3TX0A

Unphosphorylated bacillus cereus phosphopentomutase in a p212121 crystal form
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
Knots found
sequence length
391
structure length
391
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDTMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Molecular Differences between a Mutase and a Phosphatase: Investigations of the Activation Step in Bacillus cereus Phosphopentomutase.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 143
structure length 391
sequence length 391
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3tx0A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3tx0A01
5LIAA 3M7VA 3DPCA 5IJSA 1ANJA 1FSUA 1KH5A 3TG0A 3NKPA 1URAA 3MK1A 4UPKA 1SHQA 2IUCA 2XRGA 5AJ9A 3SZZA 1KHKA 2W5QA 1K7HA 3BDHA 3TWZA 3KD8A 4UPLA 2ZKTA 3Q3QA 1EJJA 1B8JA 3UN2A 4LRDA 1URBA 4CXSA 3LXQA 1AJCA 1ZEDA 2GA3A 5L0BA 1ALIA 4KAYA 4MY4A 3UN5A 4LR7A 3TX0A 1HDHA 3BDGA 3OT9A 4KM4A 4UOPA 4KJGA 5LQQA 4GTZA 1HJKA 2D1GA 4LQYA 3UNYA 4UORA 4KAVA 3T02A 3NKRA 1ZEFA 1E2SP 2W5XA 5KXAA 2GLQA 1EW8A 1ELXA 1EQJA 4KJDA 4CXUA 5C66A 4ZGAA 3UN3A 3SZYA 1O99A 1EW2A 1EW9A 3IGZB 4CYRA 5IJQA 4CYSA 1KH7A 1KHLA 3CMRA 3BDFA 1E1ZP 3B5QA 5EGEA 1KH4A 4FDJA 5K4PA 2W8SA 5EGHA 1ALHA 2W5SA 3IDDA 2ANHA 1N2LA 1SHNA 3DYCA 1ALKA 2GSUA 4FDIA 4GTYA 4UPHA 3WAVA 4LRCA 2W5RA 1AJAA 5TJ3A 4NWJA 1E33P 1ED9A 3NKOA 4MIVA 5INHA 4ZG7A 4N7TA 5DLWA 3MK2A 2W5VA 3IGYB 3NKNA 1ANIA 2W5WA 1ELZA 1ED8A 1KHJA 2X98A 4QAXA 1KHNA 4ZG6A 4MHXA 5GRRA 4YR1A 3UO0A 1E3CP 3T01A 5GOVA 5DLVA 5L0KA 3WAXA 1AUKA 4LRAA 1AJBA 4B56A 1HQAA 2W8DA 2VQRA 3NKQA 5HRTA 1ELYA 3T00A 4LR8A 1KH9A 3MK0A 5L0EA 1ZEBA 2G9YA 2QZUA 1Y6VA 4GTWA 4LRFA 3WAYA 1EI6A 2W5TA 4LRBA 2IUCB 3M8WA 1P49A 5DLTA 3A52A 4UOOA 1O98A 2RH6A 3WBHA 3NVLA 3NKMA 4GTXA 4NWXA 4CXKA 3ED4A 1Y7AA 3WAWA 2GSNA 4LR9A 3M8ZA 4LREA 1AJDA 2GSOA 3M8YA 4TN0A 5LRMA 1ALJA 1N2KA 4LR2A 3E2DA 4UPIA 4ZG9A 2XR9A 2IFYA 3BDGB 5LRNA
chains in the Genus database with same CATH superfamily
3R7BB 4M5DB 1YJUA 1IBKF 2DTJA 3DLKB 3IG1A 5BYRA 3KUGA 2W2MP 4JI5J 2G2ZA 2FJEB 3R27A 1H3DA 1CJUB 1ALIA 2JLFA 5E33A 2YNGA 1AB8A 2GVDA 1DFDA 5A6WA 1F5AA 3H4DA 4ELVA 1NSKL 3HSJA 1J27A 3RYLA 3DMJA 3HO1A 3SFUA 3GYGA 3LPYA 4YS2A 4DCOB 4DQQA 1WG1A 2MJNA 2WB1D 1KQFB 2HHHF 5G0RA 2HRUA 2HQGA 3TR5A 3R8YA 1S1VB 4IDKB 1FWPA 4DFJA 4PWUA 5ETRA 4ZIVA 3V4MA 2HRTA 3PRBA 3FQLA 2G0CA 4OI0A 4LF1A 3BGRA 4M5IA 1EKRA 2QZUA 1FFSB 1EI6A 2KI2A 5HP1B 1YZ7A 2VG7A 4ID8A 1EETB 4AYBD 3B6BA 4F26A 2IFYA 2B8PA 1WC0A 4IQMA 2DH7A 1CEZA 1IKYB 1BC6A 2WAQD 4U6PA 4RUCA 4CXSA 4LFCF 5JJBA 4MK8A 1AZSA 2ZWOA 3WC2A 3CC4S 1S1XB 1Q16B 1WTBA 4BC7A 1WI8A 3DLEA 4NA3A 1KHLA 1RLCL 3IA0A 3G8TA 3ZZUA 1B99A 3O2IA 4J9OA 4LSLA 1S9EA 4UOGA 5BR8F 5DLWA 3IMQJ 1WEZA 3W8GA 3UE2A 2QMWA 3QAUA 5CAAA 2F3JA 1S10A 4KQZA 4DX6A 3K8VA 4JI5F 4I69A 1KC8T 2P9GA 4ED2A 3VAMA 1H38A 2HHSA 2W5TA 4UZCA 2E9RX 2K1RA 4NYOA 3DRXA 2FY8A 3ZC4A 2MDAA 2CDQA 2E7XA 3C14A 5AXLA 1JLGB 2C3YA 1VQSA 1ANJA 4J5OA 3DU5A 2NYHA 1JLEB 2CQDA 4QYRA 3VALA 5CXTA 1SQGA 4N5SA 4BWMA 4KR0B 2VFVA 1K73T 1REVA 2XGPA 2FVCA 3Q89A 2EFVA 3D7SB 1E2SP 3MM7B 3D28A 4Y65A 2J9DE 1ZTTA 4FF1A 1N52B 1WKKA 3K17A 1UEVA 4FYDA 4MKYA 4ZP8A 1B3TA 1RTHA 5H9FK 2NXUA 2GGPA 4JV0A 4JYAJ 3NBPB 1E6YA 2MZSA 5TJ3A 1M0SA 2CJKA 2FHJA 4Y2KA 1F2GA 4PAAA 1YDLA 3FC9A 3UWTA 3CTRA 3BJYA 3QT8A 3MEKA 3NG8A 1OS5A 1GT8A 5AXKA 3W8PA 2XLJA 4J9LA 1GTHA 1E6VB 2NSCA 5H1SV 2KFZA 4R5PB 4P10A 1NO8A 2ASYA 1VDHA 1M90T 2HIQA 2V8PA 5GMKa 3HULA 4LR9A 2EVZA 4ZG9A 2A18A 4YB7A 4I2PA 3NGUA 4KO0A 4DUYF 2CJYB 3FCVA 3BKUA 3A3NB 4P9SA 4A47A 3T9ZA 5D4NA 4NASA 1VQ7S 1FVQA 3W9JA 4IG0A 2UXCJ 1CJTB 2RQ4A 2X3DA 3HHLC 2B5JB 2MHNA 3GJRB 5B08A 3MUMP 3L09A 3POTB 2YKNB 5HI7A 4I2QB 3V6JA 2FC9A 4DXLA 3FK4A 4PXEA 3JSMB 2E44A 2MQQA 4GO7X 2YNIB 1N6QA 2JNJA 4BBYA 3TA1A 2CQGA 2VC0A 3CF5Q 4MIVA 3C6TA 4X65J 5M2PA 5DDRC 3KLHA 1VS3A 1CJUA 4IH5A 2PDAA 5C2CA 3M2RB 1S97A 3Q83A 2AKWB 3KNGA 4J9SA 1FJGF 3R2DJ 1S72S 2W24A 4X4TA 3IAM9 3IN5A 2FYXA 2YX1A 3KLEB 2V4JA 2KN4A 1NDPA 2KZMA 1KFSA 3TAMA 2CYYA 1UJ5A 2OIHA 2R7XA 5EUHA 1FWKA 4U8YA 2IUCA 4IUFA 4IDKA 4RL1A 4OZ3A 1G2EA 1Y3KA 1K1SA 5FDLB 1VQPS 1U1NA 3G96A 4I7FB 3RU0A 1S6OA 2LU1A 1PKUA 2YNFB 4A8KA 2AU0A 3BDPA 2CJQA 1RWWB 1IJEB 4KTQA 4K2XA 1IKVB 4WFYA 3RRHA 2B4OA 3OVSA 1N34J 1NKCA 1HNWJ 5J2PA 2BXJA 2JC1A 2DYAA 1VOMA 2UXDJ 4LSNB 1KEKA 2GCFA 1CG2A 3DOMA 3T01A 4OI2A 4ES1A 3N4WA 2MLZA 2RHQB 1RUSA 1P9QC 4U7CA 2XMKA 1UTAA 4DUZF 2DNQA 4WFNQ 5KT7A 2ASJA 2VG6B 2MKKA 2UXCF 4FS1A 3OR2B 1BLUA 1VQYA 3RB4A 2IRUA 5L1IA 1DJ0A 2QA1A 3J7Z5 3CIMA 1T03B 4ITSA 2WVCA 2R8IA 2VJUA 4OIXA 4LMZA 2L9DA 1RT6A 4KV8A 3J81Y 2RRBA 3ZFVA 4X65F 2DNHA 3RBDA 2BW7A 3RJMB 1U47A 1RBOB 5JMNA 3ELHA 1CS4A 1RE1B 1WEXA 4OJ1A 3BKFA 3M05A 4HEA9 3WX4A 3T5HA 2BOPA 2PT0A 4DL4A 4YDXA 4AE5A 4DPXA 4CLSA 2DR6A 2H3EB 4M5NA 2KTQA 1HBUB 1B0PA 2Q43A 3FSXA 2D9OA 1Q4RA 3R9LA 5KFAA 4KGVB 4O0IA 1GXLA 2GO9A 2F4VJ 3Q0AA 1BWEA 1PILA 4RWWA 2FDNA 3DCAA 4N8NA 1CSJA 4BLGA 4WCEQ 3BQ0A 1YBTA 2DR9A 3NKMA 3MAHA 3MMBB 4GVBA 4F3OA 3CCWA 3DOKB 4ELTA 5K14A 2V34A 1A9NB 1MMNA 3P4UB 3PKYA 3WBZA 3GV8B 2RUSA 5D4LA 5DG8A 2NPFA 1EQMA 1N34F 2J9DA 3JTNA 4ED3A 2XSFA 3VAGA 2UXDF 1HBMA 4JI8F 4DV3F 3DGPA 1EZZB 4ZDNA 1N0UA 3D2WA 1ACMB 5C7PA 1ZBTA 1Y00A 2HHQA 2AEMA 3CO0P 4WWSA 2ZVSA 4C48A 3PX4A 2CPHA 3R6LB 4F4XA 4U7UD 1N2LA 4NLTA 1VK8A 1FRMA 3M8PB 3GE9A 2JOQA 1QE1B 3F41A 1BXNA 1RAGB 1RT2B 3FFIA 1VBZA 4K7QA 1RJJA 1YK9A 4YDDB 3AFGA 3QWPA 3W5XA 3HPOA 4ED5A 1S57A 2OUGA 2C22A 3QJJA 4HH0A 1RAAB 5CCMA 1TAQA 2RAQA 2DNOA 4E98A 4HYKA 1QD1A 3D0IE 4DS4A 4IR9A 3NWGA 3QYYA 2OJ3A 4QOTA 4NX9A 2WHOA 3CGIA 1QTMA 3NY0A 1H72C 2DR7A 2WCXA 2QRRA 3IRXA 2XMJA 1TK0A 6FD1A 5CYJA 2BJ9A 4HT7A 1OWXA 2HS3A 1EQJA 4PXCA 3QLHA 4X4OA 2IM0A 4N41A 1FNXH 2GMJA 3N6NA 4QWEA 4FF2A 3OLAA 1YG0A 3KHRA 1UJ6A 2LQ8A 3MR7A 1DTTA 4IO9Q 1X8DA 4Q43A 3LO3A 1SJFA 1D9AA 2IAJA 2V0NA 2G4BA 4UOCA 4CLLA 1JJ2R 3M6UA 3MR2A 3RRKA 2G1DA 5FDLA 5DDOC 4IH6A 2Y1IA 4J9VA 3BF4A 4RW4B 2HNZA 1ZA2B 1HBNB 3AHPA 4X4SA 4LF2A 1W26A 2RRNA 3OTBA 2OD6A 3DRYA 2QA2A 3KFWX 1SJ3P 1B64A 5C24B 2IRXA 5KFQA 1IKVA 4U9RA 2LU2A 3ET6B 4C7QA 5HJYA 3LOUA 1U49A 1QY7A 2GX8A 1TZ0A 4OHVA 1NK4A 1Q0NA 1UA0A 2FLNA 3W9IA 4NRUA 3IS9B 1JLCB 2CPIA 2XWXA 4X62J 2Q6CA 3BDHA 3TWZA 2XG8A 2DIVA 2HBQB 4RBTA 2CNOB 3M6WA 3LANA 5BYSA 1S1TA 4URQU 3A3PB 4FPRA 2AJFE 4F4YA 4ETXA 2GLQA 2FZKB 5KFZA 4CTAB 3W2WB 3C19A 1O99A 1NHVA 4ZVOB 4K4ZA 2F9DA 3QJLA 3CJ2A 3UFCX 3K89A 5AE2A 2R8KA 2MKYA 4OYAA 1HMVB 3PJWA 1J5OA 2DY1A 5B7WA 4RNNA 4USKA 4GC7A 4DV5J 5KT6A 1Q53A 3FZ2A 3ZNUA 5HSPA 3NS6A 4ANDA 2W9CA 2C3MA 4QIVA 2J8AA 1SXLA 2IBKA 3TA2A 3K5LA 1EJ7L 1HNXF 2AQ4A 1Q5VA 5CD4H 4WXWA 2YXLA 2F40A 3BPSP 3AD9C 4LF4F 4HHHA 3Q24A 1HR0F 1D9FA 4Q0BA 3SEOA 2RF2A 4DU8A 1KONA 1LQ9A 2DGVA 2XI2A 3G8QA 2G1HA 5IM0A 4B08A 2ZOFA 2OTJS 1BQMA 1RGVA 4X4UA 4URSA 1QDUB 4EBEA 2E5LJ 1SQEA 3HMJG 3BDGA 2DNPA 1L3TA 1NSPA 1RKJA 4FXDA 2J6SA 4QWAA 2ATCB 3SQGB 4CYSA 1SIWB 2R4FA 4MKAA 1X4BA 4Y2AA 2WVBA 3QMQA 3T41A 4WKYA 2IRYA 2VONA 2WBMA 1X4EA 1YJVA 3M8QA 4DL3A 4J9KA 2HWHA 4RW6A 2B51A 5DM6Q 4DHVA 4N76A 3SCLE 2M70A 3IWXA 3I0SA 1S12A 4TN2A 3LGHA 1C1CB 1M5VC 4DV4F 1XNRF 1REGX 4KH0B 2ROGA 4A46A 3WBHA 2OGUA 4WBFA 1TL5A 1VIOA 3M8PA 4B9LA 1FVSA 5IJSA 4G1PA 2B7BB 4F0MA 1GMWD 2FVQA 3BGFA 2XZDB 2WW8A 3C6UB 5C25A 5ETOA 2I1RA 3MM9B 1AYEA 1FE0A 1T7PA 2C2NA 2JX2A 3EE3A 3TW0A 1IKWB 1R89A 2HHWA 5KFKA 4Q2LA 4YEAA 2PE8A 4HHUA 2PA3A 2LEPA 2FJBB 4U7UK 1TVRB 1FEEA 2KFNA 3CCUS 4FDIA 2XWYA 2DNYA 1R31A 2A6MA 4B3MJ 3VVUA 3ICLA 2B4PA 2ZH3A 4NRTA 3GJQB 1NJXA 3V4IA 4DG1A 3OHBA 5E3RA 3HKWA 2JHEA 4LQ3A 2RKIB 1CLFA 1LW0A 1DLOB 2V8VA 4YHHJ 1AA1B 1TKTA 3OLBA 2Z58B 3I9ZA 5HBMA 4DPTA 2E5LF 3RR8A 1UVLA 4C8KA 2Z0GA 2V6AA 2ZE2A 3W2VA 4J9MA 4KJIA 1FKPA 3JYTA 1T9WA 3M8ZA 3KLGB 1ALJA 2ZOMA 3TZXA 4R25A 3UCUP 4FN5A 1VBYA 4QU6A 1Y0HA 2NREA 3UPFA 2ZZMA 1KHKA 4I68A 4ANEA 4K4SA 1HWUA 2HQIA 2VF3A 1HBNA 4P2SA 1U24A 3IBFB 3PEJA 1VQ4S 4ID5A 4NLSA 3BM7A 3RB0A 1GEHA 2RU9A 2DEJA 5J2MA 2OEKA 1M5HA 2R8GA 2OH2A 2MZJA 3OXLA 5ETMA 2BACA 4O4GB 3KLFA 3I56S 3GFXA 1XR5A 3SMZA 1S1WB 2ZVIA 5J1PA 4CO4A 1ZA1B 4OV1A 4NI2B 3TVZA 1WEYA 2B4UA 4LVOP 1FRHA 2GAGC 1IQTA 1TKZA 1MG7A 4A8XA 2YX4A 1IKXA 1IXKA 3AD7C 2MMYA 1P1TA 1SVDA 1R6VA 2FD2A 3LALA 2MZTA 2ZBCA 4AL7A 2E1RA 3F56A 4ES2A 2QL5B 5CD4A 4FVCA 4JI4J 2DKOB 2ACYA 2AV5A 2DHSA 5I4MA 1KH5A 3ZZRA 5U47A 3MK1A 3HKZD 3UW1A 4C8NA 3JQJA 2I8EA 2XS7A 2CVIA 1VJQA 4UQTA 5HMYA 1J5EJ 1I94J 3VHQA 4UW2A 4OMFG 4EEYA 4B3MF 4R0EA 3ITHA 4IR1A 4H4MA 2RH3A 2BOAA 1Z2LA 2IY5B 4LF9J 2YWEA 2MQ8A 4F4KA 4CM2A 3MM6B 3IC1A 1SC3B 5IXUA 4OZJA 1JNZB 4ZPTR 1X4GA 4AD6A 1LWCA 2Y1JA 1U7LA 1EHWA 3U02A 2DGWA 1RT5A 1YBAA 1JXLA 3OL7A 1BQNB 2ZOGA 2O67A 2HGMA 2QFIA 3HHKA 1RHRB 1N32F 2XYGB 2ZWPA 3G9CA 3N9UC 3BGOP 5IWAJ 2DBBA 1U2FA 2KHDA 1JIHA 3DLGA 2HRYA 3AB2B 2B9YA 2CAJA 4AL5A 2ABYA 3G82B 1WDDA 2CQPA 1RLDA 3SZZA 3UDLA 1RT7A 2HYIB 2ZHOA 1ZEDA 3I31A 3DRRA 1A7GE 2FGOA 2R7QA 4FS2A 2AGPA 3T1HJ 2LYVA 4DR6J 3JSRA 4P7VA 3W65A 1YSJA 1PJ7A 3R5DA 1RACB 3GIKA 1D3WA 5F8MA 4USJC 1ZM4A 3L7UA 2UVVA 4WFBQ 5H9EK 1Y5NB 4QYZJ 4B9NA 5I3UB 3BB5A 1DAXA 1NCLA 3P45B 1ANIA 4TKTA 3GPAA 1AFIA 4JI4F 3OR1B 3MM9A 4Y2CA 2C3PA 5HL7Q 2LFVA 5GAEU 1VC0A 2BKPA 2HG4A 2VC1A 5B0AA 1IM4A 4ECXA 4LRAA 3MEEA 4TXSA 5HRTA 4C11B 2G0IA 2R7SA 2QN6B 3Q8UA 2OP5A 1SKUB 1QVFR 3ZTRA 4DSKA 5M2UA 1WF2A 3KXDA 1U8SA 4U8VA 2QMUB 2E9TA 1HYSA 3BQ2A 1AUSL 5CABA 1EIYB 1S48A 2YKAA 1N33J 4CM0A 3GIJA 3H5SA 1RB0A 1RT4B 4K4XA 4AT1B 2OPPA 1L3SA 2HBZB 1RAFB 3M6XA 2R2RA 3AJDA 3QGGA 3RAQA 3F44A 4LRDA 2ILYA 2R3VA 3WDOA 1QUVA 2ILZA 2W9BB 3BBBA 4KYZA 2BEFA 3DXBA 2ZC4A 3MPDA 2H48B 1MWYA 2I5JA 3R5JB 1HNIA 3D0GE 4DV2J 2FTRA 2VZ9A 4K8RA 3CEDA 1YTYA 1GK8A 1XERA 3Q8QB 1B0VA 5IWAF 2BJDA 2VH7A 4IOBA 1HLWA 1T05A 2VA2A 1YJ7A 4G1QB 1E3CP 4ZCMA 2BDPA 2D69A 9ATCB 1H0HB 2J6UA 4R8UA 2UU9J 3CCES 4OHYA 1IWGA 1P49A 3GJTB 2AYBA 2IA0A 4NWXA 1VQOS 4IQXA 1S1UB 3SDEA 4DR7F 5LRNA 2OHDA 2B9XA 4L3KA 2RB7A 2O5DA 3MM5B 3C66A 2H5JB 3PYFA 4P52A 3IXQA 1VHIA 2EFNA 1PIEA 3HZGA 1NKEA 3QIPB 3PRDA 2HS4A 4LF6F 2OAUA 3RRGA 4WK1A 1R0AA 1I51B 4B3RF 2VG5B 5A8RB 1QAIA 1UETA 1D8ZA 3LP1B 3QO9B 4FBUA 2V4RA 1R3NA 5CYMA 5K5MA 1FWLA 5E0OA 3K7RA 5L38A 1JJCB 2W2QP 3FVYA 1N33F 3CIZA 3OTOF 5AXNA 3ISNC 2P9EA 4RW7A 5KFVA 1UA1A 3IAS9 3ETOA 2ZH8A 1UVMA 1UZHA 2LDIA 2DXDA 2C2DA 2EFOA 1R8AA 1SB6A 1CULB 2HNDB 3E2DA 2FVPA 1S7HA 1KQSR 4HTJA 1S6PB 2ZBIA 3NKPA 3O3LA 2DEIA 2Y3YA 4C3KA 4DLGA 3CC7S 3X3UA 5DLGA 1F3VA 2BE2A 2GQCA 3M2VA 2C2OB 3LXQA 4K4YA 4WIIA 2X3GA 4ZA1A 1KKHA 4KSEB 2QSWA 2VBZA 3M4XA 1Z1ZA 4C6AA 5B0DA 4X2BA 4URGA 3FBBA 2MEWA 2XS5A 1WJ9A 4ILLA 2KL8A 2RU3A 1DURA 3RG6A 2JEIA 3SCJE 4HVZA 1OYEA 1FXLA 1NHUA 3RZAA 3NOCA 3I87A 1NAQA 1C0TB 2OPQB 2NZ4A 3NKYA 2MGZB 1TU0B 3HVTA 3TZZA 2PC6A 1KLMB 5D6GA 1FDNA 2WSCC 1NBEB 5MAOA 2E7VA 1HHQA 4FYXB 3NP5A 1YVFA 1NK8A 4K0KF 2CADA 3M30A 3MEGB 3CUNA 3UI3A 5AE1A 3QWUA 4KGMA 5FD1A 5I3UA 3TAPA 4M5MA 1Q79A 2IVFB 1CQNA 2HGNA 4F4ZA 4FDFA 2YPYA 4HL9A 1XMQF 4X66J 1D0EA 1QUPA 3BSNA 2IVMA 2OI2A 5J1NA 4RNOA 1NM2A 3BR8A 4TU7A 1C4CA 2DRBA 3EVOA 4UOFA 3R7SB 4GKKJ 2OELA 1H74A 2KRBA 2MXYA 