3TX0A

Unphosphorylated bacillus cereus phosphopentomutase in a p212121 crystal form
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
Knots found
sequence length
391
structure length
391
Chain Sequence
b'NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDTMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Molecular Differences between a Mutase and a Phosphatase: Investigations of the Activation Step in Bacillus cereus Phosphopentomutase.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 143
structure length 391
sequence length 391
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3tx0A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3tx0A01
1KH7A 3M8ZA 1HDHA 4N7TA 1E3CP 3DPCA 3NVLA 5LRMA 3WAXA 2RH6A 4CYRA 1AJAA 1ED8A 2ANHA 4LRDA 1KH9A 2W8SA 4MY4A 4ZG6A 1EW9A 2D1GA 1O99A 1Y7AA 1E1ZP 1AJBA 3NKQA 4KAYA 4UPLA 1AUKA 3KD8A 4ZGAA 5GOVA 2W5VA 3SZZA 1KH4A 4LR7A 5L0EA 1SHQA 2GSOA 1KHNA 1ALHA 1SHNA 3NKRA 4ZG9A 5LQQA 2QZUA 3T00A 4LR2A 3WBHA 3NKOA 1URBA 1EI6A 2GSUA 1EW2A 4UOPA 1Y6VA 4QAXA 5TJ3A 1ANIA 5GRRA 2X98A 2W5WA 4NWXA 2W5XA 1ALKA 2XR9A 3WAWA 1EQJA 3E2DA 1P49A 1E33P 4CXSA 3CMRA 3DYCA 3UN2A 3MK1A 5EGEA 3WAVA 3M8YA 2VQRA 4LQYA 5DLTA 1N2KA 4NWJA 1URAA 3NKPA 1KHKA 3B5QA 3Q3QA 2W5TA 4TN0A 1ANJA 3NKNA 4CXKA 1HJKA 1ED9A 2ZKTA 4UPHA 2W5SA 4LRFA 3UN3A 3IDDA 3MK0A 1ALIA 4LRBA 3BDHA 4KM4A 1EJJA 5L0BA 3ED4A 1AJCA 4ZG7A 4GTXA 4KJDA 5LIAA 3T02A 4LREA 2W5RA 1ELYA 3IGYB 5L0KA 3OT9A 4MHXA 3TWZA 3UN5A 3UNYA 3M7VA 5K4PA 5C66A 2GSNA 4LRCA 2G9YA 5AJ9A 1ZEDA 3MK2A 3UO0A 1ALJA 2W8DA 3TX0A 5LRNA 1O98A 1ZEFA 4UPKA 4LRAA 2GLQA 5IJQA 1KH5A 2IUCB 3TG0A 4MIVA 3IGZB 3SZYA 5EGHA 4GTYA 1ELXA 5HRTA 2XRGA 3WAYA 1K7HA 1B8JA 1KHJA 1ELZA 4GTZA 4KJGA 2GA3A 5IJSA 1E2SP 3BDGB 4FDIA 4KAVA 1HQAA 4UOOA 2IFYA 3LXQA 4UORA 1AJDA 2IUCA 4CXUA 3NKMA 5KXAA 4LR8A 4LR9A 4CYSA 3M8WA 4GTWA 4B56A 2W5QA 3A52A 1ZEBA 5DLVA 1N2LA 1FSUA 3BDFA 4FDJA 4UPIA 5INHA 3BDGA 1KHLA 1EW8A 3T01A 4YR1A 5DLWA
chains in the Genus database with same CATH superfamily
4LF8J 2HHQA 3NVLA 1SH3A 2MYFA 2OJ3A 1IJFB 1HNZF 4UPLA 1FXRA 3M2UA 4M5KA 2KZZA 2MKJA 1F2GA 3S6EA 1T11A 2ZOFA 5E0OA 4G1QB 5ETRA 1OY8A 2LQBA 2GIRA 3KHHA 2DNLA 3BSAA 2DXFA 2EFVA 2QLWA 5RUBA 1A9NB 2CQIA 2ZWOA 2KFZA 5L9XA 3BQ0A 1RT7B 1LWCB 5F8JA 3W61A 5KFNA 1PYOB 2CG4A 4RL1A 1OSCA 2MMYA 3VWSA 1CSJA 1L3KA 4X4PA 3D5MA 4GVBB 1VRQC 1S1TA 3HT0A 4F04B 5DDOC 4A8YA 1U7LA 1NPRA 3ZTOA 3DLGB 1KR4A 3RGIA 4HT5A 3UE2A 4ATNA 2LFVA 5HJYA 3T01A 1UMJA 2GQCA 4ELTA 1JKHA 3BO3A 2V2VA 3W5XA 1WC1A 1H98A 3IM8A 3MCMA 3BDEA 3LO3A 3FUYA 4DV2J 3D28A 1NJWA 1ACMB 2ALYB 5CXTA 2W2NP 2QEXS 2C2KB 4ANCA 1NB2A 5K8NA 5LJ3Y 2HQ3A 1SCJB 2EK6A 8AT1B 4W98A 3V2UC 4ECTA 1N36F 3CJ5A 3FKBA 1R31A 1BHNA 3OT9A 4DWIA 2YBVA 4USKA 5LM7E 1S12A 5IC6B 1LK7A 1JLCA 3NBPA 5HVGA 3TX0A 4R25A 3D2WA 2PA8D 4B3RF 2VFSA 5AT1B 2OFHX 2W7AA 4OYOA 5B0BA 2QFIA 4YHHF 1NK0A 1FWKA 2J8AA 4UUWA 1QTMA 2XCPA 4UPIA 1ICEB 3W9HA 2FGCA 3VAMA 4RKUC 2HIYA 4LBPA 4MYUA 4DCPB 4YMEA 5G0RB 5HROB 1S49A 2H54B 4CH7A 2HS0A 2FHMA 5F3ZA 3HD2A 3LAMA 4OV6A 1C1BB 2R7SA 4L73A 2CQ0A 1CJUB 1I6JA 4QYZJ 1IWGA 1XN9A 3MFIA 4DR2J 1SC6A 4DR4J 1CQMA 4HYKA 5C7PA 2HQFA 4F8RA 4WWSA 1SL2A 2V68A 2GV1A 3U27A 3C2PA 3HSGA 4XPCA 2Z8QA 3AA9A 3HHLD 2C2EA 1C2PA 4PQAA 4HVZA 2RQ4A 3I4HX 4KB7A 2LP4A 2P5VA 1T7PA 1L5UA 2VASA 3ONQA 2FJWA 1WTFA 2PA3A 2DR9A 5C42B 3LTOA 2IDLA 1XR7A 1VBZA 3C16A 1TFWA 1HWIA 1CLFA 1R8HA 2B4UA 3SFUA 2ABYA 4J90A 2XSFA 2XI2A 3G86A 1W7WA 1NCLA 1FK9B 1VBYA 2MLYA 3RAQA 3T3FA 3IR6B 2CQCA 4OYMA 3LF0A 4Q43A 3CCWA 1EW9A 5EWFA 1GMWD 1LEOA 4HT7A 3ZNJ1 4MFBB 5KT7A 3K17A 2RRAA 1HQUA 4QAXA 4CLFA 2GQ2A 2I2YA 3IP0A 5J1NA 5AE1A 3DYCA 1QDUB 1AYEA 2CJ9A 2DRBA 3R1LA 2FJAB 3A8EA 4DR3J 4OZNA 4CT8A 1N6QA 3IRXB 3EGVA 1RU1A 1S72S 4N47A 4BS2A 1IKVB 2SXLA 3MWBA 2V63A 2YVSA 3ZTPA 3CC4S 3AJDA 5BYQA 2GSNA 5HLFB 2IAJB 2J9DE 4HDHA 1WC4A 4LF2A 4BBYA 1RAFB 2DKOB 4EBEA 3GYGA 1WHXA 2KHCA 2QC3A 2BMBA 1KVKA 1KNZA 1EAYC 2LEBA 4RLEA 2Q1LA 2JLFA 3R9LA 1J5EJ 4KV8A 1C4CA 3HFVA 1Q1KA 1UJ6A 1FD2A 1YI2S 4OJGA 5F8MA 5CYJA 4B9NA 1QAIA 3EXYA 3MI7X 3E01B 5KG3A 2FJXA 4NYZA 3KD8A 2CYYA 5D0HA 3OHBA 2WK4A 2V5HG 2QZUA 4IQXA 4C3MA 2X98A 3BZQA 2VFRA 1HQ2A 1VRUB 2DXDA 4NXMF 3UN2A 5A6PA 2XG8A 3I32A 4FKYA 5ETLA 1SJ3P 2IM2A 2AD9A 1RTDB 1RWXB 4ZG7A 1HNZJ 6AT1B 1SVDA 2YNHB 1BMQB 5BYRA 2RHQB 4YDXA 3UD5A 3H20A 4NZ6A 3MMJA 3UR0A 1JJCB 3H5SA 4CO3A 2KFYA 1RHJB 1EQMA 3EM1A 4H4OA 2HPUA 2QLXA 3OXFA 1RYRA 4XTTA 4K4SA 4FVMA 3HXMA 1X4CA 3DC2A 3NOGA 2IUCA 4PZVA 1RZMA 4PXCA 1DHMA 4OZ2A 1S0OA 2K1RA 2OPQA 1RAAB 4R5PB 1AJAA 1OPIA 2XMAA 4DCJB 3V6DA 2MTLA 3EICA 2RT3A 2AGOA 3KNGA 4OX7A 4DX5A 1HI0P 4E0DA 5F9LA 1KFDA 5EDWA 1UWBB 4UOPA 2NCKL 2IRXA 1YDLA 2FYXA 1JJHA 1EP4B 3VGSA 3UR3C 1NDPA 4FPIA 2I8EA 2WVBA 5K5MA 3RB6A 4TLQA 1RTHA 4UPHA 5HATA 2VQEF 4GO7X 1FFSB 1H6KX 5DJBA 2BRKA 2D69A 2ZBCA 3G8TA 1TL7A 1WKJA 2JZ5A 1T03A 4DSFA 2B9WA 1U0HB 3W66A 1DJ0A 4L72B 3M9OB 4A8QA 5DDPC 1H2VZ 2DGUA 2KDOA 3EWGA 1RTJB 3Q86A 4FXWA 4UORA 3FK4A 5GAHU 2OSRA 4CYSA 4KY3A 2ZFHA 3NNAA 1N36J 1H38A 3EVWA 2HHPA 3GPAA 1PJ5A 4Q44A 3CDUA 3J7AN 1P9YA 2FHJD 1X4GA 3QATA 4A8WA 5H1SV 5C2GA 1D09B 4B17A 5ETSA 2HRUA 2QA4G 2EEYA 4B3RJ 2QYCA 3N6MA 2MZSA 1QSLA 2Q6BA 2OKQA 2VC1A 3ZZ0A 4HACB 3UCGA 2XI3A 1HWUA 2J8SA 1WF2A 4CP5A 3VCDA 3LAKA 3J7YI 2MHEA 4YHHJ 4ITSA 2XZTB 2V8DA 1XR5A 2VC0A 2B8QA 4ECQA 4ED2A 3B4DA 3I5CA 3BN7A 4UZBA 1I94F 5LXYA 1LW0B 1NEEA 8ATCB 1RT1A 2X3GA 1CEZA 1TVRA 5C24B 2O1PA 3AH6A 4DZ6A 1UJ4A 3BKUA 3S1TA 3P6YC 2C3MA 4GTZA 4OYBA 4DX8H 2DY1A 4ZVQB 4ZVRB 4NLUA 2ASLA 1M5OC 4FDJA 3NCRA 1EW8A 2DK2A 3PX0A 2RU3A 4GRSA 4DFMA 1YJUA 1SV5A 1MU2A 2UXCF 3MPYA 3KLHB 2W9BA 2DNNA 3BSCA 2X7IA 1SKRA 3NOCA 2PDAA 1RT4A 2RAQA 2W5WA 5KT6A 2G0CA 2IJFA 3WAVA 2ILZA 4WFNQ 2VQRA 1RT5A 2YX1A 3R5AA 4LFCF 3SDEB 2DGTA 2HFUA 3QAEA 4P10A 1GNKA 2IA0A 1CJVB 1PAEX 1HNIB 4WZQA 4C9DA 1U8WA 3KG0A 2ZE2A 4FF4A 3IBWA 1QUPA 3CJKB 2RDJA 3W2VB 3M6VA 5DM7Q 3WDOA 2O01C 3IGZB 3CJQA 1JNZB 3MR6A 5G4DA 3QT5A 3N9UC 4ZCIA 4ZVOB 2FZCB 4DF8A 1SQFA 5IM0B 3ADAC 4UOOA 2JFKA 3C66A 3UCZP 3D0GE 3ZTSA 5EX3A 3PIOQ 3GG0A 3VVTA 4F3QA 2LLZA 4EZ6A 4NLGA 3HO1A 1VQLS 2IFXA 3AD9C 4FYDA 2Q6CA 2A1BA 1HNVA 5HBMB 1MROA 1DTTA 3MURP 3TZZA 3MM9B 2DISA 3FBFA 1AW0A 1XTZA 3DGPA 2OEKA 1EW2A 2G2YA 3PHTA 5M2PA 1DBDA 3MMBA 1YLXA 3GIKA 2PMHA 3C14A 5EX0A 2KXFA 3G82B 3MPUB 4ZLLA 1I1GA 3NNCA 3AXMA 3M05A 1UVNA 1WORA 4NA1A 4YDDB 1ROFA 1B99A 4UF4A 3DRSA 3TO8A 4PG7A 1TK5A 1WEXA 2WVEA 1FO1A 1RKIA 2PI4A 5LRNA 5A8WA 1Q0NA 5IT4A 4A48A 3KK3A 1X9MA 4NXMJ 3NGRA 1S6QA 1Q7LB 4ED4A 4IFVA 2UVVA 4OHZA 1VBKA 3N79A 3FZ2A 4OI4A 5ADZA 3KLIA 4D3GA 1NDCA 1DLOB 1QAYA 1G7CB 1R27B 5C25B 2D9OA 2YKMB 5IQQA 1RYSA 1HBMA 5B0AA 5K8MA 3FBBA 2Z0GA 1VQKS 1VISA 5KFTA 3VV2B 2OEJA 4C0BA 1RADB 3MEGB 4ELUA 3B4MA 2WW8A 2E7WA 2AEJA 3RG6A 3ELHA 1O51A 2Z58B 2VODA 5DLTA 2KVQE 4DR5F 4WP3A 1NHKL 2DIUA 2WRMA 2VBXA 3OFEA 4KM4A 1F9FA 2A6OA 4OV1A 1NNDA 1VR6A 1TKTA 2QO3A 2W2QP 1ZM9A 1PILA 3MR3A 4USVA 1E6YA 4NMLA 3OXGA 2F8HA 3A4TA 3TG0A 2NZ4A 2F40A 4NMXA 1ULRA 4F0MA 2PFDA 2D41A 2BEFA 1FEHA 1Q82T 3HHLA 2CXEA 1MWZA 3PDNA 4M5DA 4OZ0A 1AZSB 1MLAA 3Q8QB 1U2FA 3TEGA 1GT8A 4DSIA 1VQOS 3CJTA 1APSA 5DGBA 1Z4UA 5D0EA 2UZAA 4P52A 3ENAA 4UQGA 3V4MA 3IFEA 3FSIA 3SCLE 3KYLA 4LF7F 4CXSA 2P6SA 3AOAA 3MD3A 3MHYA 3LA0A 4ZN1A 3AA8A 1GMWA 2VPXB 4NA2A 2VDIA 2HSEB 2C2OB 3SQGA 3OVBA 4F36A 4NLRA 2W5RA 3D6TB 2AGQA 2AZ1A 3W65A 3K5MA 4QJVA 3OL7A 5GAGI 3A8IA 1CG2A 3DXBA 2QA2A 4IO9Q 3MAHA 5EGHA 2H4WB 4GTYA 2Y1LB 3M8QA 1LWFA 2VKZG 2XRGA 1UEVA 4ZCKA 4W92B 1S9EA 4LSNB 4BWJA 1FKOB 2K2PA 2NSCA 3POTB 4FYYB 1I94J 1FFWB 1FJEB 5HSPA 1RKJA 1KLMA 2I0XA 5KFYA 4MKVA 3JYTB 2J6UA 2XSJB 2NR0A 1ZTWA 5GMEA 3PYFA 1BE4A 1OS5A 5K8PA 2D3OR 4B3SF 2DY9A 1RA6A 3RJMB 4X4UA 1MN9A 2B9XA 3HSJA 3N5FA 1X60A 1NK7A 3CNQP 1NHVA 1JLEB 2CADA 2YWGA 4I1TA 2V6AA 5D78A 3HCXA 3CMRA 3MR7A 3M8YA 3LWMA 4K2JA 2Y1JA 2OMLA 2CPIA 2J9EA 4P72A 4DSJA 3KWMA 4QYRA 5EHHA 2G4BA 2XLIA 5GADI 5LMUJ 2UXCJ 1J2VA 1N0VC 2LEAA 3IG1B 4PAAA 1IBMF 4DV3F 3THVA 2WBRA 2KG0A 3Q24A 2FDNA 1IKWB 2E1CA 1I51B 3KLFA 3MUTP 3FSYA 3UVJB 2OFGX 1XQIA 2CA9A 2KT3A 1PIEA 4LFCJ 3TQEA 4AT1B 4CLKA 2NXEA 2C2ZB 1SH2A 4USUA 3PJXA 5BXIA 2MQPA 3L3CA 3M2UB 5HMWA 3R27A 3KMQA 5F3TA 2AYEA 4A8KA 1O99A 1X9SA 4RW4A 2NS1B 2R2SA 2ZVSA 1EKRA 3NLCA 4J7CA 3QT8A 2HRTA 4LF6F 1DZ5A 4CI0B 4KSEB 4WFAQ 3ZZPA 4NWXA 5KFKA 2WSFC 3AD8C 2J6TA 1TZ0A 2ZD1A 1VQ4S 1TL3A 4QCLA 3TR5A 2CQDA 4NLVA 2W5TA 4I6YA 2E1AA 3SCIE 4UW2A 2BQUA 1S1WA 4U8VA 2UUCF 1AFIA 3ISND 2R2UA 1S1TB 4DV7F 2Y1RI 4UOCA 2ILYA 3HD1A 3QWUA 1NZ8A 2QT7A 2NSBA 2B43A 1S4FA 4C7QA 3RB0A 3CW2C 2KXNB 2CJKA 5B0EA 1A6LA 3KLVA 4WP9A 1WC6A 1KHJA 4PKDB 1VBXA 3GCXP 1SJFA 1SJQA 5FJ4A 1JKHB 2DNKA 4J9LA 1HL6A 1NSKL 1RISA 3ULHA 1YX2A 4C8YA 2DVIA 2ZH5A 3BYPA 1XERA 4KRWA 2HAFA 4ZGAA 1SL1A 3SI8A 1WNEA 3D1OA 5DRKA 3H4DA 3KJVA 1X5TA 2ASDA 2RUSA 3PYGA 4KGXB 2O67A 3LP0B 3MAQA 4X4TA 2JJ4D 2Q3PA 1U6FA 4K4XA 4JUZA 2QX0A 2MQ8A 3RAXA 3BSNA 1HMVA 1JLCB 3NBPB 4DV4F 3D0IE 2V0NA 1NK8A 1Q8LA 1RAJA 3OLBA 1VC5A 4I0WA 2HLUA 4C3LA 4RBTA 3MMCA 2YQ3A 3RTVA 2F5GA 5MLCV 3GIIA 2B0GA 1FHTA 3RYLA 3BO2A 3KUHA 2FUG9 4DR5J 4FDIA 1REGX 1VHIA 1U47A 2HFSA 1KHLA 2ZNYA 2OPRA 2JRSA 2MZRA 1C0TA 2DPJA 2HVIA 3DM2B 1RSCA 1CJTA 1LK5A 1F5BA 2MLXA 2DNYA 4HH0A 3KJFB 5E41A 3ENWA 1URBA 3HFKA 2DNQA 1ALKA 2BQ3A 4EI2A 4B9MA 3MM5A 1FX2A 2N3LA 3A1YG 4PPDA 4J9KA 3WX8A 2YKPA 5BJRA 2G13A 2WW4A 3HHLC 1TKDA 3KNAA 5DDRC 3R5BA 3M30B 1IN0A 2J5AA 4C2MA 3C16B 2MLZA 1IBCB 3DGVA 2KM8C 3PZPA 2HZVA 4KJIA 3I31A 1N5QA 2HNDA 2R9LA 3SZYA 4LF7J 4JP8A 5KFFA 1NJXA 1HQAA 1D9FA 3DLKA 2C3PA 3IMQJ 2ZOMA 5H9FJ 4YEAA 2F7VA 3M6UA 2BOPA 1FERA 2XMVA 1RWPB 1JLAA 4NEYA 1FX4A 1FE0A 3EXCX 2HEKA 3DPCA 4O3RA 2EG1A 1HQUB 3QRQA 4WU2A 4EGLA 4UZCA 1KBRA 1HD1A 4J9UE 2XS5A 1YBUA 1VC0A 1U24A 5KG1A 1P27B 1VYAA 2RJZA 4ZPWR 2WVCA 4I2PA 1VQ6S 3DDNA 2RDIA 3CF5Q 4TQRA 4X4OA 3N28A 1LWCA 3O44A 2XLKA 5HQ8A 2DHHA 2LA6A 4IH6A 2MZTA 4B3SJ 1R8CA 2EBGA 3T1AA 1WD6A 2AEMA 4UQTA 2OSQA 3CGIA 4BC7A 3J7ZT 1S7IA 4DFJA 2EFGA 4KV8B 2JEIA 2WOMB 2FLPA 4JV0A 1U1PA 2X51A 5M2UA 5IT9U 4QWEA 2KYZA 1N34F 4IG3A 2P8IA 1FTCA 3PW7A 5E3QA 1S1XA 4C8ZA 3K89A 1X4AA 4ETZA 3T5JA 2QA4S 3K59A 5F8IA 1N52B 2DH7A 2AEFA 2GIQA 3NY0A 3WAXA 1IBMJ 4DV3J 1KWMA 1ZBTA 3PEHA 1GX5A 2HHSA 1EHWA 5KFIA 3CIMA 3RAMA 4KYZA 2VBYA 4XDCA 1M5HA 3ISZA 3BB5A 2W2MP 3AY0A 2RRBA 3OTDA 4KBIA 2HS4A 4BLGA 4Y65A 5KG4A 1FESA 2H5IB 2I5JA 2VG5B 4ECZA 3NS7B 4ICLA 2CQ4A 1JIHA 4H4OB 3KHGA 3LP1A 5F0WA 1IXKA 2IM0A 2QG9B 1S59A 2B9EA 2W9CA 3QRRA 3LOUA 5E5NA 2IUCB 5BR8F 3F56A 3C6TA 4F4ZA 3R1HA 2K1RB 3BPSP 1JMTA 3VHQA 4DUZF 2J0QD 1ZM4A 3NP5A 2UUCJ 5DLFA 2ROPA 1BWEA 3V6DB 4YB7A 4DV7J 3FMBA 2ZHBA 3MCOA 3Q8SB 3PNIA 4ECSA 2DH9A 1ZETA 3RR7A 1C1BA 1VQ7S 1OIAA 2JC1A 4MIWA 2C3YA 4YY3F 3HP6A 1JB0C 4O4RA 1RTHB 3BQ2A 1WTBA 3WAWA 1HWKA 2HWIA 4IOAQ 4WTYA 3IAS9 2DGWA 4OZ5A 2IRYA 1Y4ZB 1TL7B 1T03B 1RAGB 3MK0A 4UT4A 3PX4A 3JQKA 3UDLA 2MKIA 3HKWA 4UOHA 3DLBA 3IAM9 3C6UB 2IM3A 2EW9A 1RHKB 3VGVA 1XIQA 1FEEA 5D0GA 2OO4A 1H72C 3LPEA 2R8HA 4FVCA 1LKZA 2LQ8A 2A3JA 2IFYA 3LXQA 3CDWA 4ZP7A 4EO6A 1RP5A 2YH0A 1D3WA 2AX0A 4F67A 4ECRA 4DV4J 3WIUA 2ZZTA 