3TX0A

Unphosphorylated bacillus cereus phosphopentomutase in a p212121 crystal form
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
Knots found
sequence length
391
structure length
391
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDTMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Phosphopentomutase
publication title Molecular Differences between a Mutase and a Phosphatase: Investigations of the Activation Step in Bacillus cereus Phosphopentomutase.
pubmed doi rcsb
source organism Bacillus cereus
total genus 143
structure length 391
sequence length 391
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3tx0A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3tx0A01
3BDFA 4LQYA 1KH9A 3WAYA 5C66A 4NWJA 1FSUA 1N2KA 2QZUA 4FDIA 4LRDA 3NKPA 3T00A 4LRAA 1EW8A 4NWXA 3OT9A 4UPKA 4YR1A 4ZG9A 1AJDA 3UO0A 3IGZB 3NKOA 1ED8A 5TJ3A 5GOVA 2GSOA 4KM4A 4MHXA 4LRCA 4KAVA 1URAA 3NVLA 2XR9A 3TWZA 3MK0A 2W5TA 3NKMA 1B8JA 4UOOA 5DLWA 3TG0A 4LR7A 3DPCA 1HDHA 3ED4A 1E1ZP 3NKRA 3T01A 1E33P 5IJSA 4GTWA 4CXSA 1ALIA 3E2DA 4QAXA 3BDGB 1URBA 1ALJA 1KHNA 1E2SP 5LQQA 3LXQA 5K4PA 5DLVA 3M7VA 4ZG6A 3WAWA 2W8DA 3DYCA 5EGHA 2GSNA 5KXAA 5HRTA 2IUCA 4FDJA 2IFYA 1ZEFA 4KAYA 5AJ9A 5IJQA 4UPIA 3WAVA 5DLTA 3IGYB 2GLQA 2ANHA 1ZEDA 2GSUA 3BDHA 2W5XA 5L0BA 5EGEA 1ANJA 3T02A 1SHNA 4ZGAA 1ELZA 1EW9A 1HQAA 2ZKTA 4GTZA 3UN5A 1KH7A 2W5RA 3UN2A 3SZYA 4ZG7A 1KHJA 3WAXA 1ANIA 1O98A 1ELXA 2W5SA 1KH4A 4UORA 4CXUA 4LRBA 1ALHA 3SZZA 3KD8A 4KJGA 4LREA 3Q3QA 1KHKA 2VQRA 1EJJA 1KH5A 1EI6A 1KHLA 3M8WA 4CXKA 4B56A 3NKNA 1EQJA 4GTXA 1K7HA 1Y7AA 4MIVA 4MY4A 4LR9A 1ALKA 1HJKA 1SHQA 5L0EA 4CYSA 2G9YA 3MK2A 5GRRA 2W5QA 3TX0A 3A52A 4TN0A 4UOPA 3UNYA 5LRNA 1ED9A 5L0KA 1AJCA 3WBHA 1E3CP 3BDGA 4LR8A 3M8ZA 3MK1A 4LR2A 1EW2A 1N2LA 3IDDA 3B5QA 3NKQA 1P49A 4N7TA 1Y6VA 2X98A 4GTYA 1AJAA 2W5WA 1ELYA 2IUCB 5INHA 2W8SA 4UPLA 4UPHA 5LIAA 2D1GA 1O99A 1AUKA 2XRGA 4LRFA 1ZEBA 2GA3A 2W5VA 3UN3A 4CYRA 5LRMA 2RH6A 1AJBA 4KJDA 3M8YA 3CMRA
chains in the Genus database with same CATH superfamily
4W4MA 2YNIB 4ANDA 3QJJA 3GIKA 2BE2A 1GQEA 3LQVA 5I42B 3UO0A 2HK2A 2KXNB 3AFGA 1Q53A 3KUHA 2UUCJ 4DV7F 1FKOB 1RWUA 3KLHB 3GV8B 4P74A 1QSLA 2E7VA 5T7LA 3OTDA 4NLRA 4ZDNA 2HWTA 4C97A 4DF4A 2ZWOA 2FZKB 2R3VA 4X2BA 4Y2KA 3FFIA 2AYBA 2M7SA 1JLBB 3CJQA 3ZTOA 1KHWA 1T9WA 5CQGA 2PA3A 4W92B 1DTTA 4DV1F 4CXKA 5A8KB 5B09A 3LP2B 3JTPA 4Y3CA 3PVXA 1BY9A 4ZLLA 4P6QA 2MXYA 4M63A 1R3NA 2VFTA 3CD6S 4OX9F 4DV5J 1UMJA 4LVOP 1NK8A 3T3FA 4PG8A 4ES2A 5M2UA 3VQSA 4MAKA 1YZ6A 4WFZA 3PM9A 1FDBA 3NRBA 1ZA1B 4BC7A 4H4KC 2BMBA 1VQKS 4G6VB 5E7OB 1XNRF 2WK4A 2Z4PA 2ROPA 4USVA 2XNQA 1Q86T 2OD4A 2XG8A 1G4CA 3OHBA 5F8LA 4IG0A 2OPPA 4Q2LA 3W2WB 2W8DA 2PO4A 1FKAF 4CI0B 4RW4B 4RNHA 2L9WA 4EO8A 2Y8YA 2EFNA 3KLFB 5ETSA 2QLJB 1WHYA 3C16A 3T5LA 4KTQA 3V4MA 3EXYA 3C46A 4OYXA 1EJJA 3QAUA 1UKUA 2Z2ZA 5B0EA 3QPIA 2VA2A 4P73A 1K0TA 1OY6A 2M2BA 3UD3P 1GMUA 5BR8F 3BKTA 4FP9A 1SIWB 4P10A 5KFIA 4UQTA 2XRGA 1NHUA 3FBEA 1TTHB 3BSAA 4YR3A 2H5EA 2XY7A 2XLJA 1K47A 4I6WA 3FJ2A 3G6XA 3ILIA 4A4JA 1HWLA 4OYBA 4RNMA 1RTIB 3DGPB 2QMWA 4NA3A 1Q95G 1RAFB 1WC4A 3PEJA 1LWEA 3C14B 1NUEA 3DPCA 2AGQA 3PR5B 1M5SA 4F2RA 1FRMA 3V2UC 1NEEA 4R5PB 2HHQA 5HJXA 5L0BA 4TU8A 3QGGA 3M8PA 1ICEB 2ZC4A 2DNPA 3H90A 4BS2A 1HHTP 4DV6F 2E1CA 1E6VA 5EN1A 4HHJA 2MZ1A 3LP1A 5C2CA 5K8PA 3O3LA 5KFEA 4O0NA 3VWSA 3CMAS 2ZVSA 3PYFA 1DURA 2MY8A 1OS5A 1C0UB 2FJWA 1FVSA 5C24A 2D3O1 1HHSA 1O5JA 1RHQB 3CC4S 5LM7E 1RYRA 2R7SA 4M5DB 2YNFA 3O1LA 3NBPA 3IWNC 1BQNB 1YJNS 2DNZA 2E5LF 3GQCA 1XK8A 4C0HA 4P2SA 5ETNA 1RABB 2FZGB 3TZXA 4CLKA 2V0NA 2J9DA 2LP4A 1B0TA 3VGUA 4X4TA 3FEYB 3FSIA 1WSRA 2YBVA 2OEKA 1NCLA 3ADAC 2E7WA 2B6AA 2F3JA 2RUSA 2AD9A 4UOFA 1DAXA 4Q5VA 1VQ6S 4FBUA 2HSEB 2BXJA 5LJ3Y 3GV5B 4ECRA 2HQDA 4CLYA 4U9RA 3K59A 4DL0C 4KFBA 2AV5A 3QFHA 5E41A 2FTRA 4QWBA 1D09B 4JI1F 4GO7X 4M5MA 3A52A 2XHWA 3UWTA 2FIUA 2BJ8A 3Q8UA 4UOPA 1ED9A 4K5RA 1MN9A 2QSWA 2WB4A 5HO4A 4WJBA 3DOKA 2ZM6J 2MKYA 3AQOA 4F04B 3W8GA 4J37A 4JI0F 1MG7A 5INHA 2W8SA 4DR3J 2YQ0A 2PN6A 1IWAA 5KG0A 3K2YA 3UN3A 3O2IA 4RWXA 5KT5A 1UL3A 4KRWA 3QWPA 4A8KA 1CPZA 1VQYA 4MT1A 3U1MA 2MQPA 1N36F 3GSIA 4NXNJ 4PUOB 5B0CA 1EW8A 4HH1A 4QPTA 1OWXA 1VCTA 4ZHRB 2V63A 1Y7PA 1WEXA 5IC6B 3US5A 3IM9A 3LPEA 2DNGA 4ICLB 1U47A 2Z2MA 3GR1A 1W7WA 2PFDA 2NLWA 3TAMB 3QFWA 2VKZG 1VC6A 3WC2A 3JSRA 1SL2A 4HLBA 2KTQA 3GYNA 1J27A 1SL0A 5A2QY 3I5AA 1B0PA 1TV6B 3G2XA 1N5TA 5L38A 4Q8EA 3I4PA 1IBKJ 2HWHA 4C8YA 1FJ7A 2VQRA 1L3SA 2UXBF 1NKCA 2UXDF 2CQHA 1BWVA 2FVSA 1R0AB 4Y2MA 4Q0BA 3CJKA 1N88A 3ZTRA 3GFZA 1SJQA 3KK3B 5I3PA 3JS9A 4EYHB 3OTBA 1U49A 2Y1RI 3MMAA 1RZMA 1LWCB 3HHKA 3UPFA 2QZUA 3SQGA 2CKWA 3L7OA 1YJTA 3OQ2A 5CYMB 2WVEA 1T9VA 2LCWA 2XMUA 3A1YG 3OXLA 2CJYB 1IBCB 1L3UA 2HYIB 4BCAA 2IRUA 5KFTA 2E29A 1ZM9A 2FDNA 3THTA 4DMZA 1XTZA 3QWUA 5D8HB 3R6GB 2K2PA 2BABA 1JNZB 2BJ1A 4ZGAA 5IT0A 2XMWA 3MM7B 3NOCA 4KY3A 4D3GA 2A3JA 3OTOJ 2UXCJ 4DV0J 1IR0A 3UDEA 1WOSA 3NGTA 3KLIA 4DR6J 1PJ6A 2IRYA 3D68A 2W5QA 3LGMA 3UDLA 2ERRA 3BDEA 4LBPA 4DUZF 2E1MC 2X7IA 4X66F 2F9JA 5GAEI 3T1YF 2D41A 2J6UA 4FF2A 1FTCA 1UFWA 1HPZB 1P49A 1S49A 1PBUA 1ELYA 2HNZB 4WIIA 4WF9Q 1AUKA 1HWUA 1ZEBA 2MZJA 1HBNB 2HNYB 3I6PA 5U47A 1F60B 2DJWA 4KJIA 2G2OA 1WTFA 2OPRB 3TEGA 5LSLA 2C3PA 2VV5A 4DV4F 1PBAA 3G82A 1VJQA 5F8HA 4GC6A 1RDRA 3G8TA 1KFSA 4PCQA 1QTNB 5KT3A 2LEPA 2MKSA 4PXEA 2CIMA 1NPKA 4PPDA 1Z4UA 5KFVA 1OYEA 3GFYA 3I4HX 3PYDA 4IOCQ 3T1AA 1ZM4A 4ZJQA 2Z56B 2BJ3A 1UFLA 4FF4A 4F25A 4PG7A 3D1HA 4DFKA 4C0BA 4DPYA 2DTJA 4MIAA 2W5SA 1V6HA 2AYEA 3OVBA 3HHNB 3QGIA 2B0GA 4CNZA 2FLLA 3W2VB 4ECSA 1VQNS 2PGCA 2V4JB 2F40A 3DLHA 4I4BA 2VJUA 2FLNA 4O3PA 1TL7A 3ILLA 1K0VA 4UPLA 3T1HF 3M8YA 1W2BR 2O5DA 1FSUA 1IBLF 1FJCA 3VV2B 5IC4B 3DLBA 5G0RA 4EU0A 4UY85 4OYOA 1IJEB 1NZ8A 2RHQB 3MI7X 3C8YA 3AJ1A 1TL3A 3HHLA 4QU7A 2Y9HA 1GH8A 2H65B 5ETTA 3BZQA 4HDHA 3D5MA 4NLOA 4YDXA 4DHVA 5J1EA 4USJC 3MF5A 1X0PA 3B82A 5KFRA 2QT7A 5E5NA 1FDAA 3D0GE 3HD1A 2HBQB 3CCUS 3RB6A 4CCHA 2HHUA 2CQIA 3HULA 2CQCA 5F0WA 1RTDB 3SV3A 1KHKA 2DKOB 4IH6A 3JSMA 3FKBA 4UF4A 3PKYA 2MHNA 1WC5A 2E9TA 2C42A 3BDGA 3SDEB 3DGVA 1YKWA 3CJ8A 5A2QU 3IRXA 2WOMA 2X1GA 2R2TA 1JLCA 3MM8A 4DS4A 5FJ4A 2DO4A 4OI2A 1RYSA 4KSEB 3PDNA 2B7CB 3T5JA 5GOVA 3UDVA 1UA1A 4F3MA 2B3TB 4B9MA 3LTOA 4EI2A 1TK0A 5J2PA 3QJPA 1EKRA 1EB0A 3PY8A 1VQ4S 1RT4B 5F0UA 2XM3A 4NA1A 3OD2A 1P27B 3QRPA 2M3DA 3EGNA 2R8GA 5B0BA 2HS3A 3SYZA 4KO0A 5IWAJ 3ET6A 2WRMA 4RLEA 4USWA 4DR7F 5EGEA 3CCMS 4UUXA 4CO2A 5KFHA 1RBOB 4WP9A 4OHVA 4KPCA 5HVGA 1K73T 3W3SA 3IWLA 5ETRA 1K7HA 2ZC3A 4DV2F 2MKCA 1NK7A 2ZD1B 1RT5B 3PNIA 4FF1A 3R7SB 2B9WA 4DXLA 3NGSA 4F4YA 3IO1A 2HVHA 1NJXA 5HI7A 1JJ2R 4K7QA 1U1QA 3KMSA 2FHJA 4KH1B 3FMBA 3H5SA 4F02A 3VZIA 4FDIA 2AQ4A 5CYQB 2UZAA 3KHHA 5IS2A 3KWMA 2B7BB 2JFDA 2GJFA 2ASJA 3TUZC 4YB1P 2AZ1A 1TAUA 1UA0A 3FEZA 2LXFA 3RW6A 1FCAA 5GMKa 4B3SF 2YH1A 1NPPA 4UT4A 3PFEA 2C2OB 1GNKA 3UR0A 1S59A 2KVIA 2EBGA 5DS7A 4AXJA 4N56A 4FPRA 1O98A 5L8RC 5KFKA 2DH9A 3R5CA 1JXEA 4GKJF 5DDRC 3CGIA 4QWDA 1Z2ZA 4C7QA 1J5OA 3FK4A 2A0FB 4O3SA 3HM9A 5HAOA 4N41A 5RUBA 4KV8A 4CLPA 5DDOC 3BQ2A 3SV4A 1N2LA 3GCXP 3MMBB 3P6YC 3W64A 3MEEB 1VC0A 4NXMJ 1R8AA 2UV8A 2AJ2A 1JLFA 4IRDA 4LQYA 4ZPWR 2WVCA 2DNOA 2HZCA 4NLPA 3NGRA 1NH8A 4WKRA 4F2SA 4WZMA 3TP2A 1ED8A 1LK5A 1S79A 3NCRA 4L6V3 1ZBTA 3R1LA 4KGXB 2BE9B 4PWDA 1NSPA 4HI1A 1D8YA 4PG4A 3VAIA 1E33P 4ZLNA 2M8DB 1HBUA 5EHHA 2CPYA 5EGHA 2L9DA 3V81B 4P52A 4OL8A 1BC6A 3QMQA 3CCZA 1XMOF 3CDWA 3GILA 1X9WA 2ROEA 1URRA 2W9AA 4MIWA 4ZG7A 4F3QA 2ZH7A 3M1VA 3OFFA 1NLKL 2K3KA 1KR4A 5KT2A 1N6QB 3I87A 4KKOA 3E01B 3X3UA 2K8GA 1WG5A 2JEGA 5AT1B 1GEHA 1M5HA 1RKJA 4WK1A 2MLXA 4I2QA 3GFXA 1FX4A 2I8EA 4ZCIA 3CDAA 3H5UA 2JHEA 4RW8B 5F8MA 4N7TA 4EZ6A 3TA0A 5DZ7A 4NLTA 2W24A 1KLMA 2CVIA 4ANEA 3DHWC 2EKNA 3VAFA 3MUTP 3A3OB 4DCJB 1L5UA 1FXLA 1RXOB 3QSIA 3WX4A 3DLGB 2KN4A 4A8SA 1VQ9S 2XMTA 2FGCA 1KRPA 1RWPB 4DV3J 2WONA 3C6UA 1TUWA 4NI2A 4MYTA 1ZAXA 2RDDA 2OI2A 4QYRA 5ADZA 3MECB 1VBKA 2ZUAA 3LP0A 4QAXA 1HQEB 2R7VA 4EMDA 3F56A 1IBMJ 3H2VE 3AJ2A 3KNAA 1VYAA 4Y34A 3RRGA 4LBIA 1HNZJ 4L73A 1ELZA 3R5JB 1KHJA 3QO9B 2ATCB 5JJBA 3KD8A 3LO3A 3I0RA 2IA0A 1KH5A 4PPZA 3POTB 2WSFC 4JI5J 2YTCA 4KBIA 3QRQA 2AX1A 1VQ5S 3I9ZA 2YKPA 1DJ0A 4Y2AA 3QZ8A 3HHDA 2VBXA 2P9CA 4LR8A 3M8ZA 5ETVA 1LFPA 4IH5A 1RT1A 5IV4A 1NK0A 2JOQA 5L1KA 4HVZA 3LANA 4D3HA 5J1PA 2M9KA 3DRPA 4ED6A 3VAKA 2RF2B 1DLOB 4MK8A 3QGHA 4OLPA 5B0FA 1Q0NA 2B4PA 4IH7A 1CC7A 2ZJPQ 1GFWB 3I31A 2XGQA 2MZQA 3G6ES 2QRRA 1FFGB 5FLXY 2LKZA 4QWCA 1RI7A 4FNIA 1U2RA 3DU5A 3TA1A 3NL0A 4JV5J 2R7RA 2CUYA 3M9MB 1MU2A 3CDEA 3WAWA 1JJCB 2IUCA 4CTAB 2FY8A 2JC0A 4IYQA 4FNHA 2J6SA 1OQ6A 4XDCA 2CADA 2HFSA 2M8HA 1XMQF 1RHUB 1OSDA 3H4DA 2E7XA 2ZH9A 2D74B 2HMIA 1S9EB 1KONA 1X5PA 3MEKA 2C2KB 1S12A 4HTJA 3WC0A 4F36A 3VAHA 5KOXA 4MKAA 4LSNA 4JBCA 4NZ7A 2NUHA 3FRZA 1SB6A 3DMJB 2OELA 4ER8A 5KG1A 5TJ3A 3Q8RB 4HACA 3KG1A 4MK7A 2QZ8A 5HMWA 2R9LA 1X8DA 1WHXA 3KHLA 2JNJA 1FKPB 2HHSA 1KTVA 2V4QA 4DU7A 3SZ2A 4LF9J 1X31C 4ED0A 1VBXA 1LKZA 2QL7B 1U6ZA 2W01A 4H4KA 3AD8C 4F4XA 2RS2A 2BE2B 2JVRA 3DDIA 5AJ9A 8RUCA 3BS9A 4CLUA 3S6EA 4IFYA 4XAKA 2MJNA 1YJWS 1VBYA 1R27B 2BJEA 3TQ1A 4X64J 3UN5A 4KGKA 3SI8A 4C0OC 4UOGA 4WCEQ 1YBUA 2FHKA 3FCWA 5I42A 5LOQA 1ALHA 1VDHA 3BKFA 3H8YA 2CPEA 2C2NA 3VVTA 2GVDA 2CPXA 1FKOA 4R8UB 2OLWA 3KLHA 4I7FB 3J7A1 5HLFA 3P96A 3W8PA 5ETLA 3W5XA 2XLKA 3NWRA 3CD5A 4FDFA 2GW8A 4FYDA 2UUAF 1F9HA 2OTJS 5I4MA 4LMZA 5L9XA 1RJJA 4JI4J 2KHDA 4PABA 3SQOP 1WTBA 2P5VA 3VAMA 4OI0A 2DNLA 2W8LA 2CRLA 2BKPA 1IKXA 2AT1B 3CIZA 4K5SA 1Z2LA 1MLAA 1FA0A 1VQMS 2DPJA 5ETQA 3CO0P 3P3DA 1X4EA 2FYXA 3LALA 4AE5A 4K4SA 1U8WA 1C0TA 2DR8A 3GG0A 1WHWA 4OJHA 4DZ6A 2XBPA 7FDRA 4RNNA 4ZPBA 4ATNA 3H7HB 1RAJA 4HL9A 3G87A 4IG0B 1X5SA 4CP5A 1FD8A 1ELXA 1RBAA 2IM0A 3DKDA 2OIHA 3PJXA 3DXSX 4QZVB 2DGUA 4B9UA 4I0WA 4NLYA 2XLIA 3RBZA 1UTAA 5IV3A 3I5CA 4AUKA 3TZYA 4RNOA 3AOAA 3C16B 1GMVA 4LSLB 4M5LA 4NRTA 3NWGA 3RW7A 3KUEA 2W2NP 4X65F 2WBRA 3OPKA 1ZA2B 4AQYJ 3KLFA 4KJDA 5C2GA 2IVFB 3ZZYA 1HLWA 1JJHA 4YR1A 3TRGA 2GQQA 3PTWA 3KK2A 4X4UA 2I38A 1MMLA 3S01A 3N5FA 4OX6A 4QIFA 1MMNA 4A47A 2UP1A 2Y0BB 4RZRA 3FZBA 5T41A 4C48A 3J80Y 2AWZA 1IKWB 3KK1A 2PEHA 3FCHA 2GLQA 3QIPB 3FC9A 2NR0A 2ZVIA 1MWYA 3B6BA 1RTIA 2DH8A 5DETA 4CH1A 4WK3A 2G0CA 1RLDA 2HVDA 5HQMA 4DR2J 2JLEA 2OPQB 2B4OA 2UV8G 3TYTA 3HSDA 4ETZA 1ITPA 1E6VB 1WOPA 2DEIA 3LP1B 3GJTB 3VR1A 1T9UA 3HF5A 1WC6A 1MN7A 1NM2A 4WU2A 3TNVA 1SI9A 2GGPA 4RJVA 4JI8F 3X1LB 1HNXF 5C24B 5HANA 4FYYB 1RBLA 3EPIA 2UU9F 3L4BC 3CJ3A 3DLLQ 1LXJA 2YNFB 3R97A 3IS9A 4TU9A 3NBPB 1SKUB 2ZBCA 2NS1B 2QA4S 3GJSB 4CT9A 1MMDA 4M5DA 4F3OA 2QC3A 1WSVA 3QJLA 1R43A 3ETMA 2CYYA 3OW2R 4WXWA 4S0MA 1G1XA 1BQNA 4CLLA 5E3CA 2RAQA 1FXRA 5KFSA 2YKMB 1HI8A 2OEJA 3UE2A 4L76A 2RVJA 3QIDA 2WW8A 4ECZA 2DNNA 1NNDA 2MZSA 1ZZFA 2JWNA 5DO2A 2AJ1A 2F65A 3AXKA 2MYFA 3VVUA 1U48A 1U1LA 4OJ1A 4OYAA 1VHFA 3DC2A 1VK3A 2VC1A 3KHGA 1U24A 3DOKB 4KM4A 4TVAB 4LVNP 1R6YA 1CS4B 5KFWA 3UCUP 2CPJA 2CNOB 3D1QA 3NCQA 3PV8A 3FRYA 3N0VA 4L72B 4LF8J 5LMUF 2VG6B 3BGUA 1N5SA 4WIQA 4QQBA 3L3CA 3W5YA 3E8OA 1QUVA 4KYZA 2C22A 2RJZA 