2UVWA 3GSIA 2J9CA 4UUWA 3E2EA 3Q8RB 1SJRA 1VCTA 2D3ZA 1OQ6A 3LP2A 4CYUB 1YWXA 4MFBB 4NMLA 3KK1B 1OJ4A 4DV1J 2MPUA 5AJ3J 3GIIA 3W3SA 2XYHB 5SZTA 4M8LA 4X4NA 2CQ0A 3VR1A 1NB7A 2XMUA 3EGZA 4M95A 5L0EA 4NLVA 3PYGA 1ZYQA 1O98A 3MPWA 3NCRA 1KS2A 4ED1A 1JQGA 1UEUA 3FSYA 3EGWB 4WP8A 5KG7A 5LJ3Y 3M6VA 4PG8A 2FY1A 3W9HA 3SYZA 1WC4A 3MMCA 4HLBA 3PX0A 3NAHA 5IT0A 3MURP 5T14A 4CLWA 2AD9A 1MW7A 4CQ1A 1S7IA 2ALZA 5B0BA 2MKCA 4X64F 4CH0S 1GQEA 1WOSA 1PAEX 4ZP6A 2WSEC 4O44A 1KOHA 2W2OP 2V2ZA 3L4BC 2ZJRQ 1L3KA 1FDAA 4ICLA 2BA9A 1Q81T 3GFHA 3MOJB 1UVJA 4WIQA 3SBMA 2FLLA 2E5IA 4EFAC 4UT4A 4NA2A 1M1GA 1FTCA 2W25A 1G7CB 2PFFB 3VAFA 2DGOA 4GRSA 4M5JA 2CQIA 3EGNA 1LWFA 3MM8B 5D77A 3K5PA 3THPA 4ZJLA 1ZOTA 2XHCA 3HI9A 2DRDA 2KXFA 4FVMA 2VG5A 3GP9A 4RBUA 4ZN1A 4LBHA 1YRUA 4XDCA 2XQCA 2DJWA 4DDFA 3ILIA 3MF5A 4PKDB 3K8WA 3LP0B 3DN9A 1EP4B 1B8JA 1XN9A 2VJVA 4NEYA 3WC0A 3L9ZA 5KG3A 3EUNA 4DV1F 3T02A 2HBRB 1M5KC 1UWAA 4WFZA 3MTJA 4KIAA 4DR2J 4PWDA 2WVEA 4H4OA 1RWUA 2B6AA 3QGPA 2L08A 2RMLA 5CHCB 4DS5A 4F3MA 1X4FA 2VA3A 1FKOB 1S6PA 3CCRS 3HXMA 2HGLA 4XIUA 3FQKA 5ETPA 4DEZA 2X98A 2IFXA 2UZAA 1I3OB 3ENAA 2UV8A 1SJ1A 1S9GB 2HHXA 3GMGA 2VQRA 4ECUA 2UUBJ 1PCAA 4C8LA 1X9WA 4ZOSA 4QR1A 3VAJA 3HT3A 4DV0F 2JJ4D 3CDWA 4PUOA 5C42B 3A52A 3BO4A 4NLRA 2OEMA 1HPZB 4HTIA 1R0BG 1O0PA 1OYDA 2Z2YB 2OFHX 4MYTA 4X4RA 2XRGA 3DOLB 3P49B 1RWVB 3THVA 2HWTA 2VQFJ 2WONA 1RXOB 5E3PA 3NGDA 3VGUA 2KH9A 2C1EB 3D6MB 2DGTA 1SKWA 4NPOA 2HFVA 5C66A 4ZGAA 5GMDA 2KB2A 1VK3A 3CMRA 2OPRA 2W9AA 4ZMMA 4W90B 2W4CA 1OIAA 2CFXA 3CW2C 1OSCA 2EBEA 5K8PA 5K4PA 4KGKA 1F2HA 2IMOA 2QL7B 3OTDA 4DL5A 3DYCA 2K7JA 3E51A 3WAVA 2PI4A 1U02A 4JI3F 2FPHX 3NCPA 2L9WA 2Y1LB 2XSJB 4ZVTB 3A1YG 1FNOA 3ILLA 1JKHA 3P6YC 2ZEJA 4OZ2A 3KLIB 3OTEA 1S79A 2VV5A 2V8GA 3FEZA 1VGYA 3DYAA 5F3TA 1IN0A 4LRFA 2FJAB 1T02A 5DETA 1VMBA 4EYHB 3WIVA 2V8DA 4ZPWR 4DR2F 2JVRA 3S1TA 1M1HA 2I38A 3H2LA 2VFSA 4DZDA 3GIRA 1NH7A 5J2NA 1B70B 2GHVC 3FBCA 2B43A 1LFPA 1RBLA 4JUZA 2XO6A 1CVJA 5KFLA 3NAIA 4UF4A 3M32B 1EW9A 1NH8A 3FEYB 4RW9B 2UUBF 1MMDA 2PMWA 3BN7A 1JK9B 1Y7PA 3OVAA 2C2EA 3QT5A 3UVJB 3UD5A 2KU7A 4OI1A 1DTQA 1KHJA 2H9ZA 4KBIA 3E01B 5J2QB 3KWMA 1MU2B 2A2CA 1NK0A 3MAQA 1HNZJ 2CJAA 2BJ1A 1AJBA 4DSEA 4M94A 3DKDA 3DDIA 4IFYB 4Y0FA 3KJQB 3KK2B 2C2KB 2F65A 2ERRA 4CNZA 5HLFA 3GSDA 3JTOA 3KTQA 1RHQB 1RCXB 1ULRA 2BABA 4KB7A 2BKNA 4BS2A 2RD5C 4L76A 3GWCA 1JLFB 4YB1P 3PDNA 4H4KA 3BH6B 1VRQC 3DDNA 1VIXA 3FMBA 2GFFA 4DFPA 3AJ1A 4OQJA 2K2PA 3CJKA 5HMZA 2E29A 3SCIE 3CMES 1Q78A 5I42B 4LQYA 3SQOP 1NB2A 4WJBA 2VKZG 3BDEA 3JTPA 4NCGA 1UFLA 1Q82T 1WSRA 1DQ9A 1U26A 2JL9A 3PZPA 3CO9A 1RTIB 1HQUA 3TUPA 3LAMA 4CO1A 1M5OC 4MK7A 3BQ1A 1JLBB 2CNLB 1GH8A 3Q8SB 4QBUA 3VWSA 1LW2A 3FBFA 4Q44A 4HACA 2J7WA 5KFJA 2IDEA 3LP0A 4OZ5A 1CBKA 2QJ3A 2VBWA 1EP4A 1FRXA 2VL1A 2QX0A 1N5YB 3P3DA 4ZVHA 3BR9A 2QYGA 1VI7A 1APSA 4LF5F 4PZVA 3DHWC 1T11A 3CCZA 5IT9Y 1HD1A 5DLTA 2RH6A 3CWJA 4KHRA 4MIWA 4YMEA 3FGVA 3HHLA 5A8KB 1Y7AA 4CWBA 1FKOA 3LAKA 2VUGA 4M5LA 2WK4A 4DSLA 5DG7A 3NGSA 4ZPCA 1FJEB 2QE5A 2J0SD 5LSRA 5F8JA 3LGNA 1SC4B 2QG9B 4RNFA 3WQPA 3DM2B 3W60A 4C3LA 1HNVA 2OPSA 1H2UX 1TL7A 1CJKA 4F2RA 1SI9A 2ZH7A 1HNZF 3MFIA 5IJQA 5D8HB 2J7KA 2NXEA 5T7LA 2DCUB 4P72A 4KHPJ 3G8SA 2BQUA 1XR7A 1VRUA 3HX9A 1U1OA 1VQ9S 2MZ1A 1J2VA 1VR6A 1ZH5A 3BSOA 4QAXA 4WTYA 2LCWA 1JJ4A 2PA8D 3C16A 5GVQA 3NL0A 2J0XA 1GMUA 1V5VA 5LL6d 3S6EA 1NK9A 4B3SJ 1VFJA 3MCNA 2L9NA 1U1QA 3U1LA 3ULHA 2AT1B 2EFQA 4PG4A 3J7A1 2F9JA 1CJVA 1TV6B 3M7VA 1RTDA 2B4VA 1X5PA 3MPVA 2GA3A 3MMAB 1OPZA 4JOUA 4ZPBA 2BJ7A 3OQ2A 1S6QB 5D3GB 3G6YA 1EW8A 5ETSA 1HWKA 4FKXA 3FEXB 3B5QA 3MECB 3I4PA 1IR0A 3T6BA 2R7UA 5EGHA 3MHYA 1VISA 2CPEA 2BANB 1X4AA 4LFAJ 4NWJA 3NKOA 5LJ5Y 1HI8A 1QM9A 3L95X 1S49A 2MKSA 1R6YA 3C8YA 1YJNS 4C0OC 4USTA 5CYQB 3BGUA 1FHTA 3GQCA 1I1GA 1QVGR 4J9RA 3ZZTA 2ZD1A 4HI1A 3M8SA 5C5JA 5F8IA 5D0EA 5A8WB 3EMTA 4K59A 2V68A 4J9UE 4DR4J 1MU2A 4L72B 1URBA 2BKOA 2O01C 1Y5LB 1BUXA 3CDBA 2WTFA 1OY9A 4KM4A 4C3MA 4GTZA 2V63A 3EX7B 4CO0A 3VQTA 1X0FA 2NYIA 5KG5A 4RWXA 4K5SA 1HW9A 1TL4A 2LDYA 3M1VA 4PYAA 3MD1A 3SZYA 1UWBB 5FIIA 5DM7Q 4DWIA 3HFKA 1Q8LA 3I96A 2AGQA 2HNYA 2XY6A 4YUDA 1AJAA 4N7TA 1F5CA 3BH7B 4ZVGA 2FJWA 1RT1B 4CLFA 1HQEA 2CQ3A 2VIHA 4NLQA 1JJHA 3CNQP 3CB4A 5B09A 1H2VZ 1FK9B 2C3OA 4XO0A 2NCKL 1WI6A 5I3QA 4LR2A 2R2SA 5HMXA 3PACA 3QRRA 4Y28C 4RPFA 3T1YJ 1N5YA 1TL1B 3H40A 2H5IB 5DDPC 4DZ6A 1FTRA 3DI6A 2O66A 2XYPB 2OKQA 4C8ZA 5M2RA 4ZHRB 3QT7A 4F36A 2DPJA 1JMTA 4QWBA 1ZTWA 4B02A 4KRWA 2D41A 2YY3A 2Z57B 4OI3A 3ENWA 1IBLJ 5ETNA 1NU4A 2CDRB 1PO6A 4OV6A 1TQLA 1U8WA 1JX4A 3TQ1A 3BYPA 1E33P 1S0OA 3H2UB 2F1FA 4KPCA 3DRPA 3O44A 4DLEA 1W2IA 1NK7A 3H42A 2VOOA 3UCGA 3PFOA 2G13A 1EKSA 2W01A 2RQKA 5ETKA 4EBDA 4DR4F 2IDLA 3CJTA 4C8OA 2JDJA 5DGBA 4U67Q 3CJ5A 2DHAA 2J5AA 2VPWB 1QSSA 4CLYA 1ROFA 2MKIA 4DL2A 3R5CA 2W2PP 4ZPVR 2AJ4A 1WACA 3ILOA 3A3OB 4CH7A 5L1JA 3OUYA 4ZCIA 3OSNA 1H73A 2VU5A 2DNRA 1U2CA 2HK2A 1JLAA 4LF8J 2CQ4A 1SV5A 1XMBA 2HMIB 3BYRA 1P6TA 2FHJD 3UDCA 4LF7J 4CRJA 3D5MA 1G3OA 3HD1A 4ZVSB 4OYWA 3KJVB 4B3TJ 4ED0A 4RBVA 3TEGA 4YFUA 4LVNP 1TV6A 1OPIA 2WB4A 4WKRA 3FNNA 2DRAA 5K20B 4ETZA 3NKNA 2BBEA 3TZYA 4XK8C 5DG9A 2V67A 4DU7A 4OL8A 3GR1A 2V2QA 1UL3A 1NUEA 4OJHA 4CCHA 1TL3A 5BJRA 3TI0A 4OZLA 5H9EJ 4WPAA 3QFHA 1GAOA 1NZAA 4OHZA 3NVLA 4ED6A 4ZVEA 3MR6A 3V6KA 4TN0A 4FZVA 4OYOA 1L5UA 3TX8A 1JLQB 1RT3A 3J7ZT 1AT1B 3FSIA 1HI1A 1MWZA 2UP1A 2QT7A 5A76A 4ES3A 2NXJA 1A0OB 1RQ0A 4JI7J 4OYZA 3CCQS 5ETVA 1U0HA 2W2NP 3GG0A 1XJWB 3DRSA 2ZITA 2N7CA 3BO2A 3UN3A 2NUHA 2DD8S 3O8WA 4GKJJ 3GZ7A 3PR5B 1C1BA 4QIWD 1TKDA 2H5EA 2W5SA 4KFBB 3RW6A 1N36J 2D3OR 1WTFA 4ZVUB 5A8WA 1XK8A 4W98A 2ATLA 2C2ZB 2FC8A 5CZXA 4JI1J 1TKXA 1D9DA 3HVWA 3JAMU 3G2XA 1ZS6A 2H51B 4QPTA 4HT5A 1S5ZA 4Z7CA 4B3OB 1F9FA 1ELOA 3C15B 3CD6S 1XNQJ 2LXUA 3E3XA 2CPXA 1UAWA 2BJEA 4LF7F 3TG0A 4LBPA 1WD6A 4F7VA 3LWLA 3H7HB 2MY8A 2XCAA 4ZPDA 2GVZB 2F8EX 1MWQA 1EJJA 3RW7A 4H4KC 2Z8QA 1LXJA 3RUBL 3KNAA 4DI6A 3UN5A 3B4MA 7AT1B 1XQIA 1HJKA 4UORA 5KFNA 4USVA 4AFFA 1XWLA 3D4JA 2XMTA 2M8HA 4J9PA 1N0VC 1X60A 4A8QA 4ECSA 3PRVA 1WHWA 2ANHA 1GFWB 1KQGB 1SIZA 4ZVQB 5L39A 2W7PA 5EDWA 3O1LA 2IIHA 1MN7A 4A8YA 2VBXA 4PG7A 1G4CA 1OO0B 3WAXA 2NUUG 4ZCLA 2MQOA 3OV7A 4JI0J 2YX7A 4A4JA 4WE1A 1HWLA 1T9VA 4GVLA 4O3PA 3TAQA 4JI7F 2QFJA 1YJRA 4KKOB 2K06A 2I6WA 4OYXA 3WAWA 4W92B 1RTJB 3CULA 1NDCA 4GKJF 4PQUB 3KG4A 3QRPA 1WDTA 4K50A 1N36F 1F6TA 1VQ5S 3K5NA 4RW8A 4PEOA 5LQQA 4M5DA 4JI1F 1WWHA 3DLKA 2W8KA 1NPKA 5GAGI 1UPMB 4MIAA 1ZAWA 2HFNA 2DR5A 2FIUA 2CA9A 2ZKUA 1E1ZP 5EGEA 1AW0A 2IHR1 1B7FA 4TY8B 3SFGA 4IG3B 2MQPA 1EQ0A 3VAKA 5KFIA 1XEZA 2GMLA 4P2XA 3K58A 2FB0A 3O5TB 1B4SA 3R5BA 2JC0A 3JSYA 3I0RB 1TMMA 4USHA 5K8NA 5KOWA 3OD2A 3HFZB 1FFWB 1S1VA 4QWCA 2NS1B 4JYAF 2KZZA 3PIPQ 1WF0A 2H65B 4GTXA 4QIFA 2E9ZA 1RA6A 2JRSA 5LRMA 4P2FA 2W7OA 3PYEA 4J90A 4QW9A 4JV5J 1KBRA 1QTNB 5HP1A 3PY8A 3R2CJ 1EETA 4WTOB 1P1LA 1NJIT 3NNAA 1LWEB 1MROB 2OMOA 1U25A 2Z30B 5I3PA 2CIMA 1IKYA 2FGCA 2YPZA 1SC6A 1U2RA 1RHUB 4TQRA 4F2SA 3K57A 1X7VA 5LXRA 3AA9A 1GX5A 2XZTB 3QQCD 1S1XA 5KT3A 2W5RA 2R42A 4A8MP 1RA7A 2Y9HA 2RVJA 3GILA 1NK5A 4B17A 1IBCB 2XY5A 2YVSA 2YWGA 4WP3A 1T9TA 2MSSA 1WNEA 1T3NA 1AUDA 1AUKA 3GFZA 3NGTA 4OLOA 2DR8A 4ZKAA 1SUQB 3N0VA 2E1PA 2HFZA 2QGFB 2MY7A 2KJWA 3M8RA 4PRFA 4RZRA 3AXKA 4M1KA 4F50A 4GO5X 2XNRA 3J80U 4ZVPB 2MKJA 1WC6A 1YGYA 2YH1A 1QAXA 1Y3JA 3RBEA 4NEZA 1S6UA 3W64A 2M7SA 4AQYJ 1JLGA 3ZZPA 2WW4A 1WC1A 4ZPAA 1JLEA 1I6JA 1VRTB 3KJNB 1T9YA 2KDOA 3CJRA 1KTQA 1UVIA 2N4DA 3G6XA 2AX1A 4DR3J 2IPOB 4OX6A 2L41A 4N56A 5D4OA 3EPIA 3MM7A 4BCAA 5F3ZA 5HJXA 2K8GA 2LEAA 3BSAA 3AY0A 3GFYA 4NYPA 2YWHA 4KGXB 1SL1A 4NLOA 3NBPA 4ECRA 1ELYA 5DDQC 2PFDA 2HKEA 4PG6A 3VTIA 1S9FA 2D3O1 3DLJA 4I6YA 2GIFA 1ITPA 4QWDA 3MAAB 1HNWF 2CG4A 1UP1A 3CJ4A 4YR0A 4OYMA 1PJ6A 2BE7D 1AJDA 2PO4A 5GAEI 1AFJA 4IO1A 1BHNA 1FSUA 1E6VA 1RU2A 1EAYC 1N5QA 4CO5A 4R5PA 4UPKA 4NLDA 4ZITA 2VODA 4TVAB 3M2UB 4DF4A 2ZZNA 1OY8A 5HQMA 2QLWA 2B7CB 1SCJB 2BUNA 5LMUJ 1S77D 3CC2S 2DITA 1FEHA 1EX8A 4DCJB 2E5GA 1TFWA 1S0VA 2HZAA 1CJTA 3KMSA 1VLYA 3DGVA 3TVYA 3A8EA 1RTJA 2B5JA 4UY85 2YNHB 3UD4P 2MZRA 4E0DA 2WOMB 4NA1A 2W4PA 1C0UB 4A8OA 1JXVA 4WF9Q 1TP7A 3EPGA 3POTA 2YKNA 1N56A 3ZZOA 3A8KA 4I2QA 4QR0A 1VQ8S 4OZ1A 3JSMA 3R5GA 3ZO7A 2ZJPQ 3CD0A 3KK3B 5IC4B 3KYLA 2YNIA 2AEFA 3H5XA 3CMAS 3OJSA 3CCTA 1Q7LB 5F9LA 1Y6VA 3M2RA 4IG3A 4Y2IA 2A6OA 2XCPA 2LQ5A 4I64A 2VPYB 4F04B 5LIAA 2VDIA 2NQPA 2X7IA 2XS2A 3KLEA 2H4WB 2GVDB 3BZQA 3TEHB 4NOHA 1HFEL 5AJ9A 4FXWA 5T41A 2XLIA 3DMJB 4PQAA 2F4VF 3IR7B 3TQEA 2M52A 3TA0A 3D0HE 2J7UA 2R7VA 4KAVA 2BM1A 3R3TA 8RUCA 1ELXA 2HVEA 1A6LA 3MXHP 2NR0A 3KKFA 2E1AA 5LMNJ 1G1XA 4E2FB 3W62A 4ZN3A 2Q79A 4QR2A 3KJFB 1AROP 5ITHA 4I7FA 4FP9A 3ENVA 2EC0A 3HHEA 3PW7A 3QSIA 2YNFA 1R7IA 3BGRB 5IV4A 3PW4A 5GOVA 2VG7B 4F0HA 2EPIA 3EVWA 4LSNA 4DBQA 3NNCA 1L3VA 2IM2A 5KFGA 1V3SA 2B0GA 5KG0A 1NMEB 2G0JA 2YQ1A 3P8BB 4NCBA 4F67A 1MMLA 3SV3A 1DRZA 1AZSB 2XEXA 6FDRA 2EXUA 2RIJA 5KAKA 2VG6A 3OR2A 3DU6A 2ZKTA 3DLEB 1GNKA 3CCMS 1K47A 2QLXA 1T03A 2M2BA 5AXMA 3MR3A 3WX8A 1P27B 1WKJA 2MJUA 3T3FA 3OL8A 1Z4UA 1S9EB 4X4VA 4HHJA 3CJ0A 5IS2A 4NXNJ 2ROEA 4ERDA 4OX9J 4USUA 1FXRA 2R7WA 2EFPA 1VQMS 1RZMA 5KFOA 4DCPB 3GTYX 2ZC3A 3NWRA 3MCSA 1RAEB 4IRDA 1ZETA 2W5VA 2YWFA 1PC4A 2ROPA 2K1RB 2AF6A 1RISA 3C14B 2A3JA 2DH8A 2YKPA 5KT5A 3MUTP 1UMJA 2NPIA 4XAKA 3D66A 3HK2A 1HBUA 2ZH6A 2JH3A 2N3LA 3OHAA 4ZP7A 2OEJA 4Y6IA 3H90A 1REVB 2AYGA 5J1EB 3C2PA 2CQHA 3NMRA 3B4DA 4DSJA 5F9NA 3MMBA 2BQRA 1CC8A 3DOKA 3JB9k 3BV8A 2EEYA 1RTHB 1F9HA 3NKRA 2GGPB 4NLYA 5CH7B 1E6YB 1Q8BA 4MH8A 3EYZA 1RKIA 5EWEA 3RB3A 1M5PC 2V8HA 1YQHA 4X62F 4NCAA 2P6SA 3K5OA 2JVOA 3I5AA 3G86A 2HLUA 4ATNA 2BV3A 1ELZA 3TNVA 2WZ1A 3H20A 2VDHA 1QE1A 4I2PB 1SJQA 4LFCJ 3TUJC 1RT2A 2GV1A 4KO0B 2R7OA 2G2OA 2QA4G 2NXCA 2X1GA 2V9WA 5K9FA 2XM3A 4DV5F 3LW5C 2IMWP 4F8RA 1IM6A 1YBUA 4IG0B 3H98A 3MR5A 4L6V3 3V6HA 4NXNF 5HAOA 3JXOA 1T95A 4OX9F 3FRZA 2ZHAA 3HVAA 1BE4A 4Z7YA 4PPDA 5BR8J 4DPOA 3OT9A 1FFGB 2IYIA 4I6WA 2MSTA 1N6QB 1WF1A 5DS7A 3Q8VA 2KT5A 4XPCA 3WZ0A 2HEKA 2N4CA 1K0TA 3C6TB 4DF8A 5KFUA 2XMWA 3FCHA 4KPYA 3KLHB 3CDAA 1H98A 3GCXP 3TVKA 1IUJA 4FF3A 1X4HA 2D9PA 3WHIA 5F8LA 4CT9A 1ED8A 2H54B 4FBTA 2V4JB 4UZBA 2QMXA 3TAMB 1B7YB 5E3AA 2LXIA 5GAGU 4A8WA 3CJ8A 1R8PA 3A4TA 2OO4A 3CCVS 2IUCB 4KY3A 2Q1LA 4AXIA 2XB2D 3R1LA 4QW8A 1QAJA 3PXGa 4CXKA 4RW4A 3BPDA 4EMDA 1ZM2A 2EI5A 3RB6A 3DPCA 2KJVA 5L1LA 1FCAA 3BBCA 2KRRA 2E1CA 2R7RA 1HW8A 5C24A 2XULA 4X4QA 2AWZA 3ET6A 3CT9A 4DR5J 3NS5A 3AT1B 2VPXB 3GLJA 3ZTQA 2RRAA 5A2QU 4EYIB 2BZ2A 4WZQA 2XI3A 3IS9A 1JLCA 3P5TL 2BE9B 5J2PB 2VQEJ 4RNHA 3I6PA 1H2TZ 2IC3B 1UEKA 1S4EA 2EG1A 5DZ6A 3M9NB 2VHGA 3DOMB 4WFAQ 2MQMA 5KFEA 4V19X 2FZGB 1RDRA 4CTAA 2LKZA 3W2WA 4USWA 5L8RC 4ZLPA 2C2MB 3OXFA 4NMXA 1UFKA 4DUYJ 2HHTA 1HMVA 1BMQB 1RU1A 5IQQA 3MK0A 4O23A 3HHNB 1YHQS 3G87A 1NEEA 3PW2A 1WG4A 4L73A 4J9QA 2M8DB 1RT6B 2DHGA 2AJ2A 2DISA 2GJIA 3VGVA 3MZIA 2Y0SD 3CCJS 4KV8B 4QIGA 1X31C 2G9OA 7FD1A 1KRPA 2COLA 3S7RA 4L3NA 1FDBA 3RAMA 1CS4B 4Y2MA 4YHHF 2LQJA 4W4MA 2Q6BA 1P9YA 4RJVA 3W5YA 1K44A 2HQDA 5C2GA 1SL0A 4Q8FA 4RO0A 5EHHA 