A;  4H4M B;  2R8G A;  1E6Y B;  4NX9 A;  2PEH A;  2L41 A;  4YY3 J;  2KKH A;  4FYY B;  2E5L J;  2DRB A;  4DFP A;  2JHE A;  1KQK A;  1YKW A;  2VFS A;  2HND A;  1XR6 A;  5IT0 A;  3JB9 k;  1YJU A;  1V6H A;  3G6V A;  2MHE A;  1Y7A A;  3KMQ A;  1RCO B;  2FGO A;  4K4U A;  4ZPT R;  2HFO A;  2EW9 A;  1U09 A;  3VAM A;  5CYJ A;  2VPY B;  4KKO B;  3M4X A;  2MKY A;  2YX7 A;  2R8K A;  3M8Y A;  1VRU B;  2DR7 A;  2W7A A;  3K8V A;  3L7P A;  5HP1 A;  1VRQ C;  1K73 T;  3KK1 B;  3GV7 B;  4KH1 B;  4MKB A;  1EB0 A;  3KLH B;  3HP6 A;  1PAE X;  1KON A;  3M32 B;  2KXF A;  1U8S A;  1SXL A;  4HTI A;  4ANC A;  3L3C A;  1UPP A;  2VQF F;  2ILY A;  2FC8 A;  3D1Q A;  5EUH A;  1EJ7 L;  2JZ5 A;  2IMO A;  2VPZ B;  1IR0 A;  2HHH J;  2X3D A;  4V19 X;  4OI0 A;  2VH7 A;  4F0H A;  1R43 A;  4ED0 A;  2LDI A;  2YY3 A;  2ADC A;  2HGN A;  2E66 A;  3C14 A;  4F67 A;  1Q8L A;  5M2R A;  4UTG A;  1UVN A;  3B4D A;  4OHW A;  1R7I A;  4DS5 A;  2CG8 A;  2ANH A;  3BKT A;  3CJ3 A;  1DQ9 A;  1OJ4 A;  3ISN C;  3LTO A;  2OPQ A;  4ECX A;  3JQK A;  2ZH6 A;  2OI2 A;  3UR3 C;  1WHX A;  3GIJ A;  2DNZ A;  4U7U K;  1AZS B;  1HHS A;  2C3Y A;  1ARO P;  2QN6 B;  4C11 A;  2HS3 A;  3HD1 A;  5IJS A;  2HFV A;  2GIR A;  3OHB A;  2IA0 A;  4DS4 A;  2HVI A;  3OV7 A;  3TQ1 A;  1RYR A;  2X51 A;  5K14 B;  3KUG A;  3R6G B;  4B3R J;  2W9A A;  3OSP A;  1VQ7 S;  3KUH A;  2MZT A;  1KQF B;  1Y7P A;  4FPI A;  1WKK A;  4JI6 J;  4QWC A;  4RR5 A;  1RHK B;  2FVS A;  4GRS A;  1CSJ A;  3KLE B;  2D41 A;  4F3M A;  1CQN A;  2APO A;  1IKY B;  1S1U A;  1T05 B;  2V94 A;  5L8R C;  3BSA A;  3KLF B;  1TL7 B;  1WEZ A;  4ICL B;  4M5D B;  2Z4P A;  2EFP A;  5A2Q Y;  3HHL B;  4J7C A;  4QYZ K;  1KOO A;  4IOA Q;  2QSW A;  2QE5 A;  5HRO B;  5H9F K;  2KH9 A;  1BC6 A;  6FDR A;  2ATC B;  1TKZ B;  4M5K A;  4ES2 A;  1DQ8 A;  4AFF A;  4OMF G;  2WVC A;  3D7S B;  3OR1 A;  3AJ2 A;  1FNO A;  2IRU A;  3V6K A;  2ZUA A;  3NL0 A;  4DL2 A;  5GMD A;  1HPZ A;  4UPI A;  1P1T A;  2VKZ G;  2PD1 A;  1LWF B;  5LSR A;  2A0F B;  1VC0 A;  5AJ3 J;  6AT1 B;  4K0K F;  2HIQ A;  4LF9 F;  1MMD A;  1Q79 A;  5KFF