2DIVA 4M1KA 2C2NA 4LSZB 3H90A 4IH5A 4KPCA 1XMOF 2VKRA 1B3TA 1KRPA 3IWLA 1AUKA 3TNVA 5D4NA 1WKKA 2C2DA 2DR7A 1W2BR 4XK8C 2FY1A 1SHNA 3DDIA 4ZVTB 3E3XA 1MG7A 4WBFA 3TUPA 3UW1A 1KVJA 3MPWA 1RT1B 2PO4A 1UL3A 3TYTA 2YNGA 1QE1A 1TVRB 2BR0A 2AJ1A 5J2NB 1S97A 1P6TA 3M32A 3UN3A 1XC9A 3C46A 3W9IA 3I5BA 1TP7A 4ECXA 4Q2LA 1VQ5S 1BD6A 3TUIC 2J76E 3MXHP 4HLBA 1YWXA 2VPZB 3CVKA 5CYMB 4CYUB 2AT1B 1CJKB 2GAGC 2RE1A 2LXIA 3CJ3A 3OTEA 4F2SA 2HFZA 1NB7A 4DLEA 2P2CB 1AA1B 4QBUA 3KDNA 2VBZA 1AJDA 3GJTB 5L1JA 3OL9A 4ZP9A 4CM2A 3NKYA 2HHVA 3FCHA 3H4BA 2CQ3A 1SV5B 1K0TA 1MU2B 1S10A 3HM9A 1B70B 4N41A 1U1MA 1HDHA 1IWAA 1KN6A 4J9OA 1RT4B 3TA1A 4P7TA 4KAYA 1M90T 3D6HB 3IWXA 4H4KC 4IQMA 4OYZA 4USWA 3SFGA 1T9XA 3EPIA 4EU0A 1RT5B 4AL5A 4IRKA 4GMKA 3BGOP 3DDKA 4DJBA 4R0EA 2RVJA 1KKHA 1EQJA 3CJ4A 1FRLA 4LF9F 1X9WA 4LQYA 4ZVFA 4DPXA 1NPPA 2ZE2B 4DL7A 2DPIA 5E3PA 1HBNA 3O1LA 4O23A 3H5YA 1UAWA 1KQGB 4LT6A 2OPSB 3G4SS 1NK6A 2E1RA 4N5SA 1YZ6A 1TKXA 4I2QA 1JK9B 5ETNA 4PG4A 4MH8A 2CZ4A 3ZZYA 1IM6A 1QSSA 4OJ1A 1K0VA 1HNVB 4R5PA 1YVFA 2W7OA 1DTTB 4QOTA 1PGZA 1B0TA 1HW8A 3UDVA 4F4YA 2O5DA 3DGPB 1QAXA 3P3DA 4ZPTR 4U9RA 4ZHRA 1UWBA 3MMBB 1DQAA 4I7FA 3PM9A 4M5IA 3ZXWA 4K0KF 2KJWA 3C14B 4JI1F 2Y9HA 2FC8A 1GEHA 1N34J 2YXLA 1UJ5A 4LJMA 4BDPA 2AJ0A 1KTQA 1UVMA 3DRSB 3W1YC 1U1NA 3CC7S 2CJYB 5A8WB 3FDSA 3MMAA 4NCGA 3KK3B 1XR6A 4Q8FA 2KYXA 3F0NA 1KQKA 1H7WA 2DT9A 1S6QB 3SXLA 4OMFG 4IFVB 3QQCD 1HR0F 3QIDA 4TNOA 2HRYA 2MQMA 3ZZTA 3FVYA 2ZBIA 2RF2A 4K7QA 1L3VA 3TAMA 3KJNB 1T8EA 3T41A 4WCEQ 2YWWA 1Z2LA 3CCVS 3G87A 2J9CA 3C19A 4OYWA 1HBMB 4N56A 1UPMB 2B4PA 1HFEL 2E29A 3D1HA 2QSWA 5IT0A 2F3JA 1LNQA 3PV8A 4YUDA 3DMJA 4RO0A 2GA7A 3PKMA 1JX4A 3SEOA 5BR8J 2N4CA 1N88A 5T14A 2AJ4A 4U8YA 4ED5A 2I9SA 1FKAF 2GVZA 4DUZJ 2CWXA 2OD4A 4OZ3A 4P7VA 4NASA 1GTEA 2WB1D 4QZVB 4EO8A 1E6YB 3D66A 1FXDA 3FEZA 2CNKB 4X4SA 2EWHA 3V6HA 4FXVA 1TL5A 3HHDA 4F4XA 4YY3J 3VTIA 2VPWB 3HHLB 2XMJA 3DU5A 5E33A 2JC0A 3VZIA 2HHWA 4CRJA 4UPKA 1X4EA 3MR5A 1R8PA 1JXEA 1U2RA 5FLXU 2NQPA 1DAXA 4DQRA 2BM0A 2POKA 4KPYA 1DURA 5L1KA 3O8WA 1Y00A 1FDBA 3UFCX 1RA7A 2KH9A 1WC3A 4F7VA 3KG1A 4ZN3A 3BH6B 2VA3A 4PABA 1WSRA 3QZ7A 1UEKA 2AW0A 1OYDA 3S01A 3ITHB 4I64A 1FDAA 3UDCA 5CAAA 1JLBA 4FN5A 2BE2A 4NI2A 1Q81T 1Q4RA 4I56A 2OTJS 3LPYA 4Q7AA 2HNYB 1KEKA 3JQJA 2GQQA 1X5PA 3DOMA 1HNIA 4ZA1A 2I38A 4QQBA 2Y1IA 1TK8A 1XMOJ 1RACB 5H9FK 3OJSA 2HMIA 4K4WA 1LW2A 2A0FB 1EARA 5IT9Y 4DF4A 2HVZA 3CJKA 3G6VA 3BGUA 2YNFA 1LWFB 1W2IA 3R5JB 1UA0A 1S9EB 3W64A 1G3OA 1WEYA 3ILJA 4ZLPA 5IM0A 4ZCLA 5CZVA 1CC8A 1WDTA 3P4UB 1M5SA 5DZ6A 3PW2A 3R7BB 1L3TA 1KLMB 3GFYA 1GXTA 1HIYA 5KFPA 3MM7A 4PYDA 4WU3A 3BS9A 3RU0A 4OX8A 4RNNA 2ATLA 2HAIA 2ACYA 5HBMA 3HFZB 3TA2A 1IBKF 4BHQA 2P9GA 2J0XA 1RAEB 4AE5A 3GIJA 1YJNS 4PWDA 1ZZNA 2LKZA 3THTA 2BACA 5LQQA 1YG0A 3T00A 4F0HA 3KKFA 2OTLS 1P49A 4A8SA 2MSTA 2FD2A 1Y10A 4E2FB 2MPUA 4JYAJ 1DQ8A 4UUXA 2QJ3A 2FJDB 1RAOA 2B4OA 1V5IB 3BR8A 3CMAS 2W4DA 4IKAA 1FNMA 3KLFB 1NKCA 2A2DA 4PYAA 1GXUA 3MEKA 5J2MA 1N54B 3VZHA 3KK2B 1K73T 4AL7A 2KHDA 2HFVA 1GTHA 4LF9J 3PCOB 3H59A 4O3PA 3CD6S 1WEZA 4LR8A 2ALZA 2CPDA 2VOPA 1HQEA 4RW4B 1S48A 2IMOA 4O3OA 2QL5B 1NDLA 1LFPA 2ZBRA 2CPZA 2UP1A 3KG4A 4X65F 3QZ8A 4X4NA 3LH2S 2X3DA 1QTNB 2AV5A 5E3CA 4ZMMA 5AXKA 1NZAA 3VVUA 2ZD1B 1X0PA 1TL3B 3I5AA 3JTOA 1S4EA 4P71A 3LALA 4WTOB 4LQ3A 5GAEI 3BKTA 2MEWA 1S1WB 2V4QA 2QL9B 2W8KA 2M70A 1VLYA 2H5JB 4M5JA 4RX6A 2CPEA 4JI5F 3MAAB 1ZA1B 2CQPA 2XMTA 3FFIA 3ISNC 5IZHA 2CUYA 4RNHA 4DR6F 4X4QA 5F8GA 2AIRB 2QLJB 2K7JA 1YIJS 2G9YA 4K0KJ 2P9EA 4OI0A 4JI1J 4K59A 2N7CA 2LECA 5GMKa 4ANEA 1KH5A 5DO2A 3W9JA 4XDDA 1K7HA 4QPTA 2LVWA 2OH2A 5E7OB 4M5MA 3EZ5A 4ZJLA 4RW6A 2FTRA 2E5HA 2C1EB 3BDFA 5HVFA 4XO0A 3GP9A 5HANA 3VAFA 4FS1A 3Q8UA 2GMHA 4IRCA 2D74B 3T1YF 3N4WA 3OUYA 1AJBA 1HR0J 2M88A 4RNFA 1A0OB 2OELA 1TL1A 2FIUA 4H4MA 4P2MA 2G1HA 4ED8A 3DLLQ 2UUBF 2CDQA 3NCQA 3MMCB 2L48A 3JS9A 4LIWA 1FNXH 2DGQA 2ADCA 4C3KA 1X8DA 3UO0A 3R5DA 1S0MA 1HW9A 2HFOA 4R0JA 2KT2A 2E7XA 3R5CA 3ENVA 4O3NA 3L7UA 2ZC3A 1S99A 3OBIA 5E3RA 1N0UA 4U7CA 2OPRB 1MSWD 1XJWB 3SZ2A 4Y2MA 5C5JA 1C0TB 1GH8A 3NS6A 4FKXA 1PYTA 5H9EJ 2CQ1A 3AJ1A 2NYIA 3OFGA 2WVDA 1CJTB 1JLFA 2PEHA 4GKJF 5LSOA 2QA1A 2YX4A 2IM1A 2RSQA 1BQXA 5K14A 4ED3A 1CPZA 2DB1A 2W1BA 1Y3JA 3CULA 1T9UA 4KGMA 3EZUA 1QSYA 4LSLA 1VGYA 2B5JA 2DO4A 1M1GA 3ILLA 5TJ3A 3IGVA 4WXWA 2VICA 1JLQA 2EI5A 3I9ZA 3M8PA 1R3NA 4RW9A 2R2TA 3IBFB 4NWJA 3B6BA 4JI0F 2F9DA 4M5NA 2MJNA 3EGNA 5FD1A 1FRJA 4DMZA 1H2TZ 2HNDB 1N5VA 1S76D 3H40A 3UN5A 3EYZA 4MKAA 3ZZUA 1RHQB 4CNYA 3X3UA 4DL4A 2E9RX 3DLKB 5KFCA 4DX7A 3TANA 2VG7A 2HNZA 5J1PA 1HBUA 1KDNA 2J6SA 1JLAB 4Q5VA 3AQPA 1MWYA 1F6TA 5KXAA 4QU6A 2H3EB 1Q5VA 5FDLA 4RNOA 3Q8VA 4PQUB 4CLYA 5LRMA 2M9KA 1UCNA 3Q83A 2V50A 3MDFA 1VQ8S 1KQSR 4I2PB 3DRYA 3G6XA 3T1HF 3WBHA 4BWMA 5B0DA 2J0WA 4HHUA 2IJRA 1H73A 1R8AA 5T41A 5KFOA 2V4JA 2GW8A 1LFWA 3R2CJ 1WSVA 1IBKJ 3D6MB 2XWYA 4FYXB 4ELVA 1WI6A 2OHDA 2YNIA 3NG8A 2KJVA 4LF1A 4QIWD 3IGYB 2CNNB 5E2QA 4F3MA 4OX9F 1NSQA 1NK5A 1Y9OA 3A3NB 4L6V3 1W25A 2GS8A 1X31C 1TUWA 4NLWA 5THWA 4IG3B 1G2EA 5LXRA 1S1XB 1HNXF 4P2SA 1WACA 2BW2A 1GK8A 1WC0A 4JI3F 4AXJA 4ETXA 4Y3CA 3M8SA 2ZH7A 5F8NA 3GJRB 2W4PA 2CJBA 4N77A 2MY7A 4F4AA 3F73A 1FJGF 5I3PA 2IBOA 4DV6F 3SZZA 3J7Z5 3BREA 3LP0A 2JLGA 3EZOA 2MGZA 2YKQA 1QUVA 1X5OA 5D8HB 2I5JB 3ZC4A 4ICLB 1U1KA 3BN4A 1O0PA 4DR1F 2DD8S 1RQ0A 2YPYA 1RHUB 2NPIA 3LP1B 5A6WA 5FLXY 1FT8A 1YJWS 4I67A 4OI2A 3VAGA 3LW5C 3FEYB 5ITHA 4J9NA 1RE1B 1F9EB 3QIPB 5HN0A 3CCRS 2W9CB 3QJPA 2JDJA 3OR2A 4X65J 3FBCA 3NWRA 2EFQA 4NCBA 3C6TB 4K50A 4UTGA 1ALJA 3CCLS 4LFBF 1QAJA 4LRAA 2QGFB 2VFUA 3O2IA 3GV8B 1OMSA 2GNKA 5L38A 2FPHX 1PO6A 3SQOP 3L09A 4NLTA 2UUWA 1ZOTA 4PXBA 4M8LA 2L41A 3JB9k 3NMRA 2ZH2A 4KAVA 1YJVA 4JI5J 1UETA 4X4RA 4A47A 3MTKA 4RUHA 2QLBB 4PPZA 1N2LA 4DR6J 3G2XA 3DM2A 4Y28C 3HJVA 4DS5A 2RH6A 4B9VA 4DXLA 1Y7AA 4YR2A 1URNA 4C8MA 4ZIWA 2HWTA 3R3TA 1EI6A 1Y6VA 1K1QA 5GRRA 2GO8A 5SUHA 2J7UA 4YB5A 1Y7PA 5HMYA 1NAQA 3C15A 4K2XA 3IR5B 3M30A 4Y6IA 1NK9A 2EPIA 4DV1F 3T1YJ 1PYSB 4B9LA 4M63A 2BJ9A 2HVHA 2VL1A 4DV0F 2EC2A 2K3KA 3N6NA 5EWGA 1T94A 3DFEA 2VDHA 2GHVC 3CDBA 1OQ3A 2EXUA 2UUBJ 1ZS6A 4TKTA 2BRLA 4ALZA 2E66A 2AX1A 1ZTTA 3KLGA 3ILIA 1M1KT 3NNHA 2R8GA 2AJQA 1IKYB 2K06A 2ZZNA 3BGFA 4RWWA 4ED0A 2MDAA 4JV5F 2YNGB 4QWCA 3KLEA 1QE1B 1Y0HA 3M32B 3TVZA 2ZJRQ 1Q7YT 4WF9Q 3H98A 2VPYB 4CIOA 4GKJJ 2EK1A 1WWHA 3A12A 4KKOA 4YQWA 2IBKA 2W01A 3CB4A 1FVSA 2E5IA 2H1YA 3PW0A 4LREA 2ZH3A 2E5LF 4TVAB 3MUVP 5HAOA 3K57A 2M0GB 1D8ZA 3JSMA 3V81A 1JQGA 3BO4A 2WOMA 3FNNA 2QN6B 4X84A 1YBTA 4JI8J 2NREA 1RJJA 1TL4A 4JI0J 2VZ9A 2HHTA 4CXUA 4X64F 4C11A 3K5OA 3O6QA 3FBEA 1HWLA 1CVJA 2LMIA 4ECVA 4PG6A 2A6MA 1U4BA 2CZ9A 3I87A 4EFAC 1U6ZA 4USIA 1P1TA 3GE9A 1Q79A 4ZP8A 2C22A 2DHGA 4URQU 2IPOB 2XC9A 2CPFA 4IYQA 4NLXA 4PXEA 1IQTA 5D4LA 2Z4PA 4CTAA 1WG4A 1YRUA 5KT2A 2X1BA 3T6BA 1HBNB 5EN1A 2DNMA 2VG5A 3UQSA 2ZH4A 1HYSA 2ASYA 2UU9F 3W5ZA 2IVYA 4RUBA 3BEGB 1TKXB 3PJWA 4I2QB 1OO0B 1R7IA 2R2RA 3T1HJ 3CD0A 2CIMA 3R6LB 2BKOA 1HARA 2EFOA 3CD5A 3D6FB 2R3VA 3DRRA 4DLGA 2Y8WA 3MEEA 4LVNP 4EEYA 2C42A 4CO2A 2MKCA 4OHXA 1YJTA 4ZLNA 4Z7YA 1ZEBA 1WG1A 3TEHB 4ZHRB 4AQYF 4I7FB 2CPJA 4OX9J 1AB8A 1TV6A 3G6YA 3RBDA 1ED8A 1YGYA 1T0TV 3PR4A 2PT0A 1KS2A 3MGJA 4CLWA 1Y3KA 1KHNA 1ALHA 4LMZA 2NYHA 1HNXJ 3DNCA 2U2FA 1T05A 1LXNA 5A0YA 3T9NA 2XR9A 1LWEA 3G9CA 4JI3J 4MT1A 2WHOA 3EPGA 3MMAB 4NCGB 4U7UK 1GMVA 3PYDA 2APOA 1FJGJ 3C6UA 3R7NB 1D8YA 4F0KA 4DV6J 1TFYA 2RF2B 3TAMB 2EKNA 3TVKA 3H5XA 2QMUB 4J9RA 1YITS 2ZWPA 5D0RA 2U1AA 4DR1J 1QLNA 3GR0A 5DZ7A 2CJAA 3DMJB 4GTWA 3GQCA 5LT5A 2HHHF 5FIIA 2ATCB 2NZCA 1WF0A 2D3O1 2WSCC 4QWBA 4LFBJ 2JFDA 2V8VA 2XEXA 4K5SA 2R8IA 2GVZB 2XMWA 1RT6A 4OI6A 2F65A 3Q8YA 5KFEA 4D3HA 1F5AA 3U1NA 1UZHA 4DCOB 4KGZB 2VJVA 3E51A 4M5GA 4OLOA 4EK2A 1FNOA 2QRRA 5J2NA 2RDDA 2PMZD 4ES3A 1N33F 2FZGB 3P49B 3WC0A 2RD5C 5KFUA 1HA1A 5CYMA 5H9EK 4DR7F 1XBWA 4CYUA 2AU0A 1SC1B 2MKSA 4NZ0A 5GAHI 1CJKA 3J81j 2FVSA 4ZIVA 2DO0A 3H5UA 3OLAA 3W8PA 5D4PA 3R6GB 2VB6A 2HGMA 1SUQA 3UNGC 5LMNJ 3QRPA 2N4DA 3QWPA 1U48A 3A8KA 2CDRB 4W4MA 3TZXA 5LMUF 3AXKA 3CXCR 1UVKA 2RMLA 4DV1J 3HVTA 4F4WA 1JLBB 4U67Q 1HI1A 4DEZA 1RBLA 2BE2B 4NI2B 3ZFVA 3KUGA 1ZA2B 4DV0J 4OYIA 2GVDA 2AJ2A 2HQDA 2E9ZA 4RW7A 3DOMB 2GAHC 1PJ6A 3H2VE 4CZCA 4IR1A 2HMIB 4YB6A 1YJ9S 1LW2B 1SB6A 5KT3A 2KT5A 2IVFB 5KFHA 1BQNA 2YNFB 3VQSA 2QE5A 2RH3A 2Y3YA 4KO0A 1B0PA 1NXIA 3MF5A 3MEDA 4FP9A 4ZPAA 3K8WA 5I4MA 1EJJA 2OPSA 2XULA 3UD3P 3GFXA 1Q8KA 3GU0A 4FF1A 3CJ2A 4JV5J 1RWNB 3DOKA 2Y0SD 4C0OC 3MM7B 4OHVA 4F2RA 1TAUA 1RT2B 2A2CA 4PWWA 2Z30B 1ELXA 4IFYA 5KFSA 4F4KA 3F44A 1S9GA 1AROP 4CO5A 4RW8A 2R7RA 4PWDB 4DPTA 4PUOA 2PGCA 1DTQA 3MOJB 1K47A 3GTYX 4P2XA 2E5LJ 2DGVA 1M0SA 2ANHA 4NLYA 1ZAWA 3G8SA 3QBCA 3QGPA 1B4SA 3W7BA 4KHRA 1RAHB 2FVPA 1S6OA 4Q8EA 5LOQA 4X64J 5KG6A 3SBMA 3HT3A 2FVCA 2XNRA 2HGLA 3E8OA 1KOOA 1MWQA 2NPFA 4A8MP 1YJRA 5J2MB 2GJIA 4PG8A 3AJ2A 1U1OA 5KFLA 4V19X 1UVJA 2DEJA 2E5JA 1V3RA 2YQ0A 4ILRA 4ZPDA 1HQEB 1S5ZA 1WF1A 2XNQA 2HQGA 3GONA 3L7PA 1YK9A 2UXDF 2K3IA 2COLA 2W5QA 2UU9J 2V4RA 1AUDA 3N5BA 5DLWA 3QGHA 1JJ2R 3KK1A 4LF5F 3ET6A 5KFWA 5I42A 5CZXA 1Q8BA 4HL9A 2IVMA 1EETA 3Q0AA 4J9QA 1UVIA 3LP2B 3R97A 3GV5B 4CCHA 3EX7B 4O4GA 3FFIB 1K9MT 2R7QA 4M94A 2BUNA 4HR2A 3M6XA 2QV6A 4AQYJ 1TR0A 1BLUA 4GC6A 2BJ7A 1FKPB 2B8PA 2R8JA 4CT9A 5CHCB 4Q2MA 3M8RA 4OYPA 2OPPA 1WDDA 2D9PA 1AUSL 4CDIA 3AOBA 5F0UA 5ETPA 4RW6B 4K5RA 4CLZA 3HDSA 1VHFA 4WIIA 4OX6A 3CC2S 2VQFF 1SJ4P 3SCJE 2NXJA 3M8WA 4ECWA 2FJEB 1PBUA 1IR0A 3FC9A 3OUYB 3MPVA 2NXUA 8RUCA 5ETOA 2AF6A 4USMA 1FWLA 2XB2D 4OZ1A 3UPFA 1TL1B 3ITHA 4B3MF 4LVOP 4TXSA 3DI6A 4H4MB 1FRXA 4B9UA 2HQCA 1OQ6A 4I6WA 3R5GA 2J9DA 1F3FA 2B51A 2ZKUA 2HNYA 4J9MA 2GSUA 2XBPA 2AGPA 4CLUA 4U7UD 2MQLA 2ZJPQ 3ZTQA 3AODA 2HHHJ 3K8VA 4B02A 4ZLJA 2ZKTA 3PO5A 1RGVA 4ILLA 4I68A 4A8FA 1IR1A 1EJ7L 5L8RC 4I6AA 4QW9A 2NUUG 4DV5F 1IBLF 2F63A 4DQSA 1N4LA 3IWNC 2D3ZA 3MUMP 1TKZB 3AB2B 2ZOGA 1RHMB 1FE4A 4OJ3A 2MSSA 2GGPA 4GC7A 4B3OA 2Z2ZA 1JLFB 4GVLA 3FGVA 1U49A 1E2SP 1P9QC 4DQQA 1N33J 5IOLA 2XZDB 2BQRA 2HBRB 3OR1B 2CPXA 4ID8A 2CWKA 4P9SA 5K14B 2Z2YB 2M52A 3BR9A 4DR7J 3OV7A 1T02A 2RQMA 3ZO7A 3UD4P 2DTJA 4LSLB 3MCSA 2GMLA 1V3SA 2B5JB 5B08A 2VBWA 5KOWA 2KVIA 1JLQB 4JI4F 4HEA9 4Z37A 3M8PB 3CDEA 2HHUA 4RW9B 1I5OB 3CSKA 2V94A 3T5KA 3S7RA 3IM9A 2NXCA 5CABA 1J27A 4O44B 5KG7A 2XM3A 3EMTA 3GG1A 4NWBA 5T7LA 1ED9A 3IDDA 1HPZA 1VQPS 4DI6A 3L4BC 1F1BB 1AT1B 2VG7B 2CAJA 2HNZB 3VALA 1OY9A 3KK2A 1HBUB 1VIXA 4ZITA 4PG5A 3LGMA 3NAHA 1NHUA 3VAKA 4MIVA 4QU7A 1L3SA 3GLJA 1FRMA 5FDLB 5KFZA 2IHR1 1Q78A 4M5HA 3NGUA 3M2RA 2KXHA 4OHYA 3OD2A 1IVZA 2JSXA 3FCWA 2HYIB 4DPYA 5HVHA 4TY9A 4JB8B 2X1AA 1FSUA 2IMWP 2PD1A 2H9ZA 5U47A 5F8HA 2J0SD 5KFGA 1XEZA 3NL0A 3L95X 4ES2A 4FF2A 2V4JB 2YH1A 3LGHA 4OYXA 1HNWF 3HHNB 3MAAA 2YNIB 3AD7C 4MKYA 3LWLA 4USTA 2ZJQQ 4M95A 2E9TA 1HHQA 2BV3A 4RWXA 1HLWA 3KHLA 1SBRA 1DQ9A 5IQ6A 4ZVSB 5L9NA 1VI7A 5KTQA 4QW8A 1F2HA 3DOLA 4AD6A 2VF3A 3D68A 3KTQA 1WHWA 2BJEA 3O5TB 4ID5A 3JAMU 4ZVUB 5GMDA 1Y5NB 4F3OA 4B3TF 3TAQA 1VDHA 2YKNB 3WZ0A 4O0IA 3BJYA 4KIAA 3PXGa 4QIEA 5KOXA 5KFMA 1LXJA 4OIXA 