5HVGA 2K3KA 3OFGA 2AX0A 1FJGJ 2Z56B 1YLXA 4C0BA 3ONQA 2RNEA 3FBEA 2E1MC 2HQFA 4DPWA 1ALKA 5J1EA 4UPHA 1VLOA 3SQGA 2B9WA 5INHA 1RAIB 3FJ2A 2ZM6J 2YWWA 1IR2A 1O6XA 4YR2A 1U1MA 2FZCB 3B54A 1YKWA 4LFBJ 2DGQA 3B78A 5JUMA 4GVBB 1XR6A 2QLJB 1T0TV 2FLPA 5K14B 2C42A 4DR5F 3QBCA 2DCLA 2PSZA 2HZCA 5LXYA 2DGSA 4EK2A 3AH6A 4DR1J 3K2YA 1SQFA 1BGXT 1RHMB 3M8YA 2DHXA 3TJ9A 2VQEF 1HBMB 3AODA 1OMSA 3GU0A 3D6TB 3DGPB 3EVMA 3MOZA 1C1CA 1V9OA 3AOCA 3J7YI 1NSAA 2POKA 2ZNYA 3VGTA 3HCXA 1RI7A 8AT1B 1UFWA 2OTLS 4ECVA 1R8BA 1UW9A 2XMMA 3D67A 2C28A 1T94A 3C6UA 4DPUA 2IYGA 2E5HA 3U1MA 4OI4A 4UTGA 1RWNB 2ZZTA 1UKUA 3FFIB 2GO8A 4DUZJ 2BJ8A 2N3OA 1J5EF 1IQZA 1IKWA 1I94F 1RTZA 4NZ7A 4RNMA 2HLTA 2KT3A 1GMVA 3H5YA 3HVRA 2ASDA 1B0TA 3UO0A 3U27A 1TVRA 4OX8A 4LF9F 2Z2MA 1SH3A 3CVKA 4TU9A 1RP5A 4LIRA 4TLQA 3LA0A 3P5BP 2RKIA 5THWA 1DLOA 1Q95G 3OW2R 2F8HA 4I56A 1RSCA 1W2BR 3IRXB 4IYQA 4OI6A 3TRGA 4EBCA 1PYSB 5HN0A 4NWBA 4Y3CA 2ZHBA 2AGOA 1WHYA 2HBYB 3QLHB 2QSFA 3KLGA 2Z2LA 2CQBA 3EDRB 2WVDA 2YH0A 5EWGA 2ZM6F 3PFEA 3H25A 1DTTB 1ZEFA 3NCQA 2AZ3A 1EARA 4WXOA 4LFBF 2IAJB 3C3LA 1TFYA 4ZLLA 3RAXA 4MK9A 4P73A 3MPUB 1VBXA 4PYDA 2HNZB 1KOOA 4DR1F 3I4HX 2CQCA 2YTCA 4B9UA 3PW0A 4DQSA 3QGHA 3IGYB 3SXLA 1QJHA 3T1HF 1FD8A 2JLEA 4XPEA 3UDEA 1RWOB 3ADAC 2IM1A 2MYFA 4DR6F 2MQLA 2MLXA 2HHVA 4O4GA 1FNMA 5HMWA 4K4UA 4OHWA 2HVZA 4JI8J 2IBOA 4DV3J 1S1WA 2IC3A 1NJYA 4NI2A 2WVFA 3TO8A 1YJ9S 2X1AA 1LNQA 1S1TB 3HDSA 4EI2A 3PR4A 2DNKA 3CJQA 1U1PA 4NZ6A 4C8YA 4UPLA 3CD5A 2QIFA 3N5FA 4TY9A 1J5OB 1YJWS 3LUYA 4AUKA 2HIYA 2KM8B 1PSDA 3TANA 1KN6A 4G6VB 2FHMA 2W9CB 3ZZ0A 2WSFC 4NLWA 4BWJA 3D3CJ 4NE9C 4A8FA 1NRKA 3MM6A 4CO2A 3AQOA 5KFBA 1WOOA 4CZCA 3JSBA 4H54A 2FJDB 4Q0BB 2HQ3A 2RF2B 2R2UA 1KVKA 3B8HA 2BQ3A 4ZJQA 3G4SS 2R9LA 4ZVFA 2RE1A 3FKBA 1WOPA 4DUTA 4DV2F 1HARA 5IM0B 1BQNA 1BQMB 1FI4A 1FJ7A 2NXNA 4RX6A 3BDGB 2EC2A 3TUIC 3VAHA 3GYNA 4FKYA 3FCWA 4UQGA 1LFWA 3LQVA 3AA8A 2AP6A 4NLGA 5KFRA 2UU9F 2MLYA 3UQSA 2BR0A 3G82A 3NXZA 3ZTOA 4C8MA 1FD2A 3D9BA 4Z37A 4MAKA 3M8QB 4E8UA 4QJVA 4RW6B 1NDLA 4P6QA 1SHNA 5IZHA 4B9MA 1WELA 5H9FJ 3I0SB 2YKOA 4MKBA 3QZ7A 3NNHA 4U95A 5KFFA 3BBFA 4ER8A 5F41A 1BY9A 3TJAA 1HQAA 5DQIA 2YQ3A 2FLOA 1CQMA 1F5BA 3MCOA 2IVYA 5KG4A 3OR1A 4ILRA 4L75A 3UDVA 1ZAXA 2LMIA 5C25B 2A0FB 2GZOA 3NEKA 1BWVA 2KXNB 4C11A 2P8IA 2NZCA 2OFGX 2ZDOA 3ENQA 3AD8C 1TK8A 1Y11A 4X4PA 4WK3A 2EK6A 3IP0A 2ZH5A 5JXSA 3KD8A 3BS9A 2Y0BB 2MHEA 3UN2A 3J81j 3VGSA 3IGVA 1F60B 4Y00A 1KDNA 4EGLA 4PG5A 1RT4A 2CKWA 4N77A 1X9SA 2QV6A 3F73A 4YB5A 2CQ2A 4FNIA 5EN1A 3ZZYA 3V4IB 4DG1B 1HNXJ 2W9BA 3IBWA 4LF4J 1ALHA 3LTOA 1LW0B 1HR0J 3QPIA 1K0VA 3L7PA 3TYTA 1TKTB 3MK2A 3VQSA 5HBMB 2VOPA 1WHXA 1ZM3A 3BREA 4DFMA 2ZE2B 3W2VB 3KLVA 1FKPB 3QSYB 1XC9A 3JYTB 2YWKA 5LSOA 3TARA 3N6LA 4B9TA 4J9NA 1DY3A 4G1QA 1IJFB 1PJ5A 2BRKA 5KFWA 2DK2A 1VQNS 3K59A 5KG2A 3J81U 2HSEB 5L1KA 4Q7AA 2ACMA 4JI2J 1ZAVA 3EZUA 1DARA 4CT8A 3VZHA 3KHHA 3MDFA 5KFSA 4ID5B 3EZOA 2RJZA 1S1UA 1FF2A 5J2MB 3SSRA 2HURA 2RSQA 2W1BA 4RUAA 2EG2A 4F25A 2PN6A 5F8HA 2DB1A 4DN9A 3MM5A 3KLFB 3W66A 4YQWA 1NPPA 2JZ5A 1KVJA 4DV4J 4DL7A 1R0CB 2PEBA 2RQCA 1XNRJ 3QIPA 1UJ4A 2AZ1A 3TJ8A 1TKZB 4X66F 4DSFA 2GAHC 2LA4A 5ADZA 1KHNA 3VCDA 1IKXB 2GMHA 5A8RA 4FF4A 3LP1A 3QO9A 4B56A 4GKKF 4GC6A 4Z2XA 2LA6A 1IBMJ 2OLWA 1PBUA 4NL5A 1UVKA 2W4DA 2CZ9A 4CLKA 4I0WA 3V81B 3ED4A 3SV4A 4MYUA 3ITHB 2GIQA 1NHKL 5AJ3F 4H4MB 3A8IA 4ZIWA 1FT8A 2CPDA 2K3IA 4V19J 1U0SA 1CULA 4LBIA 3PJ9A 3VV2B 2HVIA 2HNDA 3ZXWA 4OYBA 4CLTA 4OZ0A 5FJ4A 2JFKA 2W5XA 2F8MA 1LWCB 5GMEA 4IOCQ 1R27B 4F02A 4ZS6A 1RT5B 3S8SA 1KQKA 5HROB 4Q5VA 4M5KA 1JXEA 4IKAA 3DC2A 1UCNA 2B56A 1Z2ZA 3PHEA 4DQRA 3HD2A 1KWMA 4KC5A 4JI2F 2EW9A 5KFMA 4N47A 3L7OA 1X5OA 3DLGB 1JB0C 1C0TA 2OPQA 3W63A 4Q2MA 2MGZA 1Q1KA 3EICA 4A8SA 2AJQA 3QRQA 1KLMA 4ZJOA 2V4QA 4BC9A 1RT7B 1HBOB 2U2FA 3DRRB 4BDPA 1G6BA 2LQBA 4UOHA 3CPWR 2HHUA 4CIOA 2HWIA 4RU9A 4G1IA 3RR7A 4QZVB 1NJWA 3MEGA 2RT3A 3IR6B 4WP9A 3S01A 2AEJA 3CD7A 2D3UA 4CXUA 4PXBA 2GS8A 3HFVA 2UUAJ 4I6AA 4U96A 5KFYA 5F8GA 3SSSA 3SIPB 2CNKB 4USMA 3G6ES 1IBMF 5KFTA 3ISZA 3ZTPA 4YR3A 3MEEB 2KYZA 2BX6A 3HZEA 4P7TA 1ED9A 2ZUGA 3E8OA 1TUWA 3J7YU 5AE3A 2KHCA 2C3UA 4M5HA 4DPYA 1U6ZA 1RBAA 3HHLD 1HYSB 3Q22A 2VFRA 1K1QA 2AHOB 2V5HG 5KTQA 3EXYA 4CYUA 3CDUA 4MFBA 4PXDA 3KK1A 1F1BB 3R5AA 4WYLA 2OPPB 2DGUA 1T9XA 4LSZB 1YI2S 2BYCA 4I1TA 1URAA 4Y34A 4XDDA 2UXBJ 3PO5A 3PHTA 5DQHA 3TX0A 2CPYA 2I5JB 1HNIB 2BJ3A 2HS0A 1KR4A 1R8HA 4PR6A 2YKMB 2CWKA 2I0XA 3PG9A 2DO0A 3BDFA 3Q2SC 5SUHA 4C4WA 1T05B 1N32J 1U1LA 5DGAA 2OSRA 3IWNC 3N5BA 2K7KA 1BQXA 2GJ2A 3V6DB 2B3TB 2VQFF 4R8UB 5A6PA 4KH1B 1NJZA 2CQ1A 1XBWA 3EGVA 3CE8A 2QTWA 3HP6A 2RS2A 2KYXA 3T5JA 3QIDA 2W8LA 4OZNA 2A2DA 3SDEB 3MGJA 2CUYA 5EX0A 1WSVA 1O51A 2RDJA 3SI8A 3B82A 3NLCA 1V5IB 2UUAF 2JSXA 3MM8A 4OFZA 4LUBA 4OJ3A 5GADI 2EWHA 1S4FA 2GW8A 1VC6A 1PAUB 1D8YA 4O3NA 4LR7A 1R0AB 3OFHA 3H2VE 2C2RA 2VKRA 1SJ4P 3TP2A 3AOAA 1GMWA 3AXMA 3AOBA 5CYMB 3KDOA 1EW2A 3IRWP 1FX2A 3V81A 4RW7B 4DFKA 2W8SA 3D1OA 4N8OA 3Q2TC 4F4AA 1QLNA 1YITS 1UZDA 2FJXA 2JEFA 2UVRA 5LOQA 3R1HA 3G71S 5KT4A 1MN9A 2UXBF 2HAFA 3PVXA 1RAHB 4RUHA 3OVBA 3T19A 4S0MA 3D1HA 1LK5A 5HROA 1X5SA 3GIMA 1S9GA 2BE2B 1KTVA 3IO1A 3M2VB 2HQCA 2H4YB 1W25A 2JFDA 2V9KA 1ZZFA 3OFFA 1WC3A 2HW3A 4O0NA 2R8JA 5C42A 2J6TA 1KFDA 2GNKA 1HPZA 1OQ3A 2MB0B 3D6HB 3Q8PB 1KLNA 3DNCA 3I5CA 3W61A 3UNYA 2VD3A 4AXJA 2YBVA 4M63A 3DOLA 4DQIA 2RDDA 3HVTB 4CLPA 1Y5IB 2I9SA 3R7NB 2AMCB 1HBOA 3NGRA 2FJVA 1DQAA 4FXVA 2QO3A 2YKQA 2VFUA 2CNNB 2MTLA 2AIRB 4X84A 3W5ZA 4DR7J 1U6FA 3U7JA 2DHHA 4JP8A 1X9MA 1RWKB 1U45A 2XO7A 3IM8A 2CVEA 2D1CA 3M30B 4ED7A 3OJUA 1HKAA 3IR5B 5HQLA 2A1BA 4GTWA 3D1QA 1D1UA 1S0MA 3WAYA 2XSJA 3GG1A 3KMQA 2ZBPA 2AYMA 4CI0B 1U1RA 1X0PA 1NK6A 2KVQE 1F3FA 3KLIA 3NMAA 1CPZA 2N7YA 3US5A 4LF6J 1PGZA 5EWFA 2GIRA 3P96A 3MEDB 4KGZB 2J76E 4K2JA 4P71A 1NZ8A 5FLXY 5HO4A 4B3RJ 2CJ9A 2CZ4A 3CJSA 1RWMB 2N82B 4RU2A 1OSDA 1JNRB 1RHKB 3OTOJ 1EB0A 5IQ6A 4EZ9A 3G6VA 4O4RA 1VQ6S 1N54B 1VHFA 4EWTA 5ETQA 3LP2B 3IGZB 3K5MA 4TNOA 4V1Ak 2OMLA 1RAOA 3MPYA 1GTEA 2NSBA 2CPJA 5D15A 3ZNJ1 4CP5A 1PC5A 4FYVB 3M32A 4NLUA 1KNZA 2CZVC 1S0NA 4RW9A 2DNNA 2DXEA 3THTA 3VAIA 4F0KA 5DLVA 1LOUA 5GAHI 5ETTA 3UVJA 2KVIA 2LECA 2DO4A 1HL6A 3D3BJ 1QAYA 2R8HA 1ZEBA 2M5YA 2YKMA 1PYOB 4KHPF 4Q8EA 4B9VA 3E01A 1N5TA 5J2QA 3MMCB 1WORA 1PG5B 4PWWA 4C9DA 2GSNA 4IFYA 2CJXB 2CPFA 3KK2A 3V6DA 2F4FA 2AW0A 1JWWA 2DGXA 1RHJB 3EZ5A 4O44B 3I82A 4M5GA 1HQ2A 4KAIA 4B3SF 2LLZA 3QATA 4KJGA 3CCLS 2ZH9A 1N5SA 4KHMA 4OHXA 4ICLB 1JLFA 1SKRA 2M88A 2GC8A 3D54A 3ZZZA 2GQQA 2ALYB 4MMOA 1KH4A 3SSQA 4RUBA 2E7WA 5I42A 2VBYA 2UV8G 4ZVRB 2DNMA 4K0KJ 1U1KA 2LVWA 1LV5A 1LWFB 1RTIA 3LF0A 2FQQB 2DIUA 3AQPA 1RCOB 1JLBA 5F0WA 4USIA 1NLKL 2ZH4A 4CDIA 1SBRA 1XMQJ 5L46A 4DSIA 5K8OA 1ZZNA 3MMJA 4EU0A 3JAMY 4UOOA 2KM8C 4MKVA 4LFAF 2Q66A 2V50A 2JWNA 2ZNZA 1SC1B 3ILJA 1VYAA 3UR0A 2DNGA 3PNIA 3Q86A 3UR3C 4O3OA 1VJWA 1NXIA 3Q3QA 2V2VA 5A8KA 3K0JA 4PWDB 1AJCA 1R43A 4H4OB 2B6AB 3MUVP 2D1GA 2Y8YA 1RWPB 3RBZA 3TZWA 5D0RA 3PW5A 4G65A 3SCKE 2XY7A 3DM2A 4YN3B 3MCMA 2EFGA 3PM9A 4O3QA 4DN0A 4NLPA 1WG5A 4G3IA 4GTYA 2GHPA 1VBKA 1YRXA 1HI0P 3KOAA 2GA7A 4PUOB 4ZG6A 3H4BA 5FLXU 4MJKA 1KD1T 4ED8A 4QQBA 4IOAQ 1SH2A 2CRLA 4DMZA 1QSYA 1U09A 4C0HA 3T00A 3IFEA 5EX3A 3EDQB 4LT6A 4X64J 2BVZA 3SZ2A 5HQ8A 1ZM9A 2F63A 2WONB 2XR9A 3GCWP 3UD3P 4J91A 1FRIA 2KO1A 1TK5A 3HSDA 5JVGQ 2P6TA 3HHDA 5E7OB 3OPKA 2OPRB 3AAWB 3KHLA 5AT1B 4BHQA 2IA6A 1ZPWX 1VQLS 4K4WA 4EZ6A 2ADBA 2DNZA 2HVDA 5KXAA 4KJDA 3J7AN 5JVHQ 4JI6J 5LSLA 3BN4A 1H7XA 3MMAA 3BGLA 1JKHB 1S6QA 1XIQA 3JQKA 3T1AA 3T1YF 4UUXA 3MEDA 5D3GA 3Q23A 2R7TA 2FVRA 4FYYB 2FUG9 2P5VA 3IM9A 1V3ZA 3PX6A 3BO3A 4ZG7A 3DYAB 5B0CA 2PI5A 3O6QA 1WUUA 3MECA 6AT1B 1HWJA 3QT6A 4MHXA 4ECTA 2XLKA 2KKHA 4NLXA 5IOLA 1M5SA 4IRKA 3BSCA 4NZ0A 3HLUA 1PBAA 2BANA 2EBGA 4ZK7M 3CCSS 1IBLF 4EO8A 2VICA 4O3SA 3V2UC 2JEJA 2WBRA 1DBDA 4YP3A 3LPEA 2RDIA 3D68A 3QNWB 5J2NB 5KFCA 2PMZD 5CYQA 2KT2A 1WHVA 2ZFHA 4K5RA 5RUBA 2A10A 5K8MA 1FKAF 3EM1A 3PYDA 1IVZA 5DLFA 3CDEA 2W5QA 5A0YB 2HAIA 1AXQA 2NLWA 1FO1A 2ZH1A 3MD3A 4J37A 2CWXA 3GV5B 1MNEA 1HDHA 2G2YA 1YZ6A 4YOEA 4ZP9A 1TR0A 2AJ1A 4C2MA 3PCOB 1Q7YT 3T5KA 2SXLA 1DTQB 3VVTA 3BKTA 4DV6J 1Q8KA 3N28A 5CCLA 4FDJA 4DV0J 5E3CA 5E5NA 2OD4A 3I55S 2QLFB 4RR5A 3N6MA 1UWBA 2JEGA 2W5WA 4CO3A 5HLFB 1U4BA 4LF8F 3A8JA 3A12A 2O3DA 5E3QA 2VB6A 1HWIA 5L0KA 2L3MA 3PTWA 2QLBB 2APOA 4CH1A 4EO6A 3FRYA 4B3TF 4ZLNA 1R8CA 1FX4A 3N79A 1RT1A 5LT5A 2Y8WA 9RUBA 4CNYA 3T5LA 2UUWA 4CLZA 3ZTSA 4GMKA 1N2KA 4JI6F 3CJKB 4ZCKA 1RAJA 2AYEA 1V3RA 1FERA 2QA4S 1FK9A 3A13A 3PEHA 4DJBA 1NSQA 4NCGB 4CLUA 2HZVA 4JV1A 2V69A 4HR2A 1HQUB 4JI3J 2X51A 5L0BA 4A48A 2UUCJ 4MY4A 3J80Y 1X4CA 5DJBA 1KSPA 4IH7A 1LW2B 1MSWD 1TL1A 3Q8YA 4HACB 2D74B 5E41A 3HT0A 1KH7A 2IJFA 2ZH2A 2BM0A 2GQ2A 2KXHA 3R6GB 3HJVA 1HHSA 2QC3A 2QZ8A 2HVHA 4ZHRA 3CJ3A 4UY8T 2FHOB 5GADU 3N01A 2MQNA 3M9OB 1GXUA 3CXCR 2DXFA 3HSGA 3RTVA 3WIUA 2XC9A 2HPUA 3MFHA 1XTZA 3HHLB 1CC7A 3EXCX 1LK7A 2CPZA 2HFSA 2CXEA 4LJMA 1UW4A 2LEBA 2RQMA 3AB4B 2VASA 2F5GA 3NGKA 3PKMA 3EWGA 1OY6A 4DV6F 1HNVB 2OPSB 1RADB 3U1NA 3PIOQ 4ALZA 1TL7B 4DX8H 1CJKB 2PIIA 2J0QD 2E66A 4ELUA 2P2CB 5T7LB 1FRLA 4FNHA 4QIEA 1VRUB 3RBXA 3H0PA 4HDGA 1XNQF 1Y10A 3GR0A 4IFVB 5KOXA 3LH2S 1MLAA 4P74A 4IRCA 5KFXA 4R0JA 4HKQA 4B9SA 3C16B 2ASLA 3T6JA 2HMIA 4QU7A 3PJXA 1YRTA 4P2MA 3GV7B 2R2TA 3KJVA 2XHWA 1RYSA 1UVNA 4OYPA 2J0WA 3HM9A 3QZ8A 2XTJP 1CJVB 2FVSA 4WU3A 5D78A 1RTDB 2F7VA 2UUCF 1IR1A 2PMHA 5LM7E 3MTKA 2JLGA 5D4PA 4NYZA 3FZBA 1L3UA 3JQMA 4UPIA 1F9EB 4DX7A 3LWMA 3T9NA 1RK8A 3IBCB 4MIBA 4JI0F 2AJ0A 3ETMA 2MZQA 2XNQA 3HF5A 4MT1A 1JLQA 1LEOA 3QAEA 5IV3A 5DRKA 2ZJQQ 3TOQA 4CYRA 3GONA 1X4DA 4LF5J 2IJNA 5F0UA 2PGCA 4KE5A 1FA0A 3IDDA 2GSUA 1KVIA 5MLCV 4LIWA 5A0YA 3F0NA 4JV2A 3FDSA 4YR1A 2ZD1B 2M3DA 3H8YA 4KFBA 1FESA 4ENOA 2V2KA 1KH9A 4HI2A 1YIJS 3BEGB 2G9YA 2FHKA 5KFDA 1URNA 3MI7X 3KG1A 3GB0A 3QJPA 4K4TA 3H59A 2GSOA 3FUYA 3DLBA 1P8GA 2M9KA 2EK1A 1DQ8A 3DHXA 1HHTP 4WYWA 4YY3J 4B3OA 1DHMA 1IWAA 3DXSX 3M1VB 3NRBA 3C15A 5KFHA 1WC5A 5GAHU 4ECYA 4OX7A 4KAYA 4J7CA 1K9MT 2ADCA 3VF0B 1I5OB 2BW2A 3NS7B 2HNYB 5KFPA 1URRA 2GVZA 1D09B 4NXMJ 2MKHA 4D3GA 2GJFA 4JV5F 2V94A 2OSQA 3W7BA 3EJMA 1HQEB 1Q8IA 2LQ9A 4LRCA 4JBCA 2HFOA 4PPZA 1TAUA 3HJFA 4LQ9A 4WU2A 3L3CA 4DV7J 5HK4A 4ECWA 2U1AA 3GJSB 2XMAA 4AL6A 4C97A 3KUEA 4O3RA 2ZBQA 2LXFA 3M8WA 3OL9A 4K4VA 4QCLA 3DI6B 2ZBRA 4DOZA 3IGNA 5E2QA 4L74A 3CSKA 2X1BA 2RHSB 3ISND 1FE4A 2XMVA 3OBIA 3TUZC 4TU8A 4KKOA 1T9UA 1LXNA 2J8SA 4EUVA 1O8BA 5CQGA 4OJGA 3UNGC 4PQUA 1Y4ZB 5DZ7A 2WRMA 1S59A 1FJCA 3KUHA 2KG1A 2Y1RI 3OFEA 5ETLA 3DRPB 2H1YA 5D0HA 4ED4A 2ZDPA 5CZVA 1FRJA 1V6HA 1ICEB 1T3OA 2W7AA 1U6BA 3NOGA 1XMOJ 4ZLJA 3PO4A 5HATA 4AQYF 1DZ5A 3IG1B 1TTHB 2DPIA 4ANCA 4TY8A 4DL0C 4F4WA 3RGIA 5HVFA 1SL2A 5EGYA 1RABB 4JB8B 5DQGA 3D6FB 4YY3F 2BRLA 1M1KT 2EKNA 2YNGB 1HA1A 4DR3F 4IFVA 2UVUA 4RLEA 3QFWA 4D3HA 3OUYB 2DY9A 2XZWA 4HH1A 3I0RA 4FYWB 1N88A 3V5RA 5L9XA 1F0XA 1H6KX 3DLHA 3AJ2A 4NXMF 4ILMA 1JLAB 2LP4A 5G0RB 2XBPA 1H7WA 1K8AT 1SHQA 2IM3A 1SV5B 2QEXS 1SH0A 2DVIA 3W1YC 4I4BA 5HVHA 4UOPA 4FPIA 1N8RT 5F8NA 4DX5A 1NKBA 3HSZA 2KG0A 1NPRA 4YB6A 2HK3A 2RS8A 2DH9A 1Q5YA 5L9NA 4DV7F 4Q45A 4F3QA 3DLLQ 1LWEA 1MROA 2HFUA 1O5JA 1YX2A 1BD6A 3KG0A 1FXDA 3CMQA 1TL3B 4I67A 3KHGA 5LMUF 3OSPA 1TUGB 3OL6A 4TLRA 3VZIA 1N5VA 5HANA 3QGIA 2RUGA 1RT3B 2P9CA 1RYRA 3C46A 2J9EA 1KP6A 5IT4A 3IWLA 1SUQA 1GX6A 4DQPA 2ZUAA 3R97A 1U0HB 8ATCB 1YJTA 4LSLB 3DRSB 1TMJA 1Q86T 2BMBA 1TUVA 1XMOF 1GXTA 2VPZB 2I2YA 2L48A 1UPPA 1C1BB 1NDKA 1FRKA 2RILA 3KDNA 4TYBA 2Z2ZA 3I32A 2KFYA 5B0FA 1TKXB 2YQ0A 5A2QY 1IBKJ 3FMWA 5D0GA 1S76D 5IC6B 1VRTA 4PABA 4TYAA 5CA5A 2M4MA 1LKZA 1WKLA 1ZPVA 5B0EA 1TELA 3I5BA 5IT9U 4MTPA 4PCQA 5KT2A 3NKQA 1Y9OA 5LMNF 4LR8A 1FDDA 2M0GB 1VC5A 5BYQA 1W7WA 4TQSA 3UCZP 4C98A 2HHHJ 4KT0C 3LGMA 2CJBA 3DDKA 1N48A 2DT9A 3H5UA 1PYTA 5KG6A 1NNDA 2Z4PA 1C2PA 1KHWA 2VFTA 1QSLA 1U48A 2EKYA 4ECZA 2HHPA 3MAAA 1N4LA 1K7HA 4WFXA 2B9EA 1S99A 1LWXA 2QYCA 3DFEA 4QYZK 1SPBP 1VQKS 2PD1A 4XTTA 4QPXA 2D7SA 3M9MB 2GHWA 2DNLA 3M2UA 5IFMA 1KHVA 3JS9A 2CG8A 1X5TA 4WZMA 1RWXB 2O1PA 3OXGA 3GYXB 4RKUC 3OTCA 5G4DA 4WE1B 4P75A 2PEHA 5B0GA 5KG1A 1C4AA 5DO2A 5GRRA 3MWBA 4HDHA 2YNHA 4ECQA 2W8DA 4DL6A 2WOMA 1T8EA 1C0UA 1HIYA 4OYIA 4OLPA 2Q3PA 5BXIA 2XGQA 7FDRA 4LRBA 1HD0A 2IJRA 2QL9B 3KK3A 1SKSA 2X1FA 2E5JA 2UUTA 4LREA 3PV8A 3X1LB 3I9V9 4RW8B 2B8QA