A;  2XNR A;  3KWM A;  1HBN B;  2LXU A;  3QT5 A;  1YJN S;  1U1R A;  3MMJ A;  1TMJ A;  1HNZ J;  4OYO A;  3SQG B;  1WSV A;  2JVO A;  4AT1 B;  1NK5 A;  3MDF A;  2GSU A;  2JH3 A;  1QVF R;  1NK0 A;  3C3L A;  2BQ3 A;  4R25 A;  2V63 A;  4IG3 B;  2V8V A;  4DSJ A;  2F5G A;  1PCA A;  3G8Q A;  2K8G A;  1OY8 A;  2HRY A;  1TEL A;  1XR5 A;  1VC5 A;  4NYO A;  2UUB J;  1CC8 A;  3R5J B;  3TUJ C;  2UUW A;  1NM2 A;  2DIU A;  3MEK A;  2XMV A;  5HQL A;  5E2Q A;  2FJB B;  2HNZ A;  4PAB A;  3G86 A;  2DVI A;  2EPI A;  3PYF A;  2XWY A;  2YH0 A;  3BO2 A;  3Q24 A;  2ZDP A;  1FI4 A;  1YQH A;  3NG8 A;  3CDU A;  3POT B;  3DLL Q;  2IRX A;  1UW9 A;  3MOJ B;  2MST A;  2GA7 A;  2ZD1 B;  2XQC A;  4JI5 F;  5F41 A;  1TKX A;  3I87 A;  4L74 A;  4IH6 A;  2UUC F;  2DGQ A;  4Z7C A;  4Q0B A;  3T1H J;  3LW5 C;  3CIM A;  4FYW B;  4DBQ A;  3VAI A;  3TUZ C;  4I67 A;  5DGB A;  2DB1 A;  4EYH B;  3C16 B;  3BBB A;  1T3O A;  2YNG A;  3NP5 A;  3BPD A;  5DLV A;  1QSS A;  3T19 A;  4CLL A;  2B9X A;  2DNH A;  1Y3J A;  1VIO A;  2PMH A;  3RYL A;  5A8K B;  3K57 A;  4ZS6 A;  1F3V A;  2DGS A;  3NBP A;  2CQ2 A;  1Z4U A;  1UA0 A;  4RUA A;  3HZE A;  4FS2 A;  1S0V A;  1U1N A;  2B5J A;  2F7V A;  2IA6 A;  2JFD A;  3JTN A;  3IG1 A;  1N52 B;  5HLF A;  1FXR A;  3SSR A;  1RBO B;  1ZYQ A;  4H4O B;  1HBO B;  4DZ6 A;  1ELY A;  3D6H B;  2KJW A;  1ZM3 A;  4Y2A A;  2QLJ B;  3MCO A;  3WIU A;  2VUG A;  3WC2 A;  2B51 A;  2ZHA A;  1RAG B;  3ZTS A;  5F8H A;  2HQF A;  2BRK A;  3FUY A;  3VAJ A;  4I56 A;  2MJN A;  3MAH A;  3U1L A;  3OJU A;  2IFX A;  3KLI A;  3MM8 A;  1I94 F;  1MN7 A;  3PW0 A;  4ZP9 A;  4UT4 A;  1GEH A;  1O51 A;  5L39 A;  1OY9 A;  2QA4 S;  1VI7 A;  1DBD A;  3TEG A;  3S1T A;  2IC3 B;  5D0G A;  4AL7 A;  3QNW B;  1DTQ A;  5EWF A;  2E1R A;  4GMK A;  4DWI A;  2IM0 A;  2ZBR A;  3WAW A;  3CC2 S;  2YKM A;  1PAU B;  3JSY A;  4Q5V A;  3UDE A;  4R0E A;  4QWD A;  3KJN B;  2D3U A;  2B43 A;  3OUY B;  4RW8 B;  1JLQ A;  4ETZ A;  2IM2 A;  3IR7 B;  4RW4 B;  2FJV A;  4JI7 F;  1JB0 C;  2P9C A;  4L76 A;  1LW0 B;  3MMA A;  4BHQ A;  4O3Q A;  1FDB A;  3T1Y F;  3M6X A;  