1T11A 1GX5A 3IFEA 2IBKA 9RUBA 3IGYB 1AFJA 1H38A 5J2NB 2W4CA 3M8QB 3A4TA 3UN2A 2W5RA 4PUOA 3ZZPA 4G65A 3MD3A 2HQ3A 4ZHRA 1UETA 1HL6A 3R5DA 3FSYA 2AGOA 4ZOSA 4CRJA 5BXIA 4FYXB 1X4CA 3HVRA 2KJWA 2LA4A 4LQ3A 4NCAA 2H4WB 3TAMA 3TVYA 4AXIA 3NNHA 4P72A 3L9ZA 3PKMA 2R4FA 5GADI 2QSFA 3CJKB 2HZVA 2APOA 3TUPA 3A13A 5E3QA 2UUCF 2BOPA 2KH9A 1RTZA 2LECA 1T9YA 1R0AA 1RP5A 4ZPTR 3Q8YA 3SQGB 2PSZA 1M5OC 3RYLA 2JZ5A 3VHQA 5K4PA 2GAHC 3AB2B 2HRTA 4C3MA 1PYOB 4PR6A 4FYVB 2XB2D 1LWCA 1P1TA 4OHXA 1S1UB 2VD3A 2VG7A 5DM6Q 3HK2A 1IXKA 1RCOB 2AIRB 3FDSA 2VBYA 4A8OA 3MAHA 1U1PA 2GAGC 4OZ5A 4PWWA 1F3VA 4B3TJ 4MIVA 4OX8A 2DIUA 2HQCA 4NLVA 1T3NA 1PO6A 2PIIA 4QWEA 2CJXB 1T3OA 4YR2A 1XBWA 3J80U 1UW4A 3R7NB 1RUSA 3EVOA 3KLIB 4WPAA 2RH6A 5H1SV 3H4BA 1KH9A 5J2MA 2XYPB 4QIGA 3I32A 5D0RA 3OL9A 3IR6B 4J9OA 3LOUA 4HT7A 3KDNA 5CCMA 4IQXA 4Y2IA 2HHPA 3OFGA 2MZRA 4NYZA 5D0HA 1VQOS 3JTNA 1N5VA 1EP4A 5FDLA 5SZTA 2HHHJ 4LFAF 3G82B 1KS2A 2AEJA 4CM0A 2BKOA 3E2EA 2HNYA 2X3GA 3DXBA 4BWMA 4ES3A 3FQLA 4QIWD 4LBHA 1U09A 4FKXA 1QAYA 3IG1B 1UPPA 3GIRA 4B9LA 1YLXA 3M30A 5GRRA 2AU0A 2U1AA 1FE4A 2ZZMA 2V8HA 5HSPA 1YWXA 2HIYA 1APSA 1O51A 2MMYA 9ATCB 2FY1A 2F4VJ 1EAYC 5A8RA 4CH0S 4DFMA 3D7SB 4LF7F 4RU2A 4DV1J 2Q79A 1M1KT 4PXDA 3I9V9 4TLRA 2IJRA 2ZOFA 1FRLA 4ZP9A 4NCBA 3OHAA 2LQ9A 3C6TB 2KFZA 4OX9J 4LFBJ 3FSXA 2JEJA 3ZZTA 1JX4A 4O3NA 1NMEB 3H25A 4K0KF 1N32F 4G1PA 4CM2A 2KM8C 1YSJA 4GTWA 1JMTA 1ALJA 2HFZA 3GONA 1BXNA 4U96A 1XNRJ 3IR7B 2EC2A 3NAHA 3HHLB 3PIPQ 3N28A 4ANCA 1HNWF 1U2FA 2IPOB 2N3OA 3WDOA 1YJ9S 4XIUA 2QN6B 4N8OA 3I5BA 4ZMMA 2V34A 3G86A 1T03B 6FD1A 4KR0B 4L74A 4IDKB 4DUYF 2ZHBA 1TL1A 5EGYA 3AT1B 4ZVHA 3JSMB 5HROA 3IMQJ 4O3RA 5LSRA 5SUHA 1RTDA 2VPXB 5C42B 1AJDA 3IGZB 1FRXA 1P9YA 5KFFA 1HBOB 5BR8J 2VA3A 5K8NA 4X84A 3R8YA 3IRXB 2VPWB 1YBAA 2YWGA 3MM8B 4OQJA 3UD4P 2DXEA 2YNGA 3MDFA 4J5OA 2LA6A 1PJ5A 1D9FA 1I51B 2CA9A 2VODA 2KG0A 4N76A 5J2PB 1SPBP 4RR5A 2KI2A 4I69A 1HD0A 5AXLA 5GAEU 3BO2A 2IHR1 2DXDA 4F50A 6AT1B 2YKAA 4CH7A 3IN5A 3KJFB 4IG3B 4B3RJ 2KFNA 5KFCA 4TN2A 2ALZA 3ET6B 1RADB 1RT4A 2HFVA 2HVIA 1QUPA 2ZM6F 3JYTA 3Q2SC 1JLGB 2VH7A 1YRXA 4DV6J 2AW0A 4WFYA 1BGXT 3ZNUA 3ZO7A 2RNEA 1VHIA 2VG5A 1WC1A 3CCRS 4LIRA 4QYZK 3QZ7A 2CDRB 2D69A 3CDBA 3KJQB 1FXDA 2QYGA 3K0JA 2GSOA 1CBKA 1TUVA 1S1VA 3OVAA 4WWSA 3P5TL 3S1TA 3FZ2A 2ZD1A 5AJ3F 4JI2F 4C2MA 1CJKA 3LWLA 2H54B 1OY9A 1RWKB 1VQPS 2E5LJ 2DVIA 2LDIA 2B43A 4DL3A 2BZ2A 4ECUA 3QT8A 2CDQA 5MAOA 2JL9A 1PAEX 3M4XA 2Y3YA 1T7PA 4HH0A 4M5JA 3G8SA 4YOEA 2P6SA 3BM7A 3ILJA 1Q5YA 5CZVA 4RBTA 2E66A 2MKIA 4ZKAA 1BWEA 3CULA 2H4YB 1DTQA 3ISNC 1UJ5A 3M8WA 2VJVA 4GTXA 5L0EA 2DISA 1NPRA 3GIMA 1UJ6A 2QE5A 3EE3A 4HEA9 4M5IA 4OYZA 3THPA 1UAWA 1NDCA 4W98A 3MR5A 2MQLA 2RMLA 4NASA 2XMKA 2GA3A 3NLCA 4JI1J 3DLKA 4FZVA 4LFCJ 2BQ3A 3W66A 3LAKA 4P7TA 4TYAA 1J5OB 2DR6A 2LXIA 3AOBA 4PYAA 4KV8B 2G2YA 1KQFB 2XMVA 4LRAA 4I6AA 1H2VZ 3UQSA 3PW2A 2AP6A 3EX7B 1EZZB 4JI0J 1BHNA 1IVZA 1JLFB 4ID5B 5DLWA 1QSSA 2FLPA 2D1CA 2VZ9A 1QAIA 1N36J 2NXEA 3ETOA 4DZDA 2LXUA 2AEMA 1EQMA 5E33A 4TY8B 4N8NA 2WHOA 4PWDB 4DQQA 4KHPJ 2R2UA 4ECTA 1HBUB 3C15A 2N3LA 1HHQA 2UXCF 4USUA 1S76D 3ZZRA 3RR8A 8ATCB 4A48A 2QL5B 3A12A 1NRKA 2G9YA 2WVDA 1UEUA 3N5BA 4TN0A 3UNYA 2E44A 1AJCA 4B9SA 3A8EA 5L46A 1AXQA 4IFVA 1XR7A 3CCLS 3M1VB 4WKYA 2MQMA 1RISA 3WIVA 1S0OA 3MEDB 1YG0A 4WZQA 2UXBJ 1H7XA 1LK7A 1OQ3A 2UXDJ 7FD1A 4XPEA 4DPWA 3SCLE 3CUNA 2BRKA 2GVZA 4C8KA 4I2QB 3B54A 3AQPA 4YB7A 3EWGA 4UW2A 4AL7A 2ZDPA 2EG2A 4U7UK 4YHHJ 4Q7AA 3CJ2A 1N6QA 2CZVC 2BBEA 2CZ9A 1T0TV 1R8BA 2VBWA 2GV1A 1KLMB 4O4GA 4YP3A 1S6QB 4DFPA 2M88A 3HVTA 1KHVA 1WDTA 2I0XA 5IT4A 3TANA 3LH2S 1SQFA 1JNRB 1Q81T 2IC3A 4I68A 2WONB 3QSYB 3C6UB 4NI2B 4CO1A 1NJYA 2C2RA 2V67A 2MQQA 5D4OA 3NXZA 2OSQA 3DLGA 3LP0B 3DLJA 2XMJA 4OYWA 4LREA 4P2MA 1DZ5A 1WKKA 3EGZA 1N5QA 3GSDA 2HGNA 4CYUB 3MECA 4E98A 1WG4A 1M1HA 1SBRA 4P2XA 3CXCR 1HQEA 1XMBA 4LF2A 2XULA 1FJGJ 3QAEA 4J9UE 5DQIA 4LF1A 1JLAB 4X62F 1Q7YT 3R5BA 2COLA 5D3GB 1REVA 2JLFA 1FT8A 1K1SA 1GMWD 2BJDA 2GC8A 2EFGA 4DUZJ 2BX6A 4KHMA 4X66J 2GX8A 3T1YJ 3ENQA 3IGVA 1AB8A 3BH7B 5CCLA 3DRPB 4ZPVR 2AF6A 1S4FA 4ZPAA 1E1ZP 4JI3F 3BBCA 1TMJA 3WX8A 5IZHA 2GA7A 1H74A 3BR8A 1AROP 3OUYB 1SC1B 1T9XA 2HURA 3MCMA 1C4AA 2GFFA 1FHTA 3Q8QB 2DY1A 5D0EA 2DRBA 3EXCX 2JRSA 4C6AA 2ZHAA 2CJKA 4JV0A 3KJVB 3EPGA 4UORA 5EWFA 2V69A 4WXOA 2EI5A 1QTMA 2FVRA 4ED2A 3AHPA 2K06A 3ZNJ1 3L09A 2HMIB 3MR2A 4QW9A 5EWEA 5A6WA 1OJ4A 3BQ0A 2HK3A 5D4LA 2KRBA 4DN0A 5GAHI 4CXSA 2ACYA 2P9EA 1S9EA 4OV1A 5IQ6A 1TU0B 5HL7Q 4IQMA 5KT6A 4YN3B 2F5GA 4M8LA 3FBFA 2K3IA 3SSRA 3D6MB 1IBLJ 1HW9A 1HYSB 1SJ1A 2C3UA 4GVLA 1ZEFA 1HARA 4HACB 4DPXA 5IWAF 2HAIA 5JXSA 4B17A 1SHNA 1UFKA 1TFWA 1OIAA 1R31A 3DMJA 5K8OA 1IQZA 4CXUA 4DN9A 4GMKA 1R89A 4IFYB 3RAXA 4ALZA 2B8PA 3NGDA 1TZ0A 3VCDA 4B02A 4ZPDA 3DN9A 3K8VA 3BN7A 4ED4A 4P71A 2YNHB 4JYAJ 1ZAVA 2RSQA 2CJQA 1U7LA 2BA9A 3DU6A 2ZH8A 3VAJA 1X9SA 1KWMA 2XZDB 2GVDB 1VS3A 4YB5A 2FJEB 3N6LA 2DYAA 5HLFB 5EX3A 4LJMA 2RDJA 3PRVA 2PFFB 2KKHA 3CT9A 3PRBA 4Q44A 4LUBA 2F8HA 4QU6A 1DY3A 3BO3A 4OYMA 4R8UA 4I7FA 2W7AA 3N4WA 2RIJA 1JLEA 4ED1A 2K7KA 3EZOA 2YQ1A 3CTRA 1IKXB 1HQUA 1XNQF 3CJ4A 2AKWB 4H54A 3F41A 1KOHA 2UUBF 2ABYA 5HQ8A 1L3KA 2AGPA 4K4VA 4E8UA 4QWAA 4DSFA 3QGPA 1OSCA 3Q3QA 2A10A 4YR0A 1C0TB 1VQ8S 2VIHA 1J5EF 3NP5A 2MSSA 3MK2A 4ZVPB 2OH2A 2E9ZA 4ZP7A 4DPOA 2PMHA 4DR7J 1Z1ZA 4ZVRB 4K8RA 1S0NA 2O66A 3IDDA 4A8QA 3PW5A 1T95A 3JSBA 3AOCA 4DV2J 5K14A 3OSPA 3KXDA 1WORA 3NMAA 2EBEA 2WZ1A 1SH3A 3UFCX 1GT8A 4YEAA 5DGAA 2D9OA 2QGFB 3KMQA 2FJAB 4YFUA 2C2DA 4H4OA 1OPZA 4DPUA 1MWQA 3MMCA 4ZVOB 4LSLA 1LOUA 2Q1LA 2NZCA 2QTWA 3HD2A 3BO4A 4ZG6A 1RAGB 1YRUA 2Q43A 3KK2B 4ZP6A 1EARA 2QA1A 3DRRA 1LQ9A 2K7JA 3CC2S 1LXNA 4KT0C 3CNQP 5FIIA 3T02A 2KHCA 2FJBB 4ELUA 1A7GE 4ED8A 2HGLA 3PW4A 2HPUA 2ADCA 3ZZZA 2YKQA 4B3SJ 4KQZA 2R7QA 1RAIB 3D54A 4K2JA 1ALKA 2G0JA 3KK1B 3PJ9A 3UCGA 5L1JA 2AYGA 2NSCA 2XY6A 4RW6A 3DI6A 4GKJJ 1IKWA 4B3OA 3QIPA 3BGRB 1SC4B 4K4UA 4RNFA 5DDPC 3CJ0A 1CJVB 1CULA 2RDIA 1UWBA 4OZLA 3D0HE 3MGJA 4FXWA 3ZC4A 2MTLA 2G13A 3WHIA 5GMEA 3NKMA 2ASYA 2OPQA 2J7KA 2AX0A 3CJTA 3PIOQ 1KVIA 1CG2A 4JV2A 5AXMA 3WZ0A 2GGPB 4NWBA 4R0EA 3WBZA 2VQEJ 5DJBA 2RHSB 4P2FA 2QYCA 2ZNYA 4F0MA 4XO0A 1NHKL 1DQAA 3IS9B 1RT3B 4E0DA 2W5XA 3KLGA 5KFPA 4PZVA 2CPIA 4NE9C 5CYJA 2W7PA 2NZ4A 3G6VA 2F4FA 4JI5F 4CYSA 3BSCA 5CD4A 2NXJA 1XMOJ 2HHWA 2WW4A 4QR1A 3TAQA 3W63A 4J91A 2V6AA 1S1TB 3SCKE 2QLFB 2KT2A 3OL7A 2HQFA 2PMWA 4M5NA 5C66A 1N2KA 5DDQC 3MEGA 2DNQA 2EW9A 3W9JA 2YVSA 2YKMA 1N34J 4LF6F 1X4FA 4OFZA 2H1YA 2XC9A 2X1AA 4URSA 2O1PA 4H4MA 2WVBA 2BQRA 2CQ2A 4XTTA 5ETKA 2W2MP 3NOGA 3E2DA 2RRBA 4NPOA 3A3PB 1D8ZA 2DHAA 1F2HA 5DRKA 1SJ4P 1NBEB 3CB4A 3MCSA 4DS5A 4C9DA 4FS2A 2N4DA 5DG8A 2QIFA 1S1XA 3PYGA 1E6YA 3SFGA 1U0SA 2XMAA 3K5NA 1RK8A 3FQKA 4NLDA 1CS4A 2DNHA 1LV5A 1SHQA 5DZ6A 1R8PA 4BHQA 3TX0A 3E51A 2C28A 3DDKA 3LAMA 4GC7A 4MKYA 3BN4A 2VG6A 1FEHA 2KT3A 2XSJA 3ENVA 2M70A 2Z58B 2E5HA 2G0IA 1FK9A 4LRFA 4ECQA 2NPIA 5H9EK 2W5VA 1RHJB 1XJWB 4IR9A 1FNMA 2IJNA 5K8MA 5J2NA 1YX2A 3M8QA 4CZCA 2LQ8A 4O0IA 1NAQA 2MGZB 3ZTSA 3FCVA 4X4RA 3I0SA 3B8HA 3MPDA 1TVRB 3D3CJ 4DJBA 4DLGA 1NXIA 1TKTB 1L3TA 3D6FB 3CSKA 3C2PA 3GIIA 4ZP8A 2J9EA 3RBXA 1RT6B 2RKIA 3A8KA 4M94A 2CAJA 1IJFB 1Q78A 1ZPWX 1FNXH 3CO9A 2CQBA 2C3YA 4WFBQ 1VC5A 5KG6A 2GZOA 3IBFB 1C1CA 4EBCA 4DX6A 2CQ4A 2DD8S 4DF8A 1TR0A 2VG7B 3M6WA 4QR0A 4ES1A 1RT7B 4OYIA 4F4KA 2L08A 1XMQJ 5A0YA 4ZA1A 2VL1A 1LNQA 3NKQA 3M9NB 4TYBA 4ZVFA 3MOJB 3I55S 2XS5A 2ASLA 5LRMA 1S1UA 1DFDA 1U6FA 4E2FB 5IOLA 2HVZA 4B3MF 3TARA 4O3QA 3AODA 2EEYA 2KL8A 3MFHA 3TZZA 1ACMB 3GG1A 2Q6CA 2W5TA 2V94A 2NPFA 4PAAA 4M1KA 4OYPA 5J2MB 1EETB 1T94A 2OJ3A 3GYXB 2G9OA 4WFXA 3DOMA 4KC5A 3AD7C 1NDKA 3JTOA 2IFYA 2W8KA 2HRYA 2RUGA 1DHMA 1EW9A 1JIHA 1OO0B 2Q6BA 3Q83A 1EP4B 2FJXA 2N4CA 5FDLB 2W2OP 4A8YA 2FHMA 2VOOA 2MHEA 3RB3A 3HPOA 2Q3PA 1RAAB 4JI7F 1G7CB 1Q7LB 1U0HA 5CH7B 4O23A 3M2RA 2YKNA 2LU2A 1WC0A 2ZHOA 2Y1IA 1O99A 4J9LA 5KG3A 1RQ0A 3M30B 4ZIVA 4EZ9A 2ACMA 2UUTA 2AHOB 5A8RB 4MTPA 1S5ZA 3IWXA 4WTOB 2VOPA 5HN0A 3IG1A 3HT3A 3P4UB 5K5MA 2UUAJ 2VASA 5F8JA 3TA2A 4ITSA 2V50A 2LEBA 4ELTA 5J2QA 1HW8A 5KFLA 2XMMA 1AT1B 2KZZA 4V1Ak 5KTQA 1PC5A 4QYZJ 3SMZA 1IKYB 3Q22A 2CJBA 2ANHA 3MOZA 3A8IA 3OR1B 4J9VA 4TU7A 8AT1B 3W5ZA 4TQSA 2R2RA 1ANIA 1KH4A 3C6TA 1S1WB 4LRBA 4RKUC 3MPUB 2IM3A 5D78A 4IOBA 1Y7AA 4DSLA 3N6NA 1YJRA 1TKXA 2DRDA 5LRNA 1N5YA 2OAUA 2YPYA 5GADU 4EEYA 1I94F 1ZETA 2XZWA 1I6JA 3GIJA 3VGTA 3O6QA 2BJ7A 2MY7A 2LFVA 2B56A 4PKDB 2UVRA 3CCWA 1FD2A 1X4DA 2L9NA 4K2XA 5M2PA 1GTHA 2IFXA 4R25A 3AXMA 4UPKA 1VR6A 1RCXB 3VF0B 5F8IA 4USMA 2HBRB 3JB9k 4X65J 2JX2A 2A2CA 1TL1B 1VRTA 2CG8A 1X9MA 5GAGI 1T03A 2NXNA 1LW0B 5HROB 2OEMA 4ZVQB 4UOCA 2FD2A 1KHNA 4DFJA 3B4DA 4QOTA 4IDKA 3HHLD 5HRTA 2GMJA 2RRAA 2VQFF 2CWXA 3W7BA 1QE1B 4ZJOA 4YY3F 3BPDA 4K59A 2YNGB 4ZPCA 1F9FA 5C42A 2KYZA 1HBOA 3PCOB 4LF4F 4N5SA 2KYXA 1SQEA 1NO8A 2XWYA 1TELA 4C8MA 3CE8A 3D0IE 2HKEA 2EC0A 1S72S 1ZTTA 5KOWA 4XDDA 1AUSL 5B0GA 4LR2A 2GMHA 3W62A 3MCNA 3J81Y 2KFYA 2HS0A 2GIFA 3JQJA 3D2WA 3A3NB 2DHGA 1ZM2A 3AH6A 5DQGA 3JYTB 2C2MB 1QAXA 2H5JB 1SUQB 3GYGA 3LGNA 1UVJA 3M2UB 4IG3A 2BVZA 4DR4F 1KOOA 2VG5B 2LU1A 3ISND 2HG4A 1N0UA 3IBWA 1T02A 1B7FA 3EJMA 1JLGA 4JI8J 4I6YA 3AB4B 3MM5A 1PG5B 1RKIA 1S1VB 2LLZA 3UW1A 1NB7A 3QBCA 3EICA 1RHMB 1Q5VA 3KLEB 2Y0SD 1RU1A 5KFGA 1CJKB 2F63A 3QLHA 3SZYA 1H0HB 1D9AA 3UNGC 3WIUA 4NCGB 2QLWA 3J7ZT 2R7TA 4ZITA 4DG1A 2C3MA 3GU0A 1U1RA 4ENOA 3ZZOA 1JQGA 2RQMA 4C8OA 5AE3A 5IT9Y 3KG0A 4ZCLA 2R7XA 1AYEA 4U6PA 3MK1A 1PSDA 1DTQB 3T41A 5HBMB 1FNOA 5H9FK 4HHHA 4HI2A 1LWXA 1S7IA 4X4QA 2E1RA 2YY3A 2FHJD 3MAAB 2ZJQQ 1WKJA 4PG6A 4LF5F 5KFOA 1N8RT 2DH7A 5GMDA 2B9YA 4YMEA 4JI6F 1X4GA 3DLKB 4K4ZA 3M9OB 3VAGA 3CCSS 2BW7A 1X4BA 1TP7A 3RBDA 4KAYA 3W61A 2R7OA 1K44A 2Y1JA 4OMFG 3DOLA 3SEOA 4GTZA 4AFFA 3TQEA 3FNNA 5LMUJ 4NMLA 3IAM9 3NKYA 3NKNA 3FUYA 4ID5A 1FRHA 2VB6A 4AYBD 2H51B 1WHVA 3I82A 4TQRA 2XYGB 1KBRA 3C15B 1SKRA 4TY8A 3H2UB 1AJAA 3MR7A 4ILRA 1D3WA 5D0GA 4X4NA 1FRKA 3ZFVA 1SC6A 1UCNA 3CDUA 3BDFA 2H9ZA 3MWBA 1TK5A 2IM2A 2HQGA 2AEFA 4UZBA 4NOHA 4IFVB 1FVQA 3EGVA 1U1NA 4U7CA 2QV6A 5THWA 2OD6A 2NQPA 4M5HA 1CVJA 2QFJA 2XYHB 2YX1A 2GVZB 4AL5A 1PILA 2ZZNA 4CO3A 2DCUB 2MEWA 4MKVA 3NNAA 4ED5A 5KG4A 1ZZNA 2FQQB 2HHHF 3MEDA 5KXAA 3J7YI 3KLVA 4NLGA 2JEIA 2GHPA 2BM1A 3EDRB 4CIOA 4O4GB 2GSUA 1FX2A 1HR0J 1HD1A 3P8BB 1WACA 1HQAA 2ZITA 3HVTB 4BWJA 4DX5A 1ULRA 5K20B 1FWLA 1Q8KA 2XS2A 2IC3B 1BD6A 6FDRA 2HFUA 1S6QA 1UW9A 3CCJS 4CT8A 2PI5A 4EBEA 2F4VF 3G4SS 3HXMA 1HNIB 3AJDA 1GXUA 1XERA 2PC6A 3QYYA 4C11B 2MDAA 3OFHA 3OV7A 1FRIA 3IGNA 1TMMA 1GXLA 2HHVA 1UVNA 4KGMA 2V8PA 3Q24A 2R8KA 1FI4A 3N79A 1RGVA 4LFBF 2FJVA 1WUUA 4ECWA 3HP6A 1FDDA 4TXSA 1S0VA 3BPSP 4ZJLA 1REVB 1ZS6A 4CYUA 3EZ5A 2GO8A 2FZCB 4DL7A 3J81U 3O5TB 1YI2S 1HQ2A 4MK9A 1F5BA 1JLAA 2ZOMA 1FESA 5D3GA 2ZOGA 3Q89A 2IIHA 2NXCA 3TAPA 1Q16B 3WAXA 5D4PA 2J6TA 3NGKA 1B0VA 1X5OA 1RSCA 4DUTA 3T5HA 1EI6A 4LFAJ 2CPZA 4HDGA 3TVZA 4ED3A 2HGMA 2QA2A 2RQCA 2BRLA 1NK4A 3WBHA 1EQ0A 4OIXA 1P8GA 2X98A 3OUYA 4B9TA 5DM7Q 3TR5A 4FBTA 3UI3A 4Z7CA 4FXDA 2HVEA 3KJVA 5EWGA 1T05A 4C8LA 4LF7J 