chains in the Genus database with same CATH topology
5LIAA 3M7VA 3DPCA 5IJSA 1ANJA 1FSUA 1KH5A 3TG0A 3NKPA 1URAA 3MK1A 4UPKA 1SHQA 2IUCA 2XRGA 5AJ9A 3SZZA 1KHKA 2W5QA 1K7HA 3BDHA 3TWZA 3KD8A 4UPLA 2ZKTA 3Q3QA 1EJJA 1B8JA 3UN2A 4LRDA 1URBA 4CXSA 3LXQA 1AJCA 1ZEDA 2GA3A 5L0BA 1ALIA 4KAYA 4MY4A 3UN5A 4LR7A 3TX0A 1HDHA 3BDGA 3OT9A 4KM4A 4UOPA 4KJGA 5LQQA 4GTZA 1HJKA 2D1GA 4LQYA 3UNYA 4UORA 4KAVA 3T02A 3NKRA 1ZEFA 1E2SP 2W5XA 5KXAA 2GLQA 1EW8A 1ELXA 1EQJA 4KJDA 4CXUA 5C66A 4ZGAA 3UN3A 3SZYA 1O99A 1EW2A 1EW9A 3IGZB 4CYRA 5IJQA 4CYSA 1KH7A 1KHLA 3CMRA 3BDFA 1E1ZP 3B5QA 5EGEA 1KH4A 4FDJA 5K4PA 2W8SA 5EGHA 1ALHA 2W5SA 3IDDA 2ANHA 1N2LA 1SHNA 3DYCA 1ALKA 2GSUA 4FDIA 4GTYA 4UPHA 3WAVA 4LRCA 2W5RA 1AJAA 5TJ3A 4NWJA 1E33P 1ED9A 3NKOA 4MIVA 5INHA 4ZG7A 4N7TA 5DLWA 3MK2A 2W5VA 3IGYB 3NKNA 1ANIA 2W5WA 1ELZA 1ED8A 1KHJA 2X98A 4QAXA 1KHNA 4ZG6A 4MHXA 5GRRA 4YR1A 3UO0A 1E3CP 3T01A 5GOVA 5DLVA 5L0KA 3WAXA 1AUKA 4LRAA 1AJBA 4B56A 1HQAA 2W8DA 2VQRA 3NKQA 5HRTA 1ELYA 3T00A 4LR8A 1KH9A 3MK0A 5L0EA 1ZEBA 2G9YA 2QZUA 1Y6VA 4GTWA 4LRFA 3WAYA 1EI6A 2W5TA 4LRBA 2IUCB 3M8WA 1P49A 5DLTA 3A52A 4UOOA 1O98A 2RH6A 3WBHA 3NVLA 3NKMA 4GTXA 4NWXA 4CXKA 3ED4A 1Y7AA 3WAWA 2GSNA 4LR9A 3M8ZA 4LREA 1AJDA 2GSOA 3M8YA 4TN0A 5LRMA 1ALJA 1N2KA 4LR2A 3E2DA 4UPIA 4ZG9A 2XR9A 2IFYA 3BDGB 5LRNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LIA A;  3M7V A;  3DPC A;  5IJS A;  1ANJ A;  1FSU A;  1KH5 A;  3TG0 A;  3NKP A;  1URA A;  3MK1 A;  4UPK A;  1SHQ A;  2IUC A;  2XRG A;  5AJ9 A;  3SZZ A;  1KHK A;  2W5Q A;  1K7H A;  3BDH A;  3TWZ A;  3KD8 A;  4UPL A;  2ZKT A;  3Q3Q A;  1EJJ A;  1B8J A;  3UN2 A;  4LRD A;  1URB A;  4CXS A;  3LXQ A;  1AJC A;  1ZED A;  2GA3 A;  5L0B A;  1ALI A;  4KAY A;  4MY4 A;  3UN5 A;  4LR7 A;  3TX0 A;  1HDH A;  3BDG A;  3OT9 A;  4KM4 A;  4UOP A;  4KJG A;  5LQQ A;  4GTZ A;  1HJK A;  2D1G A;  4LQY A;  3UNY A;  4UOR A;  4KAV A;  3T02 A;  3NKR A;  1ZEF A;  1E2S P;  2W5X A;  5KXA A;  2GLQ A;  1EW8 A;  1ELX A;  1EQJ A;  4KJD A;  4CXU A;  5C66 A;  4ZGA A;  3UN3 A;  3SZY A;  1O99 A;  1EW2 A;  1EW9 A;  3IGZ B;  4CYR A;  5IJQ A;  4CYS A;  1KH7 A;  1KHL A;  3CMR A;  3BDF A;  1E1Z P;  3B5Q A;  5EGE A;  1KH4 A;  4FDJ A;  5K4P A;  2W8S A;  5EGH A;  1ALH A;  2W5S A;  3IDD A;  2ANH A;  1N2L A;  1SHN A;  3DYC A;  1ALK A;  2GSU A;  4FDI A;  4GTY A;  4UPH A;  3WAV A;  4LRC A;  2W5R A;  1AJA A;  5TJ3 A;  4NWJ A;  1E33 P;  1ED9 A;  3NKO A;  4MIV A;  5INH A;  4ZG7 A;  4N7T A;  5DLW A;  3MK2 A;  2W5V A;  3IGY B;  3NKN A;  1ANI A;  2W5W A;  1ELZ A;  1ED8 A;  1KHJ A;  2X98 A;  4QAX A;  1KHN A;  4ZG6 A;  4MHX A;  5GRR A;  4YR1 A;  3UO0 A;  1E3C P;  3T01 A;  5GOV A;  5DLV A;  5L0K A;  3WAX A;  1AUK A;  4LRA A;  1AJB A;  4B56 A;  1HQA A;  2W8D A;  2VQR A;  3NKQ A;  5HRT A;  1ELY A;  3T00 A;  4LR8 A;  1KH9 A;  3MK0 A;  5L0E A;  1ZEB A;  2G9Y A;  2QZU A;  1Y6V A;  4GTW A;  4LRF A;  3WAY A;  1EI6 A;  2W5T A;  4LRB A;  2IUC B;  3M8W A;  1P49 A;  5DLT A;  3A52 A;  4UOO A;  1O98 A;  2RH6 A;  3WBH A;  3NVL A;  3NKM A;  4GTX A;  4NWX A;  4CXK A;  3ED4 A;  1Y7A A;  3WAW A;  2GSN A;  4LR9 A;  3M8Z A;  4LRE A;  1AJD A;  2GSO A;  3M8Y A;  4TN0 A;  5LRM A;  1ALJ A;  1N2K A;  4LR2 A;  3E2D A;  4UPI A;  4ZG9 A;  2XR9 A;  2IFY A;  3BDG B;  5LRN A; 
#chains in the Genus database with same CATH topology
 3R7B B;  4M5D B;  1YJU A;  1IBK F;  2DTJ A;  3DLK B;  3IG1 A;  5BYR A;  3KUG A;  2W2M P;  4JI5 J;  2G2Z A;  2FJE B;  3R27 A;  1H3D A;  1CJU B;  1ALI A;  2JLF A;  5E33 A;  2YNG A;  1AB8 A;  2GVD A;  1DFD A;  5A6W A;  1F5A A;  3H4D A;  4ELV A;  1NSK L;  3HSJ A;  1J27 A;  3RYL A;  3DMJ A;  3HO1 A;  3SFU A;  3GYG A;  3LPY A;  4YS2 A;  4DCO B;  4DQQ A;  1WG1 A;  2MJN A;  2WB1 D;  1KQF B;  2HHH F;  5G0R A;  2HRU A;  2HQG A;  3TR5 A;  3R8Y A;  1S1V B;  4IDK B;  1FWP A;  4DFJ A;  4PWU A;  5ETR A;  4ZIV A;  3V4M A;  2HRT A;  3PRB A;  3FQL A;  2G0C A;  4OI0 A;  4LF1 A;  3BGR A;  4M5I A;  1EKR A;  2QZU A;  1FFS B;  1EI6 A;  2KI2 A;  5HP1 B;  1YZ7 A;  2VG7 A;  4ID8 A;  1EET B;  4AYB D;  3B6B A;  4F26 A;  2IFY A;  2B8P A;  1WC0 A;  4IQM A;  2DH7 A;  1CEZ A;  1IKY B;  1BC6 A;  2WAQ D;  4U6P A;  4RUC A;  4CXS A;  4LFC F;  5JJB A;  4MK8 A;  1AZS A;  2ZWO A;  3WC2 A;  3CC4 S;  1S1X B;  1Q16 B;  1WTB A;  4BC7 A;  1WI8 A;  3DLE A;  4NA3 A;  1KHL A;  1RLC L;  3IA0 A;  3G8T A;  3ZZU A;  1B99 A;  3O2I A;  4J9O A;  4LSL A;  1S9E A;  4UOG A;  5BR8 F;  5DLW A;  3IMQ J;  1WEZ A;  3W8G A;  3UE2 A;  2QMW A;  3QAU A;  5CAA A;  2F3J A;  1S10 A;  4KQZ A;  4DX6 A;  3K8V A;  4JI5 F;  4I69 A;  1KC8 T;  2P9G A;  4ED2 A;  3VAM A;  1H38 A;  2HHS A;  2W5T A;  4UZC A;  2E9R X;  2K1R A;  4NYO A;  3DRX A;  2FY8 A;  3ZC4 A;  2MDA A;  2CDQ A;  2E7X A;  3C14 A;  5AXL A;  1JLG B;  2C3Y A;  1VQS A;  1ANJ A;  4J5O A;  3DU5 A;  2NYH A;  1JLE B;  2CQD A;  4QYR A;  3VAL A;  5CXT A;  1SQG A;  4N5S A;  4BWM A;  4KR0 B;  2VFV A;  1K73 T;  1REV A;  2XGP A;  2FVC A;  3Q89 A;  2EFV A;  3D7S B;  1E2S P;  3MM7 B;  3D28 A;  4Y65 A;  2J9D E;  1ZTT A;  4FF1 A;  1N52 B;  1WKK A;  3K17 A;  1UEV A;  4FYD A;  4MKY A;  4ZP8 A;  1B3T A;  1RTH A;  5H9F K;  2NXU A;  2GGP A;  4JV0 A;  4JYA J;  3NBP B;  1E6Y A;  2MZS A;  5TJ3 A;  1M0S A;  2CJK A;  2FHJ A;  4Y2K A;  1F2G A;  4PAA A;  1YDL A;  3FC9 A;  3UWT A;  3CTR A;  3BJY A;  3QT8 A;  3MEK A;  3NG8 A;  1OS5 A;  1GT8 A;  5AXK A;  3W8P A;  2XLJ A;  4J9L A;  1GTH A;  1E6V B;  2NSC A;  5H1S V;  2KFZ A;  4R5P B;  4P10 A;  1NO8 A;  2ASY A;  1VDH A;  1M90 T;  2HIQ A;  2V8P A;  5GMK a;  3HUL A;  4LR9 A;  2EVZ A;  4ZG9 A;  2A18 A;  4YB7 A;  4I2P A;  3NGU A;  4KO0 A;  4DUY F;  2CJY B;  3FCV A;  3BKU A;  3A3N B;  4P9S A;  4A47 A;  3T9Z A;  5D4N A;  4NAS A;  1VQ7 S;  1FVQ A;  3W9J A;  4IG0 A;  2UXC J;  1CJT B;  2RQ4 A;  2X3D A;  3HHL C;  2B5J B;  2MHN A;  3GJR B;  5B08 A;  3MUM P;  3L09 A;  3POT B;  2YKN B;  5HI7 A;  4I2Q B;  3V6J A;  2FC9 A;  4DXL A;  3FK4 A;  4PXE A;  3JSM B;  2E44 A;  2MQQ A;  4GO7 X;  2YNI B;  1N6Q A;  2JNJ A;  4BBY A;  3TA1 A;  2CQG A;  2VC0 A;  3CF5 Q;  4MIV A;  3C6T A;  4X65 J;  5M2P A;  5DDR C;  3KLH A;  1VS3 A;  1CJU A;  4IH5 A;  2PDA A;  5C2C A;  3M2R B;  1S97 A;  3Q83 A;  2AKW B;  3KNG A;  4J9S A;  1FJG F;  3R2D J;  1S72 S;  2W24 A;  4X4T A;  3IAM 9;  3IN5 A;  2FYX A;  2YX1 A;  3KLE B;  2V4J A;  2KN4 A;  1NDP A;  2KZM A;  1KFS A;  3TAM A;  2CYY A;  1UJ5 A;  2OIH A;  2R7X A;  5EUH A;  1FWK A;  4U8Y A;  2IUC A;  4IUF A;  4IDK A;  4RL1 A;  4OZ3 A;  1G2E A;  1Y3K A;  1K1S A;  5FDL B;  1VQP S;  1U1N A;  3G96 A;  4I7F B;  3RU0 A;  1S6O A;  2LU1 A;  1PKU A;  2YNF B;  4A8K A;  2AU0 A;  3BDP A;  2CJQ A;  1RWW B;  1IJE B;  4KTQ A;  4K2X A;  1IKV B;  4WFY A;  3RRH A;  2B4O A;  3OVS A;  1N34 J;  1NKC A;  1HNW J;  5J2P A;  2BXJ A;  2JC1 A;  2DYA A;  1VOM A;  2UXD J;  4LSN B;  1KEK A;  2GCF A;  1CG2 A;  3DOM A;  3T01 A;  4OI2 A;  4ES1 A;  3N4W A;  2MLZ A;  2RHQ B;  1RUS A;  1P9Q C;  4U7C A;  2XMK A;  1UTA A;  4DUZ F;  2DNQ A;  4WFN Q;  5KT7 A;  2ASJ A;  2VG6 B;  2MKK A;  2UXC F;  4FS1 A;  3OR2 B;  1BLU A;  1VQY A;  3RB4 A;  2IRU A;  5L1I A;  1DJ0 A;  2QA1 A;  3J7Z 5;  3CIM A;  1T03 B;  4ITS A;  2WVC A;  2R8I A;  2VJU A;  4OIX A;  4LMZ A;  2L9D A;  1RT6 A;  4KV8 A;  3J81 Y;  2RRB A;  3ZFV A;  4X65 F;  2DNH A;  3RBD A;  2BW7 A;  3RJM B;  1U47 A;  1RBO B;  5JMN A;  3ELH A;  1CS4 A;  1RE1 B;  1WEX A;  4OJ1 A;  3BKF A;  3M05 A;  4HEA 9;  3WX4 A;  3T5H A;  2BOP A;  2PT0 A;  4DL4 A;  4YDX A;  4AE5 A;  4DPX A;  4CLS A;  2DR6 A;  2H3E B;  4M5N A;  2KTQ A;  1HBU B;  1B0P A;  2Q43 A;  3FSX A;  2D9O A;  1Q4R A;  3R9L A;  5KFA A;  4KGV B;  4O0I A;  1GXL A;  2GO9 A;  2F4V J;  3Q0A A;  1BWE A;  1PIL A;  4RWW A;  2FDN A;  3DCA A;  4N8N A;  1CSJ A;  4BLG A;  4WCE Q;  3BQ0 A;  1YBT A;  2DR9 A;  3NKM A;  3MAH A;  3MMB B;  4GVB A;  4F3O A;  3CCW A;  3DOK B;  4ELT A;  5K14 A;  2V34 A;  1A9N B;  1MMN A;  3P4U B;  3PKY A;  3WBZ A;  3GV8 B;  2RUS A;  5D4L A;  5DG8 A;  2NPF A;  1EQM A;  1N34 F;  2J9D A;  3JTN A;  4ED3 A;  2XSF A;  3VAG A;  2UXD F;  1HBM A;  4JI8 F;  4DV3 F;  3DGP A;  1EZZ B;  4ZDN A;  1N0U A;  3D2W A;  1ACM B;  5C7P A;  1ZBT A;  1Y00 A;  2HHQ A;  2AEM A;  3CO0 P;  4WWS A;  2ZVS A;  4C48 A;  3PX4 A;  2CPH A;  3R6L B;  4F4X A;  4U7U D;  1N2L A;  4NLT A;  1VK8 A;  1FRM A;  3M8P B;  3GE9 A;  2JOQ A;  1QE1 B;  3F41 A;  1BXN A;  1RAG B;  1RT2 B;  3FFI A;  1VBZ A;  4K7Q A;  1RJJ A;  1YK9 A;  4YDD B;  3AFG A;  3QWP A;  3W5X A;  3HPO A;  4ED5 A;  1S57 A;  2OUG A;  2C22 A;  3QJJ A;  4HH0 A;  1RAA B;  5CCM A;  1TAQ A;  2RAQ A;  2DNO A;  4E98 A;  4HYK A;  1QD1 A;  3D0I E;  4DS4 A;  4IR9 A;  3NWG A;  3QYY A;  2OJ3 A;  4QOT A;  4NX9 A;  2WHO A;  3CGI A;  1QTM A;  3NY0 A;  1H72 C;  2DR7 A;  2WCX A;  2QRR A;  3IRX A;  2XMJ A;  1TK0 A;  6FD1 A;  5CYJ A;  2BJ9 A;  4HT7 A;  1OWX A;  2HS3 A;  1EQJ A;  4PXC A;  3QLH A;  4X4O A;  2IM0 A;  4N41 A;  1FNX H;  2GMJ A;  3N6N A;  4QWE A;  4FF2 A;  3OLA A;  1YG0 A;  3KHR A;  1UJ6 A;  2LQ8 A;  3MR7 A;  1DTT A;  4IO9 Q;  1X8D A;  4Q43 A;  3LO3 A;  1SJF A;  1D9A A;  2IAJ A;  2V0N A;  2G4B A;  4UOC A;  4CLL A;  1JJ2 R;  3M6U A;  3MR2 A;  3RRK A;  2G1D A;  5FDL A;  5DDO C;  4IH6 A;  2Y1I A;  4J9V A;  3BF4 A;  4RW4 B;  2HNZ A;  1ZA2 B;  1HBN B;  3AHP A;  4X4S A;  4LF2 A;  1W26 A;  2RRN A;  3OTB A;  2OD6 A;  3DRY A;  2QA2 A;  3KFW X;  1SJ3 P;  1B64 A;  5C24 B;  2IRX A;  5KFQ A;  1IKV A;  4U9R A;  2LU2 A;  3ET6 B;  4C7Q A;  5HJY A;  3LOU A;  1U49 A;  1QY7 A;  2GX8 A;  1TZ0 A;  4OHV A;  1NK4 A;  1Q0N A;  1UA0 A;  2FLN A;  3W9I A;  4NRU A;  3IS9 B;  1JLC B;  2CPI A;  2XWX A;  4X62 J;  2Q6C A;  3BDH A;  3TWZ A;  2XG8 A;  2DIV A;  2HBQ B;  4RBT A;  2CNO B;  3M6W A;  3LAN A;  5BYS A;  1S1T A;  4URQ U;  