1KH7A 1FCAA 3K5PA 2FHJA 2LEPA 1D0EA 2UVWA 2MGZB 2XY5A 4E8UA 2B4VA 4FNHA 3OFHA 3U7JA 2B56A 3CCJS 3NXZA 4ED7A 3A3OB 2V69A 3M1VA 3HULA 1EX8A 1E33P 3TOQA 5D15A 2UXDJ 4K4YA 3OR2B 2MXYA 1N2KA 1R8BA 3DCAA 1REVB 5KFJA 3OL8A 5CD4H 3FJ2A 2EFPA 2DRAA 4LF5J 5K9FA 1ELOA 5L0KA 4DL2A 5HL7Q 4Z2XA 1K1SA 2ZH9A 5MAOA 2O3DA 4ZCMA 5JMNA 1HHTP 3GB0A 2FJBB 2RS2A 1HWJA 2XYPB 3H2LA 4DG1A 2CVEA 2IJNA 1NMEB 3D3BJ 3X1LB 1P8GA 4NRTA 4CQ1A 3BDPA 1MNEA 3EVMA 2WB4A 1OWXA 3JQMA 1TELA 4ER8A 4ZKAA 4MMOA 3HF5A 2EKYA 4MIAA 4RUCA 5D3GA 1RT3A 2D7SA 4AUKA 4H4KA 3SMZA 4J9VA 1UTAA 2EG2A 3C15B 5C2CA 3BH7B 5IWAF 2CRLA 2HQIA 3QT7A 2BANA 2B9YA 3TQ1A 2VQFJ 4DS4A 5A2QU 1NU4A 2LXFA 5I3UA 3IN5A 2BE9B 4JOUA 1K8AT 4TN0A 1NM2A 4WKRA 1HJKA 2BM1A 2W5SA 4C4WA 4LRBA 4B3MJ 3IGNA 7FD1A 3GYNA 2HBQB 5DETA 3EE3A 1H3DA 3RRGA 1NUEA 4OHWA 3SIPB 3BBCA 1NKBA 2BKPA 2W8DA 1D9AA 2Y0BB 1U02A 1UEUA 2KL8A 3KMSA 3THPA 3KLGB 4DHVA 3ZZOA 5D6GA 3M6WA 3K7RA 3OTOF 1SJRA 4PQUA 4YOEA 4AYBD 4UOFA 1RABB 2E7VA 2PMWA 4LIRA 4RZRA 4ZPBA 4DV5J 2XMMA 2MZQA 4JBCA 1IBLJ 2L9WA 1JLGA 3KLEB 3RW6A 1FDNA 5JJBA 5D77A 4LBHA 1VJWA 4EMDA 2CJXB 5DQHA 4G65A 3CE8A 3W62A 2BE7D 1RBOB 1N5YA 2HURA 3CCZA 4KKOB 4ZVGA 1H74A 2AP6A 1M1HA 2ROEA 4OZLA 4HTJA 2DGSA 1PSDA 4ZP6A 3IBCB 4J5OA 1UWAA 2YKAA 1ALIA 3JSMB 6FDRA 3V81B 1VQYA 4KFBA 3TUZC 4JI4J 4JI7F 3CO0P 2IIHA 1WOPA 1PKUA 3J7YU 2VD3A 3DHXA 3TVYA 4TYAA 4QWDA 2UVUA 2Z56B 4C11B 1CQNA 1DFDA 2GJFA 4EWTA 5HRTA 2NUHA 5F9NA 2JOQA 4ZVHA 4U95A 3BYRA 5K20B 4LFAF 2IC3A 4X62F 1RLCL 3T9ZA 2OAUA 4U96A 3CIZA 2C3UA 2GJ2A 5INHA 3BDGA 4YN3B 2LQ9A 1V3ZA 2BW7A 3TZYA 2AYGA 2DNOA 7AT1B 4NZ7A 4G1PA 1IJEB 2KI2A 3KXDA 4CTAB 2Z57B 4IG0A 2IY5B 1RWKB 1XMQF 2AHOB 1C0UA 1HYSB 1R89A 3W63A 2CQBA 4A4JA 2XO7A 3QIPA 5EWEA 4M5LA 1SKSA 3J80U 1N32F 1Q86T 4C8OA 1IQZA 1AJCA 1MN7A 3GSIA 5KG0A 4NLQA 2J7WA 3DRRB 1FF2A 2Y8YA 1Z2ZA 3MEEB 3MR2A 4QR0A 3ETOA 2FVQA 3GV7B 4EYIB 1HNWJ 2JVOA 3TJAA 2ZHAA 2UUAF 1FRHA 4O0NA 2KRRA 4WFYA 5EGYA 4NLPA 3M4XA 3RB4A 5J1EA 2R7WA 4P74A 1TV6B 4LR9A 3V4IA 2OP5A 4ED1A 5DG9A 3OL6A 5DQGA 5HQMA 3PX6A 2RILA 5E3AA 2GCFA 3MM6B 4ZJQA 1T05B 5A0YB 4FS2A 1LWEB 2QYGA 3NGKA 1KH4A 2ZEJA 1XMBA 1YKWA 2XMKA 4IUFA 3N01A 1B64A 4TU9A 2F9JA 3CCTA 2LCWA 4B3TJ 2UV8A 3SSQA 3HPOA 5EGEA 1ZAVA 2QFJA 2FLNA 4NRUA 3CCES 4DUYF 2IRUA 3Q3QA 5HP1A 3U1MA 3VGTA 3KJQB 2GO9A 1T95A 3WX4A 1BQMA 1VQ9S 2ZHOA 1ELYA 3VF0B 2AYMA 4DBQA 3MOZA 3DLJA 4G1IA 2FHOB 2HWHA 1S77D 4NLDA 3BKFA 1VS3A 1SC3B 2WAQD 2KG1A 3ZNUA 2KKHA 3I55S 1SH0A 2MKKA 4QPXA 2BZ2A 1BXNA 1U0SA 2WSEC 3OPKA 2VG6A 1X4HA 1U1LA 3GR1A 4F25A 4KHPF 3KHRA 5L1IA 3DRXA 5SZTA 1Q5YA 3PVXA 1IKYA 2YWKA 1RT6B 1C4AA 2Q43A 2OMOA 3HHEA 1GFWB 3K0JA 3T19A 2M8DB 3D0HE 3R7SB 2VUGA 4CM0A 1OSDA 2H5EA 5KFDA 1S7HA 4FF3A 3W60A 1N5SA 3P96A 3PYEA 2KU7A 4CXKA 3QJLA 1RTIA 2BXJA 3Q2TC 3QYYA 3QT6A 2ADBA 2AQ4A 4URSA 2Q66A 1SUQB 2YTCA 4WKYA 4EZ9A 1FFGB 1IKXA 2F4FA 1SIWB 4OQJA 5IWAJ 4JYAF 4L3KA 1FRKA 3CJ0A 1CULA 3HVTB 2WZ1A 1N56A 4RU2A 2YX7A 3NGDA 4OI3A 5F41A 5L46A 1RB0A 4DDFA 2GVDB 3VQTA 5B0GA 2RU9A 4RR5A 1BC6A 2K7KA 4NLSA 4RW7B 4LRDA 4MY4A 2KTQA 4B9SA 2AZ3A 2RKIA 3NEKA 2WCXA 1KFSA 2ACMA 3D3CJ 1J5OA 3NS5A 2DCLA 3CCQS 1BQNB 2MHNA 3NWGA 4KO0B 3MEDB 3OFFA 4Q45A 3OTOJ 2W4CA 1JWWA 1OPZA 5B09A 4PWUA 1S1VA 3JAMY 1N5TA 3DOKB 4CNZA 3H2UB 3OXLA 1JXVA 4ANDA 2KZMA 3T6JA 4Y0FA 4IFYB 2Z2LA 5JXSA 1HBOA 3AB4B 2B7BB 2QMWA 4U6PA 1O98A 2GLQA 2F4VF 5IJQA 1S9GB 4CLLA 1VMBA 4RW8B 1ZPWX 4YP3A 4PUOB 4NLOA 1DTQB 1RDRA 4KQZA 3WAYA 3WIVA 2GX8A 2A18A 2M3DA 2WONA 4ECUA 2V8PA 2DR5A 4DN9A 4OZJA 1VRTA 1FDDA 3QO9A 5GAGU 2BBEA 2V8HA 4JI7J 2EBEA 4NXNF 1RUSA 4JI2F 3M8ZA 4X66F 3RBZA 5D4OA 1G1XA 2EC0A 2QZ8A 1VFJA 1P1LA 1EB0A 1RU2A 4YR0A 3LGNA 4QYZK 5HO4A 3SSRA 2VQEJ 3UWTA 2HBZB 4USHA 1PBAA 4LFAJ 4X62J 2HFNA 4V1Ak 2C28A 1DY3A 2JHEA 1RWVB 1F5CA 3RR8A 3I0SA 3HVWA 4DFPA 3CEDA 3PO4A 3W2WB 1U6BA 1O8BA 5KFBA 3CPWR 5LIAA 3EDQB 1X4DA 1S57A 3HK2A 4WFZA 4Q0BA 1XMQJ 1VQNS 1C1CA 2FLOA 1D1UA 3QGIA 3RW7A 2R7VA 4CLPA 4MK8A 5DM6Q 3A13A 3PTWA 3HJFA 4Y00A 1TMJA 2CNOB 2AKWB 3PFOA 2OIHA 2V34A 2R7UA 5GADU 2PN6A 4TU8A 3KK1B 3ET6B 2ZM6F 3Q8RB 1N32J 1R0AA 3MM8B 5DLVA 4WXOA 1PCAA 2QIFA 3AHPA 5I42B 5A2QY 1EETB 2RQKA 4DL3A 5ETMA 3BGRA 3VAJA 3D1QA 2BDPA 1M5PC 1EZZB 3WQPA 1V5VA 1RCOB 4O4GB 5GOVA 2X1FA 4LR2A 3PIPQ 2UUAJ 4OFZA 1WHVA 4LUBA 3R2DJ 1T9TA 5J2QA 2PC6A 4QIGA 1X4FA 3PKYA 4LRFA 2OPPB 1NDKA 3DU6A 3WBZA 4KH0B 3K5LA 1M5VC 2KM8B 4GTXA 5JVGQ 3DLEA 1YTYA 5IV4A 2EFNA 2MQQA 1ZAXA 4NEZA 4DSKA 2DNPA 2VOOA 1ZEFA 2ROGA 4LF4F 2ZITA 3IA0A 5KG5A 4ENOA 2XS7A 1SKWA 4DUYJ 3RRKA 3B82A 4TU7A 3PR5B 2V2KA 2C2RA 1AFJA 4L76A 3DI6B 1R6VA 4F50A 2OEMA 4WZMA 2JX2A 4L74A 2QMXA 3K5NA 3G8QA 2ZC4A 3I56S 1UPPA 1BUXA 3M9NB 2XGPA 2H48B 3CJRA 4IH7A 4H54A 3QAUA 4DX6A 4LR7A 4KT0C 1R43A 2LYVA 3BSOA 1R0BG 3GJQB 2AJFE 4KHPJ 4E98A 4OI1A 1U26A 3V5RA 4DUTA 4O3QA 2BVZA 2DNGA 4CWBA 5L39A 3NMAA 2C2MB 3HHKA 3DXSX 4QR1A 4FZVA 2GGPB 4XIUA 1O6XA 4B3OB 3ILOA 3MECA 1LV5A 1RT2A 2V9WA 4IDKA 3UDEA 2PFFB 1Y5IB 4FNIA 2DITA 4TN2A 1WOOA 3JSYA 3W8GA 3I0RA 4NYPA 4KH1B 1L3UA 3D67A 2MKHA 3Q23A 1HKAA 3TJ9A 2FHKA 3NGSA 3AOCA 4A8OA 3GFHA 1QJHA 4ES1A 2G9OA 4BCAA 1VCTA 3ETMA 1S1UA 3JSBA 4TY8A 4C0HA 2I1RA 4F02A 1T9WA 2D1GA 5CYQA 4UOGA 4KE5A 3SV3A 3TARA 3DRPA 3J80Y 2YWFA 4ZG9A 3DHWC 1WKLA 1B0VA 2R4FA 1ZYQA 3OTCA 5T7LB 4JV2A 1HPZB 3G6ES 4ZVPB 2UVRA 1XNRF 3CD7A 3M2VA 2XYGB 1FD8A 4ZK7M 5LSRA 1H7XA 1O5JA 5KFRA 1Z1ZA 3M2RB 1XNQF 1E6VA 2O66A 1FA0A 1CS4A 4WYWA 3CTRA 2BJ1A 1R6YA 1HI8A 2BX6A 1B7YB 2IYIA 2MZJA 1NJIT 1UP1A 3QNWB 2LQJA 1NK4A 2PI5A 2HS3A 2CQHA 2V67A 1S6PA 3I82A 4J9SA 1RK8A 3B78A 4ZDNA 4ZVEA 3QPIA 4WK3A 1IM4A 4MJKA 4P75A 2VHGA 1UA1A 2F4VJ 4EBCA 1VJQA 3I4PA 2XYHB 3LP2A 1WI8A 3HLUA 5A8KA 2HVEA 3NKOA 1V6HA 1VK3A 2FGOA 1SQEA 4WPAA 2VIHA 2V9KA 3KDOA 3RUBL 1ANIA 1PC4A 4R8UA 2LU2A 2QSFA 3D7SB 1FKPA 2CVIA 1WELA 2VJUA 1OYEA 5J2PA 4LQ9A 5JUMA 3B5QA 5IFMA 2BOAA 1CC7A 4NXNJ 4NCAA 3V6KA 4JI2J 2R7TA 4X66J 3DOLB 1SPBP 1TUVA 4UY8T 2B6AA 1TQLA 4ID5B 3UNYA 3ZZRA 3HI9A 5F8LA 3DYAA 3RBXA 4WE1A 4V19J 3MK2A 1WOSA 4O3SA 3H25A 3QLHA 3FEXB 3Q2SC 3P45B 2XGQA 2AMCB 2F1FA 2W24A 2M4MA 5KFAA 4MKBA 4DSEA 2XS2A 5HJXA 1OY6A 4N8NA 5CH7B 1SQGA 1RTZA 2GFFA 3IS9A 1NPKA 1YQHA 1YRTA 4N7TA 5AE2A 1KH9A 3Q8PB 4ZG6A 3I9V9 2NXNA 3QSYB 3M1VB 4C97A 5A8RA 4CO4A 1JXLA 1VLOA 2YKOA 3NKRA 3WC2A 3HKZD 4HHHA 1EIYB 4AFFA 3DKDA 2ZM6J 1TAQA 2G0JA 1Q16B 3NKPA 3HZEA 4WJBA 3HVRA 4QIFA 2AYBA 3QFWA 2HVDA 1NJYA 3U02A 1G6BA 3N0VA 4G1QA 2N7YA 1MMNA 2AWZA 2KO1A 4WFXA 2HW3A 2BJ3A 5IXUA 1TKZA 2RIJA 2JEGA 1N6QB 1BWVA 2RQCA 4YFUA 3M7VA 4RU9A 2M2BA 3EGWB 1RT7A 4NL5A 4DG1B 1Q95G 1UZDA 2OLWA 1M5KC 2XHCA 1T9YA 3AQOA 1KC8T 3H7HB 1MMDA 1LOUA 1UW4A 1H0HB 1B8JA 3OR1A 3GYXB 3PW5A 3TX8A 1WC5A 4Y2KA 4P73A 4GVBA 3BV8A 2ZBPA 4ED6A 1KONA 2Z2MA 2MB0B 2I6WA 5D3GB 3TW0A 4MYTA 1RT3B 3VAHA 4P6QA 3CCUS 3DLGA 1E3CP 3OVAA 4CO0A 3BBFA 2XTJP 4JI8F 2BANB 2WVFA 3OQ2A 2ERRA 5ETTA 5CCLA 2DRDA 4LF4J 3P5BP 3RB3A 1SHQA 5I3UB 4O44A 2MY8A 2GSOA 4A8XA 4AXIA 4WIQA 2VH7A 2H4YB 3I6PA 2DNZA 4BC9A 5DQIA 2P6TA 1UKUA 1NJZA 3MK1A 3VGUA 2DYAA 3IR7B 1DARA 2K8GA 2M5YA 2DHSA 1D9DA 1ANJA 5JVHQ 2OUGA 3OHAA 4C98A 3J81U 2MKYA 4QIVA 3CDAA 1OJ4A 4N8OA 1F0XA 3Q22A 1VK8A 3TWZA 1MW7A 2RB7A 3TP2A 2ZUAA 1S79A 4EUVA 2OI2A 1KQFB 3PW4A 2DHAA 3FMWA 5B0FA 1RWMB 2GA3A 2F8MA 1KOHA 3GILA 2GHWA 1JLGB 1X4BA 3OTBA 4LF6J 4B56A 5LSLA 3HSDA 4NOHA 4IR9A 2DR8A 3F41A 2M7SA 2HG4A 1ZM3A 1N5YB 1U1QA 2GMJA 4J91A 4OYAA 2OPQB 4J9PA 2DGOA 3FQKA 4DSLA 2VU5A 5BYSA 5G0RA 5AJ3F 2DEIA 5HROA 2DR6A 2E1PA 4WFBQ 1LWXA 2XZWA 1PJ7A 2PIIA 4KFBB 2W8LA 3JTPA 3DN9A 2MZ1A 1CJUA 4FXDA 5ETKA 1Y5LB 3E2EA 4ZPVR 5M2RA 3IRWP 1HD0A 3EJMA 5AXLA 1FWPA 1VOMA 4IO1A 3P5TL 3TRGA 3CJ8A 5HI7A 2X1GA 1QVGR 1KHVA 2IC3B 3KOAA 2R7XA 2YKNA 4FBUA 3D4JA 1KD1T 3BDGB 3AFGA 2WTFA 1XNRJ 2V2ZA 2D1CA 4XAKA 5C42A 5K8OA 4DQPA 3TJ8A 2KB2A 3MCNA 2GZOA 2V8GA 4IG0B 4B08A 4CLSA 1ITPA 3CJSA 4DU7A 3LQVA 1FK9A 1C0UB 1XNQJ 5KFXA 2IA6A 3T5HA 3ZTRA 3M9MB 3UI3A 2UUTA 1TK0A 5KAKA 4L75A 3C8YA 1REVA 1SXLA 4MFBA 5ETQA 4RUAA 1BGXT 3NAIA 1ZZFA 1FRIA 3JXOA 2ZH1A 3RZAA 4DU8A 2RUGA 2FC9A 6FD1A 4PEOA 1B7FA 2BABA 5KFVA 2ASJA 4OLPA 3IRXA 5DDQC 1IKVA 4P2FA 5J1EB 2XY6A 3CCSS 3MTJA 2FJVA 5DG7A 4WP8A 2RRNA 2XY7A 3V4IB 4JV1A 2MJUA 3SV4A 3GJSB 5KFQA 2JLEA 5HLFA 2IAJA 4QWAA 1U09A 1RWUA 3KFWX 4Y34A 1MMLA 3HX9A 4PCQA 1RXOB 4DPWA 5LMNF 1GX6A 1NSAA 1RWWB 4TLRA 5CQGA 1E1ZP 3NKQA 2JEJA 2CJQA 1ZPVA 3D54A 3FRZA 2ZH6A 1RWOB 3QFHA 4ILMA 5L0EA 4K4TA 1U45A 7FDRA 1YBAA 1RCXB 5HP1B 2DXEA 2W2PP 3E01A 2W9BB 3KUEA 4DPUA 2IDEA 5HMZA 1UFKA 5B0CA 4HKQA 2YPZA 2E1MC 1BQMB 4Y2CA 3NRBA 3BGLA 1V9OA 1VRUA 3OJUA 1PC5A 4GO5X 1RBAA 4W90B 5B7WA 2J7KA 4URGA 2VA2A 4HH1A 2QLFB 5LJ5Y 4C8KA 3N6LA 1UFLA 3B54A 1SJ1A 5LL6d 2WBMA 2UXBF 4J37A 4ZPCA 1RTDA 3I96A 2VG6B 3JTNA 2DCUB 4IRDA 3OSNA 2YNHA 4DOZA 3V6JA 1TMMA 3T5LA 2FQQB 2RNEA 3B8HA 4HDGA 3G96A 2CPHA 1KHWA 3CT9A 4OJHA 4RPFA 4CYRA 1QM9A 1RI7A 4X4VA 1GMUA 3C3LA 2E5GA 4OL8A 4FPRA 4ZOSA 1RHRB 1MROB 1ZM2A 3AT1B 3SCKE 2XHWA 1NKEA 3K58A 1YHQS 1RTIB 1XWLA 3E2DA 4WYLA 4G3IA 5DGAA 4I69A 2YQ1A 3DLHA 3NKNA 1TTHB 1WJ9A 3L7OA 1IKXB 4MK7A 2L08A 1EP4A 4Z7CA 2ZDOA 5L0BA 4USJC 2YWHA 2LA4A 4KGVB 5C66A 4JI6F 1CULB 5AJ9A 1ZEDA 2KFNA 2G1DA 4PR6A 4K4VA 1NH7A 2JVRA 2HK3A 1YRXA 4DL6A 1U0HA 2NLWA 4YB1P 3Q89A 4XPEA 2FB0A 4PXDA 3NKMA 3H0PA 4FDFA 4MK9A 5KG2A 3PJ9A 5I3QA 1JJ4A 4C8NA 2MQNA 1RTJA 2RKIB 3PRVA 3KLIB 4DL0C 1X5SA 1J5OB 4PRFA 4CLTA 3CUNA 2VV5A 2W8SA 3R8YA 2E44A 1UW9A 5ETVA 9RUBA 5L1LA 3GCWP 1RAIB 1S1VB 2W5XA 3HVAA 3G71S 3H42A 4C8LA 2CFXA 4HACA 3MFHA 1URAA 3GZ7A 4YR3A 2IYGA 1HBOB 1XK8A 2G2OA 4C6AA 2VONA 1FVQA 1SL0A 3BF4A 4L3NA 1LW0A 1Q8IA 4RBVA 2GHPA 1TKTB 2HIQA 5AJ3J 3PG9A 1KP6A 2ZUGA 4ZJOA 2WONB 1WHYA 5C24A 4YS2A 1FI4A 4LBIA 1VRTB 3QO9B 2UV8G 1T3NA 2VFTA 2HHXA 2BA9A 2YY3A 1FJCA 4MTPA 3PRDA 4FYVB 4A46A 1PAUB 2XQCA 3MM6A 3ZZZA 4M5DB 1H2UX 3NGTA 1RLDA 3US5A 1IUJA 3HSZA 3TA0A 3P8BB 4KC5A 1N48A 2W2OP 5CA5A 3I0SB 4KHMA 2XWXA 1EQ0A 3MD1A 3CCMS 3KLHA 2KRBA 1I3OB 2DNHA 3QGGA 1GQEA 2B7CB 3JSRA 4TYBA 2ZDPA 3EDRB 2KN4A 4MIBA 4NYOA 4Q0BB 1C1CB 2OD6A 1U8SA 1X7VA 2EVZA 4KGKA 4MHXA 3SDEA 4GKKF 3SQGB 4LF8F 4LRCA 1R0CB 3QSIA 1CJVA 1U2CA 9ATCB 3SYZA 3HMJG 2XO6A 1WG5A 3EVOA 1VQSA 4HTIA 3FRYA 1R0AB 3QJJA 2QTWA 5A76A 5IJSA 4CH1A 3W2VA 3OVSA 3LUYA 3M8QB 2DGXA 3BGRB 5HQLA 2ZBQA 3D9BA 2N82B 2CPYA 2M8HA 3EGZA 1S0NA 1UVLA 2CZVC 1UFWA 5AXMA 4NX9A 1F9HA 3H8YA 3FZBA 3FQLA 2DNRA 4DL5A 4K4ZA 2LQ5A 3RRHA 2R42A 3J81Y 4S0MA 4K4UA 3UCUP 5CD4A 5J2QB 4EBDA 2FLLA 4TQSA 2LU1A 4DN0A 2H65B 1S9FA 3MM9A 5EUHA 2HLTA 4IOCQ 2ZVIA 3IO1A 2QL7B 3DLEB 3A3PB 1G4CA 3PY8A 2P9CA 2W7PA 3QMQA 5GAEU 4ZS6A 3G82A 5K4PA 2LXUA 3MZIA 1SI9A 3GIRA 4HI2A 3CMES 2HKEA 2C3OA 4DV2F 1T9VA 2FVRA 2L3MA 2W9AA 1HHSA 1YZ7A 2XMUA 3ICLA 2B3TB 1ELZA 2PEBA 1KSPA 2PSZA 2HGNA 2JWNA 1NLKL 3EUNA 1DRZA 5KT4A 3TUJC 2XLJA 2UXBJ 1FJ7A 3BPDA 1IR2A 1DLOA 4NA3A 1YSJA 4KR0B 2JNJA 5C25A 2GIFA 3FSXA 4I4BA 1BY9A 2YKMA 2DHXA 3TI0A 2VFVA 4F26A 1S6UA 1LQ9A 1TUGB 1FTRA 4Y2IA 2Q79A 2DJWA 1NRKA 3PACA 4Y2AA 3IXQA 2HZAA 3WHIA 1KHKA 3MEGA 1VIOA 2YWEA 3CO9A 3MECB 3BDHA 4IDKB 3T02A 4RNMA 3K2YA 3A8JA 5IS2A 3TAPA 3I0RB 1F3VA 3CWJA 2R8KA 5AXNA 2LDIA 3S8SA 1QVFR 2LDYA 2BKNA 2DBBA 2G2ZA 2OGUA 1ZH5A 5KT5A 1URRA 3LANA 3RBEA 3U1LA 1S1UB 2V2QA 4CO1A 4TY8B 4X2BA 4DR2F 1U25A 4DR4F 4DZDA 1AXQA 4QR2A 2A10A 3A52A 5CYQB 3W5YA 1K44A 3DRPB 1A7GE 2CQ2A 4JI6J 4HHJA 4KAIA 2H51B 4DFKA 1NBEB 1W26A 5DG8A 3O3LA 3PHEA 1AZSA 3SSSA 1X0FA 1VC6A 2W5VA 4HI1A 4RJVA 2RHSB 4FBTA 2G0IA 2W25A 2CQGA 3OW2R 2FZKB 3KJVB 3M2VB 3VR1A 5HMXA 2JH3A 5IV3A 1VQMS 2HBYB 1Y11A 2ZNZA 4RBUA 1QD1A 3W2WA 4B9TA 1WUUA 2F8EX 2MQOA 1E6VB 5DS7A 3W3SA 4KJDA 1EKSA 1CS4B 1S0VA 1HMVB 1NSPA 1PG5B 1FXLA 3GFZA 3HZGA 2BJ8A 2XCAA 1JNRB 5DLGA 3VAIA 4NE9C 5AE3A 1TU0B 4DQIA 2CNLB 1KVIA 4EYHB 3MPDA 2HK2A 1SIZA 3GWCA 1GXLA 2DH8A 4KJGA 1QY7A 1SC4B 3PRBA 4C48A 2L9NA 3MM8A 1S6PB 4K8RA 1NH8A 3GSDA 3OSPA 3BM7A 2BJDA 3BBBA 4NPOA 2BYCA 3GIMA 3CMQA 4DR3F 4CH0S 4YR1A 1SKUB 2ZZMA 4LSNA 4FYWB 1FKOA 2N3OA 3POTA 5A8KB 2D3UA 3GMGA 4ERDA 3ENQA 4DPOA 1GAOA 4R8UB 3JYTA 2XSJA 5HK4A 3IC1A 5J2PB 4AL6A 2RS8A 3FCVA 1N8RT 1KTVA 4MAKA 2HZCA 5GVQA 1CBKA 2FY8A 2CKWA 1NO8A 1JLEA 2B6AB 3TZWA 1Q53A 3DYAB 3MM5B 4WE1B 4ECYA 1J5EF 4G6VB 3PEJA 3ED4A 5CCMA 2L9DA 2CG8A 3NCPA 4N76A 1U1RA 3QLHB 2GC8A 3J7A1 2JL9A 2PE8A 4KTQA 3PFEA 1T3OA 1YJ7A 3IG1A 3L9ZA 1F60B 3AAWB 5IC4B 3IS9B 4IOBA 1IKWA 4WK1A 3BQ1A 2R7OA 3UVJA 4UY85 2ZH8A 5A8RB 2JEFA 1KLNA 4GKKJ