1KN6 A;  4X4O A;  2XI2 A;  4CO0 A;  1AJD A;  1V9O A;  2D3Z A;  4OYB A;  4G1Q A;  4KJD A;  1CC7 A;  2FHK A;  2MTL A;  3FEY B;  4B9S A;  1MU2 B;  2E1M C;  5ADZ A;  1XR7 A;  5E3R A;  2PI5 A;  4PQU A;  2LU2 A;  5AE3 A;  4YB1 P;  1VDH A;  4GVB A;  4KTQ A;  3PJX A;  3ISZ A;  1K1Q A;  3MEC A;  2CZV C;  3J80 U;  2ALZ A;  2LYV A;  4JBC A;  1XMQ F;  4FN5 A;  3TVK A;  2MLZ A;  3H2U B;  3FSI A;  1WOP A;  1RWW B;  2JFK A;  2V8D A;  1FER A;  3TEH B;  2IIH A;  2R7W A;  3DOK A;  2VB6 A;  4FBT A;  4RBV A;  1JJ2 R;  2XGQ A;  2Z57 B;  3CIZ A;  3KJV B;  3P6Y C;  3P4U B;  3NNC A;  1VOM A;  3M8P B;  4NLG A;  1GNK A;  3W5Y A;  4KY3 A;  4HH1 A;  1YWX A;  3LP2 A;  2V0N A;  1GTE A;  2BE7 D;  4YP3 A;  4WK1 A;  1IWA A;  4Y00 A;  2H65 B;  5K8N A;  4F4A A;  3OLB A;  1ZH5 A;  5AXM A;  5A2Q U;  4NLS A;  4YB6 A;  2NUH A;  3JSM B;  2ZH7 A;  1AXQ A;  1CJK A;  1UA1 A;  1U02 A;  4XIU A;  2FJA B;  4OYZ A;  1CPZ A;  2JC1 A;  2CPX A;  2OEM A;  2UV8 G;  1ZOT A;  2HLU A;  3V6D A;  3VVU A;  3DDN A;  4L73 A;  1RJJ A;  4O4G A;  4FP9 A;  1H2V Z;  2GS8 A;  2XMU A;  1S1X A;  5E3Q A;  4GKJ J;  3HX9 A;  2ZC4 A;  1UZD A;  3JS9 A;  1MG7 A;  4WFY A;  3H5U A;  1FFG B;  4DV7 J;  2WBR A;  4J90 A;  4CYS A;  3M8Q A;  2DGU A;  1EHW A;  2W8K A;  4QR1 A;  5ETV A;  5T7L A;  1REV A;  3DLG B;  3KNG A;  3GP9 A;  1RWV B;  1UCN A;  1ZPV A;  1Y0H A;  4YHH J;  1UWB A;  2Y0S D;  4IYQ A;  2W4C A;  2LQJ A;  2DGT A;  5F0W A;  2M5Y A;  3LUY A;  2WVB A;  3VAK A;  1KVK A;  2IYI A;  1JJH A;  2D1C A;  1IBM J;  1SUQ B;  1B99 A;  1RAJ A;  1VGY A;  1O99 A;  3KJF B;  1TL1 A;  3DYA A;  1IQZ A;  3BQ0 A;  1PBU A;  5JUM A;  3T02 A;  3Q8R B;  3W62 A;  3M30 A;  1YJ7 A;  2CQ4 A;  2OIH A;  1X60 A;  2NUU G;  3BQ1 A;  1S6Q A;  1ZZN A;  1Q5Y A;  2H48 B;  5EDW A;  4ECY A;  3EPG A;  1JKH A;  2MQN A;  5KFX A;  2OPS A;  3Q8Q B;  2DHS A;  2B9Y A;  1FKP A;  1XNR F;  5L9X A;  2I2Y A;  5HP1 B;  1ZPW X;  4KGX B;  3RZA A;  2MQL A;  2C2N A;  2GSO A;  3CCW A;  3V4I A;  4K5R A;  1J2V A;  2VOO A;  1HNX F;  1E6V A;  3EVM A;  2IFY A;  3CW2 C;  3OT9 A;  4LMZ A;  4WYW A;  5HMX A;  