3A3P B;  4FPR A;  2AJF E;  4F4Y A;  4ETX A;  2GLQ A;  2FZK B;  5KFZ A;  4CTA B;  3W2W B;  3C19 A;  1O99 A;  1NHV A;  4ZVO B;  4K4Z A;  2F9D A;  3QJL A;  3CJ2 A;  3UFC X;  3K89 A;  5AE2 A;  2R8K A;  2MKY A;  4OYA A;  1HMV B;  3PJW A;  1J5O A;  2DY1 A;  5B7W A;  4RNN A;  4USK A;  4GC7 A;  4DV5 J;  5KT6 A;  1Q53 A;  3FZ2 A;  3ZNU A;  5HSP A;  3NS6 A;  4AND A;  2W9C A;  2C3M A;  4QIV A;  2J8A A;  1SXL A;  2IBK A;  3TA2 A;  3K5L A;  1EJ7 L;  1HNX F;  2AQ4 A;  1Q5V A;  5CD4 H;  4WXW A;  2YXL A;  2F40 A;  3BPS P;  3AD9 C;  4LF4 F;  4HHH A;  3Q24 A;  1HR0 F;  1D9F A;  4Q0B A;  3SEO A;  2RF2 A;  4DU8 A;  1KON A;  1LQ9 A;  2DGV A;  2XI2 A;  3G8Q A;  2G1H A;  5IM0 A;  4B08 A;  2ZOF A;  2OTJ S;  1BQM A;  1RGV A;  4X4U A;  4URS A;  1QDU B;  4EBE A;  2E5L J;  1SQE A;  3HMJ G;  3BDG A;  2DNP A;  1L3T A;  1NSP A;  1RKJ A;  4FXD A;  2J6S A;  4QWA A;  2ATC B;  3SQG B;  4CYS A;  1SIW B;  2R4F A;  4MKA A;  1X4B A;  4Y2A A;  2WVB A;  3QMQ A;  3T41 A;  4WKY A;  2IRY A;  2VON A;  2WBM A;  1X4E A;  1YJV A;  3M8Q A;  4DL3 A;  4J9K A;  2HWH A;  4RW6 A;  2B51 A;  5DM6 Q;  4DHV A;  4N76 A;  3SCL E;  2M70 A;  3IWX A;  3I0S A;  1S12 A;  4TN2 A;  3LGH A;  1C1C B;  1M5V C;  4DV4 F;  1XNR F;  1REG X;  4KH0 B;  2ROG A;  4A46 A;  3WBH A;  2OGU A;  4WBF A;  1TL5 A;  1VIO A;  3M8P A;  4B9L A;  1FVS A;  5IJS A;  4G1P A;  2B7B B;  4F0M A;  1GMW D;  2FVQ A;  3BGF A;  2XZD B;  2WW8 A;  3C6U B;  5C25 A;  5ETO A;  2I1R A;  3MM9 B;  1AYE A;  1FE0 A;  1T7P A;  2C2N A;  2JX2 A;  3EE3 A;  3TW0 A;  1IKW B;  1R89 A;  2HHW A;  5KFK A;  4Q2L A;  4YEA A;  2PE8 A;  4HHU A;  2PA3 A;  2LEP A;  2FJB B;  4U7U K;  1TVR B;  1FEE A;  2KFN A;  3CCU S;  4FDI A;  2XWY A;  2DNY A;  1R31 A;  2A6M A;  4B3M J;  3VVU A;  3ICL A;  2B4P A;  2ZH3 A;  4NRT A;  3GJQ B;  1NJX A;  3V4I A;  4DG1 A;  3OHB A;  5E3R A;  3HKW A;  2JHE A;  4LQ3 A;  2RKI B;  1CLF A;  1LW0 A;  1DLO B;  2V8V A;  4YHH J;  1AA1 B;  1TKT A;  3OLB A;  2Z58 B;  3I9Z A;  5HBM A;  4DPT A;  2E5L F;  3RR8 A;  1UVL A;  4C8K A;  2Z0G A;  2V6A A;  2ZE2 A;  3W2V A;  4J9M A;  4KJI A;  1FKP A;  3JYT A;  1T9W A;  3M8Z A;  3KLG B;  1ALJ A;  2ZOM A;  3TZX A;  4R25 A;  3UCU P;  4FN5 A;  1VBY A;  4QU6 A;  1Y0H A;  2NRE A;  3UPF A;  2ZZM A;  1KHK A;  4I68 A;  4ANE A;  4K4S A;  1HWU A;  2HQI A;  2VF3 A;  1HBN A;  4P2S A;  1U24 A;  3IBF B;  3PEJ A;  1VQ4 S;  4ID5 A;  4NLS A;  3BM7 A;  3RB0 A;  1GEH A;  2RU9 A;  2DEJ A;  5J2M A;  2OEK A;  1M5H A;  2R8G A;  2OH2 A;  2MZJ A;  3OXL A;  5ETM A;  2BAC A;  4O4G B;  3KLF A;  3I56 S;  3GFX A;  1XR5 A;  3SMZ A;  1S1W B;  2ZVI A;  5J1P A;  4CO4 A;  1ZA1 B;  4OV1 A;  4NI2 B;  3TVZ A;  1WEY A;  2B4U A;  4LVO P;  1FRH A;  2GAG C;  1IQT A;  1TKZ A;  1MG7 A;  4A8X A;  2YX4 A;  1IKX A;  1IXK A;  3AD7 C;  2MMY A;  1P1T A;  1SVD A;  1R6V A;  2FD2 A;  3LAL A;  2MZT A;  2ZBC A;  4AL7 A;  2E1R A;  3F56 A;  4ES2 A;  2QL5 B;  5CD4 A;  4FVC A;  4JI4 J;  2DKO B;  2ACY A;  2AV5 A;  2DHS A;  5I4M A;  1KH5 A;  3ZZR A;  5U47 A;  3MK1 A;  3HKZ D;  3UW1 A;  4C8N A;  3JQJ A;  2I8E A;  2XS7 A;  2CVI A;  1VJQ A;  4UQT A;  5HMY A;  1J5E J;  1I94 J;  3VHQ A;  4UW2 A;  4OMF G;  4EEY A;  4B3M F;  4R0E A;  3ITH A;  4IR1 A;  4H4M A;  2RH3 A;  2BOA A;  1Z2L A;  2IY5 B;  4LF9 J;  2YWE A;  2MQ8 A;  4F4K A;  4CM2 A;  3MM6 B;  3IC1 A;  1SC3 B;  5IXU A;  4OZJ A;  1JNZ B;  4ZPT R;  1X4G A;  4AD6 A;  1LWC A;  2Y1J A;  1U7L A;  1EHW A;  3U02 A;  2DGW A;  1RT5 A;  1YBA A;  1JXL A;  3OL7 A;  1BQN B;  2ZOG A;  2O67 A;  2HGM A;  2QFI A;  3HHK A;  1RHR B;  1N32 F;  2XYG B;  2ZWP A;  3G9C A;  3N9U C;  3BGO P;  5IWA J;  2DBB A;  1U2F A;  2KHD A;  1JIH A;  3DLG A;  2HRY A;  3AB2 B;  2B9Y A;  2CAJ A;  4AL5 A;  2ABY A;  3G82 B;  1WDD A;  2CQP A;  1RLD A;  3SZZ A;  3UDL A;  1RT7 A;  2HYI B;  2ZHO A;  1ZED A;  3I31 A;  3DRR A;  1A7G E;  2FGO A;  2R7Q A;  4FS2 A;  2AGP A;  3T1H J;  2LYV A;  4DR6 J;  3JSR A;  4P7V A;  3W65 A;  1YSJ A;  1PJ7 A;  3R5D A;  1RAC B;  3GIK A;  1D3W A;  5F8M A;  4USJ C;  1ZM4 A;  3L7U A;  2UVV A;  4WFB Q;  5H9E K;  1Y5N B;  4QYZ J;  4B9N A;  5I3U B;  3BB5 A;  1DAX A;  1NCL A;  3P45 B;  1ANI A;  4TKT A;  3GPA A;  1AFI A;  4JI4 F;  3OR1 B;  3MM9 A;  4Y2C A;  2C3P A;  5HL7 Q;  2LFV A;  5GAE U;  1VC0 A;  2BKP A;  2HG4 A;  2VC1 A;  5B0A A;  1IM4 A;  4ECX A;  4LRA A;  3MEE A;  4TXS A;  5HRT A;  4C11 B;  2G0I A;  2R7S A;  2QN6 B;  3Q8U A;  2OP5 A;  1SKU B;  1QVF R;  3ZTR A;  4DSK A;  5M2U A;  1WF2 A;  3KXD A;  1U8S A;  4U8V A;  2QMU B;  2E9T A;  1HYS A;  3BQ2 A;  1AUS L;  5CAB A;  1EIY B;  1S48 A;  2YKA A;  1N33 J;  4CM0 A;  3GIJ A;  3H5S A;  1RB0 A;  1RT4 B;  4K4X A;  4AT1 B;  2OPP A;  1L3S A;  2HBZ B;  1RAF B;  3M6X A;  2R2R A;  3AJD A;  3QGG A;  3RAQ A;  3F44 A;  4LRD A;  2ILY A;  2R3V A;  3WDO A;  1QUV A;  2ILZ A;  2W9B B;  3BBB A;  4KYZ A;  2BEF A;  3DXB A;  2ZC4 A;  3MPD A;  2H48 B;  1MWY A;  2I5J A;  3R5J B;  1HNI A;  3D0G E;  4DV2 J;  2FTR A;  2VZ9 A;  4K8R A;  3CED A;  1YTY A;  1GK8 A;  1XER A;  3Q8Q B;  1B0V A;  5IWA F;  2BJD A;  2VH7 A;  4IOB A;  1HLW A;  1T05 A;  2VA2 A;  1YJ7 A;  4G1Q B;  1E3C P;  4ZCM A;  2BDP A;  2D69 A;  9ATC B;  1H0H B;  2J6U A;  4R8U A;  2UU9 J;  3CCE S;  4OHY A;  1IWG A;  1P49 A;  3GJT B;  2AYB A;  2IA0 A;  4NWX A;  1VQO S;  4IQX A;  1S1U B;  3SDE A;  4DR7 F;  5LRN A;  2OHD A;  2B9X A;  4L3K A;  2RB7 A;  2O5D A;  3MM5 B;  3C66 A;  2H5J B;  3PYF A;  4P52 A;  3IXQ A;  1VHI A;  2EFN A;  1PIE A;  3HZG A;  1NKE A;  3QIP B;  3PRD A;  2HS4 A;  4LF6 F;  2OAU A;  3RRG A;  4WK1 A;  1R0A A;  1I51 B;  4B3R F;  2VG5 B;  5A8R B;  1QAI A;  1UET A;  1D8Z A;  3LP1 B;  3QO9 B;  4FBU A;  2V4R A;  1R3N A;  5CYM A;  5K5M A;  1FWL A;  5E0O A;  3K7R A;  5L38 A;  1JJC B;  2W2Q P;  3FVY A;  1N33 F;  3CIZ A;  3OTO F;  5AXN A;  3ISN C;  2P9E A;  4RW7 A;  5KFV A;  1UA1 A;  3IAS 9;  3ETO A;  2ZH8 A;  1UVM A;  1UZH A;  2LDI A;  2DXD A;  2C2D A;  2EFO A;  1R8A A;  1SB6 A;  1CUL B;  2HND B;  3E2D A;  2FVP A;  1S7H A;  1KQS R;  4HTJ A;  1S6P B;  2ZBI A;  3NKP A;  3O3L A;  2DEI A;  2Y3Y A;  4C3K A;  4DLG A;  3CC7 S;  3X3U A;  5DLG A;  1F3V A;  2BE2 A;  2GQC A;  3M2V A;  2C2O B;  3LXQ A;  4K4Y A;  4WII A;  2X3G A;  4ZA1 A;  1KKH A;  4KSE B;  2QSW A;  2VBZ A;  3M4X A;  1Z1Z A;  4C6A A;  5B0D A;  4X2B A;  4URG A;  3FBB A;  2MEW A;  2XS5 A;  1WJ9 A;  4ILL A;  2KL8 A;  2RU3 A;  1DUR A;  3RG6 A;  2JEI A;  3SCJ E;  4HVZ A;  1OYE A;  1FXL A;  1NHU A;  3RZA A;  3NOC A;  3I87 A;  1NAQ A;  1C0T B;  2OPQ B;  2NZ4 A;  3NKY A;  2MGZ B;  1TU0 B;  3HVT A;  3TZZ A;  2PC6 A;  1KLM B;  5D6G A;  1FDN A;  2WSC C;  1NBE B;  5MAO A;  2E7V A;  1HHQ A;  4FYX B;  3NP5 A;  1YVF A;  1NK8 A;  4K0K F;  2CAD A;  3M30 A;  3MEG B;  3CUN A;  3UI3 A;  5AE1 A;  3QWU A;  4KGM A;  5FD1 A;  5I3U A;  3TAP A;  4M5M A;  1Q79 A;  2IVF B;  1CQN A;  2HGN A;  4F4Z A;  4FDF A;  2YPY A;  4HL9 A;  1XMQ F;  4X66 J;  1D0E A;  1QUP A;  3BSN A;  2IVM A;  2OI2 A;  5J1N A;  4RNO A;  1NM2 A;  3BR8 A;  4TU7 A;  1C4C A;  2DRB A;  3EVO A;  4UOF A;  3R7S B;  4GKK J;  2OEL A;  1H74 A;  2KRB A;  2MXY A;  2UVW A;  3GSI A;  2J9C A;  4UUW A;  3E2E A;  3Q8R B;  1SJR A;  1VCT A;  2D3Z A;  1OQ6 A;  3LP2 A;  4CYU B;  1YWX A;  4MFB B;  4NML A;  3KK1 B;  1OJ4 A;  4DV1 J;  2MPU A;  5AJ3 J;  3GII A;  3W3S A;  2XYH B;  5SZT A;  4M8L A;  4X4N A;  2CQ0 A;  3VR1 A;  1NB7 A;  2XMU A;  3EGZ A;  4M95 A;  5L0E A;  4NLV A;  3PYG A;  1ZYQ A;  1O98 A;  3MPW A;  3NCR A;  1KS2 A;  4ED1 A;  1JQG A;  1UEU A;  3FSY A;  3EGW B;  4WP8 A;  5KG7 A;  5LJ3 Y;  3M6V A;  4PG8 A;  2FY1 A;  3W9H A;  3SYZ A;  1WC4 A;  3MMC A;  4HLB A;  3PX0 A;  3NAH A;  5IT0 A;  3MUR P;  5T14 A;  4CLW A;  2AD9 A;  1MW7 A;  4CQ1 A;  1S7I A;  2ALZ A;  5B0B A;  2MKC A;  4X64 F;  4CH0 S;  1GQE A;  1WOS A;  1PAE X;  4ZP6 A;  2WSE C;  4O44 A;  1KOH A;  2W2O P;  2V2Z A;  3L4B C;  2ZJR Q;  1L3K A;  1FDA A;  4ICL A;  2BA9 A;  1Q81 T;  3GFH A;  3MOJ B;  1UVJ A;  4WIQ A;  3SBM A;  2FLL A;  2E5I A;  4EFA C;  4UT4 A;  4NA2 A;  1M1G A;  1FTC A;  2W25 A;  1G7C B;  2PFF B;  3VAF A;  2DGO A;  4GRS A;  4M5J A;  2CQI A;  3EGN A;  1LWF A;  3MM8 B;  5D77 A;  3K5P A;  3THP A;  4ZJL A;  1ZOT A;  2XHC A;  3HI9 A;  2DRD A;  2KXF A;  4FVM A;  2VG5 A;  3GP9 A;  4RBU A;  4ZN1 A;  4LBH A;  1YRU A;  4XDC A;  2XQC A;  2DJW A;  4DDF A;  3ILI A;  3MF5 A;  4PKD B;  3K8W A;  3LP0 B;  3DN9 A;  1EP4 B;  1B8J A;  1XN9 A;  2VJV A;  4NEY A;  3WC0 A;  3L9Z A;  5KG3 A;  3EUN A;  4DV1 F;  3T02 A;  2HBR B;  1M5K C;  1UWA A;  4WFZ A;  3MTJ A;  4KIA A;  4DR2 J;  4PWD A;  2WVE A;  4H4O A;  1RWU A;  2B6A A;  3QGP A;  2L08 A;  2RML A;  5CHC B;  4DS5 A;  4F3M A;  1X4F A;  2VA3 A;  1FKO B;  1S6P A;  3CCR S;  3HXM A;  2HGL A;  4XIU A;  3FQK A;  5ETP A;  4DEZ A;  2X98 A;  2IFX A;  2UZA A;  1I3O B;  3ENA A;  2UV8 A;  1SJ1 A;  1S9G B;  2HHX A;  3GMG A;  2VQR A;  4ECU A;  2UUB J;  1PCA A;  4C8L A;  1X9W A;  4ZOS A;  4QR1 A;  3VAJ A;  3HT3 A;  4DV0 F;  2JJ4 D;  3CDW A;  4PUO A;  5C42 B;  3A52 A;  3BO4 A;  4NLR A;  2OEM A;  1HPZ B;  4HTI A;  1R0B G;  1O0P A;  1OYD A;  2Z2Y B;  2OFH X;  4MYT A;  4X4R A;  2XRG A;  3DOL B;  3P49 B;  1RWV B;  3THV A;  2HWT A;  2VQF J;  2WON A;  1RXO B;  5E3P A;  3NGD A;  3VGU A;  2KH9 A;  2C1E B;  3D6M B;  2DGT A;  1SKW A;  4NPO A;  2HFV A;  5C66 A;  4ZGA A;  5GMD A;  2KB2 A;  1VK3 A;  3CMR A;  2OPR A;  2W9A A;  4ZMM A;  4W90 B;  2W4C A;  1OIA A;  2CFX A;  3CW2 C;  1OSC A;  2EBE A;  5K8P A;  5K4P A;  4KGK A;  1F2H A;  2IMO A;  2QL7 B;  3OTD A;  4DL5 A;  3DYC A;  2K7J A;  3E51 A;  3WAV A;  2PI4 A;  1U02 A;  4JI3 F;  2FPH X;  3NCP A;  2L9W A;  2Y1L B;  2XSJ B;  4ZVT B;  3A1Y G;  1FNO A;  3ILL A;  1JKH A;  3P6Y C;  2ZEJ A;  4OZ2 A;  3KLI B;  3OTE A;  1S79 A;  2VV5 A;  2V8G A;  3FEZ A;  1VGY A;  3DYA A;  5F3T A;  1IN0 A;  4LRF A;  2FJA B;  1T02 A;  5DET A;  1VMB A;  4EYH B;  3WIV A;  2V8D A;  4ZPW R;  4DR2 F;  2JVR A;  3S1T A;  1M1H A;  2I38 A;  3H2L A;  2VFS A;  4DZD A;  3GIR A;  1NH7 A;  5J2N A;  1B70 B;  2GHV C;  3FBC A;  2B43 A;  1LFP A;  1RBL A;  4JUZ A;  2XO6 A;  1CVJ A;  5KFL A;  3NAI A;  4UF4 A;  3M32 B;  1EW9 A;  1NH8 A;  3FEY B;  4RW9 B;  2UUB F;  1MMD A;  2PMW A;  3BN7 A;  1JK9 B;  1Y7P A;  3OVA A;  2C2E A;  3QT5 A;  3UVJ B;  3UD5 A;  2KU7 A;  4OI1 A;  1DTQ A;  1KHJ A;  2H9Z A;  4KBI A;  3E01 B;  5J2Q B;  3KWM A;  1MU2 B;  2A2C A;  1NK0 A;  3MAQ A;  1HNZ J;  2CJA A;  2BJ1 A;  1AJB A;  4DSE A;  4M94 A;  3DKD A;  3DDI A;  4IFY B;  4Y0F A;  3KJQ B;  3KK2 B;  2C2K B;  2F65 A;  2ERR A;  4CNZ A;  5HLF A;  3GSD A;  3JTO A;  3KTQ A;  1RHQ B;  1RCX B;  1ULR A;  2BAB A;  4KB7 A;  2BKN A;  4BS2 A;  2RD5 C;  4L76 A;  3GWC A;  1JLF B;  4YB1 P;  3PDN A;  4H4K A;  3BH6 B;  1VRQ C;  3DDN A;  1VIX A;  3FMB A;  2GFF A;  4DFP A;  3AJ1 A;  4OQJ A;  2K2P A;  3CJK A;  5HMZ A;  2E29 A;  3SCI E;  3CME S;  1Q78 A;  5I42 B;  4LQY A;  3SQO P;  1NB2 A;  4WJB A;  2VKZ G;  3BDE A;  3JTP A;  4NCG A;  1UFL A;  1Q82 T;  1WSR A;  1DQ9 A;  1U26 A;  2JL9 A;  3PZP A;  3CO9 A;  