2ZH2A 2XEXA 1HNVB 1MW7A 5IT9U 3T5KA 3NAIA 5L1IA 2ZUGA 1HMVA 1SL1A 1U8SA 1VISA 3M7VA 3NMRA 4PYDA 3GTYX 2E1PA 3TOQA 2GQCA 4K0KJ 2B4UA 1N32J 1RTHA 5DG9A 2B5JB 5B7WA 3BH6B 3PX4A 3LGHA 2GO9A 2V2KA 3OTEA 4B3RF 3CCES 1VJWA 2X1FA 3IR5B 1RT2B 2QFIA 3CVKA 1HYSA 3GE9A 1HNWJ 3R5GA 4M5KA 1TUGB 4NMXA 3K5MA 1S77D 4IRCA 2H48B 3PW7A 4BBYA 4Z2XA 2XGPA 1UVKA 3HMJG 5EUHA 1S48A 3M6UA 7AT1B 4MMOA 3MM6A 1YZ7A 2P6TA 5F8NA 4DUYJ 5CAAA 4EFAC 1NDPA 2DRAA 2Z57B 4PRFA 1D0EA 4Z37A 2Y8WA 1CC8A 2YNHA 3I56S 2J5AA 3DRSA 4KAIA 3WAVA 3K7RA 4NLSA 5DLTA 2JEFA 1U1KA 1M1GA 1C4CA 2VDIA 2YWKA 2LQ5A 2H5IB 4OV6A 1JLEB 2BDPA 4RPFA 1B99A 1HQUB 2AZ3A 2RRNA 3UCZP 4PXCA 2R7WA 1YDLA 3MM9A 1S0MA 3V6DA 3NGUA 1V5IB 3MZIA 1JLQA 3CEDA 2VPYB 4DR5F 2DCLA 1D1UA 2DT9A 2EFQA 3HI9A 4FKYA 3Q8PB 1W25A 1NK9A 1EX8A 2JSXA 3SFUA 2CFXA 4LFCF 3U1LA 1SV5A 3GMGA 4YS2A 3K5PA 2PE8A 3NKPA 5L0KA 3DNCA 4NWXA 2D7SA 2AMCB 2FPHX 5KT4A 1R8CA 4YUDA 3MXHP 2EFOA 2DB1A 5E0OA 3PZPA 5K14B 4CQ1A 4ELVA 3QT5A 4A8WA 3NKRA 4GRSA 1Q8IA 4ZCMA 1R0BG 2VFVA 3MMJA 3LXQA 5LQQA 2CNKB 3MAQA 1JKHB 1OYDA 1IR1A 4RBVA 3GR0A 3BGOP 4H4OB 5AJ3J 1ZEDA 4JI2J 1N56A 3BEGB 3MMCB 1S4EA 2W2PP 2VONA 4KHPF 4KJGA 4UUWA 2OKQA 1KHLA 1KVJA 4ZN3A 4CLTA 3DRRB 3BJYA 2CNNB 3LW5C 4DL2A 2E5GA 3IC1A 1PKUA 3BSOA 4HT5A 4NRUA 2KDOA 2HZAA 1PGZA 5GAHU 4WP3A 2ZBIA 4ZCKA 2VF3A 2YWWA 2L48A 2K1RB 1S9GA 4FXVA 2WVFA 4M5GA 2IY5B 5BJRA 2JJ4D 2W9CB 2F9DA 1N4LA 1B3TA 4RW6B 4OJ3A 4USTA 5CXTA 3DI6B 3UD5A 4PXBA 4YHHF 2ILYA 4MHXA 3NS6A 4PG5A 5F9LA 1WG1A 2RU9A 4B3OB 2MQ8A 3TG0A 2DNYA 3I96A 1S6UA 2V2ZA 1KQGB 5AXKA 2W7OA 3QATA 5H9EJ 1ALIA 1W26A 1CULB 1UWBB 3HFZB 4ECVA 3BGRA 4J9RA 4OX7A 2C3OA 1RA6A 2IMWP 3MUMP 3PRDA 1CJVA 4O4RA 4DSEA 1YQHA 5CA5A 3SZZA 4X4VA 2YH0A 3TVKA 1Y3KA 1A9NB 3JQMA 2FHOB 3HFKA 1HKAA 3KLGB 3IBCB 1RB0A 2JC1A 4I1TA 2VKRA 3J7AN 4LQ9A 4Q8FA 1FJGF 1BQMB 4DCPB 1KSPA 2R8JA 4PQAA 4CYRA 1RT3A 1YTYA 3KHRA 2FGOA 3WAYA 1K9MT 2ZE2B 2OGUA 3H20A 4RW7B 2BV3A 4NZ0A 1KKHA 2W2QP 3G71S 1GXTA 4WYLA 3Q0AA 2ADBA 1Y5LB 4G1QA 3QRRA 1URNA 3HVAA 5LMNF 3DHXA 1FTRA 3MEGB 1S1TA 2UVUA 1WWHA 3T9ZA 4RUCA 1N33F 2M0GB 2O67A 4DR1J 3JAMY 3SSSA 3KJNB 1NK5A 2ZH6A 2CQDA 3IM8A 4CWBA 2PT0A 2N7YA 4NEYA 4V19X 4ERDA 4RUHA 2YPZA 4H4MB 1T9TA 4ETXA 3IA0A 3K5LA 2MQNA 3M32A 5HP1A 4ZVGA 2QEXS 5HK4A 1EQJA 2KXHA 2WSCC 1VQ7S 3HVWA 2J0XA 5KFAA 1U25A 3R2CJ 2HHXA 1ELOA 1S1XB 2HLUA 1HI0P 1E6YB 2OMOA 4CLSA 4A8MP 2HFNA 2UVVA 2E1AA 4GKKJ 1K8AT 2ZH1A 1LW2A 3HDSA 4KHRA 4OZ0A 2AJ0A 2BANA 2W9BA 4ZVTB 1L3VA 2N7CA 4U8YA 5KFXA 5KG2A 2LMIA 1YJ7A 1VIOA 2XSJB 2DNMA 2QA4G 2I9SA 2ZBRA 2HNDB 5KAKA 2RILA 1VQSA 2FLOA 3UR3C 1Q8BA 1FK9B 2QLBB 4X62J 4CO0A 2HLTA 4OI1A 1HWIA 3AA9A 3KG4A 3GB0A 2Z2YB 3R1HA 2I5JA 2NSBA 1FJEB 2DHSA 3EZUA 3I0SB 4FDJA 5L39A 4HKQA 2HEKA 3LF0A 4ID8A 5CZXA 3Q8SB 2IDLA 4NA2A 2CZ4A 4DQSA 2JFKA 1TAQA 4JI3J 2MGZA 4OHWA 2CPHA 3IP0A 1NHVA 1TVRA 1F5CA 3HFVA 1HJKA 1WEZA 2RB7A 3E3XA 3QT7A 3ISZA 2IA6A 1TKTA 2RKIB 1H73A 1AFIA 5D77A 2FVCA 5A8WB 5C25A 4JYAF 2VFUA 5E3PA 3J81j 4WU3A 3H5YA 1NB2A 5IXUA 3FGVA 2MQOA 2Z30B 1C1CB 2R8HA 4URQU 1RT6A 3K89A 4L3NA 1AA1B 3BYPA 4CNYA 4DSIA 4RW9A 4LRDA 4KGZB 1LFWA 5A0YB 3N9UC 4QBUA 3V4IA 1URAA 1RHKB 3UVJA 4HR2A 1TKDA 1Y10A 4ILLA 3D6TB 1FDNA 2YXLA 3DYAA 1RT7A 1UVMA 2OO4A 2OFHX 4P7VA 4ZLJA 5L9NA 1U2CA 3HKZD 2CVEA 3LPYA 2PDAA 1D9DA 4J9SA 3T19A 5G4DA 3KFWX 2LDYA 4XK8C 4DV5F 3DOMB 3FBCA 3QQCD 4ZVUB 1P9QC 3G8QA 2ZH3A 4K4TA 1FE0A 1RTJA 2OFGX 2KM8B 2J76E 2DHXA 1EETA 4ZLPA 1M5KC 4OZNA 2J8AA 3C3LA 4LSZB 1NKBA 3NS5A 2FC9A 4C8ZA 1U0HB 5IM0B 1RWVB 1FFWB 2IYIA 2D9PA 5KFUA 3M2RB 2YKNB 5L1LA 2VBZA 1KVKA 2BYCA 1PYTA 4DV7J 2IM1A 2I6WA 3MD1A 3ONQA 3W9HA 3R7BB 3PXGa 3M2VB 1URBA 2HHTA 2HW3A 2WSEC 4F7VA 2J0SD 3SXLA 5I3UB 3G9CA 1HBMA 2NUUG 3TUJC 3BV8A 1SJ3P 4YQWA 3OLAA 3SIPB 3SCIE 5J2QB 3RGIA 4B9VA 1H98A 2G2ZA 1VI7A 3OBIA 3OR2A 1YHQS 1XNQJ 1TQLA 4RUBA 2P9GA 3OJSA 4CLWA 1BUXA 2DXFA 2YX4A 3GPAA 5AE2A 2I1RA 2UUBJ 2OPSA 3F73A 4CLFA 3DRXA 5ETPA 2CQGA 3JAMU 4Y00A 1IKYA 4DX8H 2XWXA 2HBYB 3PJWA 4F26A 3BBBA 1J5EJ 3ELHA 3Q86A 1M0SA 1J2VA 1FRJA 4USIA 1TKXB 3OR1A 1ZM3A 4L3KA 1N5YB 2DHHA 2EFPA 5EDWA 1S1WA 2ZZTA 1AZSB 2DR9A 1NZAA 1JJ4A 2IAJB 5H9FJ 2MSTA 1VOMA 2VQEF 2NREA 2CQ0A 1VRTB 1Q82T 1VLYA 5HMZA 1ANJA 3NCPA 2IRXA 5BYQA 3FMWA 4ZN1A 2WTFA 2CJ9A 2MJUA 1PYSB 2ZBPA 1HIYA 3D4JA 2X1BA 1LW0A 1S6PB 2F7VA 2AJQA 4B08A 3R27A 2V2VA 3R9LA 1HA1A 2LVWA 1QE1A 1H3DA 3JSYA 3RUBL 3CJ5A 1F0XA 2LYVA 4O44A 4TNOA 5LXRA 5LL6d 1UVLA 2W1BA 2F1FA 1N34F 3FBBA 1O8BA 3Q8VA 2HQIA 3THVA 1SCJB 2QLXA 3DFEA 2XR9A 1GX6A 3D66A 2HBZB 2DK2A 3TW0A 1M5VC 2ZH4A 4QPXA 3ED4A 2WB1D 4J90A 3AD9C 4IOAQ 1NSQA 4U95A 1TKZA 1N0VC 2VC0A 3ZXWA 4DI6A 2XQCA 4F0KA 4LT6A 1N52B 4ECXA 5IFMA 1DARA 4PWUA 2KZMA 4YB6A 2DBBA 1V9OA 3V6KA 3CCVS 4X4SA 1GTEA 2MKKA 3TJ8A 1CJTB 1OY8A 1SUQA 3M2UA 1WEYA 3MM5B 4DR3F 1IM4A 3KTQA 4FYWB 4WE1B 4C8NA 3IRWP 2C2EA 2PEBA 4MFBA 2CPFA 1VQLS 3TZWA 4NXNF 3QLHB 1QVFR 1CJUB 2ZWPA 1CQMA 5B0DA 1Y6VA 1X7VA 2DGOA 1ZH5A 3HHEA 4DG1B 3KLEA 5DLFA 3VGSA 2DNRA 3ITHB 3KYLA 2BACA 2CQ3A 1XC9A 4I2PB 4URGA 1FWKA 1KN6A 4NCGA 4DX7A 4BLGA 1TL4A 4DQIA 2V68A 4UOOA 1NSAA 1WELA 1DBDA 1IBKF 3J7Z5 3FVYA 1VRUA 4GVBB 4JB8B 2EFVA 2GSNA 5HBMA 4ED7A 3DLEB 4QR2A 1NJIT 4LF6J 4G3IA 5KG7A 2XSFA 2YQ3A 4KH0B 1F2GA 1GK8A 3HCXA 4OI3A 2R8IA 1F6TA 4PQUB 4I56A 1IKVA 3MAAA 3TEHB 3W65A 2GJIA 1UVIA 1MSWD 3NNCA 2ZNZA 3S8SA 2LQBA 2GHWA 3T6JA 5A6PA 5HVHA 3DOLB 1KP6A 1XN9A 1MROA 2O01C 5DG7A 2DPIA 3U27A 2ZDOA 2LEAA 4NLUA 4DEZA 2XZTB 1HWKA 1QM9A 1WD6A 1AJBA 2V9KA 4OLOA 3HSJA 5GAGU 4X4PA 3RAMA 4IO9Q 1LWFB 4OZ1A 3MK0A 5DLGA 4F4ZA 3H42A 2X51A 3DM2B 1EKSA 2MKHA 4KIAA 4U67Q 1SQGA 3OTOF 1TL5A 4DV0F 4DSKA 1Y9OA 3MPVA 3HZGA 4DR6F 1H72C 1N54B 3CCTA 3ZTPA 2DEJA 1RE1B 2V9WA 1FWPA 2DNKA 1G3OA 4ZK7M 2R7UA 2ALYB 1BLUA 5GVQA 1VK8A 2EVZA 3OXFA 1C1BA 4JP8A 3HJVA 4ZVEA 3PX6A 2YNIA 1WF1A 2ASDA 5JUMA 5T7LB 3HLUA 5AXNA 5HATA 4I67A 2XCAA 3VGVA 4HYKA 4OI4A 2EWHA 2D1GA 3P45B 4NYOA 1REGX 1IUJA 4DOZA 1OMSA 1WF2A 3FFIB 2XO6A 2AJFE 2JLGA 3OSNA 4C98A 3GZ7A 3TUIC 2OSRA 3PR4A 1NDLA 5LJ5Y 1DTTB 2BQUA 3TWZA 1B8JA 2A18A 4LR7A 5LT5A 1UPMB 1XR6A 2G1HA 4J9QA 1JLBA 2Z2LA 1HNIA 2XNRA 3BKUA 4B3MJ 4J9NA 4F4AA 4C11A 4C4WA 5A8KA 1Y11A 3HJFA 3LP2A 1V3ZA 4EBDA 4RBUA 3ZZ0A 4ZVSB 1IWGA 2IDEA 4ECYA 1RWNB 4WFAQ 3GFHA 3D1OA 3CW2C 1V3RA 3U1NA 5JVGQ 5HMXA 4K50A 3H59A 3CD7A 2C1EB 4MYUA 1GAOA 5B08A 2CWKA 2MKJA 2MLZA 4KB7A 2OPPB 3F0NA 2HWIA 3K58A 3RB4A 1ROFA 3WQPA 1YJVA 1X0FA 3MTKA 1M5PC 4JI7J 2GHVC 3EGWB 4C3KA 4OHYA 3H40A 5D15A 3BQ1A 2HIQA 3L7UA 3W2WA 3RR7A 5B0AA 4DV4J 4RW4A 4UZCA 2KO1A 1CLFA 2RT3A 3EDQB 2KU7A 1SH2A 2VPZB 3R2DJ 2J0WA 5KFJA 4U8VA 2M52A 1KNZA 1WOOA 2NYIA 2KXFA 1UEKA 1T05B 2P2CB 2MPUA 3PACA 4UPIA 4G1IA 5KG5A 1U1OA 3OL8A 3OJUA 4NLXA 4TKTA 2RD5C 2GIRA 1HMVB 3ILOA 1SJRA 5LSOA 1RWWB 3PHTA 2GQ2A 1HI1A 1HNVA 2FB0A 3GP9A 1LWEB 3C19A 1RTHB 4F4WA 3DGPA 2RQKA 5FLXU 3R6LB 2GNKA 4RX6A 3OXGA 2J7UA 3C14A 3T1HJ 2B5JA 3H0PA 4JUZA 3V5RA 3M8PB 1I94J 1IR2A 2V8VA 4KAVA 3BR9A 4R5PA 1HFEL 3A8JA 3J7YU 2RS8A 1QY7A 1RT2A 2B8QA 2BW2A 4Q45A 3T01A 2DGWA 1HWJA 3MM6B 1B64A 2AJ4A 2Y1LB 3R5AA 2F8MA 4YDDB 1XIQA 4L75A 4EYIB 1H7WA 2QL9B 2KG1A 1QSYA 1KTQA 5D6GA 4CDIA 4WYWA 1C0UA 3HT0A 4DLEA 3DRSB 3DRYA 2HAFA 1U45A 4C3LA 3GJRB 2GJ2A 4FPIA 2VQFJ 2N82B 4YY3J 2YX7A 4JOUA 1QD1A 1XR5A 3BB5A 1XQIA 3Q2TC 4IUFA 3G6YA 4V19J 2V8DA 3KUGA 1X4HA 5AE1A 4LF4J 2QMUB 2GMLA 5T14A 2B6AB 3MM9B 3V6DB 2WAQD 2MB0B 1S97A 2HS4A 3EVMA 2WCXA 2KB2A 4OZJA 1JLQB 2ZBQA 2QO3A 4QIVA 5KFMA 1JXVA 4J7CA 2R42A 3BSNA 4BDPA 4KFBB 1FERA 3CJRA 4ILMA 1ZAWA 2XHCA 1SV5B 3K17A 2M5YA 1ZYQA 2CQ1A 2ROGA 4DR4J 1VIXA 3M6VA 3MR3A 2B9XA 3PHEA 3HO1A 1KH7A 3TJ9A 1KC8T 1TK8A 1U4BA 3CPWR 1VMBA 3V6HA 3PFOA 5DQHA 2E5IA 2KVQE 4RO0A 3W1YC 4MY4A 4NXMF 1VRQC 5C5JA 4NL5A 1YRTA 4DCOB 3CJSA 3EYZA 4BC9A 4Y28C 1YITS 2WBMA 1FF2A 2Q66A 1JKHA 2DGVA 3CC7S 4EO6A 2IMOA 1RLCL 5LIAA 3TX8A 4DL5A 2L3MA 3D6HB 2CG4A 4ICLA 4I64A 2OUGA 4A8XA 2X3DA 1K1QA 2W4DA 1DQ8A 4ZG9A 2IVYA 3RTVA 1I1GA 3SCJE 5JMNA 1S9GB 2NYHA 2XI2A 1W2IA 4AT1B 1WDDA 3RU0A 1TV6A 4MIBA 1ZTWA 2O3DA 3GV7B 4Q0BB 4DU8A 2DGSA 3BYRA 5M2RA 5LXYA 2BOAA 2K1RA 1YBTA 4LF5J 1T8EA 1QVGR 3BBFA 3U02A 3PX0A 4JI6J 3MMAB 1HR0F 2W9CA 1BQXA 4QJVA 4K4XA 4AD6A 3EUNA 1Y5NB 3CWJA 1JWWA 1ZOTA 2V5HG 3KK3A 1NJZA 2PA8D 2EK1A 4IKAA 5ITHA 1U6BA 1NK6A 5KFBA 2DR5A 2VHGA 4DL4A 4Z7YA 2AYMA 2W4PA 3MPWA 2GIQA 4P9SA 3HX9A 5CYMA 1PIEA 4DV3F 1PAUB 1KEKA 2PMZD 3RG6A 2EK6A 2P8IA 1NJWA 2B4VA 3G96A 4MKBA 4NLWA 1IM6A 5K9FA 2BR0A 1F3FA 4CO5A 1IBMF 2J7WA 3LA0A 1F9EB 5CABA 1P1LA 3NVLA 4UOHA 4FVCA 4XPCA 1Y3JA 1HNZF 5BYSA 3RB0A 1U26A 2NXUA 3MM7A 5IJSA 1SC3B 3IAS9 1WI8A 3TI0A 1BQMA 2QG9B 1YK9A 5KT7A 2JH3A 4G1QB 5HVFA 3T9NA 3KOAA 3D67A 3O44A 2ZE2A 4GO5X 5A76A 2ZKTA 4RW7A 3MCOA 1R6VA 1HPZA 5HQLA 2LQJA 2HNZA 2I2YA 2KJVA 4DDFA 2ZH5A 2A6MA 3ICLA 1QDUB 1HBNA 1X5TA 3OFEA 5I3QA 2OPRA 2OP5A 5EX0A 3VZHA 1NSKL 1R0CB 5KFNA 2ZKUA 3W60A 3M32B 5HP1B 1R7IA 1Y0HA 4USHA 3D28A 4JV5F 3MFIA 3PO4A 3QT6A 4IRKA 3OT9A 3SSQA 2A6OA 1VLOA 4MH8A 3RZAA 1PJ7A 2UVWA 4LRCA 2GS8A 4J9KA 1KLNA 2ZEJA 5BYRA 3M8SA 1LW2B 2W9BB 2BANB 3KKFA 4DSJA 1G6BA 2ATLA 3N01A 1VGYA 5F8GA 1XEZA 1KD1T 3RRHA 1TL7B 1CSJA 2CXEA 3K57A 3AA8A 5F9NA 2DITA 3W2VA 4UY8T 2V4JA 4A8FA 1Y4ZB 1QAJA 2ILZA 4W90B 1SKSA 4R0JA 5G0RB 2DIVA 2E5JA 2HNDA 2I5JB 2J0QD 3EM1A 4NEZA 1TL3B 3CMES 3PEHA 3RRKA 2DO0A 1NU4A 5J1NA 5CHCB 1B4SA 4Y2CA 2B51A 4OJGA 1RHRB 3AY0A 1VFJA 5J1EB 4QIEA 2IJFA 2J9CA 4IO1A 3OVSA 3VALA 4LF9F 4F0HA 4NWJA 1RA7A 3HKWA 4CO4A 2DGXA 3MPYA 5C25B 3KDOA 3T00A 2BKNA 1QJHA 3NKOA 3L7PA 2G1DA 1KFDA 4Y6IA 1RU2A 4KGVB 3DDNA 4X64F 1SVDA 2CQPA 1ZPVA 1WNEA 2POKA 5A8WA 3FEXB 4RW9B 2VICA 2B9EA 3BDGB 4Y0FA 1SH0A 1CEZA 2PD1A 2BJ9A 1A0OB 3V4IB 1WC3A 3UVJB 2RU3A 3EMTA 2PI4A 3JQKA 2WOMB 1JLCB 2CJAA 1N48A 3DYAB 4FVMA 2VU5A 3SDEA 4FF3A 3W9IA 3OTCA 3K8WA 5F3TA 3RJMB 3VTIA 3NY0A 2QMXA 1AUDA 3CD0A 2XS7A 2RH3A 4JI4F 2OHDA 2YWFA 2IYGA 1BMQB 1B7YB 1RAOA 5C7PA 2A1BA 1UJ4A 4KO0B 4WP8A 1DRZA 3GCWP 2D3ZA 1RTJB 4F8RA 3UDCA 3HHLC 4K4YA 3QNWB 2BEFA 2YWHA 2D3OR 3PG9A 3EVWA 5KFYA 1YGYA 1QLNA 1RWOB 4IR1A 2OTLS 1Q79A 2XCPA 4TLQA 1E2SP 5DLVA 1JXLA 1I3OB 3F44A 1JB0C 2EXUA 3CIMA 5IJQA 1RT5A 4U7UD 5IM0A 3ENWA 3RBEA 2DR7A 2JDJA 4N77A 5ETMA 2EG1A 4B56A 4QW8A 4AQYF 4KPYA 4HHUA 2VDHA 1HBMB 3M6XA 2Z0GA 3M2VA 2CPDA 1UWAA 5CYQA 1C2PA 2KT5A 2IVMA 3T6BA 4EGLA 3BREA 3OR2B 2W5WA 3MR6A 1MNEA 1S7HA 5I3UA 3CMQA 3P49B 3CCQS 4DQPA 4WTYA 1Q4RA 3U7JA 3CMRA 1BE4A 3S7RA 1TFYA 3ENAA 1KQSR 2FUG9 2OPSB 4AL6A 4DR5J 2RQ4A 1XWLA 4M95A 3B78A 1U1MA 4DQRA 1F1BB 2C2ZB 1RWXB 4EK2A 1NKEA 2SXLA 3JXOA 4OZ3A 4UQGA 1IQTA 2MLYA 3HSZA 3NG8A 4TY9A 3DYCA 3Q23A 3PYEA 5IQQA 4J9MA 4DR2F 2XI3A 2OMLA 2V8GA 1A6LA 1SXLA 2ZJRQ 1X4AA 3KNGA 4PEOA 3N6MA 4ZIWA 2RE1A 5E3AA 1FFSB 1P6TA 3HSGA 4P75A 1AZSA 1AW0A 1UZDA 5CD4H 3AAWB 2HFOA 2DGQA 3MMBA 1FEEA 1RACB 5E2QA 3MEEA 4J9PA 3BGLA 4CLZA 1I5OB 3DCAA 3HZEA 3R3TA 1H2UX 3D3BJ 3O8WA 2FJDB 3IXQA 4JV1A 2IAJA 4F67A 5MLCV 2UUWA 3D9BA 2CNLB 2V2QA 1SIZA 1Y5IB 4B9NA 1FO1A 2A2DA 1M90T 3ULHA 4NZ6A 2JVOA 1S6OA 2QX0A 2VFRA 5JVHQ 2DY9A 2BUNA 4MJKA 1WJ9A 2Z8QA 3V81A 4EUVA 2R2SA 5E3RA 5FD1A 1YVFA 5KFZA 5ETOA 4KKOB 1HDHA 1S6PA 1EIYB 4O44B 4NYPA 1PCAA 3LWMA 4DR1F 1H2TZ 3E01A 1LEOA 2W25A 3C66A 4DWIA 2D3UA 2H3EB 3CF5Q 3GWCA 4RU9A 2XTJP 1TKZB 4RW8A 4Y65A 1KQKA 1F5AA 3VQTA 1UEVA 2BM0A 5KFQA 3BF4A 1RAHB 3MURP 1VBZA 1O6XA 4O3OA 1UP1A 1WI6A 1GMWA 4UPHA 4GKKF 1Y00A 2J9DE 1G2EA 2L41A 4K4WA 4MFBB 4LF8F 1JK9B 1CQNA 1CJTA 1NH7A 4WFNQ 1HNXJ 3I0RB 4RUAA 2IBOA 3M8RA 1DQ9A 2UU9J 2QJ3A 4DL6A 4WE1A 1RAEB 2NCKL 4USKA 3QO9A 1CJUA 1B70B 5F3ZA 2F8EX 1RT1B 5DGBA 2FVQA 4QCLA 3POTA 1Q8LA 3BGFA 3ITHA 1X60A 4DPTA 1R8HA 4HTIA 3BDHA 2EPIA 3V6JA 1OPIA 4I2PA 5LMNJ 1KDNA 1S99A 3NEKA 5F41A 1MWZA 2DGTA 4OI6A 5D4NA 1VRUB 3OLBA 1SKWA 4Q2MA 1N33J 2HRUA 2RF2A 1DLOA 1WF0A 1V3SA 2J8SA 5HMYA 3H98A 2VUGA 1YJUA 3H2LA 3P5BP 3OL6A 3MUVP 3TO8A 4GVBA 3M05A 1EW2A 1IKVB 1WKLA 2FVPA 1MU2B 3ZZUA 3H5XA 1EJ7L 1O0PA 3DLEA 3GLJA 2GCFA 4OZ2A 4GTYA 4N47A 2IUCB 4FS1A 3SBMA 3LUYA 3PW0A 2EKYA 4KE5A 3L95X 2ZFHA 4Q43A 5KFDA 2XO7A 4PQUA 1MROB 2U2FA 2BE7D 1S10A 1S57A 4CTAA 1EHWA 1PC4A 3MTJA 2YWEA 3NS7B 4RWWA 4FN5A 2YKOA 4NLQA 4OHZA 3PO5A 4NX9A 2MZTA 2FC8A 1Q1KA 3TJAA 2V4RA 4B3TF 4LSNB 3B4MA 1V5VA 2VFSA 4RL1A 4ZS6A 1IN0A 3BDPA 1LWFA 1S9FA 1YIJS 3ZTQA 3GJQB 3MHYA 2E9RX 1H6KX 1U02A 4LR9A 5HJYA 4UTGA 4DBQA 3DM2A 2XY5A 4EWTA 1E3CP 4WBFA 3RAQA 4LIWA 4X4OA 1C1BB 3B5QA 1RWMB 4A46A 3K5OA 1UZHA 2KRRA 2G4BA 1FKPA 1SJFA 2M4MA