chains in the Genus database with same CATH topology
1KH7A 3M8ZA 1HDHA 4N7TA 1E3CP 3DPCA 3NVLA 5LRMA 3WAXA 2RH6A 4CYRA 1AJAA 1ED8A 2ANHA 4LRDA 1KH9A 2W8SA 4MY4A 4ZG6A 1EW9A 2D1GA 1O99A 1Y7AA 1E1ZP 1AJBA 3NKQA 4KAYA 4UPLA 1AUKA 3KD8A 4ZGAA 5GOVA 2W5VA 3SZZA 1KH4A 4LR7A 5L0EA 1SHQA 2GSOA 1KHNA 1ALHA 1SHNA 3NKRA 4ZG9A 5LQQA 2QZUA 3T00A 4LR2A 3WBHA 3NKOA 1URBA 1EI6A 2GSUA 1EW2A 4UOPA 1Y6VA 4QAXA 5TJ3A 1ANIA 5GRRA 2X98A 2W5WA 4NWXA 2W5XA 1ALKA 2XR9A 3WAWA 1EQJA 3E2DA 1P49A 1E33P 4CXSA 3CMRA 3DYCA 3UN2A 3MK1A 5EGEA 3WAVA 3M8YA 2VQRA 4LQYA 5DLTA 1N2KA 4NWJA 1URAA 3NKPA 1KHKA 3B5QA 3Q3QA 2W5TA 4TN0A 1ANJA 3NKNA 4CXKA 1HJKA 1ED9A 2ZKTA 4UPHA 2W5SA 4LRFA 3UN3A 3IDDA 3MK0A 1ALIA 4LRBA 3BDHA 4KM4A 1EJJA 5L0BA 3ED4A 1AJCA 4ZG7A 4GTXA 4KJDA 5LIAA 3T02A 4LREA 2W5RA 1ELYA 3IGYB 5L0KA 3OT9A 4MHXA 3TWZA 3UN5A 3UNYA 3M7VA 5K4PA 5C66A 2GSNA 4LRCA 2G9YA 5AJ9A 1ZEDA 3MK2A 3UO0A 1ALJA 2W8DA 3TX0A 5LRNA 1O98A 1ZEFA 4UPKA 4LRAA 2GLQA 5IJQA 1KH5A 2IUCB 3TG0A 4MIVA 3IGZB 3SZYA 5EGHA 4GTYA 1ELXA 5HRTA 2XRGA 3WAYA 1K7HA 1B8JA 1KHJA 1ELZA 4GTZA 4KJGA 2GA3A 5IJSA 1E2SP 3BDGB 4FDIA 4KAVA 1HQAA 4UOOA 2IFYA 3LXQA 4UORA 1AJDA 2IUCA 4CXUA 3NKMA 5KXAA 4LR8A 4LR9A 4CYSA 3M8WA 4GTWA 4B56A 2W5QA 3A52A 1ZEBA 5DLVA 1N2LA 1FSUA 3BDFA 4FDJA 4UPIA 5INHA 3BDGA 1KHLA 1EW8A 3T01A 4YR1A 5DLWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KH7 A;  3M8Z A;  1HDH A;  4N7T A;  1E3C P;  3DPC A;  3NVL A;  5LRM A;  3WAX A;  2RH6 A;  4CYR A;  1AJA A;  1ED8 A;  2ANH A;  4LRD A;  1KH9 A;  2W8S A;  4MY4 A;  4ZG6 A;  1EW9 A;  2D1G A;  1O99 A;  1Y7A A;  1E1Z P;  1AJB A;  3NKQ A;  4KAY A;  4UPL A;  1AUK A;  3KD8 A;  4ZGA A;  5GOV A;  2W5V A;  3SZZ A;  1KH4 A;  4LR7 A;  5L0E A;  1SHQ A;  2GSO A;  1KHN A;  1ALH A;  1SHN A;  3NKR A;  4ZG9 A;  5LQQ A;  2QZU A;  3T00 A;  4LR2 A;  3WBH A;  3NKO A;  1URB A;  1EI6 A;  2GSU A;  1EW2 A;  4UOP A;  1Y6V A;  4QAX A;  5TJ3 A;  1ANI A;  5GRR A;  2X98 A;  2W5W A;  4NWX A;  2W5X A;  1ALK A;  2XR9 A;  3WAW A;  1EQJ A;  3E2D A;  1P49 A;  1E33 P;  4CXS A;  3CMR A;  3DYC A;  3UN2 A;  3MK1 A;  5EGE A;  3WAV A;  3M8Y A;  2VQR A;  4LQY A;  5DLT A;  1N2K A;  4NWJ A;  1URA A;  3NKP A;  1KHK A;  3B5Q A;  3Q3Q A;  2W5T A;  4TN0 A;  1ANJ A;  3NKN A;  4CXK A;  1HJK A;  1ED9 A;  2ZKT A;  4UPH A;  2W5S A;  4LRF A;  3UN3 A;  3IDD A;  3MK0 A;  1ALI A;  4LRB A;  3BDH A;  4KM4 A;  1EJJ A;  5L0B A;  3ED4 A;  1AJC A;  4ZG7 A;  4GTX A;  4KJD A;  5LIA A;  3T02 A;  4LRE A;  2W5R A;  1ELY A;  3IGY B;  5L0K A;  3OT9 A;  4MHX A;  3TWZ A;  3UN5 A;  3UNY A;  3M7V A;  5K4P A;  5C66 A;  2GSN A;  4LRC A;  2G9Y A;  5AJ9 A;  1ZED A;  3MK2 A;  3UO0 A;  1ALJ A;  2W8D A;  3TX0 A;  5LRN A;  1O98 A;  1ZEF A;  4UPK A;  4LRA A;  2GLQ A;  5IJQ A;  1KH5 A;  2IUC B;  3TG0 A;  4MIV A;  3IGZ B;  3SZY A;  5EGH A;  4GTY A;  1ELX A;  5HRT A;  2XRG A;  3WAY A;  1K7H A;  1B8J A;  1KHJ A;  1ELZ A;  4GTZ A;  4KJG A;  2GA3 A;  5IJS A;  1E2S P;  3BDG B;  4FDI A;  4KAV A;  1HQA A;  4UOO A;  2IFY A;  3LXQ A;  4UOR A;  1AJD A;  2IUC A;  4CXU A;  3NKM A;  5KXA A;  4LR8 A;  4LR9 A;  4CYS A;  3M8W A;  4GTW A;  4B56 A;  2W5Q A;  3A52 A;  1ZEB A;  5DLV A;  1N2L A;  1FSU A;  3BDF A;  4FDJ A;  4UPI A;  5INH A;  3BDG A;  1KHL A;  1EW8 A;  3T01 A;  4YR1 A;  5DLW A; 
#chains in the Genus database with same CATH topology
 4LF8 J;  2HHQ A;  3NVL A;  1SH3 A;  2MYF A;  2OJ3 A;  1IJF B;  1HNZ F;  4UPL A;  1FXR A;  3M2U A;  4M5K A;  2KZZ A;  2MKJ A;  1F2G A;  3S6E A;  1T11 A;  2ZOF A;  5E0O A;  4G1Q B;  5ETR A;  1OY8 A;  2LQB A;  2GIR A;  3KHH A;  2DNL A;  3BSA A;  2DXF A;  2EFV A;  2QLW A;  5RUB A;  1A9N B;  2CQI A;  2ZWO A;  2KFZ A;  5L9X A;  3BQ0 A;  1RT7 B;  1LWC B;  5F8J A;  3W61 A;  5KFN A;  1PYO B;  2CG4 A;  4RL1 A;  1OSC A;  2MMY A;  3VWS A;  1CSJ A;  1L3K A;  4X4P A;  3D5M A;  4GVB B;  1VRQ C;  1S1T A;  3HT0 A;  4F04 B;  5DDO C;  4A8Y A;  1U7L A;  1NPR A;  3ZTO A;  3DLG B;  1KR4 A;  3RGI A;  4HT5 A;  3UE2 A;  4ATN A;  2LFV A;  5HJY A;  3T01 A;  1UMJ A;  2GQC A;  4ELT A;  1JKH A;  3BO3 A;  2V2V A;  3W5X A;  1WC1 A;  1H98 A;  3IM8 A;  3MCM A;  3BDE A;  3LO3 A;  3FUY A;  4DV2 J;  3D28 A;  1NJW A;  1ACM B;  2ALY B;  5CXT A;  2W2N P;  2QEX S;  2C2K B;  4ANC A;  1NB2 A;  5K8N A;  5LJ3 Y;  2HQ3 A;  1SCJ B;  2EK6 A;  8AT1 B;  4W98 A;  3V2U C;  4ECT A;  1N36 F;  3CJ5 A;  3FKB A;  1R31 A;  1BHN A;  3OT9 A;  4DWI A;  2YBV A;  4USK A;  5LM7 E;  1S12 A;  5IC6 B;  1LK7 A;  1JLC A;  3NBP A;  5HVG A;  3TX0 A;  4R25 A;  3D2W A;  2PA8 D;  4B3R F;  2VFS A;  5AT1 B;  2OFH X;  2W7A A;  4OYO A;  5B0B A;  2QFI A;  4YHH F;  1NK0 A;  1FWK A;  2J8A A;  4UUW A;  1QTM A;  2XCP A;  4UPI A;  1ICE B;  3W9H A;  2FGC A;  3VAM A;  4RKU C;  2HIY A;  4LBP A;  4MYU A;  4DCP B;  4YME A;  5G0R B;  5HRO B;  1S49 A;  2H54 B;  4CH7 A;  2HS0 A;  2FHM A;  5F3Z A;  3HD2 A;  3LAM A;  4OV6 A;  1C1B B;  2R7S A;  4L73 A;  2CQ0 A;  1CJU B;  1I6J A;  4QYZ J;  1IWG A;  1XN9 A;  3MFI A;  4DR2 J;  1SC6 A;  4DR4 J;  1CQM A;  4HYK A;  5C7P A;  2HQF A;  4F8R A;  4WWS A;  1SL2 A;  2V68 A;  2GV1 A;  3U27 A;  3C2P A;  3HSG A;  4XPC A;  2Z8Q A;  3AA9 A;  3HHL D;  2C2E A;  1C2P A;  4PQA A;  4HVZ A;  2RQ4 A;  3I4H X;  4KB7 A;  2LP4 A;  2P5V A;  1T7P A;  1L5U A;  2VAS A;  3ONQ A;  2FJW A;  1WTF A;  2PA3 A;  2DR9 A;  5C42 B;  3LTO A;  2IDL A;  1XR7 A;  1VBZ A;  3C16 A;  1TFW A;  1HWI A;  1CLF A;  1R8H A;  2B4U A;  3SFU A;  2ABY A;  4J90 A;  2XSF A;  2XI2 A;  3G86 A;  1W7W A;  1NCL A;  1FK9 B;  1VBY A;  2MLY A;  3RAQ A;  3T3F A;  3IR6 B;  2CQC A;  4OYM A;  3LF0 A;  4Q43 A;  3CCW A;  1EW9 A;  5EWF A;  1GMW D;  1LEO A;  4HT7 A;  3ZNJ 1;  4MFB B;  5KT7 A;  3K17 A;  2RRA A;  1HQU A;  4QAX A;  4CLF A;  2GQ2 A;  2I2Y A;  3IP0 A;  5J1N A;  5AE1 A;  3DYC A;  1QDU B;  1AYE A;  2CJ9 A;  2DRB A;  3R1L A;  2FJA B;  3A8E A;  4DR3 J;  4OZN A;  4CT8 A;  1N6Q A;  3IRX B;  3EGV A;  1RU1 A;  1S72 S;  4N47 A;  4BS2 A;  1IKV B;  2SXL A;  3MWB A;  2V63 A;  2YVS A;  3ZTP A;  3CC4 S;  3AJD A;  5BYQ A;  2GSN A;  5HLF B;  2IAJ B;  2J9D E;  4HDH A;  1WC4 A;  4LF2 A;  4BBY A;  1RAF B;  2DKO B;  4EBE A;  3GYG A;  1WHX A;  2KHC A;  2QC3 A;  2BMB A;  1KVK A;  1KNZ A;  1EAY C;  2LEB A;  4RLE A;  2Q1L A;  2JLF A;  3R9L A;  1J5E J;  4KV8 A;  1C4C A;  3HFV A;  1Q1K A;  1UJ6 A;  1FD2 A;  1YI2 S;  4OJG A;  5F8M A;  5CYJ A;  4B9N A;  1QAI A;  3EXY A;  3MI7 X;  3E01 B;  5KG3 A;  2FJX A;  4NYZ A;  3KD8 A;  2CYY A;  5D0H A;  3OHB A;  2WK4 A;  2V5H G;  2QZU A;  4IQX A;  4C3M A;  2X98 A;  3BZQ A;  2VFR A;  1HQ2 A;  1VRU B;  2DXD A;  4NXM F;  3UN2 A;  5A6P A;  2XG8 A;  3I32 A;  4FKY A;  5ETL A;  1SJ3 P;  2IM2 A;  2AD9 A;  1RTD B;  1RWX B;  4ZG7 A;  1HNZ J;  6AT1 B;  1SVD A;  2YNH B;  1BMQ B;  5BYR A;  2RHQ B;  4YDX A;  3UD5 A;  3H20 A;  4NZ6 A;  3MMJ A;  3UR0 A;  1JJC B;  3H5S A;  4CO3 A;  2KFY A;  1RHJ B;  1EQM A;  3EM1 A;  4H4O A;  2HPU A;  2QLX A;  3OXF A;  1RYR A;  4XTT A;  4K4S A;  4FVM A;  3HXM A;  1X4C A;  3DC2 A;  3NOG A;  2IUC A;  4PZV A;  1RZM A;  4PXC A;  1DHM A;  4OZ2 A;  1S0O A;  2K1R A;  2OPQ A;  1RAA B;  4R5P B;  1AJA A;  1OPI A;  2XMA A;  4DCJ B;  3V6D A;  2MTL A;  3EIC A;  2RT3 A;  2AGO A;  3KNG A;  4OX7 A;  4DX5 A;  1HI0 P;  4E0D A;  5F9L A;  1KFD A;  5EDW A;  1UWB B;  4UOP A;  2NCK L;  2IRX A;  1YDL A;  2FYX A;  1JJH A;  1EP4 B;  3VGS A;  3UR3 C;  1NDP A;  4FPI A;  2I8E A;  2WVB A;  5K5M A;  3RB6 A;  4TLQ A;  1RTH A;  4UPH A;  5HAT A;  2VQE F;  4GO7 X;  1FFS B;  1H6K X;  5DJB A;  2BRK A;  2D69 A;  2ZBC A;  3G8T A;  1TL7 A;  1WKJ A;  2JZ5 A;  1T03 A;  4DSF A;  2B9W A;  1U0H B;  3W66 A;  1DJ0 A;  4L72 B;  3M9O B;  4A8Q A;  5DDP C;  1H2V Z;  2DGU A;  2KDO A;  3EWG A;  1RTJ B;  3Q86 A;  4FXW A;  4UOR A;  3FK4 A;  5GAH U;  2OSR A;  4CYS A;  4KY3 A;  2ZFH A;  3NNA A;  1N36 J;  1H38 A;  3EVW A;  2HHP A;  3GPA A;  1PJ5 A;  4Q44 A;  3CDU A;  3J7A N;  1P9Y A;  2FHJ D;  1X4G A;  3QAT A;  4A8W A;  5H1S V;  5C2G A;  1D09 B;  4B17 A;  5ETS A;  2HRU A;  2QA4 G;  2EEY A;  4B3R J;  2QYC A;  3N6M A;  2MZS A;  1QSL A;  2Q6B A;  2OKQ A;  2VC1 A;  3ZZ0 A;  4HAC B;  3UCG A;  2XI3 A;  1HWU A;  2J8S A;  1WF2 A;  4CP5 A;  3VCD A;  3LAK A;  3J7Y I;  2MHE A;  4YHH J;  4ITS A;  2XZT B;  2V8D A;  1XR5 A;  2VC0 A;  2B8Q A;  4ECQ A;  4ED2 A;  3B4D A;  3I5C A;  3BN7 A;  4UZB A;  1I94 F;  5LXY A;  1LW0 B;  1NEE A;  8ATC B;  1RT1 A;  2X3G A;  1CEZ A;  1TVR A;  5C24 B;  2O1P A;  3AH6 A;  4DZ6 A;  1UJ4 A;  3BKU A;  3S1T A;  3P6Y C;  2C3M A;  4GTZ A;  4OYB A;  4DX8 H;  2DY1 A;  4ZVQ B;  4ZVR B;  4NLU A;  2ASL A;  1M5O C;  4FDJ A;  3NCR A;  1EW8 A;  2DK2 A;  3PX0 A;  2RU3 A;  4GRS A;  4DFM A;  1YJU A;  1SV5 A;  1MU2 A;  2UXC F;  3MPY A;  3KLH B;  2W9B A;  2DNN A;  3BSC A;  2X7I A;  1SKR A;  3NOC A;  2PDA A;  1RT4 A;  2RAQ A;  2W5W A;  5KT6 A;  2G0C A;  2IJF A;  3WAV A;  2ILZ A;  4WFN Q;  2VQR A;  1RT5 A;  2YX1 A;  3R5A A;  4LFC F;  3SDE B;  2DGT A;  2HFU A;  3QAE A;  4P10 A;  1GNK A;  2IA0 A;  1CJV B;  1PAE X;  1HNI B;  4WZQ A;  4C9D A;  1U8W A;  3KG0 A;  2ZE2 A;  4FF4 A;  3IBW A;  1QUP A;  3CJK B;  2RDJ A;  3W2V B;  3M6V A;  5DM7 Q;  3WDO A;  2O01 C;  3IGZ B;  3CJQ A;  1JNZ B;  3MR6 A;  5G4D A;  3QT5 A;  3N9U C;  4ZCI A;  4ZVO B;  2FZC B;  4DF8 A;  1SQF A;  5IM0 B;  3ADA C;  4UOO A;  2JFK A;  3C66 A;  3UCZ P;  3D0G E;  3ZTS A;  5EX3 A;  3PIO Q;  3GG0 A;  3VVT A;  4F3Q A;  2LLZ A;  4EZ6 A;  4NLG A;  3HO1 A;  1VQL S;  2IFX A;  3AD9 C;  4FYD A;  2Q6C A;  2A1B A;  1HNV A;  5HBM B;  1MRO A;  1DTT A;  3MUR P;  3TZZ A;  3MM9 B;  2DIS A;  3FBF A;  1AW0 A;  1XTZ A;  3DGP A;  2OEK A;  1EW2 A;  2G2Y A;  3PHT A;  5M2P A;  1DBD A;  3MMB A;  1YLX A;  3GIK A;  2PMH A;  3C14 A;  5EX0 A;  2KXF A;  3G82 B;  3MPU B;  4ZLL A;  1I1G A;  