1RTI B;  1HQU A;  3TUP A;  3LAM A;  4CO1 A;  1M5O C;  4MK7 A;  3BQ1 A;  1JLB B;  2CNL B;  1GH8 A;  3Q8S B;  4QBU A;  3VWS A;  1LW2 A;  3FBF A;  4Q44 A;  4HAC A;  2J7W A;  5KFJ A;  2IDE A;  3LP0 A;  4OZ5 A;  1CBK A;  2QJ3 A;  2VBW A;  1EP4 A;  1FRX A;  2VL1 A;  2QX0 A;  1N5Y B;  3P3D A;  4ZVH A;  3BR9 A;  2QYG A;  1VI7 A;  1APS A;  4LF5 F;  4PZV A;  3DHW C;  1T11 A;  3CCZ A;  5IT9 Y;  1HD1 A;  5DLT A;  2RH6 A;  3CWJ A;  4KHR A;  4MIW A;  4YME A;  3FGV A;  3HHL A;  5A8K B;  1Y7A A;  4CWB A;  1FKO A;  3LAK A;  2VUG A;  4M5L A;  2WK4 A;  4DSL A;  5DG7 A;  3NGS A;  4ZPC A;  1FJE B;  2QE5 A;  2J0S D;  5LSR A;  5F8J A;  3LGN A;  1SC4 B;  2QG9 B;  4RNF A;  3WQP A;  3DM2 B;  3W60 A;  4C3L A;  1HNV A;  2OPS A;  1H2U X;  1TL7 A;  1CJK A;  4F2R A;  1SI9 A;  2ZH7 A;  1HNZ F;  3MFI A;  5IJQ A;  5D8H B;  2J7K A;  2NXE A;  5T7L A;  2DCU B;  4P72 A;  4KHP J;  3G8S A;  2BQU A;  1XR7 A;  1VRU A;  3HX9 A;  1U1O A;  1VQ9 S;  2MZ1 A;  1J2V A;  1VR6 A;  1ZH5 A;  3BSO A;  4QAX A;  4WTY A;  2LCW A;  1JJ4 A;  2PA8 D;  3C16 A;  5GVQ A;  3NL0 A;  2J0X A;  1GMU A;  1V5V A;  5LL6 d;  3S6E A;  1NK9 A;  4B3S J;  1VFJ A;  3MCN A;  2L9N A;  1U1Q A;  3U1L A;  3ULH A;  2AT1 B;  2EFQ A;  4PG4 A;  3J7A 1;  2F9J A;  1CJV A;  1TV6 B;  3M7V A;  1RTD A;  2B4V A;  1X5P A;  3MPV A;  2GA3 A;  3MMA B;  1OPZ A;  4JOU A;  4ZPB A;  2BJ7 A;  3OQ2 A;  1S6Q B;  5D3G B;  3G6Y A;  1EW8 A;  5ETS A;  1HWK A;  4FKX A;  3FEX B;  3B5Q A;  3MEC B;  3I4P A;  1IR0 A;  3T6B A;  2R7U A;  5EGH A;  3MHY A;  1VIS A;  2CPE A;  2BAN B;  1X4A A;  4LFA J;  4NWJ A;  3NKO A;  5LJ5 Y;  1HI8 A;  1QM9 A;  3L95 X;  1S49 A;  2MKS A;  1R6Y A;  3C8Y A;  1YJN S;  4C0O C;  4UST A;  5CYQ B;  3BGU A;  1FHT A;  3GQC A;  1I1G A;  1QVG R;  4J9R A;  3ZZT A;  2ZD1 A;  4HI1 A;  3M8S A;  5C5J A;  5F8I A;  5D0E A;  5A8W B;  3EMT A;  4K59 A;  2V68 A;  4J9U E;  4DR4 J;  1MU2 A;  4L72 B;  1URB A;  2BKO A;  2O01 C;  1Y5L B;  1BUX A;  3CDB A;  2WTF A;  1OY9 A;  4KM4 A;  4C3M A;  4GTZ A;  2V63 A;  3EX7 B;  4CO0 A;  3VQT A;  1X0F A;  2NYI A;  5KG5 A;  4RWX A;  4K5S A;  1HW9 A;  1TL4 A;  2LDY A;  3M1V A;  4PYA A;  3MD1 A;  3SZY A;  1UWB B;  5FII A;  5DM7 Q;  4DWI A;  3HFK A;  1Q8L A;  3I96 A;  2AGQ A;  2HNY A;  2XY6 A;  4YUD A;  1AJA A;  4N7T A;  1F5C A;  3BH7 B;  4ZVG A;  2FJW A;  1RT1 B;  4CLF A;  1HQE A;  2CQ3 A;  2VIH A;  4NLQ A;  1JJH A;  3CNQ P;  3CB4 A;  5B09 A;  1H2V Z;  1FK9 B;  2C3O A;  4XO0 A;  2NCK L;  1WI6 A;  5I3Q A;  4LR2 A;  2R2S A;  5HMX A;  3PAC A;  3QRR A;  4Y28 C;  4RPF A;  3T1Y J;  1N5Y A;  1TL1 B;  3H40 A;  2H5I B;  5DDP C;  4DZ6 A;  1FTR A;  3DI6 A;  2O66 A;  2XYP B;  2OKQ A;  4C8Z A;  5M2R A;  4ZHR B;  3QT7 A;  4F36 A;  2DPJ A;  1JMT A;  4QWB A;  1ZTW A;  4B02 A;  4KRW A;  2D41 A;  2YY3 A;  2Z57 B;  4OI3 A;  3ENW A;  1IBL J;  5ETN A;  1NU4 A;  2CDR B;  1PO6 A;  4OV6 A;  1TQL A;  1U8W A;  1JX4 A;  3TQ1 A;  3BYP A;  1E33 P;  1S0O A;  3H2U B;  2F1F A;  4KPC A;  3DRP A;  3O44 A;  4DLE A;  1W2I A;  1NK7 A;  3H42 A;  2VOO A;  3UCG A;  3PFO A;  2G13 A;  1EKS A;  2W01 A;  2RQK A;  5ETK A;  4EBD A;  4DR4 F;  2IDL A;  3CJT A;  4C8O A;  2JDJ A;  5DGB A;  4U67 Q;  3CJ5 A;  2DHA A;  2J5A A;  2VPW B;  1QSS A;  4CLY A;  1ROF A;  2MKI A;  4DL2 A;  3R5C A;  2W2P P;  4ZPV R;  2AJ4 A;  1WAC A;  3ILO A;  3A3O B;  4CH7 A;  5L1J A;  3OUY A;  4ZCI A;  3OSN A;  1H73 A;  2VU5 A;  2DNR A;  1U2C A;  2HK2 A;  1JLA A;  4LF8 J;  2CQ4 A;  1SV5 A;  1XMB A;  2HMI B;  3BYR A;  1P6T A;  2FHJ D;  3UDC A;  4LF7 J;  4CRJ A;  3D5M A;  1G3O A;  3HD1 A;  4ZVS B;  4OYW A;  3KJV B;  4B3T J;  4ED0 A;  4RBV A;  3TEG A;  4YFU A;  4LVN P;  1TV6 A;  1OPI A;  2WB4 A;  4WKR A;  3FNN A;  2DRA A;  5K20 B;  4ETZ A;  3NKN A;  2BBE A;  3TZY A;  4XK8 C;  5DG9 A;  2V67 A;  4DU7 A;  4OL8 A;  3GR1 A;  2V2Q A;  1UL3 A;  1NUE A;  4OJH A;  4CCH A;  1TL3 A;  5BJR A;  3TI0 A;  4OZL A;  5H9E J;  4WPA A;  3QFH A;  1GAO A;  1NZA A;  4OHZ A;  3NVL A;  4ED6 A;  4ZVE A;  3MR6 A;  3V6K A;  4TN0 A;  4FZV A;  4OYO A;  1L5U A;  3TX8 A;  1JLQ B;  1RT3 A;  3J7Z T;  1AT1 B;  3FSI A;  1HI1 A;  1MWZ A;  2UP1 A;  2QT7 A;  5A76 A;  4ES3 A;  2NXJ A;  1A0O B;  1RQ0 A;  4JI7 J;  4OYZ A;  3CCQ S;  5ETV A;  1U0H A;  2W2N P;  3GG0 A;  1XJW B;  3DRS A;  2ZIT A;  2N7C A;  3BO2 A;  3UN3 A;  2NUH A;  2DD8 S;  3O8W A;  4GKJ J;  3GZ7 A;  3PR5 B;  1C1B A;  4QIW D;  1TKD A;  2H5E A;  2W5S A;  4KFB B;  3RW6 A;  1N36 J;  2D3O R;  1WTF A;  4ZVU B;  5A8W A;  1XK8 A;  4W98 A;  2ATL A;  2C2Z B;  2FC8 A;  5CZX A;  4JI1 J;  1TKX A;  1D9D A;  3HVW A;  3JAM U;  3G2X A;  1ZS6 A;  2H51 B;  4QPT A;  4HT5 A;  1S5Z A;  4Z7C A;  4B3O B;  1F9F A;  1ELO A;  3C15 B;  3CD6 S;  1XNQ J;  2LXU A;  3E3X A;  2CPX A;  1UAW A;  2BJE A;  4LF7 F;  3TG0 A;  4LBP A;  1WD6 A;  4F7V A;  3LWL A;  3H7H B;  2MY8 A;  2XCA A;  4ZPD A;  2GVZ B;  2F8E X;  1MWQ A;  1EJJ A;  3RW7 A;  4H4K C;  2Z8Q A;  1LXJ A;  3RUB L;  3KNA A;  4DI6 A;  3UN5 A;  3B4M A;  7AT1 B;  1XQI A;  1HJK A;  4UOR A;  5KFN A;  4USV A;  4AFF A;  1XWL A;  3D4J A;  2XMT A;  2M8H A;  4J9P A;  1N0V C;  1X60 A;  4A8Q A;  4ECS A;  3PRV A;  1WHW A;  2ANH A;  1GFW B;  1KQG B;  1SIZ A;  4ZVQ B;  5L39 A;  2W7P A;  5EDW A;  3O1L A;  2IIH A;  1MN7 A;  4A8Y A;  2VBX A;  4PG7 A;  1G4C A;  1OO0 B;  3WAX A;  2NUU G;  4ZCL A;  2MQO A;  3OV7 A;  4JI0 J;  2YX7 A;  4A4J A;  4WE1 A;  1HWL A;  1T9V A;  4GVL A;  4O3P A;  3TAQ A;  4JI7 F;  2QFJ A;  1YJR A;  4KKO B;  2K06 A;  2I6W A;  4OYX A;  3WAW A;  4W92 B;  1RTJ B;  3CUL A;  1NDC A;  4GKJ F;  4PQU B;  3KG4 A;  3QRP A;  1WDT A;  4K50 A;  1N36 F;  1F6T A;  1VQ5 S;  3K5N A;  4RW8 A;  4PEO A;  5LQQ A;  4M5D A;  4JI1 F;  1WWH A;  3DLK A;  2W8K A;  1NPK A;  5GAG I;  1UPM B;  4MIA A;  1ZAW A;  2HFN A;  2DR5 A;  2FIU A;  2CA9 A;  2ZKU A;  1E1Z P;  5EGE A;  1AW0 A;  2IHR 1;  1B7F A;  4TY8 B;  3SFG A;  4IG3 B;  2MQP A;  1EQ0 A;  3VAK A;  5KFI A;  1XEZ A;  2GML A;  4P2X A;  3K58 A;  2FB0 A;  3O5T B;  1B4S A;  3R5B A;  2JC0 A;  3JSY A;  3I0R B;  1TMM A;  4USH A;  5K8N A;  5KOW A;  3OD2 A;  3HFZ B;  1FFW B;  1S1V A;  4QWC A;  2NS1 B;  4JYA F;  2KZZ A;  3PIP Q;  1WF0 A;  2H65 B;  4GTX A;  4QIF A;  2E9Z A;  1RA6 A;  2JRS A;  5LRM A;  4P2F A;  2W7O A;  3PYE A;  4J90 A;  4QW9 A;  4JV5 J;  1KBR A;  1QTN B;  5HP1 A;  3PY8 A;  3R2C J;  1EET A;  4WTO B;  1P1L A;  1NJI T;  3NNA A;  1LWE B;  1MRO B;  2OMO A;  1U25 A;  2Z30 B;  5I3P A;  2CIM A;  1IKY A;  2FGC A;  2YPZ A;  1SC6 A;  1U2R A;  1RHU B;  4TQR A;  4F2S A;  3K57 A;  1X7V A;  5LXR A;  3AA9 A;  1GX5 A;  2XZT B;  3QQC D;  1S1X A;  5KT3 A;  2W5R A;  2R42 A;  4A8M P;  1RA7 A;  2Y9H A;  2RVJ A;  3GIL A;  1NK5 A;  4B17 A;  1IBC B;  2XY5 A;  2YVS A;  2YWG A;  4WP3 A;  1T9T A;  2MSS A;  1WNE A;  1T3N A;  1AUD A;  1AUK A;  3GFZ A;  3NGT A;  4OLO A;  2DR8 A;  4ZKA A;  1SUQ B;  3N0V A;  2E1P A;  2HFZ A;  2QGF B;  2MY7 A;  2KJW A;  3M8R A;  4PRF A;  4RZR A;  3AXK A;  4M1K A;  4F50 A;  4GO5 X;  2XNR A;  3J80 U;  4ZVP B;  2MKJ A;  1WC6 A;  1YGY A;  2YH1 A;  1QAX A;  1Y3J A;  3RBE A;  4NEZ A;  1S6U A;  3W64 A;  2M7S A;  4AQY J;  1JLG A;  3ZZP A;  2WW4 A;  1WC1 A;  4ZPA A;  1JLE A;  1I6J A;  1VRT B;  3KJN B;  1T9Y A;  2KDO A;  3CJR A;  1KTQ A;  1UVI A;  2N4D A;  3G6X A;  2AX1 A;  4DR3 J;  2IPO B;  4OX6 A;  2L41 A;  4N56 A;  5D4O A;  3EPI A;  3MM7 A;  4BCA A;  5F3Z A;  5HJX A;  2K8G A;  2LEA A;  3BSA A;  3AY0 A;  3GFY A;  4NYP A;  2YWH A;  4KGX B;  1SL1 A;  4NLO A;  3NBP A;  4ECR A;  1ELY A;  5DDQ C;  2PFD A;  2HKE A;  4PG6 A;  3VTI A;  1S9F A;  2D3O 1;  3DLJ A;  4I6Y A;  2GIF A;  1ITP A;  4QWD A;  3MAA B;  1HNW F;  2CG4 A;  1UP1 A;  3CJ4 A;  4YR0 A;  4OYM A;  1PJ6 A;  2BE7 D;  1AJD A;  2PO4 A;  5GAE I;  1AFJ A;  4IO1 A;  1BHN A;  1FSU A;  1E6V A;  1RU2 A;  1EAY C;  1N5Q A;  4CO5 A;  4R5P A;  4UPK A;  4NLD A;  4ZIT A;  2VOD A;  4TVA B;  3M2U B;  4DF4 A;  2ZZN A;  1OY8 A;  5HQM A;  2QLW A;  2B7C B;  1SCJ B;  2BUN A;  5LMU J;  1S77 D;  3CC2 S;  2DIT A;  1FEH A;  1EX8 A;  4DCJ B;  2E5G A;  1TFW A;  1S0V A;  2HZA A;  1CJT A;  3KMS A;  1VLY A;  3DGV A;  3TVY A;  3A8E A;  1RTJ A;  2B5J A;  4UY8 5;  2YNH B;  3UD4 P;  2MZR A;  4E0D A;  2WOM B;  4NA1 A;  2W4P A;  1C0U B;  4A8O A;  1JXV A;  4WF9 Q;  1TP7 A;  3EPG A;  3POT A;  2YKN A;  1N56 A;  3ZZO A;  3A8K A;  4I2Q A;  4QR0 A;  1VQ8 S;  4OZ1 A;  3JSM A;  3R5G A;  3ZO7 A;  2ZJP Q;  3CD0 A;  3KK3 B;  5IC4 B;  3KYL A;  2YNI A;  2AEF A;  3H5X A;  3CMA S;  3OJS A;  3CCT A;  1Q7L B;  5F9L A;  1Y6V A;  3M2R A;  4IG3 A;  4Y2I A;  2A6O A;  2XCP A;  2LQ5 A;  4I64 A;  2VPY B;  4F04 B;  5LIA A;  2VDI A;  2NQP A;  2X7I A;  2XS2 A;  3KLE A;  2H4W B;  2GVD B;  3BZQ A;  3TEH B;  4NOH A;  1HFE L;  5AJ9 A;  4FXW A;  5T41 A;  2XLI A;  3DMJ B;  4PQA A;  2F4V F;  3IR7 B;  3TQE A;  2M52 A;  3TA0 A;  3D0H E;  2J7U A;  2R7V A;  4KAV A;  2BM1 A;  3R3T A;  8RUC A;  1ELX A;  2HVE A;  1A6L A;  3MXH P;  2NR0 A;  3KKF A;  2E1A A;  5LMN J;  1G1X A;  4E2F B;  3W62 A;  4ZN3 A;  2Q79 A;  4QR2 A;  3KJF B;  1ARO P;  5ITH A;  4I7F A;  4FP9 A;  3ENV A;  2EC0 A;  3HHE A;  3PW7 A;  3QSI A;  2YNF A;  1R7I A;  3BGR B;  5IV4 A;  3PW4 A;  5GOV A;  2VG7 B;  4F0H A;  2EPI A;  3EVW A;  4LSN A;  4DBQ A;  3NNC A;  1L3V A;  2IM2 A;  5KFG A;  1V3S A;  2B0G A;  5KG0 A;  1NME B;  2G0J A;  2YQ1 A;  3P8B B;  4NCB A;  4F67 A;  1MML A;  3SV3 A;  1DRZ A;  1AZS B;  2XEX A;  6FDR A;  2EXU A;  2RIJ A;  5KAK A;  2VG6 A;  3OR2 A;  3DU6 A;  2ZKT A;  3DLE B;  1GNK A;  3CCM S;  1K47 A;  2QLX A;  1T03 A;  2M2B A;  5AXM A;  3MR3 A;  3WX8 A;  1P27 B;  1WKJ A;  2MJU A;  3T3F A;  3OL8 A;  1Z4U A;  1S9E B;  4X4V A;  4HHJ A;  3CJ0 A;  5IS2 A;  4NXN J;  2ROE A;  4ERD A;  4OX9 J;  4USU A;  1FXR A;  2R7W A;  2EFP A;  1VQM S;  1RZM A;  5KFO A;  4DCP B;  3GTY X;  2ZC3 A;  3NWR A;  3MCS A;  1RAE B;  4IRD A;  1ZET A;  2W5V A;  2YWF A;  1PC4 A;  2ROP A;  2K1R B;  2AF6 A;  1RIS A;  3C14 B;  2A3J A;  2DH8 A;  2YKP A;  5KT5 A;  3MUT P;  1UMJ A;  2NPI A;  4XAK A;  3D66 A;  3HK2 A;  1HBU A;  2ZH6 A;  2JH3 A;  2N3L A;  3OHA A;  4ZP7 A;  2OEJ A;  4Y6I A;  3H90 A;  1REV B;  2AYG A;  5J1E B;  3C2P A;  2CQH A;  3NMR A;  3B4D A;  4DSJ A;  5F9N A;  3MMB A;  2BQR A;  1CC8 A;  3DOK A;  3JB9 k;  3BV8 A;  2EEY A;  1RTH B;  1F9H A;  3NKR A;  2GGP B;  4NLY A;  5CH7 B;  1E6Y B;  1Q8B A;  4MH8 A;  3EYZ A;  1RKI A;  5EWE A;  3RB3 A;  1M5P C;  2V8H A;  1YQH A;  4X62 F;  4NCA A;  2P6S A;  3K5O A;  2JVO A;  3I5A A;  3G86 A;  2HLU A;  4ATN A;  2BV3 A;  1ELZ A;  3TNV A;  2WZ1 A;  3H20 A;  2VDH A;  1QE1 A;  4I2P B;  1SJQ A;  4LFC J;  3TUJ C;  1RT2 A;  2GV1 A;  4KO0 B;  2R7O A;  2G2O A;  2QA4 G;  2NXC A;  2X1G A;  2V9W A;  5K9F A;  2XM3 A;  4DV5 F;  3LW5 C;  2IMW P;  4F8R A;  1IM6 A;  1YBU A;  4IG0 B;  3H98 A;  3MR5 A;  4L6V 3;  3V6H A;  4NXN F;  5HAO A;  3JXO A;  1T95 A;  4OX9 F;  3FRZ A;  2ZHA A;  3HVA A;  1BE4 A;  4Z7Y A;  4PPD A;  5BR8 J;  4DPO A;  3OT9 A;  1FFG B;  2IYI A;  4I6W A;  2MST A;  1N6Q B;  1WF1 A;  5DS7 A;  3Q8V A;  2KT5 A;  4XPC A;  3WZ0 