chains in the Genus database with same CATH topology
3BDFA 4LQYA 1KH9A 3WAYA 5C66A 4NWJA 1FSUA 1N2KA 2QZUA 4FDIA 4LRDA 3NKPA 3T00A 4LRAA 1EW8A 4NWXA 3OT9A 4UPKA 4YR1A 4ZG9A 1AJDA 3UO0A 3IGZB 3NKOA 1ED8A 5TJ3A 5GOVA 2GSOA 4KM4A 4MHXA 4LRCA 4KAVA 1URAA 3NVLA 2XR9A 3TWZA 3MK0A 2W5TA 3NKMA 1B8JA 4UOOA 5DLWA 3TG0A 4LR7A 3DPCA 1HDHA 3ED4A 1E1ZP 3NKRA 3T01A 1E33P 5IJSA 4GTWA 4CXSA 1ALIA 3E2DA 4QAXA 3BDGB 1URBA 1ALJA 1KHNA 1E2SP 5LQQA 3LXQA 5K4PA 5DLVA 3M7VA 4ZG6A 3WAWA 2W8DA 3DYCA 5EGHA 2GSNA 5KXAA 5HRTA 2IUCA 4FDJA 2IFYA 1ZEFA 4KAYA 5AJ9A 5IJQA 4UPIA 3WAVA 5DLTA 3IGYB 2GLQA 2ANHA 1ZEDA 2GSUA 3BDHA 2W5XA 5L0BA 5EGEA 1ANJA 3T02A 1SHNA 4ZGAA 1ELZA 1EW9A 1HQAA 2ZKTA 4GTZA 3UN5A 1KH7A 2W5RA 3UN2A 3SZYA 4ZG7A 1KHJA 3WAXA 1ANIA 1O98A 1ELXA 2W5SA 1KH4A 4UORA 4CXUA 4LRBA 1ALHA 3SZZA 3KD8A 4KJGA 4LREA 3Q3QA 1KHKA 2VQRA 1EJJA 1KH5A 1EI6A 1KHLA 3M8WA 4CXKA 4B56A 3NKNA 1EQJA 4GTXA 1K7HA 1Y7AA 4MIVA 4MY4A 4LR9A 1ALKA 1HJKA 1SHQA 5L0EA 4CYSA 2G9YA 3MK2A 5GRRA 2W5QA 3TX0A 3A52A 4TN0A 4UOPA 3UNYA 5LRNA 1ED9A 5L0KA 1AJCA 3WBHA 1E3CP 3BDGA 4LR8A 3M8ZA 3MK1A 4LR2A 1EW2A 1N2LA 3IDDA 3B5QA 3NKQA 1P49A 4N7TA 1Y6VA 2X98A 4GTYA 1AJAA 2W5WA 1ELYA 2IUCB 5INHA 2W8SA 4UPLA 4UPHA 5LIAA 2D1GA 1O99A 1AUKA 2XRGA 4LRFA 1ZEBA 2GA3A 2W5VA 3UN3A 4CYRA 5LRMA 2RH6A 1AJBA 4KJDA 3M8YA 3CMRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BDF A;  4LQY A;  1KH9 A;  3WAY A;  5C66 A;  4NWJ A;  1FSU A;  1N2K A;  2QZU A;  4FDI A;  4LRD A;  3NKP A;  3T00 A;  4LRA A;  1EW8 A;  4NWX A;  3OT9 A;  4UPK A;  4YR1 A;  4ZG9 A;  1AJD A;  3UO0 A;  3IGZ B;  3NKO A;  1ED8 A;  5TJ3 A;  5GOV A;  2GSO A;  4KM4 A;  4MHX A;  4LRC A;  4KAV A;  1URA A;  3NVL A;  2XR9 A;  3TWZ A;  3MK0 A;  2W5T A;  3NKM A;  1B8J A;  4UOO A;  5DLW A;  3TG0 A;  4LR7 A;  3DPC A;  1HDH A;  3ED4 A;  1E1Z P;  3NKR A;  3T01 A;  1E33 P;  5IJS A;  4GTW A;  4CXS A;  1ALI A;  3E2D A;  4QAX A;  3BDG B;  1URB A;  1ALJ A;  1KHN A;  1E2S P;  5LQQ A;  3LXQ A;  5K4P A;  5DLV A;  3M7V A;  4ZG6 A;  3WAW A;  2W8D A;  3DYC A;  5EGH A;  2GSN A;  5KXA A;  5HRT A;  2IUC A;  4FDJ A;  2IFY A;  1ZEF A;  4KAY A;  5AJ9 A;  5IJQ A;  4UPI A;  3WAV A;  5DLT A;  3IGY B;  2GLQ A;  2ANH A;  1ZED A;  2GSU A;  3BDH A;  2W5X A;  5L0B A;  5EGE A;  1ANJ A;  3T02 A;  1SHN A;  4ZGA A;  1ELZ A;  1EW9 A;  1HQA A;  2ZKT A;  4GTZ A;  3UN5 A;  1KH7 A;  2W5R A;  3UN2 A;  3SZY A;  4ZG7 A;  1KHJ A;  3WAX A;  1ANI A;  1O98 A;  1ELX A;  2W5S A;  1KH4 A;  4UOR A;  4CXU A;  4LRB A;  1ALH A;  3SZZ A;  3KD8 A;  4KJG A;  4LRE A;  3Q3Q A;  1KHK A;  2VQR A;  1EJJ A;  1KH5 A;  1EI6 A;  1KHL A;  3M8W A;  4CXK A;  4B56 A;  3NKN A;  1EQJ A;  4GTX A;  1K7H A;  1Y7A A;  4MIV A;  4MY4 A;  4LR9 A;  1ALK A;  1HJK A;  1SHQ A;  5L0E A;  4CYS A;  2G9Y A;  3MK2 A;  5GRR A;  2W5Q A;  3TX0 A;  3A52 A;  4TN0 A;  4UOP A;  3UNY A;  5LRN A;  1ED9 A;  5L0K A;  1AJC A;  3WBH A;  1E3C P;  3BDG A;  4LR8 A;  3M8Z A;  3MK1 A;  4LR2 A;  1EW2 A;  1N2L A;  3IDD A;  3B5Q A;  3NKQ A;  1P49 A;  4N7T A;  1Y6V A;  2X98 A;  4GTY A;  1AJA A;  2W5W A;  1ELY A;  2IUC B;  5INH A;  2W8S A;  4UPL A;  4UPH A;  5LIA A;  2D1G A;  1O99 A;  1AUK A;  2XRG A;  4LRF A;  1ZEB A;  2GA3 A;  2W5V A;  3UN3 A;  4CYR A;  5LRM A;  2RH6 A;  1AJB A;  4KJD A;  3M8Y A;  3CMR A; 
#chains in the Genus database with same CATH topology
 4W4M A;  2YNI B;  4AND A;  3QJJ A;  3GIK A;  2BE2 A;  1GQE A;  3LQV A;  5I42 B;  3UO0 A;  2HK2 A;  2KXN B;  3AFG A;  1Q53 A;  3KUH A;  2UUC J;  4DV7 F;  1FKO B;  1RWU A;  3KLH B;  3GV8 B;  4P74 A;  1QSL A;  2E7V A;  5T7L A;  3OTD A;  4NLR A;  4ZDN A;  2HWT A;  4C97 A;  4DF4 A;  2ZWO A;  2FZK B;  2R3V A;  4X2B A;  4Y2K A;  3FFI A;  2AYB A;  2M7S A;  1JLB B;  3CJQ A;  3ZTO A;  1KHW A;  1T9W A;  5CQG A;  2PA3 A;  4W92 B;  1DTT A;  4DV1 F;  4CXK A;  5A8K B;  5B09 A;  3LP2 B;  3JTP A;  4Y3C A;  3PVX A;  1BY9 A;  4ZLL A;  4P6Q A;  2MXY A;  4M63 A;  1R3N A;  2VFT A;  3CD6 S;  4OX9 F;  4DV5 J;  1UMJ A;  4LVO P;  1NK8 A;  3T3F A;  4PG8 A;  4ES2 A;  5M2U A;  3VQS A;  4MAK A;  1YZ6 A;  4WFZ A;  3PM9 A;  1FDB A;  3NRB A;  1ZA1 B;  4BC7 A;  4H4K C;  2BMB A;  1VQK S;  4G6V B;  5E7O B;  1XNR F;  2WK4 A;  2Z4P A;  2ROP A;  4USV A;  2XNQ A;  1Q86 T;  2OD4 A;  2XG8 A;  1G4C A;  3OHB A;  5F8L A;  4IG0 A;  2OPP A;  4Q2L A;  3W2W B;  2W8D A;  2PO4 A;  1FKA F;  4CI0 B;  4RW4 B;  4RNH A;  2L9W A;  4EO8 A;  2Y8Y A;  2EFN A;  3KLF B;  5ETS A;  2QLJ B;  1WHY A;  3C16 A;  3T5L A;  4KTQ A;  3V4M A;  3EXY A;  3C46 A;  4OYX A;  1EJJ A;  3QAU A;  1UKU A;  2Z2Z A;  5B0E A;  3QPI A;  2VA2 A;  4P73 A;  1K0T A;  1OY6 A;  2M2B A;  3UD3 P;  1GMU A;  5BR8 F;  3BKT A;  4FP9 A;  1SIW B;  4P10 A;  5KFI A;  4UQT A;  2XRG A;  1NHU A;  3FBE A;  1TTH B;  3BSA A;  4YR3 A;  2H5E A;  2XY7 A;  2XLJ A;  1K47 A;  4I6W A;  3FJ2 A;  3G6X A;  3ILI A;  4A4J A;  1HWL A;  4OYB A;  4RNM A;  1RTI B;  3DGP B;  2QMW A;  4NA3 A;  1Q95 G;  1RAF B;  1WC4 A;  3PEJ A;  1LWE A;  3C14 B;  1NUE A;  3DPC A;  2AGQ A;  3PR5 B;  1M5S A;  4F2R A;  1FRM A;  3V2U C;  1NEE A;  4R5P B;  2HHQ A;  5HJX A;  5L0B A;  4TU8 A;  3QGG A;  3M8P A;  1ICE B;  2ZC4 A;  2DNP A;  3H90 A;  4BS2 A;  1HHT P;  4DV6 F;  2E1C A;  1E6V A;  5EN1 A;  4HHJ A;  2MZ1 A;  3LP1 A;  5C2C A;  5K8P A;  3O3L A;  5KFE A;  4O0N A;  3VWS A;  3CMA S;  2ZVS A;  3PYF A;  1DUR A;  2MY8 A;  1OS5 A;  1C0U B;  2FJW A;  1FVS A;  5C24 A;  2D3O 1;  1HHS A;  1O5J A;  1RHQ B;  3CC4 S;  5LM7 E;  1RYR A;  2R7S A;  4M5D B;  2YNF A;  3O1L A;  3NBP A;  3IWN C;  1BQN B;  1YJN S;  2DNZ A;  2E5L F;  3GQC A;  1XK8 A;  4C0H A;  4P2S A;  5ETN A;  1RAB B;  2FZG B;  3TZX A;  4CLK A;  2V0N A;  2J9D A;  2LP4 A;  1B0T A;  3VGU A;  4X4T A;  3FEY B;  3FSI A;  1WSR A;  2YBV A;  2OEK A;  1NCL A;  3ADA C;  2E7W A;  2B6A A;  2F3J A;  2RUS A;  2AD9 A;  4UOF A;  1DAX A;  4Q5V A;  1VQ6 S;  4FBU A;  2HSE B;  2BXJ A;  5LJ3 Y;  3GV5 B;  4ECR A;  2HQD A;  4CLY A;  4U9R A;  3K59 A;  4DL0 C;  4KFB A;  2AV5 A;  3QFH A;  5E41 A;  2FTR A;  4QWB A;  1D09 B;  4JI1 F;  4GO7 X;  4M5M A;  3A52 A;  2XHW A;  3UWT A;  2FIU A;  2BJ8 A;  3Q8U A;  4UOP A;  1ED9 A;  4K5R A;  1MN9 A;  2QSW A;  2WB4 A;  5HO4 A;  4WJB A;  3DOK A;  2ZM6 J;  2MKY A;  3AQO A;  4F04 B;  3W8G A;  4J37 A;  4JI0 F;  1MG7 A;  5INH A;  2W8S A;  4DR3 J;  2YQ0 A;  2PN6 A;  1IWA A;  5KG0 A;  3K2Y A;  3UN3 A;  3O2I A;  4RWX A;  5KT5 A;  1UL3 A;  4KRW A;  3QWP A;  4A8K A;  1CPZ A;  1VQY A;  4MT1 A;  3U1M A;  2MQP A;  1N36 F;  3GSI A;  4NXN J;  4PUO B;  5B0C A;  1EW8 A;  4HH1 A;  4QPT A;  1OWX A;  1VCT A;  4ZHR B;  2V63 A;  1Y7P A;  1WEX A;  5IC6 B;  3US5 A;  3IM9 A;  3LPE A;  2DNG A;  4ICL B;  1U47 A;  2Z2M A;  3GR1 A;  1W7W A;  2PFD A;  2NLW A;  3TAM B;  3QFW A;  2VKZ G;  1VC6 A;  3WC2 A;  3JSR A;  1SL2 A;  4HLB A;  2KTQ A;  3GYN A;  1J27 A;  1SL0 A;  5A2Q Y;  3I5A A;  1B0P A;  1TV6 B;  3G2X A;  1N5T A;  5L38 A;  4Q8E A;  3I4P A;  1IBK J;  2HWH A;  4C8Y A;  1FJ7 A;  2VQR A;  1L3S A;  2UXB F;  1NKC A;  2UXD F;  2CQH A;  1BWV A;  2FVS A;  1R0A B;  4Y2M A;  4Q0B A;  3CJK A;  1N88 A;  3ZTR A;  3GFZ A;  1SJQ A;  3KK3 B;  5I3P A;  3JS9 A;  4EYH B;  3OTB A;  1U49 A;  2Y1R I;  3MMA A;  1RZM A;  1LWC B;  3HHK A;  3UPF A;  2QZU A;  3SQG A;  2CKW A;  3L7O A;  1YJT A;  3OQ2 A;  5CYM B;  2WVE A;  1T9V A;  2LCW A;  2XMU A;  3A1Y G;  3OXL A;  2CJY B;  1IBC B;  1L3U A;  2HYI B;  4BCA A;  2IRU A;  5KFT A;  2E29 A;  1ZM9 A;  2FDN A;  3THT A;  4DMZ A;  1XTZ A;  3QWU A;  5D8H B;  3R6G B;  2K2P A;  2BAB A;  1JNZ B;  2BJ1 A;  4ZGA A;  5IT0 A;  2XMW A;  3MM7 B;  3NOC A;  4KY3 A;  4D3G A;  2A3J A;  3OTO J;  2UXC J;  4DV0 J;  1IR0 A;  3UDE A;  1WOS A;  3NGT A;  3KLI A;  4DR6 J;  1PJ6 A;  2IRY A;  3D68 A;  2W5Q A;  3LGM A;  3UDL A;  2ERR A;  3BDE A;  4LBP A;  4DUZ F;  2E1M C;  2X7I A;  4X66 F;  2F9J A;  5GAE I;  3T1Y F;  2D41 A;  2J6U A;  4FF2 A;  1FTC A;  1UFW A;  1HPZ B;  1P49 A;  1S49 A;  1PBU A;  1ELY A;  2HNZ B;  4WII A;  4WF9 Q;  1AUK A;  1HWU A;  1ZEB A;  2MZJ A;  1HBN B;  2HNY B;  3I6P A;  5U47 A;  1F60 B;  2DJW A;  4KJI A;  2G2O A;  1WTF A;  2OPR B;  3TEG A;  5LSL A;  2C3P A;  2VV5 A;  4DV4 F;  1PBA A;  3G82 A;  1VJQ A;  5F8H A;  4GC6 A;  1RDR A;  3G8T A;  1KFS A;  4PCQ A;  1QTN B;  5KT3 A;  2LEP A;  2MKS A;  4PXE A;  2CIM A;  1NPK A;  4PPD A;  1Z4U A;  5KFV A;  1OYE A;  3GFY A;  3I4H X;  3PYD A;  4IOC Q;  3T1A A;  1ZM4 A;  4ZJQ A;  2Z56 B;  2BJ3 A;  1UFL A;  4FF4 A;  4F25 A;  4PG7 A;  3D1H A;  4DFK A;  4C0B A;  4DPY A;  2DTJ A;  4MIA A;  2W5S A;  1V6H A;  2AYE A;  3OVB A;  3HHN B;  3QGI A;  2B0G A;  4CNZ A;  2FLL A;  3W2V B;  4ECS A;  1VQN S;  2PGC A;  2V4J B;  2F40 A;  3DLH A;  4I4B A;  2VJU A;  2FLN A;  4O3P A;  1TL7 A;  3ILL A;  1K0V A;  4UPL A;  3T1H F;  3M8Y A;  1W2B R;  2O5D A;  1FSU A;  1IBL F;  1FJC A;  3VV2 B;  5IC4 B;  3DLB A;  5G0R A;  4EU0 A;  4UY8 5;  4OYO A;  1IJE B;  1NZ8 A;  2RHQ B;  3MI7 X;  3C8Y A;  3AJ1 A;  1TL3 A;  3HHL A;  4QU7 A;  2Y9H A;  1GH8 A;  2H65 B;  5ETT A;  3BZQ A;  4HDH A;  3D5M A;  4NLO A;  4YDX A;  4DHV A;  5J1E A;  4USJ C;  3MF5 A;  1X0P A;  3B82 A;  5KFR A;  2QT7 A;  5E5N A;  1FDA A;  3D0G E;  3HD1 A;  2HBQ B;  3CCU S;  3RB6 A;  4CCH A;  2HHU A;  2CQI A;  3HUL A;  2CQC A;  5F0W A;  1RTD B;  3SV3 A;  1KHK A;  2DKO B;  4IH6 A;  3JSM A;  3FKB A;  4UF4 A;  3PKY A;  2MHN A;  1WC5 A;  2E9T A;  2C42 A;  3BDG A;  3SDE B;  3DGV A;  1YKW A;  3CJ8 A;  5A2Q U;  3IRX A;  2WOM A;  2X1G A;  2R2T A;  1JLC A;  3MM8 A;  4DS4 A;  5FJ4 A;  2DO4 A;  4OI2 A;  1RYS A;  4KSE B;  3PDN A;  2B7C B;  3T5J A;  5GOV A;  3UDV A;  1UA1 A;  4F3M A;  2B3T B;  4B9M A;  3LTO A;  4EI2 A;  1TK0 A;  5J2P A;  3QJP A;  1EKR A;  1EB0 A;  3PY8 A;  1VQ4 S;  1RT4 B;  5F0U A;  2XM3 A;  4NA1 