1RT3 A;  1XMO J;  2WW8 A;  4CO2 A;  1K1S A;  2ZHB A;  3A3P B;  3GR1 A;  2YWK A;  5D77 A;  2I6W A;  4NLP A;  2BAB A;  2I1R A;  3HHN B;  2V2V A;  4OZ3 A;  1RKI A;  3C14 B;  2HZA A;  1TQL A;  4ZG6 A;  2E1P A;  1KLN A;  1B0P A;  3CCM S;  2DEJ A;  3WDO A;  5DG7 A;  2OPQ B;  4LQY A;  5KT3 A;  4JI2 F;  3DHW C;  1VQM S;  1G1X A;  3OL7 A;  2HFZ A;  1VBK A;  3O44 A;  2BX6 A;  3HUL A;  3I0S B;  3B6B A;  3SQO P;  3LA0 A;  4GKK F;  4LF2 A;  4MMO A;  1HWJ A;  2K2P A;  4FNH A;  3I55 S;  1NND A;  2XMW A;  4C11 B;  3BQ2 A;  4DV6 F;  1QTN B;  3LAN A;  4DL5 A;  4ZVH A;  2WK4 A;  3Q3Q A;  3AB4 B;  2FB0 A;  2CVE A;  1TP7 A;  2MYF A;  3QO9 A;  4G65 A;  2AW0 A;  2ASJ A;  1TUW A;  4RNO A;  4PEO A;  2A10 A;  2FLL A;  3KHG A;  4B08 A;  2JC0 A;  4LF5 F;  1WC3 A;  3Q8S B;  3GB0 A;  3A3O B;  4DV3 F;  4NLD A;  2BOP A;  1OS5 A;  1B4S A;  3I5C A;  2F8E X;  3AOB A;  3BR9 A;  3HSG A;  1EQM A;  2VKR A;  4D3H A;  3EX7 B;  1K0T A;  2PII A;  2Z58 B;  3DRS B;  4AYB D;  4M94 A;  3DLJ A;  1URR A;  5DDR C;  1Q82 T;  4NLR A;  5BYS A;  4ZJL A;  1NHU A;  2B6A A;  3ZO7 A;  5IZH A;  3M6V A;  4DL3 A;  4P2S A;  3T9N A;  3HO1 A;  2AEF A;  1BLU A;  4B56 A;  4J91 A;  3OR1 B;  2J7K A;  4C3L A;  1JLG B;  4UF4 A;  1L3K A;  4CXK A;  1EP4 B;  3F41 A;  3PZP A;  3PJ9 A;  3HVT B;  3HM9 A;  4WKR A;  2MZ1 A;  3AOD A;  2XSJ A;  2DR9 A;  9ATC B;  1N36 F;  3HSD A;  4ZDN A;  3HT0 A;  3NGS A;  1TV6 B;  1NUE A;  4PQA A;  2J9C A;  2EBE A;  3WAX A;  2JVR A;  3G4S S;  1JNZ B;  4X65 J;  3P49 B;  3K5P A;  4PAA A;  2H5J B;  4U96 A;  1X4A A;  4FYV B;  3QRR A;  1ZM9 A;  2B4O A;  4DEZ A;  4PPD A;  4IR9 A;  1HQU A;  2QJ3 A;  1XNQ F;  3PKM A;  3G87 A;  1OYE A;  4PXB A;  5GAD I;  1KH7 A;  3QWP A;  4IH5 A;  1XIQ A;  4KFB B;  1M1H A;  1UMJ A;  2MDA A;  4OYX A;  4DV4 J;  2ERR A;  2AJ1 A;  5BXI A;  5HN0 A;  4JI4 J;  3TJ8 A;  4JI8 J;  3MD1 A;  1M5P C;  2HNZ B;  3G96 A;  2KG1 A;  1P6T A;  3KLV A;  4NI2 A;  4AL6 A;  2DHG A;  1VQO S;  1PJ6 A;  4B17 A;  3O5T B;  2CQB A;  1UPM B;  3ZZR A;  3GSI A;  3CD0 A;  2OHD A;  5B0G A;  4PR6 A;  2MZR A;  3N6N A;  1NJX A;  