3NNC A;  3AXM A;  3M05 A;  1UVN A;  1WOR A;  4NA1 A;  4YDD B;  1ROF A;  1B99 A;  4UF4 A;  3DRS A;  3TO8 A;  4PG7 A;  1TK5 A;  1WEX A;  2WVE A;  1FO1 A;  1RKI A;  2PI4 A;  5LRN A;  5A8W A;  1Q0N A;  5IT4 A;  4A48 A;  3KK3 A;  1X9M A;  4NXM J;  3NGR A;  1S6Q A;  1Q7L B;  4ED4 A;  4IFV A;  2UVV A;  4OHZ A;  1VBK A;  3N79 A;  3FZ2 A;  4OI4 A;  5ADZ A;  3KLI A;  4D3G A;  1NDC A;  1DLO B;  1QAY A;  1G7C B;  1R27 B;  5C25 B;  2D9O A;  2YKM B;  5IQQ A;  1RYS A;  1HBM A;  5B0A A;  5K8M A;  3FBB A;  2Z0G A;  1VQK S;  1VIS A;  5KFT A;  3VV2 B;  2OEJ A;  4C0B A;  1RAD B;  3MEG B;  4ELU A;  3B4M A;  2WW8 A;  2E7W A;  2AEJ A;  3RG6 A;  3ELH A;  1O51 A;  2Z58 B;  2VOD A;  5DLT A;  2KVQ E;  4DR5 F;  4WP3 A;  1NHK L;  2DIU A;  2WRM A;  2VBX A;  3OFE A;  4KM4 A;  1F9F A;  2A6O A;  4OV1 A;  1NND A;  1VR6 A;  1TKT A;  2QO3 A;  2W2Q P;  1ZM9 A;  1PIL A;  3MR3 A;  4USV A;  1E6Y A;  4NML A;  3OXG A;  2F8H A;  3A4T A;  3TG0 A;  2NZ4 A;  2F40 A;  4NMX A;  1ULR A;  4F0M A;  2PFD A;  2D41 A;  2BEF A;  1FEH A;  1Q82 T;  3HHL A;  2CXE A;  1MWZ A;  3PDN A;  4M5D A;  4OZ0 A;  1AZS B;  1MLA A;  3Q8Q B;  1U2F A;  3TEG A;  1GT8 A;  4DSI A;  1VQO S;  3CJT A;  1APS A;  5DGB A;  1Z4U A;  5D0E A;  2UZA A;  4P52 A;  3ENA A;  4UQG A;  3V4M A;  3IFE A;  3FSI A;  3SCL E;  3KYL A;  4LF7 F;  4CXS A;  2P6S A;  3AOA A;  3MD3 A;  3MHY A;  3LA0 A;  4ZN1 A;  3AA8 A;  1GMW A;  2VPX B;  4NA2 A;  2VDI A;  2HSE B;  2C2O B;  3SQG A;  3OVB A;  4F36 A;  4NLR A;  2W5R A;  3D6T B;  2AGQ A;  2AZ1 A;  3W65 A;  3K5M A;  4QJV A;  3OL7 A;  5GAG I;  3A8I A;  1CG2 A;  3DXB A;  2QA2 A;  4IO9 Q;  3MAH A;  5EGH A;  2H4W B;  4GTY A;  2Y1L B;  3M8Q A;  1LWF A;  2VKZ G;  2XRG A;  1UEV A;  4ZCK A;  4W92 B;  1S9E A;  4LSN B;  4BWJ A;  1FKO B;  2K2P A;  2NSC A;  3POT B;  4FYY B;  1I94 J;  1FFW B;  1FJE B;  5HSP A;  1RKJ A;  1KLM A;  2I0X A;  5KFY A;  4MKV A;  3JYT B;  2J6U A;  2XSJ B;  2NR0 A;  1ZTW A;  5GME A;  3PYF A;  1BE4 A;  1OS5 A;  5K8P A;  2D3O R;  4B3S F;  2DY9 A;  1RA6 A;  3RJM B;  4X4U A;  1MN9 A;  2B9X A;  3HSJ A;  3N5F A;  1X60 A;  1NK7 A;  3CNQ P;  1NHV A;  1JLE B;  2CAD A;  2YWG A;  4I1T A;  2V6A A;  5D78 A;  3HCX A;  3CMR A;  3MR7 A;  3M8Y A;  3LWM A;  4K2J A;  2Y1J A;  2OML A;  2CPI A;  2J9E A;  4P72 A;  4DSJ A;  3KWM A;  4QYR A;  5EHH A;  2G4B A;  2XLI A;  5GAD I;  5LMU J;  2UXC J;  1J2V A;  1N0V C;  2LEA A;  3IG1 B;  4PAA A;  1IBM F;  4DV3 F;  3THV A;  2WBR A;  2KG0 A;  3Q24 A;  2FDN A;  1IKW B;  2E1C A;  1I51 B;  3KLF A;  3MUT P;  3FSY A;  3UVJ B;  2OFG X;  1XQI A;  2CA9 A;  2KT3 A;  1PIE A;  4LFC J;  3TQE A;  4AT1 B;  4CLK A;  2NXE A;  2C2Z B;  1SH2 A;  4USU A;  3PJX A;  5BXI A;  2MQP A;  3L3C A;  3M2U B;  5HMW A;  3R27 A;  3KMQ A;  5F3T A;  2AYE A;  4A8K A;  1O99 A;  1X9S A;  4RW4 A;  2NS1 B;  2R2S A;  2ZVS A;  1EKR A;  3NLC A;  4J7C A;  3QT8 A;  2HRT A;  4LF6 F;  1DZ5 A;  4CI0 B;  4KSE B;  4WFA Q;  3ZZP A;  4NWX A;  5KFK A;  2WSF C;  3AD8 C;  2J6T A;  1TZ0 A;  2ZD1 A;  1VQ4 S;  1TL3 A;  4QCL A;  3TR5 A;  2CQD A;  4NLV A;  2W5T A;  4I6Y A;  2E1A A;  3SCI E;  4UW2 A;  2BQU A;  1S1W A;  4U8V A;  2UUC F;  1AFI A;  3ISN D;  2R2U A;  1S1T B;  4DV7 F;  2Y1R I;  4UOC A;  2ILY A;  3HD1 A;  3QWU A;  1NZ8 A;  2QT7 A;  2NSB A;  2B43 A;  1S4F A;  4C7Q A;  3RB0 A;  3CW2 C;  2KXN B;  2CJK A;  5B0E A;  1A6L A;  3KLV A;  4WP9 A;  1WC6 A;  1KHJ A;  4PKD B;  1VBX A;  3GCX P;  1SJF A;  1SJQ A;  5FJ4 A;  1JKH B;  2DNK A;  4J9L A;  1HL6 A;  1NSK L;  1RIS A;  3ULH A;  1YX2 A;  4C8Y A;  2DVI A;  2ZH5 A;  3BYP A;  1XER A;  4KRW A;  2HAF A;  4ZGA A;  1SL1 A;  3SI8 A;  1WNE A;  3D1O A;  5DRK A;  3H4D A;  3KJV A;  1X5T A;  2ASD A;  2RUS A;  3PYG A;  4KGX B;  2O67 A;  3LP0 B;  3MAQ A;  4X4T A;  2JJ4 D;  2Q3P A;  1U6F A;  4K4X A;  4JUZ A;  2QX0 A;  2MQ8 A;  3RAX A;  3BSN A;  1HMV A;  1JLC B;  3NBP B;  4DV4 F;  3D0I E;  2V0N A;  1NK8 A;  1Q8L A;  1RAJ A;  3OLB A;  1VC5 A;  4I0W A;  2HLU A;  4C3L A;  4RBT A;  3MMC A;  2YQ3 A;  3RTV A;  2F5G A;  5MLC V;  3GII A;  2B0G A;  1FHT A;  3RYL A;  3BO2 A;  3KUH A;  2FUG 9;  4DR5 J;  4FDI A;  1REG X;  1VHI A;  1U47 A;  2HFS A;  1KHL A;  2ZNY A;  2OPR A;  2JRS A;  2MZR A;  1C0T A;  2DPJ A;  2HVI A;  3DM2 B;  1RSC A;  1CJT A;  1LK5 A;  1F5B A;  2MLX A;  2DNY A;  4HH0 A;  3KJF B;  5E41 A;  3ENW A;  1URB A;  3HFK A;  2DNQ A;  1ALK A;  2BQ3 A;  4EI2 A;  4B9M A;  3MM5 A;  1FX2 A;  2N3L A;  3A1Y G;  4PPD A;  4J9K A;  3WX8 A;  2YKP A;  5BJR A;  2G13 A;  2WW4 A;  3HHL C;  1TKD A;  3KNA A;  5DDR C;  3R5B A;  3M30 B;  1IN0 A;  2J5A A;  4C2M A;  3C16 B;  2MLZ A;  1IBC B;  3DGV A;  2KM8 C;  3PZP A;  2HZV A;  4KJI A;  3I31 A;  1N5Q A;  2HND A;  2R9L A;  3SZY A;  4LF7 J;  4JP8 A;  5KFF A;  1NJX A;  1HQA A;  1D9F A;  3DLK A;  2C3P A;  3IMQ J;  2ZOM A;  5H9F J;  4YEA A;  2F7V A;  3M6U A;  2BOP A;  1FER A;  2XMV A;  1RWP B;  1JLA A;  4NEY A;  1FX4 A;  1FE0 A;  3EXC X;  2HEK A;  3DPC A;  4O3R A;  2EG1 A;  1HQU B;  3QRQ A;  4WU2 A;  4EGL A;  4UZC A;  1KBR A;  1HD1 A;  4J9U E;  2XS5 A;  1YBU A;  1VC0 A;  1U24 A;  5KG1 A;  1P27 B;  1VYA A;  2RJZ A;  4ZPW R;  2WVC A;  4I2P A;  1VQ6 S;  3DDN A;  2RDI A;  3CF5 Q;  4TQR A;  4X4O A;  3N28 A;  1LWC A;  3O44 A;  2XLK A;  5HQ8 A;  2DHH A;  2LA6 A;  4IH6 A;  2MZT A;  4B3S J;  1R8C A;  2EBG A;  3T1A A;  1WD6 A;  2AEM A;  4UQT A;  2OSQ A;  3CGI A;  4BC7 A;  3J7Z T;  1S7I A;  4DFJ A;  2EFG A;  4KV8 B;  2JEI A;  2WOM B;  2FLP A;  4JV0 A;  1U1P A;  2X51 A;  5M2U A;  5IT9 U;  4QWE A;  2KYZ A;  1N34 F;  4IG3 A;  2P8I A;  1FTC A;  3PW7 A;  5E3Q A;  1S1X A;  4C8Z A;  3K89 A;  1X4A A;  4ETZ A;  3T5J A;  2QA4 S;  3K59 A;  5F8I A;  1N52 B;  2DH7 A;  2AEF A;  2GIQ A;  3NY0 A;  3WAX A;  1IBM J;  4DV3 J;  1KWM A;  1ZBT A;  3PEH A;  1GX5 A;  2HHS A;  1EHW A;  5KFI A;  3CIM A;  3RAM A;  4KYZ A;  2VBY A;  4XDC A;  1M5H A;  3ISZ A;  3BB5 A;  2W2M P;  3AY0 A;  2RRB A;  3OTD A;  4KBI A;  2HS4 A;  4BLG A;  4Y65 A;  5KG4 A;  1FES A;  2H5I B;  2I5J A;  2VG5 B;  4ECZ A;  3NS7 B;  4ICL A;  2CQ4 A;  1JIH A;  4H4O B;  3KHG A;  3LP1 A;  5F0W A;  1IXK A;  2IM0 A;  2QG9 B;  1S59 A;  2B9E A;  2W9C A;  3QRR A;  3LOU A;  5E5N A;  2IUC B;  5BR8 F;  3F56 A;  3C6T A;  4F4Z A;  3R1H A;  2K1R B;  3BPS P;  1JMT A;  3VHQ A;  4DUZ F;  2J0Q D;  1ZM4 A;  3NP5 A;  2UUC J;  5DLF A;  2ROP A;  1BWE A;  3V6D B;  4YB7 A;  4DV7 J;  3FMB A;  2ZHB A;  3MCO A;  3Q8S B;  3PNI A;  4ECS A;  2DH9 A;  1ZET A;  3RR7 A;  1C1B A;  1VQ7 S;  1OIA A;  2JC1 A;  4MIW A;  2C3Y A;  4YY3 F;  3HP6 A;  1JB0 C;  4O4R A;  1RTH B;  3BQ2 A;  1WTB A;  3WAW A;  1HWK A;  2HWI A;  4IOA Q;  4WTY A;  3IAS 9;  2DGW A;  4OZ5 A;  2IRY A;  1Y4Z B;  1TL7 B;  1T03 B;  1RAG B;  3MK0 A;  4UT4 A;  3PX4 A;  3JQK A;  3UDL A;  2MKI A;  3HKW A;  4UOH A;  3DLB A;  3IAM 9;  3C6U B;  2IM3 A;  2EW9 A;  1RHK B;  3VGV A;  1XIQ A;  1FEE A;  5D0G A;  2OO4 A;  1H72 C;  3LPE A;  2R8H A;  4FVC A;  1LKZ A;  2LQ8 A;  2A3J A;  2IFY A;  3LXQ A;  3CDW A;  4ZP7 A;  4EO6 A;  1RP5 A;  2YH0 A;  1D3W A;  2AX0 A;  4F67 A;  4ECR A;  4DV4 J;  3WIU A;  2ZZT A;  2DIV A;  4M1K A;  2C2N A;  4LSZ B;  3H90 A;  4IH5 A;  4KPC A;  1XMO F;  2VKR A;  1B3T A;  1KRP A;  3IWL A;  1AUK A;  3TNV A;  5D4N A;  1WKK A;  2C2D A;  2DR7 A;  1W2B R;  4XK8 C;  2FY1 A;  1SHN A;  3DDI A;  4ZVT B;  3E3X A;  1MG7 A;  4WBF A;  3TUP A;  3UW1 A;  1KVJ A;  3MPW A;  1RT1 B;  2PO4 A;  1UL3 A;  3TYT A;  2YNG A;  1QE1 A;  1TVR B;  2BR0 A;  2AJ1 A;  5J2N B;  1S97 A;  1P6T A;  3M32 A;  3UN3 A;  1XC9 A;  3C46 A;  3W9I A;  3I5B A;  1TP7 A;  4ECX A;  4Q2L A;  1VQ5 S;  1BD6 A;  3TUI C;  2J76 E;  3MXH P;  4HLB A;  1YWX A;  2VPZ B;  3CVK A;  5CYM B;  4CYU B;  2AT1 B;  1CJK B;  2GAG C;  2RE1 A;  2LXI A;  3CJ3 A;  3OTE A;  4F2S A;  2HFZ A;  1NB7 A;  4DLE A;  2P2C B;  1AA1 B;  4QBU A;  3KDN A;  2VBZ A;  1AJD A;  3GJT B;  5L1J A;  3OL9 A;  4ZP9 A;  4CM2 A;  3NKY A;  2HHV A;  3FCH A;  3H4B A;  2CQ3 A;  1SV5 B;  1K0T A;  1MU2 B;  1S10 A;  3HM9 A;  1B70 B;  4N41 A;  1U1M A;  1HDH A;  1IWA A;  1KN6 A;  4J9O A;  1RT4 B;  3TA1 A;  4P7T A;  4KAY A;  1M90 T;  3D6H B;  3IWX A;  4H4K C;  4IQM A;  4OYZ A;  4USW A;  3SFG A;  1T9X A;  3EPI A;  4EU0 A;  1RT5 B;  4AL5 A;  4IRK A;  4GMK A;  3BGO P;  3DDK A;  4DJB A;  4R0E A;  2RVJ A;  1KKH A;  1EQJ A;  3CJ4 A;  1FRL A;  4LF9 F;  1X9W A;  4LQY A;  4ZVF A;  4DPX A;  1NPP A;  2ZE2 B;  4DL7 A;  2DPI A;  5E3P A;  1HBN A;  3O1L A;  4O23 A;  3H5Y A;  1UAW A;  1KQG B;  4LT6 A;  2OPS B;  3G4S S;  1NK6 A;  2E1R A;  4N5S A;  1YZ6 A;  1TKX A;  4I2Q A;  1JK9 B;  5ETN A;  4PG4 A;  4MH8 A;  2CZ4 A;  3ZZY A;  1IM6 A;  1QSS A;  4OJ1 A;  1K0V A;  1HNV B;  4R5P A;  1YVF A;  2W7O A;  1DTT B;  4QOT A;  1PGZ A;  1B0T A;  1HW8 A;  3UDV A;  4F4Y A;  2O5D A;  3DGP B;  1QAX A;  3P3D A;  4ZPT R;  4U9R A;  4ZHR A;  1UWB A;  3MMB B;  1DQA A;  4I7F A;  3PM9 A;  4M5I A;  3ZXW A;  4K0K F;  2KJW A;  3C14 B;  4JI1 F;  2Y9H A;  2FC8 A;  1GEH A;  1N34 J;  2YXL A;  1UJ5 A;  4LJM A;  4BDP A;  2AJ0 A;  1KTQ A;  1UVM A;  3DRS B;  3W1Y C;  1U1N A;  3CC7 S;  2CJY B;  5A8W B;  3FDS A;  3MMA A;  4NCG A;  3KK3 B;  1XR6 A;  4Q8F A;  2KYX A;  3F0N A;  1KQK A;  1H7W A;  2DT9 A;  1S6Q B;  3SXL A;  4OMF G;  4IFV B;  3QQC D;  1HR0 F;  3QID A;  4TNO A;  2HRY A;  2MQM A;  3ZZT A;  3FVY A;  2ZBI A;  2RF2 A;  4K7Q A;  1L3V A;  3TAM A;  3KJN B;  1T8E A;  3T41 A;  4WCE Q;  2YWW A;  1Z2L A;  3CCV S;  3G87 A;  2J9C A;  3C19 A;  4OYW A;  1HBM B;  4N56 A;  1UPM B;  2B4P A;  1HFE L;  2E29 A;  3D1H A;  2QSW A;  5IT0 A;  2F3J A;  1LNQ A;  3PV8 A;  4YUD A;  3DMJ A;  4RO0 A;  2GA7 A;  3PKM A;  1JX4 A;  3SEO A;  5BR8 J;  2N4C A;  1N88 A;  5T14 A;  2AJ4 A;  4U8Y A;  4ED5 A;  2I9S A;  1FKA F;  2GVZ A;  4DUZ J;  2CWX A;  2OD4 A;  4OZ3 A;  4P7V A;  4NAS A;  1GTE A;  2WB1 D;  4QZV B;  4EO8 A;  1E6Y B;  3D66 A;  1FXD A;  3FEZ A;  2CNK B;  4X4S A;  2EWH A;  3V6H A;  4FXV A;  1TL5 A;  3HHD A;  4F4X A;  4YY3 J;  3VTI A;  2VPW B;  3HHL B;  2XMJ A;  3DU5 A;  5E33 A;  2JC0 A;  3VZI A;  2HHW A;  4CRJ A;  4UPK A;  1X4E A;  3MR5 A;  1R8P A;  1JXE A;  1U2R A;  5FLX U;  2NQP A;  1DAX A;  4DQR A;  2BM0 A;  2POK A;  4KPY A;  1DUR A;  5L1K A;  3O8W A;  1Y00 A;  1FDB A;  3UFC X;  1RA7 A;  2KH9 A;  1WC3 A;  4F7V A;  3KG1 A;  4ZN3 A;  3BH6 B;  2VA3 A;  4PAB A;  1WSR A;  3QZ7 A;  1UEK A;  2AW0 A;  1OYD A;  3S01 A;  3ITH B;  4I64 A;  1FDA A;  3UDC A;  5CAA A;  1JLB A;  4FN5 A;  2BE2 A;  4NI2 A;  1Q81 T;  1Q4R A;  4I56 A;  2OTJ S;  3LPY A;  4Q7A A;  2HNY B;  1KEK A;  3JQJ A;  2GQQ A;  1X5P A;  3DOM A;  1HNI A;  4ZA1 A;  2I38 A;  4QQB A;  2Y1I A;  1TK8 A;  1XMO J;  1RAC B;  5H9F K;  3OJS A;  2HMI A;  4K4W A;  1LW2 A;  2A0F B;  1EAR A;  5IT9 Y;  4DF4 A;  2HVZ A;  3CJK A;  3G6V A;  3BGU A;  2YNF A;  1LWF B;  1W2I A;  3R5J B;  1UA0 A;  1S9E B;  3W64 A;  1G3O A;  1WEY A;  3ILJ A;  4ZLP A;  5IM0 A;  4ZCL A;  5CZV A;  1CC8 A;  1WDT A;  3P4U B;  1M5S A;  5DZ6 A;  3PW2 A;  3R7B B;  1L3T A;  1KLM B;  3GFY A;  1GXT A;  1HIY A;  5KFP A;  3MM7 A;  4PYD