A;  3OD2 A;  1P27 B;  3QRP A;  2M3D A;  3EGN A;  2R8G A;  5B0B A;  2HS3 A;  3SYZ A;  4KO0 A;  5IWA J;  3ET6 A;  2WRM A;  4RLE A;  4USW A;  4DR7 F;  5EGE A;  3CCM S;  4UUX A;  4CO2 A;  5KFH A;  1RBO B;  4WP9 A;  4OHV A;  4KPC A;  5HVG A;  1K73 T;  3W3S A;  3IWL A;  5ETR A;  1K7H A;  2ZC3 A;  4DV2 F;  2MKC A;  1NK7 A;  2ZD1 B;  1RT5 B;  3PNI A;  4FF1 A;  3R7S B;  2B9W A;  4DXL A;  3NGS A;  4F4Y A;  3IO1 A;  2HVH A;  1NJX A;  5HI7 A;  1JJ2 R;  4K7Q A;  1U1Q A;  3KMS A;  2FHJ A;  4KH1 B;  3FMB A;  3H5S A;  4F02 A;  3VZI A;  4FDI A;  2AQ4 A;  5CYQ B;  2UZA A;  3KHH A;  5IS2 A;  3KWM A;  2B7B B;  2JFD A;  2GJF A;  2ASJ A;  3TUZ C;  4YB1 P;  2AZ1 A;  1TAU A;  1UA0 A;  3FEZ A;  2LXF A;  3RW6 A;  1FCA A;  5GMK a;  4B3S F;  2YH1 A;  1NPP A;  4UT4 A;  3PFE A;  2C2O B;  1GNK A;  3UR0 A;  1S59 A;  2KVI A;  2EBG A;  5DS7 A;  4AXJ A;  4N56 A;  4FPR A;  1O98 A;  5L8R C;  5KFK A;  2DH9 A;  3R5C A;  1JXE A;  4GKJ F;  5DDR C;  3CGI A;  4QWD A;  1Z2Z A;  4C7Q A;  1J5O A;  3FK4 A;  2A0F B;  4O3S A;  3HM9 A;  5HAO A;  4N41 A;  5RUB A;  4KV8 A;  4CLP A;  5DDO C;  3BQ2 A;  3SV4 A;  1N2L A;  3GCX P;  3MMB B;  3P6Y C;  3W64 A;  3MEE B;  1VC0 A;  4NXM J;  1R8A A;  2UV8 A;  2AJ2 A;  1JLF A;  4IRD A;  4LQY A;  4ZPW R;  2WVC A;  2DNO A;  2HZC A;  4NLP A;  3NGR A;  1NH8 A;  4WKR A;  4F2S A;  4WZM A;  3TP2 A;  1ED8 A;  1LK5 A;  1S79 A;  3NCR A;  4L6V 3;  1ZBT A;  3R1L A;  4KGX B;  2BE9 B;  4PWD A;  1NSP A;  4HI1 A;  1D8Y A;  4PG4 A;  3VAI A;  1E33 P;  4ZLN A;  2M8D B;  1HBU A;  5EHH A;  2CPY A;  5EGH A;  2L9D A;  3V81 B;  4P52 A;  4OL8 A;  1BC6 A;  3QMQ A;  3CCZ A;  1XMO F;  3CDW A;  3GIL A;  1X9W A;  2ROE A;  1URR A;  2W9A A;  4MIW A;  4ZG7 A;  4F3Q A;  2ZH7 A;  3M1V A;  3OFF A;  1NLK L;  2K3K A;  1KR4 A;  5KT2 A;  1N6Q B;  3I87 A;  4KKO A;  3E01 B;  3X3U A;  2K8G A;  1WG5 A;  2JEG A;  5AT1 B;  1GEH A;  1M5H A;  1RKJ A;  4WK1 A;  2MLX A;  4I2Q A;  3GFX A;  1FX4 A;  2I8E A;  4ZCI A;  3CDA A;  3H5U A;  2JHE A;  4RW8 B;  5F8M A;  4N7T A;  4EZ6 A;  3TA0 A;  5DZ7 A;  4NLT A;  2W24 A;  1KLM A;  2CVI A;  4ANE A;  3DHW C;  2EKN A;  3VAF A;  3MUT P;  3A3O B;  4DCJ B;  1L5U A;  1FXL A;  1RXO B;  3QSI A;  3WX4 A;  3DLG B;  2KN4 A;  4A8S A;  1VQ9 S;  2XMT A;  2FGC A;  1KRP A;  1RWP B;  4DV3 J;  2WON A;  3C6U A;  1TUW A;  4NI2 A;  4MYT A;  1ZAX A;  2RDD A;  2OI2 A;  4QYR A;  5ADZ A;  3MEC B;  1VBK A;  2ZUA A;  3LP0 A;  4QAX A;  1HQE B;  2R7V A;  4EMD A;  3F56 A;  1IBM J;  3H2V E;  3AJ2 A;  3KNA A;  1VYA A;  4Y34 A;  3RRG A;  4LBI A;  1HNZ J;  4L73 A;  1ELZ A;  3R5J B;  1KHJ A;  3QO9 B;  2ATC B;  5JJB A;  3KD8 A;  3LO3 A;  3I0R A;  2IA0 A;  1KH5 A;  4PPZ A;  3POT B;  2WSF C;  4JI5 J;  2YTC A;  4KBI A;  3QRQ A;  2AX1 A;  1VQ5 S;  3I9Z A;  2YKP A;  1DJ0 A;  4Y2A A;  3QZ8 A;  3HHD A;  2VBX A;  2P9C A;  4LR8 A;  3M8Z A;  5ETV A;  1LFP A;  4IH5 A;  1RT1 A;  5IV4 A;  1NK0 A;  2JOQ A;  5L1K A;  4HVZ A;  3LAN A;  4D3H A;  5J1P A;  2M9K A;  3DRP A;  4ED6 A;  3VAK A;  2RF2 B;  1DLO B;  4MK8 A;  3QGH A;  4OLP A;  5B0F A;  1Q0N A;  2B4P A;  4IH7 A;  1CC7 A;  2ZJP Q;  1GFW B;  3I31 A;  2XGQ A;  2MZQ A;  3G6E S;  2QRR A;  1FFG B;  5FLX Y;  2LKZ A;  4QWC A;  1RI7 A;  4FNI A;  1U2R A;  3DU5 A;  3TA1 A;  3NL0 A;  4JV5 J;  2R7R A;  2CUY A;  3M9M B;  1MU2 A;  3CDE A;  3WAW A;  1JJC B;  2IUC A;  4CTA B;  2FY8 A;  2JC0 A;  4IYQ A;  4FNH A;  2J6S A;  1OQ6 A;  4XDC A;  2CAD A;  2HFS A;  2M8H A;  1XMQ F;  1RHU B;  1OSD A;  3H4D A;  2E7X A;  2ZH9 A;  2D74 B;  2HMI A;  1S9E B;  1KON A;  1X5P A;  3MEK A;  2C2K B;  1S12 A;  4HTJ A;  3WC0 A;  4F36 A;  3VAH A;  5KOX A;  4MKA A;  4LSN A;  4JBC A;  4NZ7 A;  2NUH A;  3FRZ A;  1SB6 A;  3DMJ B;  2OEL A;  4ER8 A;  5KG1 A;  5TJ3 A;  3Q8R B;  4HAC A;  3KG1 A;  4MK7 A;  2QZ8 A;  5HMW A;  2R9L A;  1X8D A;  1WHX A;  3KHL A;  2JNJ A;  1FKP B;  2HHS A;  1KTV A;  2V4Q A;  4DU7 A;  3SZ2 A;  4LF9 J;  1X31 C;  4ED0 A;  1VBX A;  1LKZ A;  2QL7 B;  1U6Z A;  2W01 A;  4H4K A;  3AD8 C;  4F4X A;  2RS2 A;  2BE2 B;  2JVR A;  3DDI A;  5AJ9 A;  8RUC A;  3BS9 A;  4CLU A;  3S6E A;  4IFY A;  4XAK A;  2MJN A;  1YJW S;  1VBY A;  1R27 B;  2BJE A;  3TQ1 A;  4X64 J;  3UN5 A;  4KGK A;  3SI8 A;  4C0O C;  4UOG A;  4WCE Q;  1YBU A;  2FHK A;  3FCW A;  5I42 A;  5LOQ A;  1ALH A;  1VDH A;  3BKF A;  3H8Y A;  2CPE A;  2C2N A;  3VVT A;  2GVD A;  2CPX A;  1FKO A;  4R8U B;  2OLW A;  3KLH A;  4I7F B;  3J7A 1;  5HLF A;  3P96 A;  3W8P A;  5ETL A;  3W5X A;  2XLK A;  3NWR A;  3CD5 A;  4FDF A;  2GW8 A;  4FYD A;  2UUA F;  1F9H A;  2OTJ S;  5I4M A;  4LMZ A;  5L9X A;  1RJJ A;  4JI4 J;  2KHD A;  4PAB A;  3SQO P;  1WTB A;  2P5V A;  3VAM A;  4OI0 A;  2DNL A;  2W8L A;  2CRL A;  2BKP A;  1IKX A;  2AT1 B;  3CIZ A;  4K5S A;  1Z2L A;  1MLA A;  1FA0 A;  1VQM S;  2DPJ A;  5ETQ A;  3CO0 P;  3P3D A;  1X4E A;  2FYX A;  3LAL A;  4AE5 A;  4K4S A;  1U8W A;  1C0T A;  2DR8 A;  3GG0 A;  1WHW A;  4OJH A;  4DZ6 A;  2XBP A;  7FDR A;  4RNN A;  4ZPB A;  4ATN A;  3H7H B;  1RAJ A;  4HL9 A;  3G87 A;  4IG0 B;  1X5S A;  4CP5 A;  1FD8 A;  1ELX A;  1RBA A;  2IM0 A;  3DKD A;  2OIH A;  3PJX A;  3DXS X;  4QZV B;  2DGU A;  4B9U A;  4I0W A;  4NLY A;  2XLI A;  3RBZ A;  1UTA A;  5IV3 A;  3I5C A;  4AUK A;  3TZY A;  4RNO A;  3AOA A;  3C16 B;  1GMV A;  4LSL B;  4M5L A;  4NRT A;  3NWG A;  3RW7 A;  3KUE A;  2W2N P;  4X65 F;  2WBR A;  3OPK A;  1ZA2 B;  4AQY J;  3KLF A;  4KJD A;  5C2G A;  2IVF B;  3ZZY A;  1HLW A;  1JJH A;  4YR1 A;  3TRG A;  2GQQ A;  3PTW A;  3KK2 A;  4X4U A;  2I38 A;  1MML A;  3S01 A;  3N5F A;  4OX6 A;  4QIF A;  1MMN A;  4A47 A;  2UP1 A;  2Y0B B;  4RZR A;  3FZB A;  5T41 A;  4C48 A;  3J80 Y;  2AWZ A;  1IKW B;  3KK1 A;  2PEH A;  3FCH A;  2GLQ A;  3QIP B;  3FC9 A;  2NR0 A;  2ZVI A;  1MWY A;  3B6B A;  1RTI A;  2DH8 A;  5DET A;  4CH1 A;  4WK3 A;  2G0C A;  1RLD A;  2HVD A;  5HQM A;  4DR2 J;  2JLE A;  2OPQ B;  2B4O A;  2UV8 G;  3TYT A;  3HSD A;  4ETZ A;  1ITP A;  1E6V B;  1WOP A;  2DEI A;  3LP1 B;  3GJT B;  3VR1 A;  1T9U A;  3HF5 A;  1WC6 A;  1MN7 A;  1NM2 A;  4WU2 A;  3TNV A;  1SI9 A;  2GGP A;  4RJV A;  4JI8 F;  3X1L B;  1HNX F;  5C24 B;  5HAN A;  4FYY B;  1RBL A;  3EPI A;  2UU9 F;  3L4B C;  3CJ3 A;  3DLL Q;  1LXJ A;  2YNF B;  3R97 A;  3IS9 A;  4TU9 A;  3NBP B;  1SKU B;  2ZBC A;  2NS1 B;  2QA4 S;  3GJS B;  4CT9 A;  1MMD A;  4M5D A;  4F3O A;  2QC3 A;  1WSV A;  3QJL A;  1R43 A;  3ETM A;  2CYY A;  3OW2 R;  4WXW A;  4S0M A;  1G1X A;  1BQN A;  4CLL A;  5E3C A;  2RAQ A;  1FXR A;  5KFS A;  2YKM B;  1HI8 A;  2OEJ A;  3UE2 A;  4L76 A;  2RVJ A;  3QID A;  2WW8 A;  4ECZ A;  2DNN A;  1NND A;  2MZS A;  1ZZF A;  2JWN A;  5DO2 A;  2AJ1 A;  2F65 A;  3AXK A;  2MYF A;  3VVU A;  1U48 A;  1U1L A;  4OJ1 A;  4OYA A;  1VHF A;  3DC2 A;  1VK3 A;  2VC1 A;  3KHG A;  1U24 A;  3DOK B;  4KM4 A;  4TVA B;  4LVN P;  1R6Y A;  1CS4 B;  5KFW A;  3UCU P;  2CPJ A;  2CNO B;  3D1Q A;  3NCQ A;  3PV8 A;  3FRY A;  3N0V A;  4L72 B;  4LF8 J;  5LMU F;  2VG6 B;  3BGU A;  1N5S A;  4WIQ A;  4QQB A;  3L3C A;  3W5Y A;  3E8O A;  1QUV A;  4KYZ A;  2C22 A;  2RJZ A;  1T11 A;  1GX5 A;  3IFE A;  2IBK A;  9RUB A;  3IGY B;  1AFJ A;  1H38 A;  5J2N B;  2W4C A;  3M8Q B;  3A4T A;  3UN2 A;  2W5R A;  4PUO A;  3ZZP A;  4G65 A;  3MD3 A;  2HQ3 A;  4ZHR A;  1UET A;  1HL6 A;  3R5D A;  3FSY A;  2AGO A;  4ZOS A;  4CRJ A;  5BXI A;  4FYX B;  1X4C A;  3HVR A;  2KJW A;  2LA4 A;  4LQ3 A;  4NCA A;  2H4W B;  3TAM A;  3TVY A;  4AXI A;  3NNH A;  4P72 A;  3L9Z A;  3PKM A;  2R4F A;  5GAD I;  2QSF A;  3CJK B;  2HZV A;  2APO A;  3TUP A;  3A13 A;  5E3Q A;  2UUC F;  2BOP A;  2KH9 A;  1RTZ A;  2LEC A;  1T9Y A;  1R0A A;  1RP5 A;  4ZPT R;  3Q8Y A;  3SQG B;  2PSZ A;  1M5O C;  3RYL A;  2JZ5 A;  3VHQ A;  5K4P A;  2GAH C;  3AB2 B;  2HRT A;  4C3M A;  1PYO B;  4PR6 A;  4FYV B;  2XB2 D;  1LWC A;  1P1T A;  4OHX A;  1S1U B;  2VD3 A;  2VG7 A;  5DM6 Q;  3HK2 A;  1IXK A;  1RCO B;  2AIR B;  3FDS A;  2VBY A;  4A8O A;  3MAH A;  1U1P A;  2GAG C;  4OZ5 A;  4PWW A;  1F3V A;  4B3T J;  4MIV A;  4OX8 A;  2DIU A;  2HQC A;  4NLV A;  1T3N A;  1PO6 A;  2PII A;  4QWE A;  2CJX B;  1T3O A;  4YR2 A;  1XBW A;  3J80 U;  1UW4 A;  3R7N B;  1RUS A;  3EVO A;  3KLI B;  4WPA A;  2RH6 A;  5H1S V;  3H4B A;  1KH9 A;  5J2M A;  2XYP B;  4QIG A;  3I32 A;  5D0R A;  3OL9 A;  3IR6 B;  4J9O A;  3LOU A;  4HT7 A;  3KDN A;  5CCM A;  4IQX A;  4Y2I A;  2HHP A;  3OFG A;  2MZR A;  4NYZ A;  5D0H A;  1VQO S;  3JTN A;  1N5V A;  1EP4 A;  5FDL A;  5SZT A;  2HHH J;  4LFA F;  3G82 B;  1KS2 A;  2AEJ A;  4CM0 A;  2BKO A;  3E2E A;  2HNY A;  2X3G A;  3DXB A;  4BWM A;  4ES3 A;  3FQL A;  4QIW D;  4LBH A;  1U09 A;  4FKX A;  1QAY A;  3IG1 B;  1UPP A;  3GIR A;  4B9L A;  1YLX A;  3M30 A;  5GRR A;  2AU0 A;  2U1A A;  1FE4 A;  2ZZM A;  2V8H A;  5HSP A;  1YWX A;  2HIY A;  1APS A;  1O51 A;  2MMY A;  9ATC B;  2FY1 A;  2F4V J;  1EAY C;  5A8R A;  4CH0 S;  4DFM A;  3D7S B;  4LF7 F;  4RU2 A;  4DV1 J;  2Q79 A;  1M1K T;  4PXD A;  3I9V 9;  4TLR A;  2IJR A;  2ZOF A;  1FRL A;  4ZP9 A;  4NCB A;  3OHA A;  2LQ9 A;  3C6T B;  2KFZ A;  4OX9 J;  4LFB J;  3FSX A;  2JEJ A;  3ZZT A;  1JX4 A;  4O3N A;  1NME B;  3H25 A;  4K0K F;  1N32 F;  4G1P A;  4CM2 A;  2KM8 C;  1YSJ A;  4GTW A;  1JMT A;  1ALJ A;  2HFZ A;  3GON A;  1BXN A;  4U96 A;  1XNR J;  3IR7 B;  2EC2 A;  3NAH A;  3HHL B;  3PIP Q;  3N28 A;  4ANC A;  1HNW F;  1U2F A;  2IPO B;  2N3O A;  3WDO A;  1YJ9 S;  4XIU A;  2QN6 B;  4N8O A;  3I5B A;  4ZMM A;  2V34 A;  3G86 A;  1T03 B;  6FD1 A;  4KR0 B;  4L74 A;  4IDK B;  4DUY F;  2ZHB A;  1TL1 A;  5EGY A;  3AT1 B;  4ZVH A;  3JSM B;  5HRO A;  3IMQ J;  4O3R A;  5LSR A;  5SUH A;  1RTD A;  2VPX B;  5C42 B;  1AJD A;  3IGZ B;  1FRX A;  1P9Y A;  5KFF A;  1HBO B;  5BR8 J;  2VA3 A;  5K8N A;  4X84 A;  3R8Y A;  3IRX B;  2VPW B;  1YBA A;  2YWG A;  3MM8 B;  4OQJ A;  3UD4 P;  2DXE A;  2YNG A;  3MDF A;  4J5O A;  2LA6 A;  1PJ5 A;  1D9F A;  1I51 B;  2CA9 A;  2VOD A;  2KG0 A;  4N76 A;  5J2P B;  1SPB P;  4RR5 A;  2KI2 A;  4I69 A;  1HD0 A;  5AXL A;  5GAE U;  3BO2 A;  2IHR 1;  2DXD A;  4F50 A;  6AT1 B;  2YKA A;  4CH7 A;  3IN5 A;  3KJF B;  4IG3 B;  4B3R J;  2KFN A;  5KFC A;  4TN2 A;  2ALZ A;  3ET6 B;  1RAD B;  1RT4 A;  2HFV A;  2HVI A;  1QUP A;  2ZM6 F;  3JYT A;  3Q2S C;  1JLG B;  2VH7 A;  1YRX A;  4DV6 J;  2AW0 A;  4WFY A;  1BGX T;  3ZNU A;  3ZO7 A;  2RNE A;  1VHI A;  2VG5 A;  1WC1 A;  3CCR S;  4LIR A;  4QYZ K;  3QZ7 A;  2CDR B;  2D69 A;  3CDB A;  3KJQ B;  1FXD A;  2QYG A;  3K0J A;  2GSO A;  1CBK A;  1TUV A;  1S1V A;  3OVA A;  4WWS A;  3P5T L;  3S1T A;  3FZ2 A;  2ZD1 A;  5AJ3 F;  4JI2 F;  4C2M A;  1CJK A;  3LWL A;  2H54 B;  1OY9 A;  1RWK B;  1VQP S;  2E5L J;  2DVI A;  2LDI A;  2B43 A;  4DL3 A;  2BZ2 A;  4ECU A;  3QT8 A;  2CDQ A;  5MAO A;  2JL9 A;  1PAE X;  3M4X A;  2Y3Y A;  1T7P A;  4HH0 A;  4M5J A;  3G8S A;  4YOE A;  2P6S A;  3BM7 A;  3ILJ A;  1Q5Y A;  5CZV A;  4RBT A;  2E66 A;  2MKI A;  4ZKA A;  1BWE A;  3CUL A;  2H4Y B;  1DTQ A;  3ISN C;  1UJ5 A;  3M8W A;  2VJV A;  4GTX A;  5L0E A;  2DIS A;  1NPR A;  3GIM A;  1UJ6 A;  