4B3T F;  4LF6 J;  3THT A;  2MQP A;  1HKA A;  1S72 S;  4QW8 A;  1TKX B;  1KH5 A;  2VV5 A;  4EI2 A;  1BQM A;  4USM A;  3W61 A;  4ID5 B;  2EFO A;  1Y5N B;  2D9P A;  2YNG B;  4FF4 A;  2HW3 A;  2IJR A;  1Z1Z A;  3G8S A;  2V4Q A;  2HEK A;  4C7Q A;  1HI0 P;  1N32 F;  3UE2 A;  2M4M A;  1SC4 B;  4BDP A;  3NBP B;  1RWU A;  1L3V A;  1KP6 A;  3PIP Q;  2P8I A;  4N5S A;  2M88 A;  5MLC V;  3SSS A;  3MCN A;  3TAM A;  3IWN C;  2B5J B;  2BJ9 A;  4QAX A;  4LFC F;  2IY5 B;  1F1B B;  2OEL A;  1PC4 A;  5HL7 Q;  5KFN A;  4K4V A;  5GMK a;  1OPI A;  1Y11 A;  3ILO A;  2KTQ A;  2CIM A;  1GXU A;  3K7R A;  2PE8 A;  1AW0 A;  1FX4 A;  2DNM A;  1B7Y B;  2JNJ A;  4LIR A;  3T5K A;  4CLP A;  3BH6 B;  4FXV A;  3OW2 R;  3R7N B;  1ZET A;  4PXC A;  1VQK S;  4ATN A;  1LWE A;  2OEJ A;  5GAE U;  2HFS A;  5KFT A;  1FF2 A;  1Q8B A;  4X64 J;  4N56 A;  4NLQ A;  4PXE A;  2LP4 A;  3RBX A;  3CD7 A;  1PGZ A;  5D78 A;  2KZM A;  4B9L A;  3JAM Y;  1OQ6 A;  3ADA C;  3MR2 A;  5L9N A;  2RQ4 A;  2FZG B;  3D4J A;  1DTQ B;  1T95 A;  5DQG A;  3LO3 A;  3BDH A;  4LRB A;  3ENV A;  4I2P A;  1RDR A;  4A8Y A;  3W9H A;  2Y0B B;  4CCH A;  4Y2K A;  4B3O A;  1J5O B;  4NXN F;  2MGZ A;  1RT7 B;  1RP5 A;  1DUR A;  2MB0 B;  1HNW J;  5A8W A;  2M2B A;  2M70 A;  3R1L A;  3C15 A;  4ZVE A;  4ELT A;  3K5L A;  2NSC A;  4ERD A;  2LDY A;  1S79 A;  2ZBQ A;  3UI3 A;  4ZPD A;  1VQ4 S;  3EGN A;  4MK9 A;  1R0A B;  4G1Q B;  2MKH A;  2DGV A;  4LSZ B;  5C42 B;  5F3T A;  4DPU A;  1V3R A;  1F6T A;  1RTJ A;  4PQU B;  2GJ2 A;  1PIE A;  4M8L A;  4WFX A;  2ATL A;  5C25 B;  1HYS B;  5A8R A;  4R5P A;  2QSF A;  1VQ9 S;  2IHR 1;  4CH7 A;  2HGL A;  3MEC B;  2GQQ A;  5KFC A;  4PZV A;  4J37 A;  2IUC A;  2ZHO A;  2GMJ A;  3D66 A;  4DR6 J;  4Y28 C;  2Y1L B;  3AB2 B;  1L5U A;  3BRE A;  3DOK B;  2M52 A;  3R6L B;  1URB A;  2ZJQ Q;  3GR0 A;  3ET6 A;  3SMZ A;  4MH8 A;  4U9R A;  4D3G A;  4KHM A;  4ZKA A;  3CPW R;  5KG0 A;  2K3K A;  1R31 A;  3IGN A;  1WOR A;  3D3C J;  2NXN A;  1NME B;  2B4P A;  1N34 J;  1HQ2 A;  3ENW A;  3T6J A;  4BWM A;  1RBA A;  5L0B A;  1NJW A;  3GII A;  4CLU A;  1CJK