A;  2HEK A;  2N4C A;  1K0T A;  3C6T B;  4DF8 A;  5KFU A;  2XMW A;  3FCH A;  4KPY A;  3KLH B;  3CDA A;  1H98 A;  3GCX P;  3TVK A;  1IUJ A;  4FF3 A;  1X4H A;  2D9P A;  3WHI A;  5F8L A;  4CT9 A;  1ED8 A;  2H54 B;  4FBT A;  2V4J B;  4UZB A;  2QMX A;  3TAM B;  1B7Y B;  5E3A A;  2LXI A;  5GAG U;  4A8W A;  3CJ8 A;  1R8P A;  3A4T A;  2OO4 A;  3CCV S;  2IUC B;  4KY3 A;  2Q1L A;  4AXI A;  2XB2 D;  3R1L A;  4QW8 A;  1QAJ A;  3PXG a;  4CXK A;  4RW4 A;  3BPD A;  4EMD A;  1ZM2 A;  2EI5 A;  3RB6 A;  3DPC A;  2KJV A;  5L1L A;  1FCA A;  3BBC A;  2KRR A;  2E1C A;  2R7R A;  1HW8 A;  5C24 A;  2XUL A;  4X4Q A;  2AWZ A;  3ET6 A;  3CT9 A;  4DR5 J;  3NS5 A;  3AT1 B;  2VPX B;  3GLJ A;  3ZTQ A;  2RRA A;  5A2Q U;  4EYI B;  2BZ2 A;  4WZQ A;  2XI3 A;  3IS9 A;  1JLC A;  3P5T L;  2BE9 B;  5J2P B;  2VQE J;  4RNH A;  3I6P A;  1H2T Z;  2IC3 B;  1UEK A;  1S4E A;  2EG1 A;  5DZ6 A;  3M9N B;  2VHG A;  3DOM B;  4WFA Q;  2MQM A;  5KFE A;  4V19 X;  2FZG B;  1RDR A;  4CTA A;  2LKZ A;  3W2W A;  4USW A;  5L8R C;  4ZLP A;  2C2M B;  3OXF A;  4NMX A;  1UFK A;  4DUY J;  2HHT A;  1HMV A;  1BMQ B;  1RU1 A;  5IQQ A;  3MK0 A;  4O23 A;  3HHN B;  1YHQ S;  3G87 A;  1NEE A;  3PW2 A;  1WG4 A;  4L73 A;  4J9Q A;  2M8D B;  1RT6 B;  2DHG A;  2AJ2 A;  2DIS A;  2GJI A;  3VGV A;  3MZI A;  2Y0S D;  3CCJ S;  4KV8 B;  4QIG A;  1X31 C;  2G9O A;  7FD1 A;  1KRP A;  2COL A;  3S7R A;  4L3N A;  1FDB A;  3RAM A;  1CS4 B;  4Y2M A;  4YHH F;  2LQJ A;  4W4M A;  2Q6B A;  1P9Y A;  4RJV A;  3W5Y A;  1K44 A;  2HQD A;  5C2G A;  1SL0 A;  4Q8F A;  4RO0 A;  5EHH A;  5HVG A;  2K3K A;  3OFG A;  2AX0 A;  1FJG J;  2Z56 B;  1YLX A;  4C0B A;  3ONQ A;  2RNE A;  3FBE A;  2E1M C;  2HQF A;  4DPW A;  1ALK A;  5J1E A;  4UPH A;  1VLO A;  3SQG A;  2B9W A;  5INH A;  1RAI B;  3FJ2 A;  2ZM6 J;  2YWW A;  1IR2 A;  1O6X A;  4YR2 A;  1U1M A;  2FZC B;  3B54 A;  1YKW A;  4LFB J;  2DGQ A;  3B78 A;  5JUM A;  4GVB B;  1XR6 A;  2QLJ B;  1T0T V;  2FLP A;  5K14 B;  2C42 A;  4DR5 F;  3QBC A;  2DCL A;  2PSZ A;  2HZC A;  5LXY A;  2DGS A;  4EK2 A;  3AH6 A;  4DR1 J;  3K2Y A;  1SQF A;  1BGX T;  1RHM B;  3M8Y A;  2DHX A;  3TJ9 A;  2VQE F;  1HBM B;  3AOD A;  1OMS A;  3GU0 A;  3D6T B;  3DGP B;  3EVM A;  3MOZ A;  1C1C A;  1V9O A;  3AOC A;  3J7Y I;  1NSA A;  2POK A;  2ZNY A;  3VGT A;  3HCX A;  1RI7 A;  8AT1 B;  1UFW A;  2OTL S;  4ECV A;  1R8B A;  1UW9 A;  2XMM A;  3D67 A;  2C28 A;  1T94 A;  3C6U A;  4DPU A;  2IYG A;  2E5H A;  3U1M A;  4OI4 A;  4UTG A;  1RWN B;  2ZZT A;  1UKU A;  3FFI B;  2GO8 A;  4DUZ J;  2BJ8 A;  2N3O A;  1J5E F;  1IQZ A;  1IKW A;  1I94 F;  1RTZ A;  4NZ7 A;  4RNM A;  2HLT A;  2KT3 A;  1GMV A;  3H5Y A;  3HVR A;  2ASD A;  1B0T A;  3UO0 A;  3U27 A;  1TVR A;  4OX8 A;  4LF9 F;  2Z2M A;  1SH3 A;  3CVK A;  4TU9 A;  1RP5 A;  4LIR A;  4TLQ A;  3LA0 A;  3P5B P;  2RKI A;  5THW A;  1DLO A;  1Q95 G;  3OW2 R;  2F8H A;  4I56 A;  1RSC A;  1W2B R;  3IRX B;  4IYQ A;  4OI6 A;  3TRG A;  4EBC A;  1PYS B;  5HN0 A;  4NWB A;  4Y3C A;  2ZHB A;  2AGO A;  1WHY A;  2HBY B;  3QLH B;  2QSF A;  3KLG A;  2Z2L A;  2CQB A;  3EDR B;  2WVD A;  2YH0 A;  5EWG A;  2ZM6 F;  3PFE A;  3H25 A;  1DTT B;  1ZEF A;  3NCQ A;  2AZ3 A;  1EAR A;  4WXO A;  4LFB F;  2IAJ B;  3C3L A;  1TFY A;  4ZLL A;  3RAX A;  4MK9 A;  4P73 A;  3MPU B;  1VBX A;  4PYD A;  2HNZ B;  1KOO A;  4DR1 F;  3I4H X;  2CQC A;  2YTC A;  4B9U A;  3PW0 A;  4DQS A;  3QGH A;  3IGY B;  3SXL A;  1QJH A;  3T1H F;  1FD8 A;  2JLE A;  4XPE A;  3UDE A;  1RWO B;  3ADA C;  2IM1 A;  2MYF A;  4DR6 F;  2MQL A;  2MLX A;  2HHV A;  4O4G A;  1FNM A;  5HMW A;  4K4U A;  4OHW A;  2HVZ A;  4JI8 J;  2IBO A;  4DV3 J;  1S1W A;  2IC3 A;  1NJY A;  4NI2 A;  2WVF A;  3TO8 A;  1YJ9 S;  2X1A A;  1LNQ A;  1S1T B;  3HDS A;  4EI2 A;  3PR4 A;  2DNK A;  3CJQ A;  1U1P A;  4NZ6 A;  4C8Y A;  4UPL A;  3CD5 A;  2QIF A;  3N5F A;  4TY9 A;  1J5O B;  1YJW S;  3LUY A;  4AUK A;  2HIY A;  2KM8 B;  1PSD A;  3TAN A;  1KN6 A;  4G6V B;  2FHM A;  2W9C B;  3ZZ0 A;  2WSF C;  4NLW A;  4BWJ A;  3D3C J;  4NE9 C;  4A8F A;  1NRK A;  3MM6 A;  4CO2 A;  3AQO A;  5KFB A;  1WOO A;  4CZC A;  3JSB A;  4H54 A;  2FJD B;  4Q0B B;  2HQ3 A;  2RF2 B;  2R2U A;  1KVK A;  3B8H A;  2BQ3 A;  4ZJQ A;  3G4S S;  2R9L A;  4ZVF A;  2RE1 A;  3FKB A;  1WOP A;  4DUT A;  4DV2 F;  1HAR A;  5IM0 B;  1BQN A;  1BQM B;  1FI4 A;  1FJ7 A;  2NXN A;  4RX6 A;  3BDG B;  2EC2 A;  3TUI C;  3VAH A;  3GYN A;  4FKY A;  3FCW A;  4UQG A;  1LFW A;  3LQV A;  3AA8 A;  2AP6 A;  4NLG A;  5KFR A;  2UU9 F;  2MLY A;  3UQS A;  2BR0 A;  3G82 A;  3NXZ A;  3ZTO A;  4C8M A;  1FD2 A;  3D9B A;  4Z37 A;  4MAK A;  3M8Q B;  4E8U A;  4QJV A;  4RW6 B;  1NDL A;  4P6Q A;  1SHN A;  5IZH A;  4B9M A;  1WEL A;  5H9F J;  3I0S B;  2YKO A;  4MKB A;  3QZ7 A;  3NNH A;  4U95 A;  5KFF A;  3BBF A;  4ER8 A;  5F41 A;  1BY9 A;  3TJA A;  1HQA A;  5DQI A;  2YQ3 A;  2FLO A;  1CQM A;  1F5B A;  3MCO A;  2IVY A;  5KG4 A;  3OR1 A;  4ILR A;  4L75 A;  3UDV A;  1ZAX A;  2LMI A;  5C25 B;  2A0F B;  2GZO A;  3NEK A;  1BWV A;  2KXN B;  4C11 A;  2P8I A;  2NZC A;  2OFG X;  2ZDO A;  3ENQ A;  3AD8 C;  1TK8 A;  1Y11 A;  4X4P A;  4WK3 A;  2EK6 A;  3IP0 A;  2ZH5 A;  5JXS A;  3KD8 A;  3BS9 A;  2Y0B B;  2MHE A;  3UN2 A;  3J81 j;  3VGS A;  3IGV A;  1F60 B;  4Y00 A;  1KDN A;  4EGL A;  4PG5 A;  1RT4 A;  2CKW A;  4N77 A;  1X9S A;  2QV6 A;  3F73 A;  4YB5 A;  2CQ2 A;  4FNI A;  5EN1 A;  3ZZY A;  3V4I B;  4DG1 B;  1HNX J;  2W9B A;  3IBW A;  4LF4 J;  1ALH A;  3LTO A;  1LW0 B;  1HR0 J;  3QPI A;  1K0V A;  3L7P A;  3TYT A;  1TKT B;  3MK2 A;  3VQS A;  5HBM B;  2VOP A;  1WHX A;  1ZM3 A;  3BRE A;  4DFM A;  2ZE2 B;  3W2V B;  3KLV A;  1FKP B;  3QSY B;  1XC9 A;  3JYT B;  2YWK A;  5LSO A;  3TAR A;  3N6L A;  4B9T A;  4J9N A;  1DY3 A;  4G1Q A;  1IJF B;  1PJ5 A;  2BRK A;  5KFW A;  2DK2 A;  1VQN S;  3K59 A;  5KG2 A;  3J81 U;  2HSE B;  5L1K A;  4Q7A A;  2ACM A;  4JI2 J;  1ZAV A;  3EZU A;  1DAR A;  4CT8 A;  3VZH A;  3KHH A;  3MDF A;  5KFS A;  4ID5 B;  3EZO A;  2RJZ A;  1S1U A;  1FF2 A;  5J2M B;  3SSR A;  2HUR A;  2RSQ A;  2W1B A;  4RUA A;  2EG2 A;  4F25 A;  2PN6 A;  5F8H A;  2DB1 A;  4DN9 A;  3MM5 A;  3KLF B;  3W66 A;  4YQW A;  1NPP A;  2JZ5 A;  1KVJ A;  4DV4 J;  4DL7 A;  1R0C B;  2PEB A;  2RQC A;  1XNR J;  3QIP A;  1UJ4 A;  2AZ1 A;  3TJ8 A;  1TKZ B;  4X66 F;  4DSF A;  2GAH C;  2LA4 A;  5ADZ A;  1KHN A;  3VCD A;  1IKX B;  2GMH A;  5A8R A;  4FF4 A;  3LP1 A;  3QO9 A;  4B56 A;  4GKK F;  4GC6 A;  4Z2X A;  2LA6 A;  1IBM J;  2OLW A;  1PBU A;  4NL5 A;  1UVK A;  2W4D A;  2CZ9 A;  4CLK A;  4I0W A;  3V81 B;  3ED4 A;  3SV4 A;  4MYU A;  3ITH B;  2GIQ A;  1NHK L;  5AJ3 F;  4H4M B;  3A8I A;  4ZIW A;  1FT8 A;  2CPD A;  2K3I A;  4V19 J;  1U0S A;  1CUL A;  4LBI A;  3PJ9 A;  3VV2 B;  2HVI A;  2HND A;  3ZXW A;  4OYB A;  4CLT A;  4OZ0 A;  5FJ4 A;  2JFK A;  2W5X A;  2F8M A;  1LWC B;  5GME A;  4IOC Q;  1R27 B;  4F02 A;  4ZS6 A;  1RT5 B;  3S8S A;  1KQK A;  5HRO B;  4Q5V A;  4M5K A;  1JXE A;  4IKA A;  3DC2 A;  1UCN A;  2B56 A;  1Z2Z A;  3PHE A;  4DQR A;  3HD2 A;  1KWM A;  4KC5 A;  4JI2 F;  2EW9 A;  5KFM A;  4N47 A;  3L7O A;  1X5O A;  3DLG B;  1JB0 C;  1C0T A;  2OPQ A;  3W63 A;  4Q2M A;  2MGZ A;  1Q1K A;  3EIC A;  4A8S A;  2AJQ A;  3QRQ A;  1KLM A;  4ZJO A;  2V4Q A;  4BC9 A;  1RT7 B;  1HBO B;  2U2F A;  3DRR B;  4BDP A;  1G6B A;  2LQB A;  4UOH A;  3CPW R;  2HHU A;  4CIO A;  2HWI A;  4RU9 A;  4G1I A;  3RR7 A;  4QZV B;  1NJW A;  3MEG A;  2RT3 A;  3IR6 B;  4WP9 A;  3S01 A;  2AEJ A;  3CD7 A;  2D3U A;  4CXU A;  4PXB A;  2GS8 A;  3HFV A;  2UUA J;  4I6A A;  4U96 A;  5KFY A;  5F8G A;  3SSS A;  3SIP B;  2CNK B;  4USM A;  3G6E S;  1IBM F;  5KFT A;  3ISZ A;  3ZTP A;  4YR3 A;  3MEE B;  2KYZ A;  2BX6 A;  3HZE A;  4P7T A;  1ED9 A;  2ZUG A;  3E8O A;  1TUW A;  3J7Y U;  5AE3 A;  2KHC A;  2C3U A;  4M5H A;  4DPY A;  1U6Z A;  1RBA A;  3HHL D;  1HYS B;  3Q22 A;  2VFR A;  1K1Q A;  2AHO B;  2V5H G;  5KTQ A;  3EXY A;  4CYU A;  3CDU A;  4MFB A;  4PXD A;  3KK1 A;  1F1B B;  3R5A A;  4WYL A;  2OPP B;  2DGU A;  1T9X A;  4LSZ B;  1YI2 S;  2BYC A;  4I1T A;  1URA A;  4Y34 A;  4XDD A;  2UXB J;  3PO5 A;  3PHT A;  5DQH A;  3TX0 A;  2CPY A;  2I5J B;  1HNI B;  2BJ3 A;  2HS0 A;  1KR4 A;  1R8H A;  4PR6 A;  2YKM B;  2CWK A;  2I0X A;  3PG9 A;  2DO0 A;  3BDF A;  3Q2S C;  5SUH A;  4C4W A;  1T05 B;  1N32 J;  1U1L A;  5DGA A;  2OSR A;  3IWN C;  3N5B A;  2K7K A;  1BQX A;  2GJ2 A;  3V6D B;  2B3T B;  2VQF F;  4R8U B;  5A6P A;  4KH1 B;  1NJZ A;  2CQ1 A;  1XBW A;  3EGV A;  3CE8 A;  2QTW A;  3HP6 A;  2RS2 A;  2KYX A;  3T5J A;  3QID A;  2W8L A;  4OZN A;  2A2D A;  3SDE B;  3MGJ A;  2CUY A;  5EX0 A;  1WSV A;  1O51 A;  2RDJ A;  3SI8 A;  3B82 A;  3NLC A;  1V5I B;  2UUA F;  2JSX A;  3MM8 A;  4OFZ A;  4LUB A;  4OJ3 A;  5GAD I;  2EWH A;  1S4F A;  2GW8 A;  1VC6 A;  1PAU B;  1D8Y A;  4O3N A;  4LR7 A;  1R0A B;  3OFH A;  3H2V E;  2C2R A;  2VKR A;  1SJ4 P;  3TP2 A;  3AOA A;  1GMW A;  3AXM A;  3AOB A;  5CYM B;  3KDO A;  1EW2 A;  3IRW P;  1FX2 A;  3V81 A;  4RW7 B;  4DFK A;  2W8S A;  3D1O A;  4N8O A;  3Q2T C;  4F4A A;  1QLN A;  1YIT S;  1UZD A;  2FJX A;  2JEF A;  2UVR A;  5LOQ A;  3R1H A;  3G71 S;  5KT4 A;  1MN9 A;  2UXB F;  2HAF A;  3PVX A;  1RAH B;  4RUH A;  3OVB A;  3T19 A;  4S0M A;  3D1H A;  1LK5 A;  5HRO A;  1X5S A;  3GIM A;  1S9G A;  2BE2 B;  1KTV A;  3IO1 A;  3M2V B;  2HQC A;  2H4Y B;  1W25 A;  2JFD A;  2V9K A;  1ZZF A;  3OFF A;  1WC3 A;  2HW3 A;  4O0N A;  2R8J A;  5C42 A;  2J6T A;  1KFD A;  2GNK A;  1HPZ A;  1OQ3 A;  2MB0 B;  3D6H B;  3Q8P B;  1KLN A;  3DNC A;  3I5C A;  3W61 A;  3UNY A;  2VD3 A;  4AXJ A;  2YBV A;  4M63 A;  3DOL A;  4DQI A;  2RDD A;  3HVT B;  4CLP A;  1Y5I B;  2I9S A;  3R7N B;  2AMC B;  1HBO A;  3NGR A;  2FJV A;  1DQA A;  4FXV A;  2QO3 A;  2YKQ A;  2VFU A;  2CNN B;  2MTL A;  2AIR B;  4X84 A;  3W5Z A;  4DR7 J;  1U6F A;  3U7J A;  2DHH A;  4JP8 A;  1X9M A;  1RWK B;  1U45 A;  2XO7 A;  3IM8 A;  2CVE A;  2D1C A;  3M30 B;  4ED7 A;  3OJU A;  1HKA A;  3IR5 B;  5HQL A;  2A1B A;  4GTW A;  3D1Q A;  1D1U A;  1S0M A;  3WAY A;  2XSJ A;  3GG1 A;  3KMQ A;  2ZBP A;  2AYM A;  4CI0 B;  1U1R A;  1X0P A;  1NK6 A;  2KVQ E;  1F3F A;  3KLI A;  3NMA A;  1CPZ A;  2N7Y A;  3US5 A;  4LF6 J;  1PGZ A;  5EWF A;  2GIR A;  3P96 A;  3MED B;  4KGZ B;  2J76 E;  4K2J A;  4P71 A;  1NZ8 A;  5FLX Y;  5HO4 A;  4B3R J;  2CJ9 A;  2CZ4 A;  3CJS A;  1RWM B;  2N82 B;  4RU2 A;  1OSD A;  1JNR B;  1RHK B;  3OTO J;  1EB0 A;  5IQ6 A;  4EZ9 A;  3G6V A;  4O4R A;  1VQ6 S;  1N54 B;  1VHF A;  4EWT A;  5ETQ A;  3LP2 B;  3IGZ B;  3K5M A;  4TNO A;  4V1A k;  2OML A;  1RAO A;  3MPY A;  1GTE A;  2NSB A;  2CPJ A;  5D15 A;  3ZNJ 1;  4CP5 A;  1PC5 A;  4FYV B;  3M32 A;  4NLU A;  1KNZ A;  2CZV C;  1S0N A;  4RW9 A;  2DNN A;  2DXE A;  3THT A;  3VAI A;  4F0K A;  5DLV A;  1LOU A;  5GAH I;  5ETT A;  3UVJ A;  2KVI A;  2LEC A;  2DO4 A;  1HL6 A;  3D3B J;  1QAY A;  2R8H A;  1ZEB A;  2M5Y A;  2YKM A;  1PYO B;  4KHP F;  4Q8E A;  4B9V A;  3E01 A;  1N5T A;  5J2Q A;  3MMC B;  1WOR A;  1PG5 B;  4PWW A;  4C9D A;  2GSN