2QE5 A;  3EE3 A;  4HEA 9;  4M5I A;  4OYZ A;  3THP A;  1UAW A;  1NDC A;  4W98 A;  3MR5 A;  2MQL A;  2RML A;  4NAS A;  2XMK A;  2GA3 A;  3NLC A;  4JI1 J;  3DLK A;  4FZV A;  4LFC J;  2BQ3 A;  3W66 A;  3LAK A;  4P7T A;  4TYA A;  1J5O B;  2DR6 A;  2LXI A;  3AOB A;  4PYA A;  4KV8 B;  2G2Y A;  1KQF B;  2XMV A;  4LRA A;  4I6A A;  1H2V Z;  3UQS A;  3PW2 A;  2AP6 A;  3EX7 B;  1EZZ B;  4JI0 J;  1BHN A;  1IVZ A;  1JLF B;  4ID5 B;  5DLW A;  1QSS A;  2FLP A;  2D1C A;  2VZ9 A;  1QAI A;  1N36 J;  2NXE A;  3ETO A;  4DZD A;  2LXU A;  2AEM A;  1EQM A;  5E33 A;  4TY8 B;  4N8N A;  2WHO A;  4PWD B;  4DQQ A;  4KHP J;  2R2U A;  4ECT A;  1HBU B;  3C15 A;  2N3L A;  1HHQ A;  2UXC F;  4USU A;  1S76 D;  3ZZR A;  3RR8 A;  8ATC B;  4A48 A;  2QL5 B;  3A12 A;  1NRK A;  2G9Y A;  2WVD A;  1UEU A;  3N5B A;  4TN0 A;  3UNY A;  2E44 A;  1AJC A;  4B9S A;  3A8E A;  5L46 A;  1AXQ A;  4IFV A;  1XR7 A;  3CCL S;  3M1V B;  4WKY A;  2MQM A;  1RIS A;  3WIV A;  1S0O A;  3MED B;  1YG0 A;  4WZQ A;  2UXB J;  1H7X A;  1LK7 A;  1OQ3 A;  2UXD J;  7FD1 A;  4XPE A;  4DPW A;  3SCL E;  3CUN A;  2BRK A;  2GVZ A;  4C8K A;  4I2Q B;  3B54 A;  3AQP A;  4YB7 A;  3EWG A;  4UW2 A;  4AL7 A;  2ZDP A;  2EG2 A;  4U7U K;  4YHH J;  4Q7A A;  3CJ2 A;  1N6Q A;  2CZV C;  2BBE A;  2CZ9 A;  1T0T V;  1R8B A;  2VBW A;  2GV1 A;  1KLM B;  4O4G A;  4YP3 A;  1S6Q B;  4DFP A;  2M88 A;  3HVT A;  1KHV A;  1WDT A;  2I0X A;  5IT4 A;  3TAN A;  3LH2 S;  1SQF A;  1JNR B;  1Q81 T;  2IC3 A;  4I68 A;  2WON B;  3QSY B;  3C6U B;  4NI2 B;  4CO1 A;  1NJY A;  2C2R A;  2V67 A;  2MQQ A;  5D4O A;  3NXZ A;  2OSQ A;  3DLG A;  3LP0 B;  3DLJ A;  2XMJ A;  4OYW A;  4LRE A;  4P2M A;  1DZ5 A;  1WKK A;  3EGZ A;  1N5Q A;  3GSD A;  2HGN A;  4CYU B;  3MEC A;  4E98 A;  1WG4 A;  1M1H A;  1SBR A;  4P2X A;  3CXC R;  1HQE A;  1XMB A;  4LF2 A;  2XUL A;  1FJG J;  3QAE A;  4J9U E;  5DQI A;  4LF1 A;  1JLA B;  4X62 F;  1Q7Y T;  3R5B A;  2COL A;  5D3G B;  1REV A;  2JLF A;  1FT8 A;  1K1S A;  1GMW D;  2BJD A;  2GC8 A;  2EFG A;  4DUZ J;  2BX6 A;  4KHM A;  4X66 J;  2GX8 A;  3T1Y J;  3ENQ A;  3IGV A;  1AB8 A;  3BH7 B;  5CCL A;  3DRP B;  4ZPV R;  2AF6 A;  1S4F A;  4ZPA A;  1E1Z P;  4JI3 F;  3BBC A;  1TMJ A;  3WX8 A;  5IZH A;  2GA7 A;  1H74 A;  3BR8 A;  1ARO P;  3OUY B;  1SC1 B;  1T9X A;  2HUR A;  3MCM A;  1C4A A;  2GFF A;  1FHT A;  3Q8Q B;  2DY1 A;  5D0E A;  2DRB A;  3EXC X;  2JRS A;  4C6A A;  2ZHA A;  2CJK A;  4JV0 A;  3KJV B;  3EPG A;  4UOR A;  5EWF A;  2V69 A;  4WXO A;  2EI5 A;  1QTM A;  2FVR A;  4ED2 A;  3AHP A;  2K06 A;  3ZNJ 1;  3L09 A;  2HMI B;  3MR2 A;  4QW9 A;  5EWE A;  5A6W A;  1OJ4 A;  3BQ0 A;  2HK3 A;  5D4L A;  2KRB A;  4DN0 A;  5GAH I;  4CXS A;  2ACY A;  2P9E A;  1S9E A;  4OV1 A;  5IQ6 A;  1TU0 B;  5HL7 Q;  4IQM A;  5KT6 A;  4YN3 B;  2F5G A;  4M8L A;  3FBF A;  2K3I A;  3SSR A;  3D6M B;  1IBL J;  1HW9 A;  1HYS B;  1SJ1 A;  2C3U A;  4GVL A;  1ZEF A;  1HAR A;  4HAC B;  4DPX A;  5IWA F;  2HAI A;  5JXS A;  4B17 A;  1SHN A;  1UFK A;  1TFW A;  1OIA A;  1R31 A;  3DMJ A;  5K8O A;  1IQZ A;  4CXU A;  4DN9 A;  4GMK A;  1R89 A;  4IFY B;  3RAX A;  4ALZ A;  2B8P A;  3NGD A;  1TZ0 A;  3VCD A;  4B02 A;  4ZPD A;  3DN9 A;  3K8V A;  3BN7 A;  4ED4 A;  4P71 A;  2YNH B;  4JYA J;  1ZAV A;  2RSQ A;  2CJQ A;  1U7L A;  2BA9 A;  3DU6 A;  2ZH8 A;  3VAJ A;  1X9S A;  1KWM A;  2XZD B;  2GVD B;  1VS3 A;  4YB5 A;  2FJE B;  3N6L A;  2DYA A;  5HLF B;  5EX3 A;  4LJM A;  2RDJ A;  3PRV A;  2PFF B;  2KKH A;  3CT9 A;  3PRB A;  4Q44 A;  4LUB A;  2F8H A;  4QU6 A;  1DY3 A;  3BO3 A;  4OYM A;  4R8U A;  4I7F A;  2W7A A;  3N4W A;  2RIJ A;  1JLE A;  4ED1 A;  2K7K A;  3EZO A;  2YQ1 A;  3CTR A;  1IKX B;  1HQU A;  1XNQ F;  3CJ4 A;  2AKW B;  4H54 A;  3F41 A;  1KOH A;  2UUB F;  2ABY A;  5HQ8 A;  1L3K A;  2AGP A;  4K4V A;  4E8U A;  4QWA A;  4DSF A;  3QGP A;  1OSC A;  3Q3Q A;  2A10 A;  4YR0 A;  1C0T B;  1VQ8 S;  2VIH A;  1J5E F;  3NP5 A;  2MSS A;  3MK2 A;  4ZVP B;  2OH2 A;  2E9Z A;  4ZP7 A;  4DPO A;  2PMH A;  4DR7 J;  1Z1Z A;  4ZVR B;  4K8R A;  1S0N A;  2O66 A;  3IDD A;  4A8Q A;  3PW5 A;  1T95 A;  3JSB A;  3AOC A;  4DV2 J;  5K14 A;  3OSP A;  3KXD A;  1WOR A;  3NMA A;  2EBE A;  2WZ1 A;  1SH3 A;  3UFC X;  1GT8 A;  4YEA A;  5DGA A;  2D9O A;  2QGF B;  3KMQ A;  2FJA B;  4YFU A;  2C2D A;  4H4O A;  1OPZ A;  4DPU A;  1MWQ A;  3MMC A;  4ZVO B;  4LSL A;  1LOU A;  2Q1L A;  2NZC A;  2QTW A;  3HD2 A;  3BO4 A;  4ZG6 A;  1RAG B;  1YRU A;  2Q43 A;  3KK2 B;  4ZP6 A;  1EAR A;  2QA1 A;  3DRR A;  1LQ9 A;  2K7J A;  3CC2 S;  1LXN A;  4KT0 C;  3CNQ P;  5FII A;  3T02 A;  2KHC A;  2FJB B;  4ELU A;  1A7G E;  4ED8 A;  2HGL A;  3PW4 A;  2HPU A;  2ADC A;  3ZZZ A;  2YKQ A;  4B3S J;  4KQZ A;  2R7Q A;  1RAI B;  3D54 A;  4K2J A;  1ALK A;  2G0J A;  3KK1 B;  3PJ9 A;  3UCG A;  5L1J A;  2AYG A;  2NSC A;  2XY6 A;  4RW6 A;  3DI6 A;  4GKJ J;  1IKW A;  4B3O A;  3QIP A;  3BGR B;  1SC4 B;  4K4U A;  4RNF A;  5DDP C;  3CJ0 A;  1CJV B;  1CUL A;  2RDI A;  1UWB A;  4OZL A;  3D0H E;  3MGJ A;  4FXW A;  3ZC4 A;  2MTL A;  2G13 A;  3WHI A;  5GME A;  3NKM A;  2ASY A;  2OPQ A;  2J7K A;  2AX0 A;  3CJT A;  3PIO Q;  1KVI A;  1CG2 A;  4JV2 A;  5AXM A;  3WZ0 A;  2GGP B;  4NWB A;  4R0E A;  3WBZ A;  2VQE J;  5DJB A;  2RHS B;  4P2F A;  2QYC A;  2ZNY A;  4F0M A;  4XO0 A;  1NHK L;  1DQA A;  3IS9 B;  1RT3 B;  4E0D A;  2W5X A;  3KLG A;  5KFP A;  4PZV A;  2CPI A;  4NE9 C;  5CYJ A;  2W7P A;  2NZ4 A;  3G6V A;  2F4F A;  4JI5 F;  4CYS A;  3BSC A;  5CD4 A;  2NXJ A;  1XMO J;  2HHW A;  2WW4 A;  4QR1 A;  3TAQ A;  3W63 A;  4J91 A;  2V6A A;  1S1T B;  3SCK E;  2QLF B;  2KT2 A;  3OL7 A;  2HQF A;  2PMW A;  4M5N A;  5C66 A;  1N2K A;  5DDQ C;  3MEG A;  2DNQ A;  2EW9 A;  3W9J A;  2YVS A;  2YKM A;  1N34 J;  4LF6 F;  1X4F A;  4OFZ A;  2H1Y A;  2XC9 A;  2X1A A;  4URS A;  2O1P A;  4H4M A;  2WVB A;  2BQR A;  2CQ2 A;  4XTT A;  5ETK A;  2W2M P;  3NOG A;  3E2D A;  2RRB A;  4NPO A;  3A3P B;  1D8Z A;  2DHA A;  1F2H A;  5DRK A;  1SJ4 P;  1NBE B;  3CB4 A;  3MCS A;  4DS5 A;  4C9D A;  4FS2 A;  2N4D A;  5DG8 A;  2QIF A;  1S1X A;  3PYG A;  1E6Y A;  3SFG A;  1U0S A;  2XMA A;  3K5N A;  1RK8 A;  3FQK A;  4NLD A;  1CS4 A;  2DNH A;  1LV5 A;  1SHQ A;  5DZ6 A;  1R8P A;  4BHQ A;  3TX0 A;  3E51 A;  2C28 A;  3DDK A;  3LAM A;  4GC7 A;  4MKY A;  3BN4 A;  2VG6 A;  1FEH A;  2KT3 A;  2XSJ A;  3ENV A;  2M70 A;  2Z58 B;  2E5H A;  2G0I A;  1FK9 A;  4LRF A;  4ECQ A;  2NPI A;  5H9E K;  2W5V A;  1RHJ B;  1XJW B;  4IR9 A;  1FNM A;  2IJN A;  5K8M A;  5J2N A;  1YX2 A;  3M8Q A;  4CZC A;  2LQ8 A;  4O0I A;  1NAQ A;  2MGZ B;  3ZTS A;  3FCV A;  4X4R A;  3I0S A;  3B8H A;  3MPD A;  1TVR B;  3D3C J;  4DJB A;  4DLG A;  1NXI A;  1TKT B;  1L3T A;  3D6F B;  3CSK A;  3C2P A;  3GII A;  4ZP8 A;  2J9E A;  3RBX A;  1RT6 B;  2RKI A;  3A8K A;  4M94 A;  2CAJ A;  1IJF B;  1Q78 A;  1ZPW X;  1FNX H;  3CO9 A;  2CQB A;  2C3Y A;  4WFB Q;  1VC5 A;  5KG6 A;  2GZO A;  3IBF B;  1C1C A;  4EBC A;  4DX6 A;  2CQ4 A;  2DD8 S;  4DF8 A;  1TR0 A;  2VG7 B;  3M6W A;  4QR0 A;  4ES1 A;  1RT7 B;  4OYI A;  4F4K A;  2L08 A;  1XMQ J;  5A0Y A;  4ZA1 A;  2VL1 A;  1LNQ A;  3NKQ A;  3M9N B;  4TYB A;  4ZVF A;  3MOJ B;  3I55 S;  2XS5 A;  2ASL A;  5LRM A;  1S1U A;  1DFD A;  1U6F A;  4E2F B;  5IOL A;  2HVZ A;  4B3M F;  3TAR A;  4O3Q A;  3AOD A;  2EEY A;  2KL8 A;  3MFH A;  3TZZ A;  1ACM B;  3GG1 A;  2Q6C A;  2W5T A;  2V94 A;  2NPF A;  4PAA A;  4M1K A;  4OYP A;  5J2M B;  1EET B;  1T94 A;  2OJ3 A;  3GYX B;  2G9O A;  4WFX A;  3DOM A;  4KC5 A;  3AD7 C;  1NDK A;  3JTO A;  2IFY A;  2W8K A;  2HRY A;  2RUG A;  1DHM A;  1EW9 A;  1JIH A;  1OO0 B;  2Q6B A;  3Q83 A;  1EP4 B;  2FJX A;  2N4C A;  5FDL B;  2W2O P;  4A8Y A;  2FHM A;  2VOO A;  2MHE A;  3RB3 A;  3HPO A;  2Q3P A;  1RAA B;  4JI7 F;  1G7C B;  1Q7L B;  1U0H A;  5CH7 B;  4O23 A;  3M2R A;  2YKN A;  2LU2 A;  1WC0 A;  2ZHO A;  2Y1I A;  1O99 A;  4J9L A;  5KG3 A;  1RQ0 A;  3M30 B;  4ZIV A;  4EZ9 A;  2ACM A;  2UUT A;  2AHO B;  5A8R B;  4MTP A;  1S5Z A;  3IWX A;  4WTO B;  2VOP A;  5HN0 A;  3IG1 A;  3HT3 A;  3P4U B;  5K5M A;  2UUA J;  2VAS A;  5F8J A;  3TA2 A;  4ITS A;  2V50 A;  2LEB A;  4ELT A;  5J2Q A;  1HW8 A;  5KFL A;  2XMM A;  1AT1 B;  2KZZ A;  4V1A k;  5KTQ A;  1PC5 A;  4QYZ J;  3SMZ A;  1IKY B;  3Q22 A;  2CJB A;  2ANH A;  3MOZ A;  3A8I A;  3OR1 B;  4J9V A;  4TU7 A;  8AT1 B;  3W5Z A;  4TQS A;  2R2R A;  1ANI A;  1KH4 A;  3C6T A;  1S1W B;  4LRB A;  4RKU C;  3MPU B;  2IM3 A;  5D78 A;  4IOB A;  1Y7A A;  4DSL A;  3N6N A;  1YJR A;  1TKX A;  2DRD A;  5LRN A;  1N5Y A;  2OAU A;  2YPY A;  5GAD U;  4EEY A;  1I94 F;  1ZET A;  2XZW A;  1I6J A;  3GIJ A;  3VGT A;  3O6Q A;  2BJ7 A;  2MY7 A;  2LFV A;  2B56 A;  4PKD B;  2UVR A;  3CCW A;  1FD2 A;  1X4D A;  2L9N A;  4K2X A;  5M2P A;  1GTH A;  2IFX A;  4R25 A;  3AXM A;  4UPK A;  1VR6 A;  1RCX B;  3VF0 B;  5F8I A;  4USM A;  2HBR B;  3JB9 k;  4X65 J;  2JX2 A;  2A2C A;  1TL1 B;  1VRT A;  2CG8 A;  1X9M A;  5GAG I;  1T03 A;  2NXN A;  1LW0 B;  5HRO B;  2OEM A;  4ZVQ B;  4UOC A;  2FD2 A;  1KHN A;  4DFJ A;  3B4D A;  4QOT A;  4IDK A;  3HHL D;  5HRT A;  2GMJ A;  2RRA A;  2VQF F;  2CWX A;  3W7B A;  1QE1 B;  4ZJO A;  4YY3 F;  3BPD A;  4K59 A;  2YNG B;  4ZPC A;  1F9F A;  5C42 A;  2KYZ A;  1HBO A;  3PCO B;  4LF4 F;  4N5S A;  2KYX A;  1SQE A;  1NO8 A;  2XWY A;  1TEL A;  4C8M A;  3CE8 A;  3D0I E;  2HKE A;  2EC0 A;  1S72 S;  1ZTT A;  5KOW A;  4XDD A;  1AUS L;  5B0G A;  4LR2 A;  2GMH A;  3W62 A;  3MCN A;  3J81 Y;  2KFY A;  2HS0 A;  2GIF A;  3JQJ A;  3D2W A;  3A3N B;  2DHG A;  1ZM2 A;  3AH6 A;  5DQG A;  3JYT B;  2C2M B;  1QAX A;  2H5J B;  1SUQ B;  3GYG A;  3LGN A;  1UVJ A;  3M2U B;  4IG3 A;  2BVZ A;  4DR4 F;  1KOO A;  2VG5 B;  2LU1 A;  3ISN D;  2HG4 A;  1N0U A;  3IBW A;  1T02 A;  1B7F A;  3EJM A;  1JLG A;  4JI8 J;  4I6Y A;  3AB4 B;  3MM5 A;  1PG5 B;  1RKI A;  1S1V B;  2LLZ A;  3UW1 A;  1NB7 A;  3QBC A;  3EIC A;  1RHM B;  1Q5V A;  3KLE B;  2Y0S D;  1RU1 A;  5KFG A;  1CJK B;  2F63 A;  3QLH A;  3SZY A;  1H0H B;  1D9A A;  3UNG C;  3WIU A;  4NCG B;  2QLW A;  3J7Z T;  2R7T A;  4ZIT A;  4DG1 A;  2C3M A;  3GU0 A;  1U1R A;  4ENO A;  3ZZO A;  1JQG A;  2RQM A;  4C8O A;  5AE3 A;  5IT9 Y;  3KG0 A;  4ZCL A;  2R7X A;  1AYE A;  4U6P A;  3MK1 A;  1PSD A;  1DTQ B;  3T41 A;  5HBM B;  1FNO A;  5H9F K;  4HHH A;  4HI2 A;  1LWX A;  1S7I A;  4X4Q A;  2E1R A;  2YY3 A;  2FHJ D;  3MAA B;  2ZJQ Q;  1WKJ A;  4PG6 A;  4LF5 F;  5KFO A;  1N8R T;  2DH7 A;  5GMD A;  2B9Y A;  4YME A;  4JI6 F;  1X4G A;  3DLK B;  4K4Z A;  3M9O B;  3VAG A;  3CCS S;  2BW7 A;  1X4B A;  1TP7 A;  3RBD A;  4KAY A;  3W61 A;  2R7O A;  1K44 A;  2Y1J A;  4OMF G;  3DOL A;  3SEO A;  4GTZ A;  4AFF A;  3TQE A;  3FNN A;  5LMU J;  4NML A;  3IAM 9;  3NKY A;  3NKN A;  3FUY A;  4ID5 A;  1FRH A;  2VB6 A;  4AYB D;  2H51 B;  1WHV A;  3I82 A;  4TQR A;  2XYG B;  1KBR A;  3C15 B;  1SKR A;  4TY8 A;  3H2U B;  1AJA A;  3MR7 A;  4ILR A;  1D3W A;  5D0G A;  4X4N A;  1FRK A;  3ZFV A;  1SC6 A;  1UCN A;  3CDU A;  3BDF A;  2H9Z A;  3MWB A;  1TK5 A;  2IM2 A;  2HQG A;  2AEF A;  4UZB A;  