A;  4WU3 A;  3BS9 A;  3RU0 A;  4OX8 A;  4RNN A;  2ATL A;  2HAI A;  2ACY A;  5HBM A;  3HFZ B;  3TA2 A;  1IBK F;  4BHQ A;  2P9G A;  2J0X A;  1RAE B;  4AE5 A;  3GIJ A;  1YJN S;  4PWD A;  1ZZN A;  2LKZ A;  3THT A;  2BAC A;  5LQQ A;  1YG0 A;  3T00 A;  4F0H A;  3KKF A;  2OTL S;  1P49 A;  4A8S A;  2MST A;  2FD2 A;  1Y10 A;  4E2F B;  2MPU A;  4JYA J;  1DQ8 A;  4UUX A;  2QJ3 A;  2FJD B;  1RAO A;  2B4O A;  1V5I B;  3BR8 A;  3CMA S;  2W4D A;  4IKA A;  1FNM A;  3KLF B;  1NKC A;  2A2D A;  4PYA A;  1GXU A;  3MEK A;  5J2M A;  1N54 B;  3VZH A;  3KK2 B;  1K73 T;  4AL7 A;  2KHD A;  2HFV A;  1GTH A;  4LF9 J;  3PCO B;  3H59 A;  4O3P A;  3CD6 S;  1WEZ A;  4LR8 A;  2ALZ A;  2CPD A;  2VOP A;  1HQE A;  4RW4 B;  1S48 A;  2IMO A;  4O3O A;  2QL5 B;  1NDL A;  1LFP A;  2ZBR A;  2CPZ A;  2UP1 A;  3KG4 A;  4X65 F;  3QZ8 A;  4X4N A;  3LH2 S;  2X3D A;  1QTN B;  2AV5 A;  5E3C A;  4ZMM A;  5AXK A;  1NZA A;  3VVU A;  2ZD1 B;  1X0P A;  1TL3 B;  3I5A A;  3JTO A;  1S4E A;  4P71 A;  3LAL A;  4WTO B;  4LQ3 A;  5GAE I;  3BKT A;  2MEW A;  1S1W B;  2V4Q A;  2QL9 B;  2W8K A;  2M70 A;  1VLY A;  2H5J B;  4M5J A;  4RX6 A;  2CPE A;  4JI5 F;  3MAA B;  1ZA1 B;  2CQP A;  2XMT A;  3FFI A;  3ISN C;  5IZH A;  2CUY A;  4RNH A;  4DR6 F;  4X4Q A;  5F8G A;  2AIR B;  2QLJ B;  2K7J A;  1YIJ S;  2G9Y A;  4K0K J;  2P9E A;  4OI0 A;  4JI1 J;  4K59 A;  2N7C A;  2LEC A;  5GMK a;  4ANE A;  1KH5 A;  5DO2 A;  3W9J A;  4XDD A;  1K7H A;  4QPT A;  2LVW A;  2OH2 A;  5E7O B;  4M5M A;  3EZ5 A;  4ZJL A;  4RW6 A;  2FTR A;  2E5H A;  2C1E B;  3BDF A;  5HVF A;  4XO0 A;  3GP9 A;  5HAN A;  3VAF A;  4FS1 A;  3Q8U A;  2GMH A;  4IRC A;  2D74 B;  3T1Y F;  3N4W A;  3OUY A;  1AJB A;  1HR0 J;  2M88 A;  4RNF A;  1A0O B;  2OEL A;  1TL1 A;  2FIU A;  4H4M A;  4P2M A;  2G1H A;  4ED8 A;  3DLL Q;  2UUB F;  2CDQ A;  3NCQ A;  3MMC B;  2L48 A;  3JS9 A;  4LIW A;  1FNX H;  2DGQ A;  2ADC A;  4C3K A;  1X8D A;  3UO0 A;  3R5D A;  1S0M A;  1HW9 A;  2HFO A;  4R0J A;  2KT2 A;  2E7X A;  3R5C A;  3ENV A;  4O3N A;  3L7U A;  2ZC3 A;  1S99 A;  3OBI A;  5E3R A;  1N0U A;  4U7C A;  2OPR B;  1MSW D;  1XJW B;  3SZ2 A;  4Y2M A;  5C5J A;  1C0T B;  1GH8 A;  3NS6 A;  4FKX A;  1PYT A;  5H9E J;  2CQ1 A;  3AJ1 A;  2NYI A;  3OFG A;  2WVD A;  1CJT B;  1JLF A;  2PEH A;  4GKJ F;  5LSO A;  2QA1 A;  2YX4 A;  2IM1 A;  2RSQ A;  1BQX A;  5K14 A;  4ED3 A;  1CPZ A;  2DB1 A;  2W1B A;  1Y3J A;  3CUL A;  1T9U A;  4KGM A;  3EZU A;  1QSY A;  4LSL A;  1VGY A;  2B5J A;  2DO4 A;  1M1G A;  3ILL A;  5TJ3 A;  3IGV A;  4WXW A;  2VIC A;  1JLQ A;  2EI5 A;  3I9Z A;  3M8P A;  1R3N A;  4RW9 A;  2R2T A;  3IBF B;  4NWJ A;  3B6B A;  4JI0 F;  2F9D A;  4M5N A;  2MJN A;  3EGN A;  5FD1 A;  1FRJ A;  4DMZ A;  1H2T Z;  2HND B;  1N5V A;  1S76 D;  3H40 A;  3UN5 A;  3EYZ A;  4MKA A;  3ZZU A;  1RHQ B;  4CNY A;  3X3U A;  4DL4 A;  2E9R X;  3DLK B;  5KFC A;  4DX7 A;  3TAN A;  2VG7 A;  2HNZ A;  5J1P A;  1HBU A;  1KDN A;  2J6S A;  1JLA B;  4Q5V A;  3AQP A;  1MWY A;  1F6T A;  5KXA A;  4QU6 A;  2H3E B;  1Q5V A;  5FDL A;  4RNO A;  3Q8V A;  4PQU B;  4CLY A;  5LRM A;  2M9K A;  1UCN A;  3Q83 A;  2V50 A;  3MDF A;  1VQ8 S;  1KQS R;  4I2P B;  3DRY A;  3G6X A;  3T1H F;  3WBH A;  4BWM A;  5B0D A;  2J0W A;  4HHU A;  2IJR A;  1H73 A;  1R8A A;  5T41 A;  5KFO A;  2V4J A;  2GW8 A;  1LFW A;  3R2C J;  1WSV A;  1IBK J;  3D6M B;  2XWY A;  4FYX B;  4ELV A;  1WI6 A;  2OHD A;  2YNI A;  3NG8 A;  2KJV A;  4LF1 A;  4QIW D;  3IGY B;  2CNN B;  5E2Q A;  4F3M A;  4OX9 F;  1NSQ A;  1NK5 A;  1Y9O A;  3A3N B;  4L6V 3;  1W25 A;  2GS8 A;  1X31 C;  1TUW A;  4NLW A;  5THW A;  4IG3 B;  1G2E A;  5LXR A;  1S1X B;  1HNX F;  4P2S A;  1WAC A;  2BW2 A;  1GK8 A;  1WC0 A;  4JI3 F;  4AXJ A;  4ETX A;  4Y3C A;  3M8S A;  2ZH7 A;  5F8N A;  3GJR B;  2W4P A;  2CJB A;  4N77 A;  2MY7 A;  4F4A A;  3F73 A;  1FJG F;  5I3P A;  2IBO A;  4DV6 F;  3SZZ A;  3J7Z 5;  3BRE A;  3LP0 A;  2JLG A;  3EZO A;  2MGZ A;  2YKQ A;  1QUV A;  1X5O A;  5D8H B;  2I5J B;  3ZC4 A;  4ICL B;  1U1K A;  3BN4 A;  1O0P A;  4DR1 F;  2DD8 S;  1RQ0 A;  2YPY A;  1RHU B;  2NPI A;  3LP1 B;  5A6W A;  5FLX Y;  1FT8 A;  1YJW S;  4I67 A;  4OI2 A;  3VAG A;  3LW5 C;  3FEY B;  5ITH A;  4J9N A;  1RE1 B;  1F9E B;  3QIP B;  5HN0 A;  3CCR S;  2W9C B;  3QJP A;  2JDJ A;  3OR2 A;  4X65 J;  3FBC A;  3NWR A;  2EFQ A;  4NCB A;  3C6T B;  4K50 A;  4UTG A;  1ALJ A;  3CCL S;  4LFB F;  1QAJ A;  4LRA A;  2QGF B;  2VFU A;  3O2I A;  3GV8 B;  1OMS A;  2GNK A;  5L38 A;  2FPH X;  1PO6 A;  3SQO P;  3L09 A;  4NLT A;  2UUW A;  1ZOT A;  4PXB A;  4M8L A;  2L41 A;  3JB9 k;  3NMR A;  2ZH2 A;  4KAV A;  1YJV A;  4JI5 J;  1UET A;  4X4R A;  4A47 A;  3MTK A;  4RUH A;  2QLB B;  4PPZ A;  1N2L A;  4DR6 J;  3G2X A;  3DM2 A;  4Y28 C;  3HJV A;  4DS5 A;  2RH6 A;  4B9V A;  4DXL A;  1Y7A A;  4YR2 A;  1URN A;  4C8M A;  4ZIW A;  2HWT A;  3R3T A;  1EI6 A;  1Y6V A;  1K1Q A;  5GRR A;  2GO8 A;  5SUH A;  2J7U A;  4YB5 A;  1Y7P A;  5HMY A;  1NAQ A;  3C15 A;  4K2X A;  3IR5 B;  3M30 A;  4Y6I A;  1NK9 A;  2EPI A;  4DV1 F;  3T1Y J;  1PYS B;  4B9L A;  4M63 A;  2BJ9 A;  2HVH A;  2VL1 A;  4DV0 F;  2EC2 A;  2K3K A;  3N6N A;  5EWG A;  1T94 A;  3DFE A;  2VDH A;  2GHV C;  3CDB A;  1OQ3 A;  2EXU A;  2UUB J;  1ZS6 A;  4TKT A;  2BRL A;  4ALZ A;  2E66 A;  2AX1 A;  1ZTT A;  3KLG A;  3ILI A;  1M1K T;  3NNH A;  2R8G A;  2AJQ A;  1IKY B;  2K06 A;  2ZZN A;  3BGF A;  4RWW A;  4ED0 A;  2MDA A;  4JV5 F;  2YNG B;  4QWC A;  3KLE A;  1QE1 B;  1Y0H A;  3M32 B;  3TVZ A;  2ZJR Q;  1Q7Y T;  4WF9 Q;  3H98 A;  2VPY B;  4CIO A;  4GKJ J;  2EK1 A;  1WWH A;  3A12 A;  4KKO A;  4YQW A;  2IBK A;  2W01 A;  3CB4 A;  1FVS A;  2E5I A;  2H1Y A;  3PW0 A;  4LRE A;  2ZH3 A;  2E5L F;  4TVA B;  3MUV P;  5HAO A;  3K57 A;  2M0G B;  1D8Z A;  3JSM A;  3V81 A;  1JQG A;  3BO4 A;  2WOM A;  3FNN A;  2QN6 B;  4X84 A;  1YBT A;  4JI8 J;  2NRE A;  1RJJ A;  1TL4 A;  4JI0 J;  2VZ9 A;  2HHT A;  4CXU A;  4X64 F;  4C11 A;  3K5O A;  3O6Q A;  3FBE A;  1HWL A;  1CVJ A;  2LMI A;  4ECV A;  4PG6 A;  2A6M A;  1U4B A;  2CZ9 A;  3I87 A;  4EFA C;  1U6Z A;  4USI A;  1P1T A;  3GE9 A;  1Q79 A;  4ZP8 A;  2C22 A;  2DHG A;  4URQ U;  2IPO B;  2XC9 A;  2CPF A;  4IYQ A;  4NLX A;  4PXE A;  1IQT A;  5D4L A;  2Z4P A;  4CTA A;  1WG4 A;  1YRU A;  5KT2 A;  2X1B A;  3T6B A;  1HBN B;  5EN1 A;  2DNM A;  2VG5 A;  3UQS A;  2ZH4 A;  1HYS A;  2ASY A;  2UU9 F;  3W5Z A;  2IVY A;  4RUB A;  3BEG B;  1TKX B;  3PJW A;  4I2Q B;  1OO0 B;  1R7I A;  2R2R A;  3T1H J;  3CD0 A;  2CIM A;  3R6L B;  2BKO A;  1HAR A;  2EFO A;  3CD5 A;  3D6F B;  2R3V A;  3DRR A;  4DLG A;  2Y8W A;  3MEE A;  4LVN P;  4EEY A;  2C42 A;  4CO2 A;  2MKC A;  4OHX A;  1YJT A;  4ZLN A;  4Z7Y A;  1ZEB A;  1WG1 A;  3TEH B;  4ZHR B;  4AQY F;  4I7F B;  2CPJ A;  4OX9 J;  1AB8 A;  1TV6 A;  3G6Y A;  3RBD A;  1ED8 A;  1YGY A;  1T0T V;  3PR4 A;  2PT0 A;  1KS2 A;  3MGJ A;  4CLW A;  1Y3K A;  1KHN A;  1ALH A;  4LMZ A;  2NYH A;  1HNX J;  3DNC A;  2U2F A;  1T05 A;  1LXN A;  5A0Y A;  3T9N A;  2XR9 A;  1LWE A;  3G9C A;  4JI3 J;  4MT1 A;  2WHO A;  3EPG A;  3MMA B;  4NCG B;  4U7U K;  1GMV A;  3PYD A;  2APO A;  1FJG J;  3C6U A;  3R7N B;  1D8Y A;  4F0K A;  4DV6 J;  1TFY A;  2RF2 B;  3TAM B;  2EKN A;  3TVK A;  3H5X A;  2QMU B;  4J9R A;  1YIT S;  2ZWP A;  5D0R A;  2U1A A;  4DR1 J;  1QLN A;  3GR0 A;  5DZ7 A;  2CJA A;  3DMJ B;  4GTW A;  3GQC A;  5LT5 A;  2HHH F;  5FII A;  2ATC B;  2NZC A;  1WF0 A;  2D3O 1;  2WSC C;  4QWB A;  4LFB J;  2JFD A;  2V8V A;  2XEX A;  4K5S A;  2R8I A;  2GVZ B;  2XMW A;  1RT6 A;  4OI6 A;  2F65 A;  3Q8Y A;  5KFE A;  4D3H A;  1F5A A;  3U1N A;  1UZH A;  4DCO B;  4KGZ B;  2VJV A;  3E51 A;  4M5G A;  4OLO A;  4EK2 A;  1FNO A;  2QRR A;  5J2N A;  2RDD A;  2PMZ D;  4ES3 A;  1N33 F;  2FZG B;  3P49 B;  3WC0 A;  2RD5 C;  5KFU A;  1HA1 A;  5CYM A;  5H9E K;  4DR7 F;  1XBW A;  4CYU A;  2AU0 A;  1SC1 B;  2MKS A;  4NZ0 A;  5GAH I;  1CJK A;  3J81 j;  2FVS A;  4ZIV A;  2DO0 A;  3H5U A;  3OLA A;  3W8P A;  5D4P A;  3R6G B;  2VB6 A;  2HGM A;  1SUQ A;  3UNG C;  5LMN J;  3QRP A;  2N4D A;  3QWP A;  1U48 A;  3A8K A;  2CDR B;  4W4M A;  3TZX A;  5LMU F;  3AXK A;  3CXC R;  1UVK A;  2RML A;  4DV1 J;  3HVT A;  4F4W A;  1JLB B;  4U67 Q;  1HI1 A;  4DEZ A;  1RBL A;  2BE2 B;  4NI2 B;  3ZFV A;  3KUG A;  1ZA2 B;  4DV0 J;  4OYI A;  2GVD A;  2AJ2 A;  2HQD A;  2E9Z A;  4RW7 A;  3DOM B;  2GAH C;  1PJ6 A;  3H2V E;  4CZC A;  4IR1 A;  2HMI B;  4YB6 A;  1YJ9 S;  1LW2 B;  1SB6 A;  5KT3 A;  2KT5 A;  2IVF B;  5KFH A;  1BQN A;  2YNF B;  3VQS A;  2QE5 A;  2RH3 A;  2Y3Y A;  4KO0 A;  1B0P A;  1NXI A;  3MF5 A;  3MED A;  4FP9 A;  4ZPA A;  3K8W A;  5I4M A;  1EJJ A;  2OPS A;  2XUL A;  3UD3 P;  3GFX A;  1Q8K A;  3GU0 A;  4FF1 A;  3CJ2 A;  4JV5 J;  1RWN B;  3DOK A;  2Y0S D;  4C0O C;  3MM7 B;  4OHV A;  4F2R A;  1TAU A;  1RT2 B;  2A2C A;  4PWW A;  2Z30 B;  1ELX A;  4IFY A;  5KFS A;  4F4K A;  3F44 A;  1S9G A;  1ARO P;  4CO5 A;  4RW8 A;  2R7R A;  4PWD B;  4DPT A;  4PUO A;  2PGC A;  1DTQ A;  3MOJ B;  1K47 A;  3GTY X;  4P2X A;  2E5L J;  2DGV A;  1M0S A;  2ANH A;  4NLY A;  1ZAW A;  3G8S A;  3QBC A;  3QGP A;  1B4S A;  3W7B A;  4KHR A;  1RAH B;  2FVP A;  1S6O A;  4Q8E A;  5LOQ A;  4X64 J;  5KG6 A;  3SBM A;  3HT3 A;  2FVC A;  2XNR A;  2HGL A;  3E8O A;  1KOO A;  1MWQ A;  2NPF A;  4A8M P;  1YJR A;  5J2M B;  2GJI A;  4PG8 A;  3AJ2 A;  1U1O A;  5KFL A;  4V19 X;  1UVJ A;  2DEJ A;  2E5J A;  1V3R A;  2YQ0 A;  4ILR A;  4ZPD A;  1HQE B;  1S5Z A;  1WF1 A;  2XNQ A;  2HQG A;  3GON A;  3L7P A;  1YK9 A;  2UXD F;  2K3I A;  2COL A;  2W5Q A;  2UU9 J;  2V4R A;  1AUD A;  3N5B A;  5DLW A;  3QGH A;  1JJ2 R;  3KK1 A;  4LF5 F;  3ET6 A;  5KFW A;  5I42 A;  5CZX A;  1Q8B A;  4HL9 A;  2IVM A;  1EET A;  3Q0A A;  4J9Q A;  1UVI A;  3LP2 B;  3R97 A;  3GV5 B;  4CCH A;  3EX7 B;  4O4G A;  3FFI B;  1K9M T;  2R7Q A;  4M94 A;  2BUN A;  4HR2 A;  3M6X A;  2QV6 A;  4AQY J;  1TR0 A;  1BLU A;  4GC6 A;  2BJ7 A;  1FKP B;  2B8P A;  2R8J A;  4CT9 A;  5CHC B;  4Q2M A;  3M8R A;  4OYP A;  2OPP A;  1WDD A;  2D9P A;  1AUS L;  4CDI A;  3AOB A;  5F0U A;  5ETP A;  4RW6 B;  4K5R A;  4CLZ A;  3HDS A;  1VHF A;  4WII A;  4OX6 A;  3CC2 S;  2VQF F;  1SJ4 P;  3SCJ E;  2NXJ A;  3M8W A;  4ECW A;  2FJE B;  1PBU A;  1IR0 A;  3FC9 A;  3OUY B;  3MPV A;  2NXU A;  8RUC A;  5ETO A;  2AF6 A;  4USM A;  1FWL A;  2XB2 D;  4OZ1 A;  3UPF A;  1TL1 B;  3ITH A;  4B3M F;  4LVO P;  4TXS A;  3DI6 A;  4H4M B;  1FRX A;  4B9U A;  2HQC A;  1OQ6 A;  4I6W A;  3R5G A;  2J9D A;  1F3F A;  2B51 A;  2ZKU A;  2HNY A;  4J9M A;  2GSU A;  2XBP A;  2AGP A;  4CLU A;  4U7U D;  2MQL A;  2ZJP Q;  3ZTQ A;  3AOD A;  2HHH J;  3K8V A;  4B02 A;  4ZLJ A;  2ZKT A;  3PO5 A;  1RGV A;  4ILL A;  4I68 A;  4A8F A;  1IR1 A;  1EJ7 L;  5L8R C;  4I6A A;  4QW9 A;  2NUU G;  4DV5 F;  1IBL F;  2F63 A;  4DQS A;  1N4L A;  3IWN C;  2D3Z A;  3MUM P;  1TKZ B;  3AB2 B;  2ZOG A;  1RHM B;  1FE4 A;  4OJ3 A;  2MSS A;  2GGP A;  4GC7 A;  4B3O A;  2Z2Z A;  1JLF B;  4GVL A;  3FGV A;  1U49 A;  1E2S P;  1P9Q C;  4DQQ A;  1N33 J;  5IOL A;  2XZD B;  2BQR A;  