B;  3WBH A;  4WXO A;  1QJH A;  1UZH A;  4CIO A;  5CCM A;  5HK4 A;  1SHN A;  2NXJ A;  3DRR A;  4WYL A;  2CPI A;  4K2X A;  3TI0 A;  4OI6 A;  5A0Y B;  4ED7 A;  5LMU J;  2KT3 A;  3V6D B;  4K4Y A;  1E1Z P;  3MM6 A;  2HFN A;  1ZBT A;  4RZR A;  2F63 A;  4TY8 A;  4FF2 A;  2HSE B;  4O4G B;  2GJI A;  2DNL A;  1XQI A;  4ECV A;  1NU4 A;  1HNV A;  1S1X B;  5KFH A;  2MKK A;  2ZH5 A;  4PXD A;  2DR6 A;  2C3O A;  3UN3 A;  3BZQ A;  3MCS A;  2BKP A;  1LWC B;  2XTJ P;  1NK9 A;  1BQN A;  3MMB A;  4J9L A;  4AQY F;  3IMQ J;  4L3K A;  4CTA A;  3M8Q B;  3R5G A;  3FMW A;  5GRR A;  2MKI A;  4A8M P;  1I6J A;  4J9M A;  2FIU A;  4DV1 J;  2JLG A;  2CRL A;  3K58 A;  4EWT A;  1NEE A;  2RDJ A;  5LL6 d;  4KGV B;  3EVO A;  4YN3 B;  2YX4 A;  2CPD A;  1RAF B;  3I32 A;  3IGV A;  3OVA A;  1TL1 B;  1MSW D;  1N54 B;  4G1I A;  4ZGA A;  2ASD A;  2G2Y A;  2D69 A;  2DO4 A;  1RZM A;  3JTO A;  3M30 B;  2C1E B;  4WF9 Q;  4EGL A;  2D7S A;  3W5X A;  1RT5 A;  2N4C A;  3HHL D;  5IOL A;  1E2S P;  4DV5 F;  2P2C B;  5KFR A;  1T9Y A;  5HQ8 A;  4DR7 F;  3RRK A;  4WII A;  3BDG A;  4GC6 A;  2IJN A;  1KR4 A;  1DY3 A;  5K8P A;  4RO0 A;  2GLQ A;  1JKH B;  3ELH A;  1H38 A;  3QJL A;  1KQS R;  4JYA J;  1RE1 B;  1RKJ A;  2R7V A;  2M8D B;  1FKP B;  4QPX A;  1T02 A;  3LP0 A;  3MPD A;  2I8E A;  4DQS A;  3MR3 A;  1I1G A;  2NXU A;  5DLT A;  4DPW A;  4IRK A;  5BJR A;  3NVL A;  3V4I B;  1UVM A;  2E5H A;  4V19 J;  4ED2 A;  3CTR A;  3H5Y A;  1HJK A;  4USU A;  1RT3 B;  2IBK A;  2XO6 A;  5KFB A;  1ZA1 B;  3D54 A;  4HT5 A;  2UXD F;  2VG5 A;  3ITH B;  1FJG F;  1NDP A;  4E8U A;  2H9Z A;  5KXA A;  3ZTO A;  5IT9 Y;  2GQ2 A;  1HIY A;  2R42 A;  1S1V A;  1X4B A;  1W7W A;  2W2N P;  1B0T A;  2B7C B;  3F73 A;  5DDO C;  4UOG A;  2ZNZ A;  3O3L A;  1VQP S;  1EQJ A;  4QCL A;  4ZN3 A;  3W65 A;  2ZOM A;  2ASY A;  2HLT A;  3UVJ A;  5FDL B;  2KO1 A;  3PX4 A;  3DOL B;  2BW7 A;  3UNY A;  4FF3 A;  1FEH A;  2G13 A;  3BV8 A;  1SKU B;  3DRX A;  5IQ6 A;  4L72 B;  5BYR A;  3GIR A;  2YX1 A;  2CWX A;  4ZIV A;  2GHP A;  4OZ5 A;  3DI6 A;  3QO9 B;  3GG0 A;  2D3O 1;  3CCR S;  3BSO A;  3RBE A;  2COL A;  4DCJ B;  4X62 F;  4OQJ A;  4IRC A;  3NKN A;  4J9K A;  3VGS A; 