4NOH A;  4IFV B;  1FVQ A;  3EGV A;  1U1N A;  4U7C A;  2QV6 A;  5THW A;  2OD6 A;  2NQP A;  4M5H A;  1CVJ A;  2QFJ A;  2XYH B;  2YX1 A;  2GVZ B;  4AL5 A;  1PIL A;  2ZZN A;  4CO3 A;  2DCU B;  2MEW A;  4MKV A;  3NNA A;  4ED5 A;  5KG4 A;  1ZZN A;  2FQQ B;  2HHH F;  3MED A;  5KXA A;  3J7Y I;  3KLV A;  4NLG A;  2JEI A;  2GHP A;  2BM1 A;  3EDR B;  4CIO A;  4O4G B;  2GSU A;  1FX2 A;  1HR0 J;  1HD1 A;  3P8B B;  1WAC A;  1HQA A;  2ZIT A;  3HVT B;  4BWJ A;  4DX5 A;  1ULR A;  5K20 B;  1FWL A;  1Q8K A;  2XS2 A;  2IC3 B;  1BD6 A;  6FDR A;  2HFU A;  1S6Q A;  1UW9 A;  3CCJ S;  4CT8 A;  2PI5 A;  4EBE A;  2F4V F;  3G4S S;  3HXM A;  1HNI B;  3AJD A;  1GXU A;  1XER A;  2PC6 A;  3QYY A;  4C11 B;  2MDA A;  3OFH A;  3OV7 A;  1FRI A;  3IGN A;  1TMM A;  1GXL A;  2HHV A;  1UVN A;  4KGM A;  2V8P A;  3Q24 A;  2R8K A;  1FI4 A;  3N79 A;  1RGV A;  4LFB F;  2FJV A;  1WUU A;  4ECW A;  3HP6 A;  1FDD A;  4TXS A;  1S0V A;  3BPS P;  4ZJL A;  1REV B;  1ZS6 A;  4CYU A;  3EZ5 A;  2GO8 A;  2FZC B;  4DL7 A;  3J81 U;  3O5T B;  1YI2 S;  1HQ2 A;  4MK9 A;  1F5B A;  1JLA A;  2ZOM A;  1FES A;  5D3G A;  2ZOG A;  3Q89 A;  2IIH A;  2NXC A;  3TAP A;  1Q16 B;  3WAX A;  5D4P A;  2J6T A;  3NGK A;  1B0V A;  1X5O A;  1RSC A;  4DUT A;  3T5H A;  1EI6 A;  4LFA J;  2CPZ A;  4HDG A;  3TVZ A;  4ED3 A;  2HGM A;  2QA2 A;  2RQC A;  2BRL A;  1NK4 A;  3WBH A;  1EQ0 A;  4OIX A;  1P8G A;  2X98 A;  3OUY A;  4B9T A;  5DM7 Q;  3TR5 A;  4FBT A;  3UI3 A;  4Z7C A;  4FXD A;  2HVE A;  3KJV A;  5EWG A;  1T05 A;  4C8L A;  4LF7 J;  2ZH2 A;  2XEX A;  1HNV B;  1MW7 A;  5IT9 U;  3T5K A;  3NAI A;  5L1I A;  2ZUG A;  1HMV A;  1SL1 A;  1U8S A;  1VIS A;  3M7V A;  3NMR A;  4PYD A;  3GTY X;  2E1P A;  3TOQ A;  2GQC A;  4K0K J;  2B4U A;  1N32 J;  1RTH A;  5DG9 A;  2B5J B;  5B7W A;  3BH6 B;  3PX4 A;  3LGH A;  2GO9 A;  2V2K A;  3OTE A;  4B3R F;  3CCE S;  1VJW A;  2X1F A;  3IR5 B;  1RT2 B;  2QFI A;  3CVK A;  1HYS A;  3GE9 A;  1HNW J;  3R5G A;  4M5K A;  1TUG B;  4NMX A;  3K5M A;  1S77 D;  4IRC A;  2H48 B;  3PW7 A;  4BBY A;  4Z2X A;  2XGP A;  1UVK A;  3HMJ G;  5EUH A;  1S48 A;  3M6U A;  7AT1 B;  4MMO A;  3MM6 A;  1YZ7 A;  2P6T A;  5F8N A;  4DUY J;  5CAA A;  4EFA C;  1NDP A;  2DRA A;  2Z57 B;  4PRF A;  1D0E A;  4Z37 A;  2Y8W A;  1CC8 A;  2YNH A;  3I56 S;  2J5A A;  3DRS A;  4KAI A;  3WAV A;  3K7R A;  4NLS A;  5DLT A;  2JEF A;  1U1K A;  1M1G A;  1C4C A;  2VDI A;  2YWK A;  2LQ5 A;  2H5I B;  4OV6 A;  1JLE B;  2BDP A;  4RPF A;  1B99 A;  1HQU B;  2AZ3 A;  2RRN A;  3UCZ P;  4PXC A;  2R7W A;  1YDL A;  3MM9 A;  1S0M A;  3V6D A;  3NGU A;  1V5I B;  3MZI A;  1JLQ A;  3CED A;  2VPY B;  4DR5 F;  2DCL A;  1D1U A;  2DT9 A;  2EFQ A;  3HI9 A;  4FKY A;  3Q8P B;  1W25 A;  1NK9 A;  1EX8 A;  2JSX A;  3SFU A;  2CFX A;  4LFC F;  3U1L A;  1SV5 A;  3GMG A;  4YS2 A;  3K5P A;  2PE8 A;  3NKP A;  5L0K A;  3DNC A;  4NWX A;  2D7S A;  2AMC B;  2FPH X;  5KT4 A;  1R8C A;  4YUD A;  3MXH P;  2EFO A;  2DB1 A;  5E0O A;  3PZP A;  5K14 B;  4CQ1 A;  4ELV A;  3QT5 A;  4A8W A;  3NKR A;  4GRS A;  1Q8I A;  4ZCM A;  1R0B G;  2VFV A;  3MMJ A;  3LXQ A;  5LQQ A;  2CNK B;  3MAQ A;  1JKH B;  1OYD A;  1IR1 A;  4RBV A;  3GR0 A;  3BGO P;  4H4O B;  5AJ3 J;  1ZED A;  4JI2 J;  1N56 A;  3BEG B;  3MMC B;  1S4E A;  2W2P P;  2VON A;  4KHP F;  4KJG A;  4UUW A;  2OKQ A;  1KHL A;  1KVJ A;  4ZN3 A;  4CLT A;  3DRR B;  3BJY A;  2CNN B;  3LW5 C;  4DL2 A;  2E5G A;  3IC1 A;  1PKU A;  3BSO A;  4HT5 A;  4NRU A;  2KDO A;  2HZA A;  1PGZ A;  5GAH U;  4WP3 A;  2ZBI A;  4ZCK A;  2VF3 A;  2YWW A;  2L48 A;  2K1R B;  1S9G A;  4FXV A;  2WVF A;  4M5G A;  2IY5 B;  5BJR A;  2JJ4 D;  2W9C B;  2F9D A;  1N4L A;  1B3T A;  4RW6 B;  4OJ3 A;  4UST A;  5CXT A;  3DI6 B;  3UD5 A;  4PXB A;  4YHH F;  2ILY A;  4MHX A;  3NS6 A;  4PG5 A;  5F9L A;  1WG1 A;  2RU9 A;  4B3O B;  2MQ8 A;  3TG0 A;  2DNY A;  3I96 A;  1S6U A;  2V2Z A;  1KQG B;  5AXK A;  2W7O A;  3QAT A;  5H9E J;  1ALI A;  1W26 A;  1CUL B;  1UWB B;  3HFZ B;  4ECV A;  3BGR A;  4J9R A;  4OX7 A;  2C3O A;  1RA6 A;  2IMW P;  3MUM P;  3PRD A;  1CJV A;  4O4R A;  4DSE A;  1YQH A;  5CA5 A;  3SZZ A;  4X4V A;  2YH0 A;  3TVK A;  1Y3K A;  1A9N B;  3JQM A;  2FHO B;  3HFK A;  1HKA A;  3KLG B;  3IBC B;  1RB0 A;  2JC1 A;  4I1T A;  2VKR A;  3J7A N;  4LQ9 A;  4Q8F A;  1FJG F;  1BQM B;  4DCP B;  1KSP A;  2R8J A;  4PQA A;  4CYR A;  1RT3 A;  1YTY A;  3KHR A;  2FGO A;  3WAY A;  1K9M T;  2ZE2 B;  2OGU A;  3H20 A;  4RW7 B;  2BV3 A;  4NZ0 A;  1KKH A;  2W2Q P;  3G71 S;  1GXT A;  4WYL A;  3Q0A A;  2ADB A;  1Y5L B;  4G1Q A;  3QRR A;  1URN A;  3HVA A;  5LMN F;  3DHX A;  1FTR A;  3MEG B;  1S1T A;  2UVU A;  1WWH A;  3T9Z A;  4RUC A;  1N33 F;  2M0G B;  2O67 A;  4DR1 J;  3JAM Y;  3SSS A;  3KJN B;  1NK5 A;  2ZH6 A;  2CQD A;  3IM8 A;  4CWB A;  2PT0 A;  2N7Y A;  4NEY A;  4V19 X;  4ERD A;  4RUH A;  2YPZ A;  4H4M B;  1T9T A;  4ETX A;  3IA0 A;  3K5L A;  2MQN A;  3M32 A;  5HP1 A;  4ZVG A;  2QEX S;  5HK4 A;  1EQJ A;  2KXH A;  2WSC C;  1VQ7 S;  3HVW A;  2J0X A;  5KFA A;  1U25 A;  3R2C J;  2HHX A;  1ELO A;  1S1X B;  2HLU A;  1HI0 P;  1E6Y B;  2OMO A;  4CLS A;  4A8M P;  2HFN A;  2UVV A;  2E1A A;  4GKK J;  1K8A T;  2ZH1 A;  1LW2 A;  3HDS A;  4KHR A;  4OZ0 A;  2AJ0 A;  2BAN A;  2W9B A;  4ZVT B;  1L3V A;  2N7C A;  4U8Y A;  5KFX A;  5KG2 A;  2LMI A;  1YJ7 A;  1VIO A;  2XSJ B;  2DNM A;  2QA4 G;  2I9S A;  2ZBR A;  2HND B;  5KAK A;  2RIL A;  1VQS A;  2FLO A;  3UR3 C;  1Q8B A;  1FK9 B;  2QLB B;  4X62 J;  4CO0 A;  2HLT A;  4OI1 A;  1HWI A;  3AA9 A;  3KG4 A;  3GB0 A;  2Z2Y B;  3R1H A;  2I5J A;  2NSB A;  1FJE B;  2DHS A;  3EZU A;  3I0S B;  4FDJ A;  5L39 A;  4HKQ A;  2HEK A;  3LF0 A;  4ID8 A;  5CZX A;  3Q8S B;  2IDL A;  4NA2 A;  2CZ4 A;  4DQS A;  2JFK A;  1TAQ A;  4JI3 J;  2MGZ A;  4OHW A;  2CPH A;  3IP0 A;  1NHV A;  1TVR A;  1F5C A;  3HFV A;  1HJK A;  1WEZ A;  2RB7 A;  3E3X A;  3QT7 A;  3ISZ A;  2IA6 A;  1TKT A;  2RKI B;  1H73 A;  1AFI A;  5D77 A;  2FVC A;  5A8W B;  5C25 A;  4JYA F;  2VFU A;  5E3P A;  3J81 j;  4WU3 A;  3H5Y A;  1NB2 A;  5IXU A;  3FGV A;  2MQO A;  2Z30 B;  1C1C B;  2R8H A;  4URQ U;  1RT6 A;  3K89 A;  4L3N A;  1AA1 B;  3BYP A;  4CNY A;  4DSI A;  4RW9 A;  4LRD A;  4KGZ B;  1LFW A;  5A0Y B;  3N9U C;  4QBU A;  3V4I A;  1URA A;  1RHK B;  3UVJ A;  4HR2 A;  1TKD A;  1Y10 A;  4ILL A;  3D6T B;  1FDN A;  2YXL A;  3DYA A;  1RT7 A;  1UVM A;  2OO4 A;  2OFH X;  4P7V A;  4ZLJ A;  5L9N A;  1U2C A;  3HKZ D;  2CVE A;  3LPY A;  2PDA A;  1D9D A;  4J9S A;  3T19 A;  5G4D A;  3KFW X;  2LDY A;  4XK8 C;  4DV5 F;  3DOM B;  3FBC A;  3QQC D;  4ZVU B;  1P9Q C;  3G8Q A;  2ZH3 A;  4K4T A;  1FE0 A;  1RTJ A;  2OFG X;  2KM8 B;  2J76 E;  2DHX A;  1EET A;  4ZLP A;  1M5K C;  4OZN A;  2J8A A;  3C3L A;  4LSZ B;  1NKB A;  3NS5 A;  2FC9 A;  4C8Z A;  1U0H B;  5IM0 B;  1RWV B;  1FFW B;  2IYI A;  2D9P A;  5KFU A;  3M2R B;  2YKN B;  5L1L A;  2VBZ A;  1KVK A;  2BYC A;  1PYT A;  4DV7 J;  2IM1 A;  2I6W A;  3MD1 A;  3ONQ A;  3W9H A;  3R7B B;  3PXG a;  3M2V B;  1URB A;  2HHT A;  2HW3 A;  2WSE C;  4F7V A;  2J0S D;  3SXL A;  5I3U B;  3G9C A;  1HBM A;  2NUU G;  3TUJ C;  3BV8 A;  1SJ3 P;  4YQW A;  3OLA A;  3SIP B;  3SCI E;  5J2Q B;  3RGI A;  4B9V A;  1H98 A;  2G2Z A;  1VI7 A;  3OBI A;  3OR2 A;  1YHQ S;  1XNQ J;  1TQL A;  4RUB A;  2P9G A;  3OJS A;  4CLW A;  1BUX A;  2DXF A;  2YX4 A;  3GPA A;  5AE2 A;  2I1R A;  2UUB J;  2OPS A;  3F73 A;  4CLF A;  3DRX A;  5ETP A;  2CQG A;  3JAM U;  4Y00 A;  1IKY A;  4DX8 H;  2XWX A;  2HBY B;  3PJW A;  4F26 A;  3BBB A;  1J5E J;  3ELH A;  3Q86 A;  1M0S A;  1J2V A;  1FRJ A;  4USI A;  1TKX B;  3OR1 A;  1ZM3 A;  4L3K A;  1N5Y B;  2DHH A;  2EFP A;  5EDW A;  1S1W A;  2ZZT A;  1AZS B;  2DR9 A;  1NZA A;  1JJ4 A;  2IAJ B;  5H9F J;  2MST A;  1VOM A;  2VQE F;  2NRE A;  2CQ0 A;  1VRT B;  1Q82 T;  1VLY A;  5HMZ A;  1ANJ A;  3NCP A;  2IRX A;  5BYQ A;  3FMW A;  4ZN1 A;  2WTF A;  2CJ9 A;  2MJU A;  1PYS B;  2ZBP A;  1HIY A;  3D4J A;  2X1B A;  1LW0 A;  1S6P B;  2F7V A;  2AJQ A;  4B08 A;  3R27 A;  2V2V A;  3R9L A;  1HA1 A;  2LVW A;  1QE1 A;  1H3D A;  3JSY A;  3RUB L;  3CJ5 A;  1F0X A;  2LYV A;  4O44 A;  4TNO A;  5LXR A;  5LL6 d;  1UVL A;  2W1B A;  2F1F A;  1N34 F;  3FBB A;  1O8B A;  3Q8V A;  2HQI A;  3THV A;  1SCJ B;  2QLX A;  3DFE A;  2XR9 A;  1GX6 A;  3D66 A;  2HBZ B;  2DK2 A;  3TW0 A;  1M5V C;  2ZH4 A;  4QPX A;  3ED4 A;  2WB1 D;  4J90 A;  3AD9 C;  4IOA Q;  1NSQ A;  4U95 A;  1TKZ A;  1N0V C;  2VC0 A;  3ZXW A;  4DI6 A;  2XQC A;  4F0K A;  4LT6 A;  1N52 B;  4ECX A;  5IFM A;  1DAR A;  4PWU A;  2KZM A;  4YB6 A;  2DBB A;  1V9O A;  3V6K A;  3CCV S;  4X4S A;  1GTE A;  2MKK A;  3TJ8 A;  1CJT B;  1OY8 A;  1SUQ A;  3M2U A;  1WEY A;  3MM5 B;  4DR3 F;  1IM4 A;  3KTQ A;  4FYW B;  4WE1 B;  4C8N A;  3IRW P;  2C2E A;  2PEB A;  4MFB A;  2CPF A;  1VQL S;  3TZW A;  4NXN F;  3QLH B;  1QVF R;  1CJU B;  2ZWP A;  1CQM A;  5B0D A;  1Y6V A;  1X7V A;  2DGO A;  1ZH5 A;  3HHE A;  4DG1 B;  3KLE A;  5DLF A;  3VGS A;  2DNR A;  3ITH B;  3KYL A;  2BAC A;  2CQ3 A;  1XC9 A;  4I2P B;  4URG A;  1FWK A;  1KN6 A;  4NCG A;  4DX7 A;  4BLG A;  1TL4 A;  4DQI A;  2V68 A;  4UOO A;  1NSA A;  1WEL A;  1DBD A;  1IBK F;  3J7Z 5;  3FVY A;  1VRU A;  4GVB B;  4JB8 B;  2EFV A;  2GSN A;  5HBM A;  4ED7 A;  3DLE B;  4QR2 A;  1NJI T;  4LF6 J;  4G3I A;  5KG7 A;  2XSF A;  2YQ3 A;  4KH0 B;  1F2G A;  1GK8 A;  3HCX A;  4OI3 A;  2R8I A;  1F6T A;  4PQU B;  4I56 A;  1IKV A;  3MAA A;  3TEH B;  3W65 A;  2GJI A;  1UVI A;  1MSW D;  3NNC A;  2ZNZ A;  3S8S A;  2LQB A;  2GHW A;  3T6J A;  5A6P A;  5HVH A;  3DOL B;  1KP6 A;  1XN9 A;  1MRO A;  2O01 C;  5DG7 A;  2DPI A;  3U27 A;  2ZDO A;  2LEA A;  4NLU A;  4DEZ A;  2XZT B;  1HWK A;  1QM9 A;  1WD6 A;  1AJB A;  2V9K A;  4OLO A;  3HSJ A;  5GAG U;  4X4P A;  3RAM A;  4IO9 Q;  1LWF B;  4OZ1 A;  3MK0 A;  5DLG A;  4F4Z A;  3H42 A;  2X51 A;  3DM2 B;  1EKS A;  2MKH A;  4KIA A;  4U67 Q;  1SQG A;  3OTO F;  1TL5 A;  4DV0 F;  4DSK A;  1Y9O A;  3MPV A;  3HZG A;  4DR6 F;  1H72 C;  1N54 B;  3CCT A;  3ZTP A;  2DEJ A;  1RE1 B;  2V9W A;  1FWP A;  2DNK A;  1G3O A;  4ZK7 M;  2R7U A;  2ALY B;  1BLU A;  5GVQ A;  1VK8 A;  2EVZ A;  3OXF A;  1C1B A;  4JP8 A;  3HJV A;  4ZVE A;  3PX6 A;  2YNI A;  1WF1 A;  2ASD A;  5JUM A;  5T7L B;  3HLU A;  5AXN A;  5HAT A;  4I67 A;  2XCA A;  3VGV A;  4HYK A;  4OI4 A;  2EWH A;  2D1G A;  3P45 B;  4NYO A;  1REG X;  1IUJ A;  4DOZ A;  1OMS A;  1WF2 A;  3FFI B;  2XO6 A;  2AJF E;  2JLG A;  3OSN A;  4C98 A;  3GZ7 A;  3TUI C;  2OSR A;  3PR4 A;  1NDL A;  5LJ5 Y;  1DTT B;  2BQU A;  3TWZ A;  1B8J A;  2A18 A;  4LR7 A;  5LT5 A;  1UPM B;  1XR6 A;  2G1H A;  4J9Q A;  1JLB A;  2Z2L A;  1HNI A;  2XNR A;  3BKU A;  4B3M J;  4J9N A;  4F4A A;  4C11 A;  4C4W A;  5A8K A;  1Y11 A;  3HJF A;  3LP2 A;  1V3Z A;  4EBD A;  4RBU A;  3ZZ0 A;  4ZVS B;  1IWG A;  2IDE A;  4ECY A;  1RWN B;  4WFA Q;  3GFH A;  3D1O A;  3CW2 C;  1V3R A;  3U1N A;  5JVG Q;  5HMX A;  4K50 A;  3H59 A;  3CD7 A;  2C1E B;  4MYU A;  1GAO A;  5B08 A;  2CWK A;  2MKJ A;  2MLZ A;  4KB7 A;  2OPP B;  3F0N A;  