2HBR B;  3OR1 B;  2CPX A;  4ID8 A;  2CWK A;  4P9S A;  5K14 B;  2Z2Y B;  2M52 A;  3BR9 A;  4DR7 J;  3OV7 A;  1T02 A;  2RQM A;  3ZO7 A;  3UD4 P;  2DTJ A;  4LSL B;  3MCS A;  2GML A;  1V3S A;  2B5J B;  5B08 A;  2VBW A;  5KOW A;  2KVI A;  1JLQ B;  4JI4 F;  4HEA 9;  4Z37 A;  3M8P B;  3CDE A;  2HHU A;  4RW9 B;  1I5O B;  3CSK A;  2V94 A;  3T5K A;  3S7R A;  3IM9 A;  2NXC A;  5CAB A;  1J27 A;  4O44 B;  5KG7 A;  2XM3 A;  3EMT A;  3GG1 A;  4NWB A;  5T7L A;  1ED9 A;  3IDD A;  1HPZ A;  1VQP S;  4DI6 A;  3L4B C;  1F1B B;  1AT1 B;  2VG7 B;  2CAJ A;  2HNZ B;  3VAL A;  1OY9 A;  3KK2 A;  1HBU B;  1VIX A;  4ZIT A;  4PG5 A;  3LGM A;  3NAH A;  1NHU A;  3VAK A;  4MIV A;  4QU7 A;  1L3S A;  3GLJ A;  1FRM A;  5FDL B;  5KFZ A;  2IHR 1;  1Q78 A;  4M5H A;  3NGU A;  3M2R A;  2KXH A;  4OHY A;  3OD2 A;  1IVZ A;  2JSX A;  3FCW A;  2HYI B;  4DPY A;  5HVH A;  4TY9 A;  4JB8 B;  2X1A A;  1FSU A;  2IMW P;  2PD1 A;  2H9Z A;  5U47 A;  5F8H A;  2J0S D;  5KFG A;  1XEZ A;  3NL0 A;  3L95 X;  4ES2 A;  4FF2 A;  2V4J B;  2YH1 A;  3LGH A;  4OYX A;  1HNW F;  3HHN B;  3MAA A;  2YNI B;  3AD7 C;  4MKY A;  3LWL A;  4UST A;  2ZJQ Q;  4M95 A;  2E9T A;  1HHQ A;  2BV3 A;  4RWX A;  1HLW A;  3KHL A;  1SBR A;  1DQ9 A;  5IQ6 A;  4ZVS B;  5L9N A;  1VI7 A;  5KTQ A;  4QW8 A;  1F2H A;  3DOL A;  4AD6 A;  2VF3 A;  3D68 A;  3KTQ A;  1WHW A;  2BJE A;  3O5T B;  4ID5 A;  3JAM U;  4ZVU B;  5GMD A;  1Y5N B;  4F3O A;  4B3T F;  3TAQ A;  1VDH A;  2YKN B;  3WZ0 A;  4O0I A;  3BJY A;  4KIA A;  3PXG a;  4QIE A;  5KOX A;  5KFM A;  1LXJ A;  4OIX A;  1KH7 A;  1FCA A;  3K5P A;  2FHJ A;  2LEP A;  1D0E A;  2UVW A;  2MGZ B;  2XY5 A;  4E8U A;  2B4V A;  4FNH A;  3OFH A;  3U7J A;  2B56 A;  3CCJ S;  3NXZ A;  4ED7 A;  3A3O B;  2V69 A;  3M1V A;  3HUL A;  1EX8 A;  1E33 P;  3TOQ A;  5D15 A;  2UXD J;  4K4Y A;  3OR2 B;  2MXY A;  1N2K A;  1R8B A;  3DCA A;  1REV B;  5KFJ A;  3OL8 A;  5CD4 H;  3FJ2 A;  2EFP A;  2DRA A;  4LF5 J;  5K9F A;  1ELO A;  5L0K A;  4DL2 A;  5HL7 Q;  4Z2X A;  1K1S A;  2ZH9 A;  5MAO A;  2O3D A;  4ZCM A;  5JMN A;  1HHT P;  3GB0 A;  2FJB B;  2RS2 A;  1HWJ A;  2XYP B;  3H2L A;  4DG1 A;  2CVE A;  2IJN A;  1NME B;  3D3B J;  3X1L B;  1P8G A;  4NRT A;  4CQ1 A;  3BDP A;  1MNE A;  3EVM A;  2WB4 A;  1OWX A;  3JQM A;  1TEL A;  4ER8 A;  4ZKA A;  4MMO A;  3HF5 A;  2EKY A;  4MIA A;  4RUC A;  5D3G A;  1RT3 A;  2D7S A;  4AUK A;  4H4K A;  3SMZ A;  4J9V A;  1UTA A;  2EG2 A;  3C15 B;  5C2C A;  3BH7 B;  5IWA F;  2CRL A;  2HQI A;  3QT7 A;  2BAN A;  2B9Y A;  3TQ1 A;  2VQF J;  4DS4 A;  5A2Q U;  1NU4 A;  2LXF A;  5I3U A;  3IN5 A;  2BE9 B;  4JOU A;  1K8A T;  4TN0 A;  1NM2 A;  4WKR A;  1HJK A;  2BM1 A;  2W5S A;  4C4W A;  4LRB A;  4B3M J;  3IGN A;  7FD1 A;  3GYN A;  2HBQ B;  5DET A;  3EE3 A;  1H3D A;  3RRG A;  1NUE A;  4OHW A;  3SIP B;  3BBC A;  1NKB A;  2BKP A;  2W8D A;  1D9A A;  2Y0B B;  1U02 A;  1UEU A;  2KL8 A;  3KMS A;  3THP A;  3KLG B;  4DHV A;  3ZZO A;  5D6G A;  3M6W A;  3K7R A;  3OTO F;  1SJR A;  4PQU A;  4YOE A;  4AYB D;  4UOF A;  1RAB B;  2E7V A;  2PMW A;  4LIR A;  4RZR A;  4ZPB A;  4DV5 J;  2XMM A;  2MZQ A;  4JBC A;  1IBL J;  2L9W A;  1JLG A;  3KLE B;  3RW6 A;  1FDN A;  5JJB A;  5D77 A;  4LBH A;  1VJW A;  4EMD A;  2CJX B;  5DQH A;  4G65 A;  3CE8 A;  3W62 A;  2BE7 D;  1RBO B;  1N5Y A;  2HUR A;  3CCZ A;  4KKO B;  4ZVG A;  1H74 A;  2AP6 A;  1M1H A;  2ROE A;  4OZL A;  4HTJ A;  2DGS A;  1PSD A;  4ZP6 A;  3IBC B;  4J5O A;  1UWA A;  2YKA A;  1ALI A;  3JSM B;  6FDR A;  3V81 B;  1VQY A;  4KFB A;  3TUZ C;  4JI4 J;  4JI7 F;  3CO0 P;  2IIH A;  1WOP A;  1PKU A;  3J7Y U;  2VD3 A;  3DHX A;  3TVY A;  4TYA A;  4QWD A;  2UVU A;  2Z56 B;  4C11 B;  1CQN A;  1DFD A;  2GJF A;  4EWT A;  5HRT A;  2NUH A;  5F9N A;  2JOQ A;  4ZVH A;  4U95 A;  3BYR A;  5K20 B;  4LFA F;  2IC3 A;  4X62 F;  1RLC L;  3T9Z A;  2OAU A;  4U96 A;  3CIZ A;  2C3U A;  2GJ2 A;  5INH A;  3BDG A;  4YN3 B;  2LQ9 A;  1V3Z A;  2BW7 A;  3TZY A;  2AYG A;  2DNO A;  7AT1 B;  4NZ7 A;  4G1P A;  1IJE B;  2KI2 A;  3KXD A;  4CTA B;  2Z57 B;  4IG0 A;  2IY5 B;  1RWK B;  1XMQ F;  2AHO B;  1C0U A;  1HYS B;  1R89 A;  3W63 A;  2CQB A;  4A4J A;  2XO7 A;  3QIP A;  5EWE A;  4M5L A;  1SKS A;  3J80 U;  1N32 F;  1Q86 T;  4C8O A;  1IQZ A;  1AJC A;  1MN7 A;  3GSI A;  5KG0 A;  4NLQ A;  2J7W A;  3DRR B;  1FF2 A;  2Y8Y A;  1Z2Z A;  3MEE B;  3MR2 A;  4QR0 A;  3ETO A;  2FVQ A;  3GV7 B;  4EYI B;  1HNW J;  2JVO A;  3TJA A;  2ZHA A;  2UUA F;  1FRH A;  4O0N A;  2KRR A;  4WFY A;  5EGY A;  4NLP A;  3M4X A;  3RB4 A;  5J1E A;  2R7W A;  4P74 A;  1TV6 B;  4LR9 A;  3V4I A;  2OP5 A;  4ED1 A;  5DG9 A;  3OL6 A;  5DQG A;  5HQM A;  3PX6 A;  2RIL A;  5E3A A;  2GCF A;  3MM6 B;  4ZJQ A;  1T05 B;  5A0Y B;  4FS2 A;  1LWE B;  2QYG A;  3NGK A;  1KH4 A;  2ZEJ A;  1XMB A;  1YKW A;  2XMK A;  4IUF A;  3N01 A;  1B64 A;  4TU9 A;  2F9J A;  3CCT A;  2LCW A;  4B3T J;  2UV8 A;  3SSQ A;  3HPO A;  5EGE A;  1ZAV A;  2QFJ A;  2FLN A;  4NRU A;  3CCE S;  4DUY F;  2IRU A;  3Q3Q A;  5HP1 A;  3U1M A;  3VGT A;  3KJQ B;  2GO9 A;  1T95 A;  3WX4 A;  1BQM A;  1VQ9 S;  2ZHO A;  1ELY A;  3VF0 B;  2AYM A;  4DBQ A;  3MOZ A;  3DLJ A;  4G1I A;  2FHO B;  2HWH A;  1S77 D;  4NLD A;  3BKF A;  1VS3 A;  1SC3 B;  2WAQ D;  2KG1 A;  3ZNU A;  2KKH A;  3I55 S;  1SH0 A;  2MKK A;  4QPX A;  2BZ2 A;  1BXN A;  1U0S A;  2WSE C;  3OPK A;  2VG6 A;  1X4H A;  1U1L A;  3GR1 A;  4F25 A;  4KHP F;  3KHR A;  5L1I A;  3DRX A;  5SZT A;  1Q5Y A;  3PVX A;  1IKY A;  2YWK A;  1RT6 B;  1C4A A;  2Q43 A;  2OMO A;  3HHE A;  1GFW B;  3K0J A;  3T19 A;  2M8D B;  3D0H E;  3R7S B;  2VUG A;  4CM0 A;  1OSD A;  2H5E A;  5KFD A;  1S7H A;  4FF3 A;  3W60 A;  1N5S A;  3P96 A;  3PYE A;  2KU7 A;  4CXK A;  3QJL A;  1RTI A;  2BXJ A;  3Q2T C;  3QYY A;  3QT6 A;  2ADB A;  2AQ4 A;  4URS A;  2Q66 A;  1SUQ B;  2YTC A;  4WKY A;  4EZ9 A;  1FFG B;  1IKX A;  2F4F A;  1SIW B;  4OQJ A;  5IWA J;  4JYA F;  4L3K A;  1FRK A;  3CJ0 A;  1CUL A;  3HVT B;  2WZ1 A;  1N56 A;  4RU2 A;  2YX7 A;  3NGD A;  4OI3 A;  5F41 A;  5L46 A;  1RB0 A;  4DDF A;  2GVD B;  3VQT A;  5B0G A;  2RU9 A;  4RR5 A;  1BC6 A;  2K7K A;  4NLS A;  4RW7 B;  4LRD A;  4MY4 A;  2KTQ A;  4B9S A;  2AZ3 A;  2RKI A;  3NEK A;  2WCX A;  1KFS A;  2ACM A;  3D3C J;  1J5O A;  3NS5 A;  2DCL A;  3CCQ S;  1BQN B;  2MHN A;  3NWG A;  4KO0 B;  3MED B;  3OFF A;  4Q45 A;  3OTO J;  2W4C A;  1JWW A;  1OPZ A;  5B09 A;  4PWU A;  1S1V A;  3JAM Y;  1N5T A;  3DOK B;  4CNZ A;  3H2U B;  3OXL A;  1JXV A;  4AND A;  2KZM A;  3T6J A;  4Y0F A;  4IFY B;  2Z2L A;  5JXS A;  1HBO A;  3AB4 B;  2B7B B;  2QMW A;  4U6P A;  1O98 A;  2GLQ A;  2F4V F;  5IJQ A;  1S9G B;  4CLL A;  1VMB A;  4RW8 B;  1ZPW X;  4YP3 A;  4PUO B;  4NLO A;  1DTQ B;  1RDR A;  4KQZ A;  3WAY A;  3WIV A;  2GX8 A;  2A18 A;  2M3D A;  2WON A;  4ECU A;  2V8P A;  2DR5 A;  4DN9 A;  4OZJ A;  1VRT A;  1FDD A;  3QO9 A;  5GAG U;  2BBE A;  2V8H A;  4JI7 J;  2EBE A;  4NXN F;  1RUS A;  4JI2 F;  3M8Z A;  4X66 F;  3RBZ A;  5D4O A;  1G1X A;  2EC0 A;  2QZ8 A;  1VFJ A;  1P1L A;  1EB0 A;  1RU2 A;  4YR0 A;  3LGN A;  4QYZ K;  5HO4 A;  3SSR A;  2VQE J;  3UWT A;  2HBZ B;  4USH A;  1PBA A;  4LFA J;  4X62 J;  2HFN A;  4V1A k;  2C28 A;  1DY3 A;  2JHE A;  1RWV B;  1F5C A;  3RR8 A;  3I0S A;  3HVW A;  4DFP A;  3CED A;  3PO4 A;  3W2W B;  1U6B A;  1O8B A;  5KFB A;  3CPW R;  5LIA A;  3EDQ B;  1X4D A;  1S57 A;  3HK2 A;  4WFZ A;  4Q0B A;  1XMQ J;  1VQN S;  1C1C A;  2FLO A;  1D1U A;  3QGI A;  3RW7 A;  2R7V A;  4CLP A;  4MK8 A;  5DM6 Q;  3A13 A;  3PTW A;  3HJF A;  4Y00 A;  1TMJ A;  2CNO B;  2AKW B;  3PFO A;  2OIH A;  2V34 A;  2R7U A;  5GAD U;  2PN6 A;  4TU8 A;  3KK1 B;  3ET6 B;  2ZM6 F;  3Q8R B;  1N32 J;  1R0A A;  3MM8 B;  5DLV A;  4WXO A;  1PCA A;  2QIF A;  3AHP A;  5I42 B;  5A2Q Y;  1EET B;  2RQK A;  4DL3 A;  5ETM A;  3BGR A;  3VAJ A;  3D1Q A;  2BDP A;  1M5P C;  1EZZ B;  3WQP A;  1V5V A;  1RCO B;  4O4G B;  5GOV A;  2X1F A;  4LR2 A;  3PIP Q;  2UUA J;  4OFZ A;  1WHV A;  4LUB A;  3R2D J;  1T9T A;  5J2Q A;  2PC6 A;  4QIG A;  1X4F A;  3PKY A;  4LRF A;  2OPP B;  1NDK A;  3DU6 A;  3WBZ A;  4KH0 B;  3K5L A;  1M5V C;  2KM8 B;  4GTX A;  5JVG Q;  3DLE A;  1YTY A;  5IV4 A;  2EFN A;  2MQQ A;  1ZAX A;  4NEZ A;  4DSK A;  2DNP A;  2VOO A;  1ZEF A;  2ROG A;  4LF4 F;  2ZIT A;  3IA0 A;  5KG5 A;  4ENO A;  2XS7 A;  1SKW A;  4DUY J;  3RRK A;  3B82 A;  4TU7 A;  3PR5 B;  2V2K A;  2C2R A;  1AFJ A;  4L76 A;  3DI6 B;  1R6V A;  4F50 A;  2OEM A;  4WZM A;  2JX2 A;  4L74 A;  2QMX A;  3K5N A;  3G8Q A;  2ZC4 A;  3I56 S;  1UPP A;  1BUX A;  3M9N B;  2XGP A;  2H48 B;  3CJR A;  4IH7 A;  4H54 A;  3QAU A;  4DX6 A;  4LR7 A;  4KT0 C;  1R43 A;  2LYV A;  3BSO A;  1R0B G;  3GJQ B;  2AJF E;  4KHP J;  4E98 A;  4OI1 A;  1U26 A;  3V5R A;  4DUT A;  4O3Q A;  2BVZ A;  2DNG A;  4CWB A;  5L39 A;  3NMA A;  2C2M B;  3HHK A;  3DXS X;  4QR1 A;  4FZV A;  2GGP B;  4XIU A;  1O6X A;  4B3O B;  3ILO A;  3MEC A;  1LV5 A;  1RT2 A;  2V9W A;  4IDK A;  3UDE A;  2PFF B;  1Y5I B;  4FNI A;  2DIT A;  4TN2 A;  1WOO A;  3JSY A;  3W8G A;  3I0R A;  4NYP A;  4KH1 B;  1L3U A;  3D67 A;  2MKH A;  3Q23 A;  1HKA A;  3TJ9 A;  2FHK A;  3NGS A;  3AOC A;  4A8O A;  3GFH A;  1QJH A;  4ES1 A;  2G9O A;  4BCA A;  1VCT A;  3ETM A;  1S1U A;  3JSB A;  4TY8 A;  4C0H A;  2I1R A;  4F02 A;  1T9W A;  2D1G A;  5CYQ A;  4UOG A;  4KE5 A;  3SV3 A;  3TAR A;  3DRP A;  3J80 Y;  2YWF A;  4ZG9 A;  3DHW C;  1WKL A;  1B0V A;  2R4F A;  1ZYQ A;  3OTC A;  5T7L B;  4JV2 A;  1HPZ B;  3G6E S;  4ZVP B;  2UVR A;  1XNR F;  3CD7 A;  3M2V A;  2XYG B;  1FD8 A;  4ZK7 M;  5LSR A;  1H7X A;  1O5J A;  5KFR A;  1Z1Z A;  3M2R B;  1XNQ F;  1E6V A;  2O66 A;  1FA0 A;  1CS4 A;  4WYW A;  3CTR A;  2BJ1 A;  1R6Y A;  1HI8 A;  2BX6 A;  1B7Y B;  2IYI A;  2MZJ A;  1NJI T;  1UP1 A;  3QNW B;  2LQJ A;  1NK4 A;  2PI5 A;  2HS3 A;  2CQH A;  2V67 A;  1S6P A;  3I82 A;  4J9S A;  1RK8 A;  3B78 A;  4ZDN A;  4ZVE A;  3QPI A;  4WK3 A;  1IM4 A;  4MJK A;  4P75 A;  2VHG A;  1UA1 A;  2F4V J;  4EBC A;  1VJQ A;  3I4P A;  2XYH B;  3LP2 A;  1WI8 A;  3HLU A;  5A8K A;  2HVE A;  3NKO A;  1V6H A;  1VK3 A;  2FGO A;  1SQE A;  4WPA A;  2VIH A;  2V9K A;  3KDO A;  3RUB L;  1ANI A;  1PC4 A;  4R8U A;  2LU2 A;  2QSF A;  3D7S B;  1FKP A;  2CVI A;  1WEL A;  2VJU A;  1OYE A;  5J2P A;  4LQ9 A;  5JUM A;  3B5Q A;  5IFM A;  2BOA A;  1CC7 A;  4NXN J;  4NCA A;  3V6K A;  4JI2 J;  2R7T A;  4X66 J;  3DOL B;  1SPB P;  1TUV A;  4UY8 T;  2B6A A;  1TQL A;  4ID5 B;  3UNY A;  3ZZR A;  3HI9 A;  5F8L A;  3DYA A;  3RBX A;  4WE1 A;  4V19 J;  3MK2 A;  1WOS A;  4O3S A;  3H25 A;  3QLH A;  3FEX B;  3Q2S C;  3P45 B;  2XGQ A;  2AMC B;  2F1F A;  2W24 A;  2M4M A;  5KFA A;  4MKB A;  4DSE A;  2XS2 A;  5HJX A;  1OY6 A;  4N8N A;  5CH7 B;  1SQG A;  1RTZ A;  2GFF A;  3IS9 A;  1NPK A;  1YQH A;  1YRT A;  4N7T A;  5AE2 A;  1KH9 A;  3Q8P B;  4ZG6 A;  3I9V 9;  2NXN A;  3QSY B;  3M1V B;  4C97 A;  5A8R A;  4CO4 A;  1JXL A;  1VLO A;  2YKO A;  3NKR A;  3WC2 A;  3HKZ D;  4HHH A;  1EIY B;  4AFF A;  3DKD A;  2ZM6 J;  1TAQ A;  2G0J A;  1Q16 B;  3NKP A;  3HZE