#chains in the Genus database with same CATH homology
 3SZZ A;  5TJ3 A;  4LQY A;  1HJK A;  3T01 A;  5EGH A;  3NKM A;  1P49 A;  5L0K A;  4B56 A;  5INH A;  2XRG A;  3B5Q A;  2RH6 A;  4CXK A;  3TG0 A;  1ELZ A;  1B8J A;  4N7T A;  1EI6 A;  1ALI A;  1ED9 A;  2XR9 A;  4LR8 A;  1KHJ A;  3NKR A;  4LR7 A;  2W5Q A;  3WAY A;  4MIV A;  1ELX A;  3T00 A;  5DLV A;  1HDH A;  1EW9 A;  4KM4 A;  1URA A;  1Y6V A;  2W5S A;  3MK0 A;  2W5V A;  1AJC A;  2W5T A;  1ZED A;  4UOO A;  1N2K A;  4NWX A;  1N2L A;  3BDG B;  4UOR A;  5K4P A;  4UPL A;  3TX0 A;  2X98 A;  3CMR A;  1O98 A;  3SZY A;  2GSU A;  5C66 A;  5L0B A;  3NKO A;  4CXS A;  1AJA A;  1EJJ A;  2W5W A;  3NKQ A;  4ZGA A;  1ZEB A;  3BDF A;  3DPC A;  5KXA A;  4KAY A;  5GOV A;  3M8W A;  1EW8 A;  2W5X A;  3WAX A;  1SHQ A;  1KHN A;  1KHK A;  3LXQ A;  3WBH A;  1ALK A;  3WAW A;  2IUC B;  3Q3Q A;  1KHL A;  1ZEF A;  1KH5 A;  1SHN A;  4LRA A;  1HQA A;  2G9Y A;  4CYS A;  5L0E A;  3M7V A;  4GTX A;  4LRF A;  1ALH A;  5DLW A;  1E2S P;  4GTY A;  2W8S A;  2GSO A;  4UPK A;  4TN0 A;  2D1G A;  4CYR A;  4FDJ A;  2ANH A;  3KD8 A;  4NWJ A;  1E3C P;  1E33 P;  1EQJ A;  3A52 A;  3BDG A;  5LRM A;  4GTZ A;  4ZG7 A;  1E1Z P;  2IFY A;  4UPH A;  3OT9 A;  1AJB A;  4YR1 A;  4MHX A;  1KH4 A;  1ALJ A;  5LIA A;  3WAV A;  3ED4 A;  1Y7A A;  5LRN A;  1ED8 A;  2GA3 A;  2GLQ A;  4KJG A;  3UNY A;  3NKP A;  2QZU A;  2IUC A;  2GSN A;  3UN5 A;  2W5R A;  1ANI A;  1EW2 A;  4UOP A;  3BDH A;  4LRB A;  1KH7 A;  2VQR A;  1ELY A;  5HRT A;  3MK1 A;  4GTW A;  3MK2 A;  3UN3 A;  4LRD A;  4UPI A;  5LQQ A;  3IDD A;  4LR9 A;  1O99 A;  5IJS A;  4ZG9 A;  1AUK A;  4MY4 A;  2ZKT A;  1AJD A;  4FDI A;  4KAV A;  4LRE A;  1KH9 A;  5IJQ A;  3UN2 A;  4CXU A;  4LR2 A;  4ZG6 A;  3M8Y A;  4QAX A;  5GRR A;  3DYC A;  1FSU A;  3TWZ A;  1URB A;  2W8D A;  5AJ9 A;  1K7H A;  5EGE A;  4KJD A;  3T02 A;  3M8Z A;  5DLT A;  3UO0 A;  3IGY B;  3NVL A;  3NKN A;  1ANJ A;  3IGZ B;  4LRC A;  3E2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...