2HWI A;  3K58 A;  3RB4 A;  1ROF A;  3WQP A;  1YJV A;  1X0F A;  3MTK A;  1M5P C;  4JI7 J;  2GHV C;  3EGW B;  4C3K A;  4OHY A;  3H40 A;  5D15 A;  3BQ1 A;  2HIQ A;  3L7U A;  3W2W A;  3RR7 A;  5B0A A;  4DV4 J;  4RW4 A;  4UZC A;  2KO1 A;  1CLF A;  2RT3 A;  3EDQ B;  2KU7 A;  1SH2 A;  2VPZ B;  3R2D J;  2J0W A;  5KFJ A;  4U8V A;  2M52 A;  1KNZ A;  1WOO A;  2NYI A;  2KXF A;  1UEK A;  1T05 B;  2P2C B;  2MPU A;  3PAC A;  4UPI A;  4G1I A;  5KG5 A;  1U1O A;  3OL8 A;  3OJU A;  4NLX A;  4TKT A;  2RD5 C;  2GIR A;  1HMV B;  3ILO A;  1SJR A;  5LSO A;  1RWW B;  3PHT A;  2GQ2 A;  1HI1 A;  1HNV A;  2FB0 A;  3GP9 A;  1LWE B;  3C19 A;  1RTH B;  4F4W A;  3DGP A;  2RQK A;  5FLX U;  3R6L B;  2GNK A;  4RX6 A;  3OXG A;  2J7U A;  3C14 A;  3T1H J;  2B5J A;  3H0P A;  4JUZ A;  3V5R A;  3M8P B;  1I94 J;  1IR2 A;  2V8V A;  4KAV A;  3BR9 A;  4R5P A;  1HFE L;  3A8J A;  3J7Y U;  2RS8 A;  1QY7 A;  1RT2 A;  2B8Q A;  2BW2 A;  4Q45 A;  3T01 A;  2DGW A;  1HWJ A;  3MM6 B;  1B64 A;  2AJ4 A;  2Y1L B;  3R5A A;  2F8M A;  4YDD B;  1XIQ A;  4L75 A;  4EYI B;  1H7W A;  2QL9 B;  2KG1 A;  1QSY A;  1KTQ A;  5D6G A;  4CDI A;  4WYW A;  1C0U A;  3HT0 A;  4DLE A;  3DRS B;  3DRY A;  2HAF A;  1U45 A;  4C3L A;  3GJR B;  2GJ2 A;  4FPI A;  2VQF J;  2N82 B;  4YY3 J;  2YX7 A;  4JOU A;  1QD1 A;  1XR5 A;  3BB5 A;  1XQI A;  3Q2T C;  4IUF A;  3G6Y A;  4V19 J;  2V8D A;  3KUG A;  1X4H A;  5AE1 A;  4LF4 J;  2QMU B;  2GML A;  5T14 A;  2B6A B;  3MM9 B;  3V6D B;  2WAQ D;  2MB0 B;  1S97 A;  2HS4 A;  3EVM A;  2WCX A;  2KB2 A;  4OZJ A;  1JLQ B;  2ZBQ A;  2QO3 A;  4QIV A;  5KFM A;  1JXV A;  4J7C A;  2R42 A;  3BSN A;  4BDP A;  4KFB B;  1FER A;  3CJR A;  4ILM A;  1ZAW A;  2XHC A;  1SV5 B;  3K17 A;  2M5Y A;  1ZYQ A;  2CQ1 A;  2ROG A;  4DR4 J;  1VIX A;  3M6V A;  3MR3 A;  2B9X A;  3PHE A;  3HO1 A;  1KH7 A;  3TJ9 A;  1KC8 T;  1TK8 A;  1U4B A;  3CPW R;  1VMB A;  3V6H A;  3PFO A;  5DQH A;  2E5I A;  2KVQ E;  4RO0 A;  3W1Y C;  4MY4 A;  4NXM F;  1VRQ C;  5C5J A;  4NL5 A;  1YRT A;  4DCO B;  3CJS A;  3EYZ A;  4BC9 A;  4Y28 C;  1YIT S;  2WBM A;  1FF2 A;  2Q66 A;  1JKH A;  2DGV A;  3CC7 S;  4EO6 A;  2IMO A;  1RLC L;  5LIA A;  3TX8 A;  4DL5 A;  2L3M A;  3D6H B;  2CG4 A;  4ICL A;  4I64 A;  2OUG A;  4A8X A;  2X3D A;  1K1Q A;  2W4D A;  1DQ8 A;  4ZG9 A;  2IVY A;  3RTV A;  1I1G A;  3SCJ E;  5JMN A;  1S9G B;  2NYH A;  2XI2 A;  1W2I A;  4AT1 B;  1WDD A;  3RU0 A;  1TV6 A;  4MIB A;  1ZTW A;  2O3D A;  3GV7 B;  4Q0B B;  4DU8 A;  2DGS A;  3BYR A;  5M2R A;  5LXY A;  2BOA A;  2K1R A;  1YBT A;  4LF5 J;  1T8E A;  1QVG R;  3BBF A;  3U02 A;  3PX0 A;  4JI6 J;  3MMA B;  1HR0 F;  2W9C A;  1BQX A;  4QJV A;  4K4X A;  4AD6 A;  3EUN A;  1Y5N B;  3CWJ A;  1JWW A;  1ZOT A;  2V5H G;  3KK3 A;  1NJZ A;  2PA8 D;  2EK1 A;  4IKA A;  5ITH A;  1U6B A;  1NK6 A;  5KFB A;  2DR5 A;  2VHG A;  4DL4 A;  4Z7Y A;  2AYM A;  2W4P A;  3MPW A;  2GIQ A;  4P9S A;  3HX9 A;  5CYM A;  1PIE A;  4DV3 F;  1PAU B;  1KEK A;  2PMZ D;  3RG6 A;  2EK6 A;  2P8I A;  1NJW A;  2B4V A;  3G96 A;  4MKB A;  4NLW A;  1IM6 A;  5K9F A;  2BR0 A;  1F3F A;  4CO5 A;  1IBM F;  2J7W A;  3LA0 A;  1F9E B;  5CAB A;  1P1L A;  3NVL A;  4UOH A;  4FVC A;  4XPC A;  1Y3J A;  1HNZ F;  5BYS A;  3RB0 A;  1U26 A;  2NXU A;  3MM7 A;  5IJS A;  1SC3 B;  3IAS 9;  1WI8 A;  3TI0 A;  1BQM A;  2QG9 B;  1YK9 A;  5KT7 A;  2JH3 A;  4G1Q B;  5HVF A;  3T9N A;  3KOA A;  3D67 A;  3O44 A;  2ZE2 A;  4GO5 X;  5A76 A;  2ZKT A;  4RW7 A;  3MCO A;  1R6V A;  1HPZ A;  5HQL A;  2LQJ A;  2HNZ A;  2I2Y A;  2KJV A;  4DDF A;  2ZH5 A;  2A6M A;  3ICL A;  1QDU B;  1HBN A;  1X5T A;  3OFE A;  5I3Q A;  2OPR A;  2OP5 A;  5EX0 A;  3VZH A;  1NSK L;  1R0C B;  5KFN A;  2ZKU A;  3W60 A;  3M32 B;  5HP1 B;  1R7I A;  1Y0H A;  4USH A;  3D28 A;  4JV5 F;  3MFI A;  3PO4 A;  3QT6 A;  4IRK A;  3OT9 A;  3SSQ A;  2A6O A;  1VLO A;  4MH8 A;  3RZA A;  1PJ7 A;  2UVW A;  4LRC A;  2GS8 A;  4J9K A;  1KLN A;  2ZEJ A;  5BYR A;  3M8S A;  1LW2 B;  2W9B B;  2BAN B;  3KKF A;  4DSJ A;  1G6B A;  2ATL A;  3N01 A;  1VGY A;  5F8G A;  1XEZ A;  1KD1 T;  3RRH A;  1TL7 B;  1CSJ A;  2CXE A;  3K57 A;  3AA8 A;  5F9N A;  2DIT A;  3W2V A;  4UY8 T;  2V4J A;  4A8F A;  1Y4Z B;  1QAJ A;  2ILZ A;  4W90 B;  1SKS A;  4R0J A;  5G0R B;  2DIV A;  2E5J A;  2HND A;  2I5J B;  2J0Q D;  3EM1 A;  4NEZ A;  1TL3 B;  3CME S;  3PEH A;  3RRK A;  2DO0 A;  1NU4 A;  5J1N A;  5CHC B;  1B4S A;  4Y2C A;  2B51 A;  4OJG A;  1RHR B;  3AY0 A;  1VFJ A;  5J1E B;  4QIE A;  2IJF A;  2J9C A;  4IO1 A;  3OVS A;  3VAL A;  4LF9 F;  4F0H A;  4NWJ A;  1RA7 A;  3HKW A;  4CO4 A;  2DGX A;  3MPY A;  5C25 B;  3KDO A;  3T00 A;  2BKN A;  1QJH A;  3NKO A;  3L7P A;  2G1D A;  1KFD A;  4Y6I A;  1RU2 A;  4KGV B;  3DDN A;  4X64 F;  1SVD A;  2CQP A;  1ZPV A;  1WNE A;  2POK A;  5A8W A;  3FEX B;  4RW9 B;  2VIC A;  2B9E A;  3BDG B;  4Y0F A;  1SH0 A;  1CEZ A;  2PD1 A;  2BJ9 A;  1A0O B;  3V4I B;  1WC3 A;  3UVJ B;  2RU3 A;  3EMT A;  2PI4 A;  3JQK A;  2WOM B;  1JLC B;  2CJA A;  1N48 A;  3DYA B;  4FVM A;  2VU5 A;  3SDE A;  4FF3 A;  3W9I A;  3OTC A;  3K8W A;  5F3T A;  3RJM B;  3VTI A;  3NY0 A;  2QMX A;  1AUD A;  3CD0 A;  2XS7 A;  2RH3 A;  4JI4 F;  2OHD A;  2YWF A;  2IYG A;  1BMQ B;  1B7Y B;  1RAO A;  5C7P A;  2A1B A;  1UJ4 A;  4KO0 B;  4WP8 A;  1DRZ A;  3GCW P;  2D3Z A;  1RTJ B;  4F8R A;  3UDC A;  3HHL C;  4K4Y A;  3QNW B;  2BEF A;  2YWH A;  2D3O R;  3PG9 A;  3EVW A;  5KFY A;  1YGY A;  1QLN A;  1RWO B;  4IR1 A;  2OTL S;  1Q79 A;  2XCP A;  4TLQ A;  1E2S P;  5DLV A;  1JXL A;  1I3O B;  3F44 A;  1JB0 C;  2EXU A;  3CIM A;  5IJQ A;  1RT5 A;  4U7U D;  5IM0 A;  3ENW A;  3RBE A;  2DR7 A;  2JDJ A;  4N77 A;  5ETM A;  2EG1 A;  4B56 A;  4QW8 A;  4AQY F;  4KPY A;  4HHU A;  2VDH A;  1HBM B;  3M6X A;  2Z0G A;  3M2V A;  2CPD A;  1UWA A;  5CYQ A;  1C2P A;  2KT5 A;  2IVM A;  3T6B A;  4EGL A;  3BRE A;  3OR2 B;  2W5W A;  3MR6 A;  1MNE A;  1S7H A;  5I3U A;  3CMQ A;  3P49 B;  3CCQ S;  4DQP A;  4WTY A;  1Q4R A;  3U7J A;  3CMR A;  1BE4 A;  3S7R A;  1TFY A;  3ENA A;  1KQS R;  2FUG 9;  2OPS B;  4AL6 A;  4DR5 J;  2RQ4 A;  1XWL A;  4M95 A;  3B78 A;  1U1M A;  4DQR A;  1F1B B;  2C2Z B;  1RWX B;  4EK2 A;  1NKE A;  2SXL A;  3JXO A;  4OZ3 A;  4UQG A;  1IQT A;  2MLY A;  3HSZ A;  3NG8 A;  4TY9 A;  3DYC A;  3Q23 A;  3PYE A;  5IQQ A;  4J9M A;  4DR2 F;  2XI3 A;  2OML A;  2V8G A;  1A6L A;  1SXL A;  2ZJR Q;  1X4A A;  3KNG A;  4PEO A;  3N6M A;  4ZIW A;  2RE1 A;  5E3A A;  1FFS B;  1P6T A;  3HSG A;  4P75 A;  1AZS A;  1AW0 A;  1UZD A;  5CD4 H;  3AAW B;  2HFO A;  2DGQ A;  3MMB A;  1FEE A;  1RAC B;  5E2Q A;  3MEE A;  4J9P A;  3BGL A;  4CLZ A;  1I5O B;  3DCA A;  3HZE A;  3R3T A;  1H2U X;  3D3B J;  3O8W A;  2FJD B;  3IXQ A;  4JV1 A;  2IAJ A;  4F67 A;  5MLC V;  2UUW A;  3D9B A;  2CNL B;  2V2Q A;  1SIZ A;  1Y5I B;  4B9N A;  1FO1 A;  2A2D A;  1M90 T;  3ULH A;  4NZ6 A;  2JVO A;  1S6O A;  2QX0 A;  2VFR A;  5JVH Q;  2DY9 A;  2BUN A;  4MJK A;  1WJ9 A;  2Z8Q A;  3V81 A;  4EUV A;  2R2S A;  5E3R A;  5FD1 A;  1YVF A;  5KFZ A;  5ETO A;  4KKO B;  1HDH A;  1S6P A;  1EIY B;  4O44 B;  4NYP A;  1PCA A;  3LWM A;  4DR1 F;  1H2T Z;  3E01 A;  1LEO A;  2W25 A;  3C66 A;  4DWI A;  2D3U A;  2H3E B;  3CF5 Q;  3GWC A;  4RU9 A;  2XTJ P;  1TKZ B;  4RW8 A;  4Y65 A;  1KQK A;  1F5A A;  3VQT A;  1UEV A;  2BM0 A;  5KFQ A;  3BF4 A;  1RAH B;  3MUR P;  1VBZ A;  1O6X A;  4O3O A;  1UP1 A;  1WI6 A;  1GMW A;  4UPH A;  4GKK F;  1Y00 A;  2J9D E;  1G2E A;  2L41 A;  4K4W A;  4MFB B;  4LF8 F;  1JK9 B;  1CQN A;  1CJT A;  1NH7 A;  4WFN Q;  1HNX J;  3I0R B;  4RUA A;  2IBO A;  3M8R A;  1DQ9 A;  2UU9 J;  2QJ3 A;  4DL6 A;  4WE1 A;  1RAE B;  2NCK L;  4USK A;  3QO9 A;  1CJU A;  1B70 B;  5F3Z A;  2F8E X;  1RT1 B;  5DGB A;  2FVQ A;  4QCL A;  3POT A;  1Q8L A;  3BGF A;  3ITH A;  1X60 A;  4DPT A;  1R8H A;  4HTI A;  3BDH A;  2EPI A;  3V6J A;  1OPI A;  4I2P A;  5LMN J;  1KDN A;  1S99 A;  3NEK A;  5F41 A;  1MWZ A;  2DGT A;  4OI6 A;  5D4N A;  1VRU B;  3OLB A;  1SKW A;  4Q2M A;  1N33 J;  2HRU A;  2RF2 A;  1DLO A;  1WF0 A;  1V3S A;  2J8S A;  5HMY A;  3H98 A;  2VUG A;  1YJU A;  3H2L A;  3P5B P;  3OL6 A;  3MUV P;  3TO8 A;  4GVB A;  3M05 A;  1EW2 A;  1IKV B;  1WKL A;  2FVP A;  1MU2 B;  3ZZU A;  3H5X A;  1EJ7 L;  1O0P A;  3DLE A;  3GLJ A;  2GCF A;  4OZ2 A;  4GTY A;  4N47 A;  2IUC B;  4FS1 A;  3SBM A;  3LUY A;  3PW0 A;  2EKY A;  4KE5 A;  3L95 X;  2ZFH A;  4Q43 A;  5KFD A;  2XO7 A;  4PQU A;  1MRO B;  2U2F A;  2BE7 D;  1S10 A;  1S57 A;  4CTA A;  1EHW A;  1PC4 A;  3MTJ A;  2YWE A;  3NS7 B;  4RWW A;  4FN5 A;  2YKO A;  4NLQ A;  4OHZ A;  3PO5 A;  4NX9 A;  2MZT A;  2FC8 A;  1Q1K A;  3TJA A;  2V4R A;  4B3T F;  4LSN B;  3B4M A;  1V5V A;  2VFS A;  4RL1 A;  4ZS6 A;  1IN0 A;  3BDP A;  1LWF A;  1S9F A;  1YIJ S;  3ZTQ A;  3GJQ B;  3MHY A;  2E9R X;  1H6K X;  1U02 A;  4LR9 A;  5HJY A;  4UTG A;  4DBQ A;  3DM2 A;  2XY5 A;  4EWT A;  1E3C P;  4WBF A;  3RAQ A;  4LIW A;  4X4O A;  1C1B B;  3B5Q A;  1RWM B;  4A46 A;  3K5O A;  1UZH A;  2KRR A;  2G4B A;  1FKP A;  1SJF A;  2M4M A; 
#chains in the Genus database with same CATH homology
 3BDF A;  4LQY A;  1KH9 A;  3WAY A;  5C66 A;  4NWJ A;  1FSU A;  1N2K A;  2QZU A;  4FDI A;  4LRD A;  3NKP A;  3T00 A;  4LRA A;  1EW8 A;  4NWX A;  3OT9 A;  4UPK A;  4YR1 A;  4ZG9 A;  1AJD A;  3UO0 A;  3IGZ B;  3NKO A;  1ED8 A;  5TJ3 A;  5GOV A;  2GSO A;  4KM4 A;  4MHX A;  4LRC A;  4KAV A;  1URA A;  3NVL A;  2XR9 A;  3TWZ A;  3MK0 A;  2W5T A;  3NKM A;  1B8J A;  4UOO A;  5DLW A;  3TG0 A;  4LR7 A;  3DPC A;  1HDH A;  3ED4 A;  1E1Z P;  3NKR A;  3T01 A;  1E33 P;  5IJS A;  4GTW A;  4CXS A;  1ALI A;  3E2D A;  4QAX A;  3BDG B;  1URB A;  1ALJ A;  1KHN A;  1E2S P;  5LQQ A;  3LXQ A;  5K4P A;  5DLV A;  3M7V A;  4ZG6 A;  3WAW A;  2W8D A;  3DYC A;  5EGH A;  2GSN A;  5KXA A;  5HRT A;  2IUC A;  4FDJ A;  2IFY A;  1ZEF A;  4KAY A;  5AJ9 A;  5IJQ A;  4UPI A;  3WAV A;  5DLT A;  3IGY B;  2GLQ A;  2ANH A;  1ZED A;  2GSU A;  3BDH A;  2W5X A;  5L0B A;  5EGE A;  1ANJ A;  3T02 A;  1SHN A;  4ZGA A;  1ELZ A;  1EW9 A;  1HQA A;  2ZKT A;  4GTZ A;  3UN5 A;  1KH7 A;  2W5R A;  3UN2 A;  3SZY A;  4ZG7 A;  1KHJ A;  3WAX A;  1ANI A;  1O98 A;  1ELX A;  2W5S A;  1KH4 A;  4UOR A;  4CXU A;  4LRB A;  1ALH A;  3SZZ A;  3KD8 A;  4KJG A;  4LRE A;  3Q3Q A;  1KHK A;  2VQR A;  1EJJ A;  1KH5 A;  1EI6 A;  1KHL A;  3M8W A;  4CXK A;  4B56 A;  3NKN A;  1EQJ A;  4GTX A;  1K7H A;  1Y7A A;  4MIV A;  4MY4 A;  4LR9 A;  1ALK A;  1HJK A;  1SHQ A;  5L0E A;  4CYS A;  2G9Y A;  3MK2 A;  5GRR A;  2W5Q A;  3TX0 A;  3A52 A;  4TN0 A;  4UOP A;  3UNY A;  5LRN A;  1ED9 A;  5L0K A;  1AJC A;  3WBH A;  1E3C P;  3BDG A;  4LR8 A;  3M8Z A;  3MK1 A;  4LR2 A;  1EW2 A;  1N2L A;  3IDD A;  3B5Q A;  3NKQ A;  1P49 A;  4N7T A;  1Y6V A;  2X98 A;  4GTY A;  1AJA A;  2W5W A;  1ELY A;  2IUC B;  5INH A;  2W8S A;  4UPL A;  4UPH A;  5LIA A;  2D1G A;  1O99 A;  1AUK A;  2XRG A;  4LRF A;  1ZEB A;  2GA3 A;  2W5V A;  3UN3 A;  4CYR A;  5LRM A;  2RH6 A;  1AJB A;  4KJD A;  3M8Y A;  3CMR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...