A;  4WJB A;  3HVR A;  4QIF A;  2AYB A;  3QFW A;  2HVD A;  1NJY A;  3U02 A;  1G6B A;  3N0V A;  4G1Q A;  2N7Y A;  1MMN A;  2AWZ A;  2KO1 A;  4WFX A;  2HW3 A;  2BJ3 A;  5IXU A;  1TKZ A;  2RIJ A;  2JEG A;  1N6Q B;  1BWV A;  2RQC A;  4YFU A;  3M7V A;  4RU9 A;  2M2B A;  3EGW B;  1RT7 A;  4NL5 A;  4DG1 B;  1Q95 G;  1UZD A;  2OLW A;  1M5K C;  2XHC A;  1T9Y A;  3AQO A;  1KC8 T;  3H7H B;  1MMD A;  1LOU A;  1UW4 A;  1H0H B;  1B8J A;  3OR1 A;  3GYX B;  3PW5 A;  3TX8 A;  1WC5 A;  4Y2K A;  4P73 A;  4GVB A;  3BV8 A;  2ZBP A;  4ED6 A;  1KON A;  2Z2M A;  2MB0 B;  2I6W A;  5D3G B;  3TW0 A;  4MYT A;  1RT3 B;  3VAH A;  4P6Q A;  3CCU S;  3DLG A;  1E3C P;  3OVA A;  4CO0 A;  3BBF A;  2XTJ P;  4JI8 F;  2BAN B;  2WVF A;  3OQ2 A;  2ERR A;  5ETT A;  5CCL A;  2DRD A;  4LF4 J;  3P5B P;  3RB3 A;  1SHQ A;  5I3U B;  4O44 A;  2MY8 A;  2GSO A;  4A8X A;  4AXI A;  4WIQ A;  2VH7 A;  2H4Y B;  3I6P A;  2DNZ A;  4BC9 A;  5DQI A;  2P6T A;  1UKU A;  1NJZ A;  3MK1 A;  3VGU A;  2DYA A;  3IR7 B;  1DAR A;  2K8G A;  2M5Y A;  2DHS A;  1D9D A;  1ANJ A;  5JVH Q;  2OUG A;  3OHA A;  4C98 A;  3J81 U;  2MKY A;  4QIV A;  3CDA A;  1OJ4 A;  4N8O A;  1F0X A;  3Q22 A;  1VK8 A;  3TWZ A;  1MW7 A;  2RB7 A;  3TP2 A;  2ZUA A;  1S79 A;  4EUV A;  2OI2 A;  1KQF B;  3PW4 A;  2DHA A;  3FMW A;  5B0F A;  1RWM B;  2GA3 A;  2F8M A;  1KOH A;  3GIL A;  2GHW A;  1JLG B;  1X4B A;  3OTB A;  4LF6 J;  4B56 A;  5LSL A;  3HSD A;  4NOH A;  4IR9 A;  2DR8 A;  3F41 A;  2M7S A;  2HG4 A;  1ZM3 A;  1N5Y B;  1U1Q A;  2GMJ A;  4J91 A;  4OYA A;  2OPQ B;  4J9P A;  2DGO A;  3FQK A;  4DSL A;  2VU5 A;  5BYS A;  5G0R A;  5AJ3 F;  2DEI A;  5HRO A;  2DR6 A;  2E1P A;  4WFB Q;  1LWX A;  2XZW A;  1PJ7 A;  2PII A;  4KFB B;  2W8L A;  3JTP A;  3DN9 A;  2MZ1 A;  1CJU A;  4FXD A;  5ETK A;  1Y5L B;  3E2E A;  4ZPV R;  5M2R A;  3IRW P;  1HD0 A;  3EJM A;  5AXL A;  1FWP A;  1VOM A;  4IO1 A;  3P5T L;  3TRG A;  3CJ8 A;  5HI7 A;  2X1G A;  1QVG R;  1KHV A;  2IC3 B;  3KOA A;  2R7X A;  2YKN A;  4FBU A;  3D4J A;  1KD1 T;  3BDG B;  3AFG A;  2WTF A;  1XNR J;  2V2Z A;  2D1C A;  4XAK A;  5C42 A;  5K8O A;  4DQP A;  3TJ8 A;  2KB2 A;  3MCN A;  2GZO A;  2V8G A;  4IG0 B;  4B08 A;  4CLS A;  1ITP A;  3CJS A;  4DU7 A;  3LQV A;  1FK9 A;  1C0U B;  1XNQ J;  5KFX A;  2IA6 A;  3T5H A;  3ZTR A;  3M9M B;  3UI3 A;  2UUT A;  1TK0 A;  5KAK A;  4L75 A;  3C8Y A;  1REV A;  1SXL A;  4MFB A;  5ETQ A;  4RUA A;  1BGX T;  3NAI A;  1ZZF A;  1FRI A;  3JXO A;  2ZH1 A;  3RZA A;  4DU8 A;  2RUG A;  2FC9 A;  6FD1 A;  4PEO A;  1B7F A;  2BAB A;  5KFV A;  2ASJ A;  4OLP A;  3IRX A;  5DDQ C;  1IKV A;  4P2F A;  5J1E B;  2XY6 A;  3CCS S;  3MTJ A;  2FJV A;  5DG7 A;  4WP8 A;  2RRN A;  2XY7 A;  3V4I B;  4JV1 A;  2MJU A;  3SV4 A;  3GJS B;  5KFQ A;  2JLE A;  5HLF A;  2IAJ A;  4QWA A;  1U09 A;  1RWU A;  3KFW X;  4Y34 A;  1MML A;  3HX9 A;  4PCQ A;  1RXO B;  4DPW A;  5LMN F;  1GX6 A;  1NSA A;  1RWW B;  4TLR A;  5CQG A;  1E1Z P;  3NKQ A;  2JEJ A;  2CJQ A;  1ZPV A;  3D54 A;  3FRZ A;  2ZH6 A;  1RWO B;  3QFH A;  4ILM A;  5L0E A;  4K4T A;  1U45 A;  7FDR A;  1YBA A;  1RCX B;  5HP1 B;  2DXE A;  2W2P P;  3E01 A;  2W9B B;  3KUE A;  4DPU A;  2IDE A;  5HMZ A;  1UFK A;  5B0C A;  4HKQ A;  2YPZ A;  2E1M C;  1BQM B;  4Y2C A;  3NRB A;  3BGL A;  1V9O A;  1VRU A;  3OJU A;  1PC5 A;  4GO5 X;  1RBA A;  4W90 B;  5B7W A;  2J7K A;  4URG A;  2VA2 A;  4HH1 A;  2QLF B;  5LJ5 Y;  4C8K A;  3N6L A;  1UFL A;  3B54 A;  1SJ1 A;  5LL6 d;  2WBM A;  2UXB F;  4J37 A;  4ZPC A;  1RTD A;  3I96 A;  2VG6 B;  3JTN A;  2DCU B;  4IRD A;  3OSN A;  2YNH A;  4DOZ A;  3V6J A;  1TMM A;  3T5L A;  2FQQ B;  2RNE A;  3B8H A;  4HDG A;  3G96 A;  2CPH A;  1KHW A;  3CT9 A;  4OJH A;  4RPF A;  4CYR A;  1QM9 A;  1RI7 A;  4X4V A;  1GMU A;  3C3L A;  2E5G A;  4OL8 A;  4FPR A;  4ZOS A;  1RHR B;  1MRO B;  1ZM2 A;  3AT1 B;  3SCK E;  2XHW A;  1NKE A;  3K58 A;  1YHQ S;  1RTI B;  1XWL A;  3E2D A;  4WYL A;  4G3I A;  5DGA A;  4I69 A;  2YQ1 A;  3DLH A;  3NKN A;  1TTH B;  1WJ9 A;  3L7O A;  1IKX B;  4MK7 A;  2L08 A;  1EP4 A;  4Z7C A;  2ZDO A;  5L0B A;  4USJ C;  2YWH A;  2LA4 A;  4KGV B;  5C66 A;  4JI6 F;  1CUL B;  5AJ9 A;  1ZED A;  2KFN A;  2G1D A;  4PR6 A;  4K4V A;  1NH7 A;  2JVR A;  2HK3 A;  1YRX A;  4DL6 A;  1U0H A;  2NLW A;  4YB1 P;  3Q89 A;  4XPE A;  2FB0 A;  4PXD A;  3NKM A;  3H0P A;  4FDF A;  4MK9 A;  5KG2 A;  3PJ9 A;  5I3Q A;  1JJ4 A;  4C8N A;  2MQN A;  1RTJ A;  2RKI B;  3PRV A;  3KLI B;  4DL0 C;  1X5S A;  1J5O B;  4PRF A;  4CLT A;  3CUN A;  2VV5 A;  2W8S A;  3R8Y A;  2E44 A;  1UW9 A;  5ETV A;  9RUB A;  5L1L A;  3GCW P;  1RAI B;  1S1V B;  2W5X A;  3HVA A;  3G71 S;  3H42 A;  4C8L A;  2CFX A;  4HAC A;  3MFH A;  1URA A;  3GZ7 A;  4YR3 A;  2IYG A;  1HBO B;  1XK8 A;  2G2O A;  4C6A A;  2VON A;  1FVQ A;  1SL0 A;  3BF4 A;  4L3N A;  1LW0 A;  1Q8I A;  4RBV A;  2GHP A;  1TKT B;  2HIQ A;  5AJ3 J;  3PG9 A;  1KP6 A;  2ZUG A;  4ZJO A;  2WON B;  1WHY A;  5C24 A;  4YS2 A;  1FI4 A;  4LBI A;  1VRT B;  3QO9 B;  2UV8 G;  1T3N A;  2VFT A;  2HHX A;  2BA9 A;  2YY3 A;  1FJC A;  4MTP A;  3PRD A;  4FYV B;  4A46 A;  1PAU B;  2XQC A;  3MM6 A;  3ZZZ A;  4M5D B;  1H2U X;  3NGT A;  1RLD A;  3US5 A;  1IUJ A;  3HSZ A;  3TA0 A;  3P8B B;  4KC5 A;  1N48 A;  2W2O P;  5CA5 A;  3I0S B;  4KHM A;  2XWX A;  1EQ0 A;  3MD1 A;  3CCM S;  3KLH A;  2KRB A;  1I3O B;  2DNH A;  3QGG A;  1GQE A;  2B7C B;  3JSR A;  4TYB A;  2ZDP A;  3EDR B;  2KN4 A;  4MIB A;  4NYO A;  4Q0B B;  1C1C B;  2OD6 A;  1U8S A;  1X7V A;  2EVZ A;  4KGK A;  4MHX A;  3SDE A;  4GKK F;  3SQG B;  4LF8 F;  4LRC A;  1R0C B;  3QSI A;  1CJV A;  1U2C A;  9ATC B;  3SYZ A;  3HMJ G;  2XO6 A;  1WG5 A;  3EVO A;  1VQS A;  4HTI A;  3FRY A;  1R0A B;  3QJJ A;  2QTW A;  5A76 A;  5IJS A;  4CH1 A;  3W2V A;  3OVS A;  3LUY A;  3M8Q B;  2DGX A;  3BGR B;  5HQL A;  2ZBQ A;  3D9B A;  2N82 B;  2CPY A;  2M8H A;  3EGZ A;  1S0N A;  1UVL A;  2CZV C;  1UFW A;  5AXM A;  4NX9 A;  1F9H A;  3H8Y A;  3FZB A;  3FQL A;  2DNR A;  4DL5 A;  4K4Z A;  2LQ5 A;  3RRH A;  2R42 A;  3J81 Y;  4S0M A;  4K4U A;  3UCU P;  5CD4 A;  5J2Q B;  4EBD A;  2FLL A;  4TQS A;  2LU1 A;  4DN0 A;  2H65 B;  1S9F A;  3MM9 A;  5EUH A;  2HLT A;  4IOC Q;  2ZVI A;  3IO1 A;  2QL7 B;  3DLE B;  3A3P B;  1G4C A;  3PY8 A;  2P9C A;  2W7P A;  3QMQ A;  5GAE U;  4ZS6 A;  3G82 A;  5K4P A;  2LXU A;  3MZI A;  1SI9 A;  3GIR A;  4HI2 A;  3CME S;  2HKE A;  2C3O A;  4DV2 F;  1T9V A;  2FVR A;  2L3M A;  2W9A A;  1HHS A;  1YZ7 A;  2XMU A;  3ICL A;  2B3T B;  1ELZ A;  2PEB A;  1KSP A;  2PSZ A;  2HGN A;  2JWN A;  1NLK L;  3EUN A;  1DRZ A;  5KT4 A;  3TUJ C;  2XLJ A;  2UXB J;  1FJ7 A;  3BPD A;  1IR2 A;  1DLO A;  4NA3 A;  1YSJ A;  4KR0 B;  2JNJ A;  5C25 A;  2GIF A;  3FSX A;  4I4B A;  1BY9 A;  2YKM A;  2DHX A;  3TI0 A;  2VFV A;  4F26 A;  1S6U A;  1LQ9 A;  1TUG B;  1FTR A;  4Y2I A;  2Q79 A;  2DJW A;  1NRK A;  3PAC A;  4Y2A A;  3IXQ A;  2HZA A;  3WHI A;  1KHK A;  3MEG A;  1VIO A;  2YWE A;  3CO9 A;  3MEC B;  3BDH A;  4IDK B;  3T02 A;  4RNM A;  3K2Y A;  3A8J A;  5IS2 A;  3TAP A;  3I0R B;  1F3V A;  3CWJ A;  2R8K A;  5AXN A;  2LDI A;  3S8S A;  1QVF R;  2LDY A;  2BKN A;  2DBB A;  2G2Z A;  2OGU A;  1ZH5 A;  5KT5 A;  1URR A;  3LAN A;  3RBE A;  3U1L A;  1S1U B;  2V2Q A;  4CO1 A;  4TY8 B;  4X2B A;  4DR2 F;  1U25 A;  4DR4 F;  4DZD A;  1AXQ A;  4QR2 A;  2A10 A;  3A52 A;  5CYQ B;  3W5Y A;  1K44 A;  3DRP B;  1A7G E;  2CQ2 A;  4JI6 J;  4HHJ A;  4KAI A;  2H51 B;  4DFK A;  1NBE B;  1W26 A;  5DG8 A;  3O3L A;  3PHE A;  1AZS A;  3SSS A;  1X0F A;  1VC6 A;  2W5V A;  4HI1 A;  4RJV A;  2RHS B;  4FBT A;  2G0I A;  2W25 A;  2CQG A;  3OW2 R;  2FZK B;  3KJV B;  3M2V B;  3VR1 A;  5HMX A;  2JH3 A;  5IV3 A;  1VQM S;  2HBY B;  1Y11 A;  2ZNZ A;  4RBU A;  1QD1 A;  3W2W A;  4B9T A;  1WUU A;  2F8E X;  2MQO A;  1E6V B;  5DS7 A;  3W3S A;  4KJD A;  1EKS A;  1CS4 B;  1S0V A;  1HMV B;  1NSP A;  1PG5 B;  1FXL A;  3GFZ A;  3HZG A;  2BJ8 A;  2XCA A;  1JNR B;  5DLG A;  3VAI A;  4NE9 C;  5AE3 A;  1TU0 B;  4DQI A;  2CNL B;  1KVI A;  4EYH B;  3MPD A;  2HK2 A;  1SIZ A;  3GWC A;  1GXL A;  2DH8 A;  4KJG A;  1QY7 A;  1SC4 B;  3PRB A;  4C48 A;  2L9N A;  3MM8 A;  1S6P B;  4K8R A;  1NH8 A;  3GSD A;  3OSP A;  3BM7 A;  2BJD A;  3BBB A;  4NPO A;  2BYC A;  3GIM A;  3CMQ A;  4DR3 F;  4CH0 S;  4YR1 A;  1SKU B;  2ZZM A;  4LSN A;  4FYW B;  1FKO A;  2N3O A;  3POT A;  5A8K B;  2D3U A;  3GMG A;  4ERD A;  3ENQ A;  4DPO A;  1GAO A;  4R8U B;  3JYT A;  2XSJ A;  5HK4 A;  3IC1 A;  5J2P B;  4AL6 A;  2RS8 A;  3FCV A;  1N8R T;  1KTV A;  4MAK A;  2HZC A;  5GVQ A;  1CBK A;  2FY8 A;  2CKW A;  1NO8 A;  1JLE A;  2B6A B;  3TZW A;  1Q53 A;  3DYA B;  3MM5 B;  4WE1 B;  4ECY A;  1J5E F;  4G6V B;  3PEJ A;  3ED4 A;  5CCM A;  2L9D A;  2CG8 A;  3NCP A;  4N76 A;  1U1R A;  3QLH B;  2GC8 A;  3J7A 1;  2JL9 A;  2PE8 A;  4KTQ A;  3PFE A;  1T3O A;  1YJ7 A;  3IG1 A;  3L9Z A;  1F60 B;  3AAW B;  5IC4 B;  3IS9 B;  4IOB A;  1IKW A;  4WK1 A;  3BQ1 A;  2R7O A;  3UVJ A;  4UY8 5;  2ZH8 A;  5A8R B;  2JEF A;  1KLN A;  4GKK J; 
#chains in the Genus database with same CATH homology
 1KH7 A;  3M8Z A;  1HDH A;  4N7T A;  1E3C P;  3DPC A;  3NVL A;  5LRM A;  3WAX A;  2RH6 A;  4CYR A;  1AJA A;  1ED8 A;  2ANH A;  4LRD A;  1KH9 A;  2W8S A;  4MY4 A;  4ZG6 A;  1EW9 A;  2D1G A;  1O99 A;  1Y7A A;  1E1Z P;  1AJB A;  3NKQ A;  4KAY A;  4UPL A;  1AUK A;  3KD8 A;  4ZGA A;  5GOV A;  2W5V A;  3SZZ A;  1KH4 A;  4LR7 A;  5L0E A;  1SHQ A;  2GSO A;  1KHN A;  1ALH A;  1SHN A;  3NKR A;  4ZG9 A;  5LQQ A;  2QZU A;  3T00 A;  4LR2 A;  3WBH A;  3NKO A;  1URB A;  1EI6 A;  2GSU A;  1EW2 A;  4UOP A;  1Y6V A;  4QAX A;  5TJ3 A;  1ANI A;  5GRR A;  2X98 A;  2W5W A;  4NWX A;  2W5X A;  1ALK A;  2XR9 A;  3WAW A;  1EQJ A;  3E2D A;  1P49 A;  1E33 P;  4CXS A;  3CMR A;  3DYC A;  3UN2 A;  3MK1 A;  5EGE A;  3WAV A;  3M8Y A;  2VQR A;  4LQY A;  5DLT A;  1N2K A;  4NWJ A;  1URA A;  3NKP A;  1KHK A;  3B5Q A;  3Q3Q A;  2W5T A;  4TN0 A;  1ANJ A;  3NKN A;  4CXK A;  1HJK A;  1ED9 A;  2ZKT A;  4UPH A;  2W5S A;  4LRF A;  3UN3 A;  3IDD A;  3MK0 A;  1ALI A;  4LRB A;  3BDH A;  4KM4 A;  1EJJ A;  5L0B A;  3ED4 A;  1AJC A;  4ZG7 A;  4GTX A;  4KJD A;  5LIA A;  3T02 A;  4LRE A;  2W5R A;  1ELY A;  3IGY B;  5L0K A;  3OT9 A;  4MHX A;  3TWZ A;  3UN5 A;  3UNY A;  3M7V A;  5K4P A;  5C66 A;  2GSN A;  4LRC A;  2G9Y A;  5AJ9 A;  1ZED A;  3MK2 A;  3UO0 A;  1ALJ A;  2W8D A;  3TX0 A;  5LRN A;  1O98 A;  1ZEF A;  4UPK A;  4LRA A;  2GLQ A;  5IJQ A;  1KH5 A;  2IUC B;  3TG0 A;  4MIV A;  3IGZ B;  3SZY A;  5EGH A;  4GTY A;  1ELX A;  5HRT A;  2XRG A;  3WAY A;  1K7H A;  1B8J A;  1KHJ A;  1ELZ A;  4GTZ A;  4KJG A;  2GA3 A;  5IJS A;  1E2S P;  3BDG B;  4FDI A;  4KAV A;  1HQA A;  4UOO A;  2IFY A;  3LXQ A;  4UOR A;  1AJD A;  2IUC A;  4CXU A;  3NKM A;  5KXA A;  4LR8 A;  4LR9 A;  4CYS A;  3M8W A;  4GTW A;  4B56 A;  2W5Q A;  3A52 A;  1ZEB A;  5DLV A;  1N2L A;  1FSU A;  3BDF A;  4FDJ A;  4UPI A;  5INH A;  3BDG A;  1KHL A;  1EW8 A;  3T01 A;  4YR1 A;  5DLW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...