A;  4IFY A;  2CJX B;  2CPF A;  3KK2 A;  3V6D A;  2F4F A;  2AW0 A;  1JWW A;  2DGX A;  1RHJ B;  3EZ5 A;  4O44 B;  3I82 A;  4M5G A;  1HQ2 A;  4KAI A;  4B3S F;  2LLZ A;  3QAT A;  4KJG A;  3CCL S;  2ZH9 A;  1N5S A;  4KHM A;  4OHX A;  4ICL B;  1JLF A;  1SKR A;  2M88 A;  2GC8 A;  3D54 A;  3ZZZ A;  2GQQ A;  2ALY B;  4MMO A;  1KH4 A;  3SSQ A;  4RUB A;  2E7W A;  5I42 A;  2VBY A;  2UV8 G;  4ZVR B;  2DNM A;  4K0K J;  1U1K A;  2LVW A;  1LV5 A;  1LWF B;  1RTI A;  3LF0 A;  2FQQ B;  2DIU A;  3AQP A;  1RCO B;  1JLB A;  5F0W A;  4USI A;  1NLK L;  2ZH4 A;  4CDI A;  1SBR A;  1XMQ J;  5L46 A;  4DSI A;  5K8O A;  1ZZN A;  3MMJ A;  4EU0 A;  3JAM Y;  4UOO A;  2KM8 C;  4MKV A;  4LFA F;  2Q66 A;  2V50 A;  2JWN A;  2ZNZ A;  1SC1 B;  3ILJ A;  1VYA A;  3UR0 A;  2DNG A;  3PNI A;  3Q86 A;  3UR3 C;  4O3O A;  1VJW A;  1NXI A;  3Q3Q A;  2V2V A;  5A8K A;  3K0J A;  4PWD B;  1AJC A;  1R43 A;  4H4O B;  2B6A B;  3MUV P;  2D1G A;  2Y8Y A;  1RWP B;  3RBZ A;  3TZW A;  5D0R A;  3PW5 A;  4G65 A;  3SCK E;  2XY7 A;  3DM2 A;  4YN3 B;  3MCM A;  2EFG A;  3PM9 A;  4O3Q A;  4DN0 A;  4NLP A;  1WG5 A;  4G3I A;  4GTY A;  2GHP A;  1VBK A;  1YRX A;  1HI0 P;  3KOA A;  2GA7 A;  4PUO B;  4ZG6 A;  3H4B A;  5FLX U;  4MJK A;  1KD1 T;  4ED8 A;  4QQB A;  4IOA Q;  1SH2 A;  2CRL A;  4DMZ A;  1QSY A;  1U09 A;  4C0H A;  3T00 A;  3IFE A;  5EX3 A;  3EDQ B;  4LT6 A;  4X64 J;  2BVZ A;  3SZ2 A;  5HQ8 A;  1ZM9 A;  2F63 A;  2WON B;  2XR9 A;  3GCW P;  3UD3 P;  4J91 A;  1FRI A;  2KO1 A;  1TK5 A;  3HSD A;  5JVG Q;  2P6T A;  3HHD A;  5E7O B;  3OPK A;  2OPR B;  3AAW B;  3KHL A;  5AT1 B;  4BHQ A;  2IA6 A;  1ZPW X;  1VQL S;  4K4W A;  4EZ6 A;  2ADB A;  2DNZ A;  2HVD A;  5KXA A;  4KJD A;  3J7A N;  5JVH Q;  4JI6 J;  5LSL A;  3BN4 A;  1H7X A;  3MMA A;  3BGL A;  1JKH B;  1S6Q A;  1XIQ A;  3JQK A;  3T1A A;  3T1Y F;  4UUX A;  3MED A;  5D3G A;  3Q23 A;  2R7T A;  2FVR A;  4FYY B;  2FUG 9;  2P5V A;  3IM9 A;  1V3Z A;  3PX6 A;  3BO3 A;  4ZG7 A;  3DYA B;  5B0C A;  2PI5 A;  3O6Q A;  1WUU A;  3MEC A;  6AT1 B;  1HWJ A;  3QT6 A;  4MHX A;  4ECT A;  2XLK A;  2KKH A;  4NLX A;  5IOL A;  1M5S A;  4IRK A;  3BSC A;  4NZ0 A;  3HLU A;  1PBA A;  2BAN A;  2EBG A;  4ZK7 M;  3CCS S;  1IBL F;  4EO8 A;  2VIC A;  4O3S A;  3V2U C;  2JEJ A;  2WBR A;  1DBD A;  4YP3 A;  3LPE A;  2RDI A;  3D68 A;  3QNW B;  5J2N B;  5KFC A;  2PMZ D;  5CYQ A;  2KT2 A;  1WHV A;  2ZFH A;  4K5R A;  5RUB A;  2A10 A;  5K8M A;  1FKA F;  3EM1 A;  3PYD A;  1IVZ A;  5DLF A;  3CDE A;  2W5Q A;  5A0Y B;  2HAI A;  1AXQ A;  2NLW A;  1FO1 A;  2ZH1 A;  3MD3 A;  4J37 A;  2CWX A;  3GV5 B;  1MNE A;  1HDH A;  2G2Y A;  1YZ6 A;  4YOE A;  4ZP9 A;  1TR0 A;  2AJ1 A;  4C2M A;  3PCO B;  1Q7Y T;  3T5K A;  2SXL A;  1DTQ B;  3VVT A;  3BKT A;  4DV6 J;  1Q8K A;  3N28 A;  5CCL A;  4FDJ A;  4DV0 J;  5E3C A;  5E5N A;  2OD4 A;  3I55 S;  2QLF B;  4RR5 A;  3N6M A;  1UWB A;  2JEG A;  2W5W A;  4CO3 A;  5HLF B;  1U4B A;  4LF8 F;  3A8J A;  3A12 A;  2O3D A;  5E3Q A;  2VB6 A;  1HWI A;  5L0K A;  2L3M A;  3PTW A;  2QLB B;  2APO A;  4CH1 A;  4EO6 A;  3FRY A;  4B3T F;  4ZLN A;  1R8C A;  1FX4 A;  3N79 A;  1RT1 A;  5LT5 A;  2Y8W A;  9RUB A;  4CNY A;  3T5L A;  2UUW A;  4CLZ A;  3ZTS A;  4GMK A;  1N2K A;  4JI6 F;  3CJK B;  4ZCK A;  1RAJ A;  2AYE A;  1V3R A;  1FER A;  2QA4 S;  1FK9 A;  3A13 A;  3PEH A;  4DJB A;  1NSQ A;  4NCG B;  4CLU A;  2HZV A;  4JV1 A;  2V69 A;  4HR2 A;  1HQU B;  4JI3 J;  2X51 A;  5L0B A;  4A48 A;  2UUC J;  4MY4 A;  3J80 Y;  1X4C A;  5DJB A;  1KSP A;  4IH7 A;  1LW2 B;  1MSW D;  1TL1 A;  3Q8Y A;  4HAC B;  2D74 B;  5E41 A;  3HT0 A;  1KH7 A;  2IJF A;  2ZH2 A;  2BM0 A;  2GQ2 A;  2KXH A;  3R6G B;  3HJV A;  1HHS A;  2QC3 A;  2QZ8 A;  2HVH A;  4ZHR A;  3CJ3 A;  4UY8 T;  2FHO B;  5GAD U;  3N01 A;  2MQN A;  3M9O B;  1GXU A;  3CXC R;  2DXF A;  3HSG A;  3RTV A;  3WIU A;  2XC9 A;  2HPU A;  3MFH A;  1XTZ A;  3HHL B;  1CC7 A;  3EXC X;  1LK7 A;  2CPZ A;  2HFS A;  2CXE A;  4LJM A;  1UW4 A;  2LEB A;  2RQM A;  3AB4 B;  2VAS A;  2F5G A;  3NGK A;  3PKM A;  3EWG A;  1OY6 A;  4DV6 F;  1HNV B;  2OPS B;  1RAD B;  3U1N A;  3PIO Q;  4ALZ A;  1TL7 B;  4DX8 H;  1CJK B;  2PII A;  2J0Q D;  2E66 A;  4ELU A;  2P2C B;  5T7L B;  1FRL A;  4FNH A;  4QIE A;  1VRU B;  3RBX A;  3H0P A;  4HDG A;  1XNQ F;  1Y10 A;  3GR0 A;  4IFV B;  5KOX A;  3LH2 S;  1MLA A;  4P74 A;  4IRC A;  5KFX A;  4R0J A;  4HKQ A;  4B9S A;  3C16 B;  2ASL A;  3T6J A;  2HMI A;  4QU7 A;  3PJX A;  1YRT A;  4P2M A;  3GV7 B;  2R2T A;  3KJV A;  2XHW A;  1RYS A;  1UVN A;  4OYP A;  2J0W A;  3HM9 A;  3QZ8 A;  2XTJ P;  1CJV B;  2FVS A;  4WU3 A;  5D78 A;  1RTD B;  2F7V A;  2UUC F;  1IR1 A;  2PMH A;  5LM7 E;  3MTK A;  2JLG A;  5D4P A;  4NYZ A;  3FZB A;  1L3U A;  3JQM A;  4UPI A;  1F9E B;  4DX7 A;  3LWM A;  3T9N A;  1RK8 A;  3IBC B;  4MIB A;  4JI0 F;  2AJ0 A;  3ETM A;  2MZQ A;  2XNQ A;  3HF5 A;  4MT1 A;  1JLQ A;  1LEO A;  3QAE A;  5IV3 A;  5DRK A;  2ZJQ Q;  3TOQ A;  4CYR A;  3GON A;  1X4D A;  4LF5 J;  2IJN A;  5F0U A;  2PGC A;  4KE5 A;  1FA0 A;  3IDD A;  2GSU A;  1KVI A;  5MLC V;  4LIW A;  5A0Y A;  3F0N A;  4JV2 A;  3FDS A;  4YR1 A;  2ZD1 B;  2M3D A;  3H8Y A;  4KFB A;  1FES A;  4ENO A;  2V2K A;  1KH9 A;  4HI2 A;  1YIJ S;  3BEG B;  2G9Y A;  2FHK A;  5KFD A;  1URN A;  3MI7 X;  3KG1 A;  3GB0 A;  3QJP A;  4K4T A;  3H59 A;  2GSO A;  3FUY A;  3DLB A;  1P8G A;  2M9K A;  2EK1 A;  1DQ8 A;  3DHX A;  1HHT P;  4WYW A;  4YY3 J;  4B3O A;  1DHM A;  1IWA A;  3DXS X;  3M1V B;  3NRB A;  3C15 A;  5KFH A;  1WC5 A;  5GAH U;  4ECY A;  4OX7 A;  4KAY A;  4J7C A;  1K9M T;  2ADC A;  3VF0 B;  1I5O B;  2BW2 A;  3NS7 B;  2HNY B;  5KFP A;  1URR A;  2GVZ A;  1D09 B;  4NXM J;  2MKH A;  4D3G A;  2GJF A;  4JV5 F;  2V94 A;  2OSQ A;  3W7B A;  3EJM A;  1HQE B;  1Q8I A;  2LQ9 A;  4LRC A;  4JBC A;  2HFO A;  4PPZ A;  1TAU A;  3HJF A;  4LQ9 A;  4WU2 A;  3L3C A;  4DV7 J;  5HK4 A;  4ECW A;  2U1A A;  3GJS B;  2XMA A;  4AL6 A;  4C97 A;  3KUE A;  4O3R A;  2ZBQ A;  2LXF A;  3M8W A;  3OL9 A;  4K4V A;  4QCL A;  3DI6 B;  2ZBR A;  4DOZ A;  3IGN A;  5E2Q A;  4L74 A;  3CSK A;  2X1B A;  2RHS B;  3ISN D;  1FE4 A;  2XMV A;  3OBI A;  3TUZ C;  4TU8 A;  4KKO A;  1T9U A;  1LXN A;  2J8S A;  4EUV A;  1O8B A;  5CQG A;  4OJG A;  3UNG C;  4PQU A;  1Y4Z B;  5DZ7 A;  2WRM A;  1S59 A;  1FJC A;  3KUH A;  2KG1 A;  2Y1R I;  3OFE A;  5ETL A;  3DRP B;  2H1Y A;  5D0H A;  4ED4 A;  2ZDP A;  5CZV A;  1FRJ A;  1V6H A;  1ICE B;  1T3O A;  2W7A A;  1U6B A;  3NOG A;  1XMO J;  4ZLJ A;  3PO4 A;  5HAT A;  4AQY F;  1DZ5 A;  3IG1 B;  1TTH B;  2DPI A;  4ANC A;  4TY8 A;  4DL0 C;  4F4W A;  3RGI A;  5HVF A;  1SL2 A;  5EGY A;  1RAB B;  4JB8 B;  5DQG A;  3D6F B;  4YY3 F;  2BRL A;  1M1K T;  2EKN A;  2YNG B;  1HA1 A;  4DR3 F;  4IFV A;  2UVU A;  4RLE A;  3QFW A;  4D3H A;  3OUY B;  2DY9 A;  2XZW A;  4HH1 A;  3I0R A;  4FYW B;  1N88 A;  3V5R A;  5L9X A;  1F0X A;  1H6K X;  3DLH A;  3AJ2 A;  4NXM F;  4ILM A;  1JLA B;  2LP4 A;  5G0R B;  2XBP A;  1H7W A;  1K8A T;  1SHQ A;  2IM3 A;  1SV5 B;  2QEX S;  1SH0 A;  2DVI A;  3W1Y C;  4I4B A;  5HVH A;  4UOP A;  4FPI A;  1N8R T;  5F8N A;  4DX5 A;  1NKB A;  3HSZ A;  2KG0 A;  1NPR A;  4YB6 A;  2HK3 A;  2RS8 A;  2DH9 A;  1Q5Y A;  5L9N A;  4DV7 F;  4Q45 A;  4F3Q A;  3DLL Q;  1LWE A;  1MRO A;  2HFU A;  1O5J A;  1YX2 A;  1BD6 A;  3KG0 A;  1FXD A;  3CMQ A;  1TL3 B;  4I67 A;  3KHG A;  5LMU F;  3OSP A;  1TUG B;  3OL6 A;  4TLR A;  3VZI A;  1N5V A;  5HAN A;  3QGI A;  2RUG A;  1RT3 B;  2P9C A;  1RYR A;  3C46 A;  2J9E A;  1KP6 A;  5IT4 A;  3IWL A;  1SUQ A;  1GX6 A;  4DQP A;  2ZUA A;  3R97 A;  1U0H B;  8ATC B;  1YJT A;  4LSL B;  3DRS B;  1TMJ A;  1Q86 T;  2BMB A;  1TUV A;  1XMO F;  1GXT A;  2VPZ B;  2I2Y A;  2L48 A;  1UPP A;  1C1B B;  1NDK A;  1FRK A;  2RIL A;  3KDN A;  4TYB A;  2Z2Z A;  3I32 A;  2KFY A;  5B0F A;  1TKX B;  2YQ0 A;  5A2Q Y;  1IBK J;  3FMW A;  5D0G A;  1S76 D;  5IC6 B;  1VRT A;  4PAB A;  4TYA A;  5CA5 A;  2M4M A;  1LKZ A;  1WKL A;  1ZPV A;  5B0E A;  1TEL A;  3I5B A;  5IT9 U;  4MTP A;  4PCQ A;  5KT2 A;  3NKQ A;  1Y9O A;  5LMN F;  4LR8 A;  1FDD A;  2M0G B;  1VC5 A;  5BYQ A;  1W7W A;  4TQS A;  3UCZ P;  4C98 A;  2HHH J;  4KT0 C;  3LGM A;  2CJB A;  3DDK A;  1N48 A;  2DT9 A;  3H5U A;  1PYT A;  5KG6 A;  1NND A;  2Z4P A;  1C2P A;  1KHW A;  2VFT A;  1QSL A;  1U48 A;  2EKY A;  4ECZ A;  2HHP A;  3MAA A;  1N4L A;  1K7H A;  4WFX A;  2B9E A;  1S99 A;  1LWX A;  2QYC A;  3DFE A;  4QYZ K;  1SPB P;  1VQK S;  2PD1 A;  4XTT A;  4QPX A;  2D7S A;  3M9M B;  2GHW A;  2DNL A;  3M2U A;  5IFM A;  1KHV A;  3JS9 A;  2CG8 A;  1X5T A;  4WZM A;  1RWX B;  2O1P A;  3OXG A;  3GYX B;  4RKU C;  3OTC A;  5G4D A;  4WE1 B;  4P75 A;  2PEH A;  5B0G A;  5KG1 A;  1C4A A;  5DO2 A;  5GRR A;  3MWB A;  4HDH A;  2YNH A;  4ECQ A;  2W8D A;  4DL6 A;  2WOM A;  1T8E A;  1C0U A;  1HIY A;  4OYI A;  4OLP A;  2Q3P A;  5BXI A;  2XGQ A;  7FDR A;  4LRB A;  1HD0 A;  2IJR A;  2QL9 B;  3KK3 A;  1SKS A;  2X1F A;  2E5J A;  2UUT A;  4LRE A;  3PV8 A;  3X1L B;  3I9V 9;  4RW8 B;  2B8Q A; 
#chains in the Genus database with same CATH homology
 5LIA A;  3M7V A;  3DPC A;  5IJS A;  1ANJ A;  1FSU A;  1KH5 A;  3TG0 A;  3NKP A;  1URA A;  3MK1 A;  4UPK A;  1SHQ A;  2IUC A;  2XRG A;  5AJ9 A;  3SZZ A;  1KHK A;  2W5Q A;  1K7H A;  3BDH A;  3TWZ A;  3KD8 A;  4UPL A;  2ZKT A;  3Q3Q A;  1EJJ A;  1B8J A;  3UN2 A;  4LRD A;  1URB A;  4CXS A;  3LXQ A;  1AJC A;  1ZED A;  2GA3 A;  5L0B A;  1ALI A;  4KAY A;  4MY4 A;  3UN5 A;  4LR7 A;  3TX0 A;  1HDH A;  3BDG A;  3OT9 A;  4KM4 A;  4UOP A;  4KJG A;  5LQQ A;  4GTZ A;  1HJK A;  2D1G A;  4LQY A;  3UNY A;  4UOR A;  4KAV A;  3T02 A;  3NKR A;  1ZEF A;  1E2S P;  2W5X A;  5KXA A;  2GLQ A;  1EW8 A;  1ELX A;  1EQJ A;  4KJD A;  4CXU A;  5C66 A;  4ZGA A;  3UN3 A;  3SZY A;  1O99 A;  1EW2 A;  1EW9 A;  3IGZ B;  4CYR A;  5IJQ A;  4CYS A;  1KH7 A;  1KHL A;  3CMR A;  3BDF A;  1E1Z P;  3B5Q A;  5EGE A;  1KH4 A;  4FDJ A;  5K4P A;  2W8S A;  5EGH A;  1ALH A;  2W5S A;  3IDD A;  2ANH A;  1N2L A;  1SHN A;  3DYC A;  1ALK A;  2GSU A;  4FDI A;  4GTY A;  4UPH A;  3WAV A;  4LRC A;  2W5R A;  1AJA A;  5TJ3 A;  4NWJ A;  1E33 P;  1ED9 A;  3NKO A;  4MIV A;  5INH A;  4ZG7 A;  4N7T A;  5DLW A;  3MK2 A;  2W5V A;  3IGY B;  3NKN A;  1ANI A;  2W5W A;  1ELZ A;  1ED8 A;  1KHJ A;  2X98 A;  4QAX A;  1KHN A;  4ZG6 A;  4MHX A;  5GRR A;  4YR1 A;  3UO0 A;  1E3C P;  3T01 A;  5GOV A;  5DLV A;  5L0K A;  3WAX A;  1AUK A;  4LRA A;  1AJB A;  4B56 A;  1HQA A;  2W8D A;  2VQR A;  3NKQ A;  5HRT A;  1ELY A;  3T00 A;  4LR8 A;  1KH9 A;  3MK0 A;  5L0E A;  1ZEB A;  2G9Y A;  2QZU A;  1Y6V A;  4GTW A;  4LRF A;  3WAY A;  1EI6 A;  2W5T A;  4LRB A;  2IUC B;  3M8W A;  1P49 A;  5DLT A;  3A52 A;  4UOO A;  1O98 A;  2RH6 A;  3WBH A;  3NVL A;  3NKM A;  4GTX A;  4NWX A;  4CXK A;  3ED4 A;  1Y7A A;  3WAW A;  2GSN A;  4LR9 A;  3M8Z A;  4LRE A;  1AJD A;  2GSO A;  3M8Y A;  4TN0 A;  5LRM A;  1ALJ A;  1N2K A;  4LR2 A;  3E2D A;  4UPI A;  4ZG9 A;  2XR9 A;  2IFY A;  3BDG B;  5LRN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...