3T02A

Crystal structure of phosphonoacetate hydrolase from sinorhizobium meliloti 1021 in complex with phosphonoacetate
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
Knots found
sequence length
413
structure length
413
Chain Sequence
MSKISVTVNGRRYPWPRVPAIAVCLDGCEPAYLDAAIDAGLMPALKRIKERGAVRLAHSVIPSFANPNNLSIATGSPPAVHGICGNYLYEPSTGEEVMMNDPKFLRAPTIFQAFYDAGARVAVVTAKDKLRALLGKGLRFDEGRAVCFSSEKSDKATRAEHGIDNASAWLGRPVPEVYSAALSEFVFAAGVKLLREFRPDIMYLTTTDYVQHKYAPGVPEANSFYEMFDRYLAELDGLGAAIVVTADHGMKPKHKADGSPDVIYVQDLLDEWLGKDAARVILPITDPYVVHHGALGSFATAYLPDGCDRSEIMARLKAIQGVDVVLGREEACRRFELPEDRIGDIVLVSSENKTLGTSEHRHDLAALDEPLRSHGGLTEQEVPFIVNRVLPELPNAPRLRNFDAFFYAVTAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords phosphonoacetate hydrolase
publication title Structural and mechanistic insights into C-p bond hydrolysis by phosphonoacetate hydrolase.
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Hydrolase
total genus 126
structure length 413
sequence length 413
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.6.1.9: Nucleotide diphosphatase.
pdb deposition date 2011-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.110 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Domain 2, Phosphonoacetate Hydrolase 3t02A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3t02A01
1E33P 4MIVA 4UORA 3A52A 2ANHA 3B5QA 2GSOA 3CMRA 5GRRA 3UNYA 4UOPA 4GTWA 4CXUA 2X98A 5HRTA 1ELXA 2GLQA 1KHKA 2W5TA 1KHLA 2GA3A 1SHQA 2XR9A 1Y6VA 2W8SA 1SHNA 3MK2A 3OT9A 3M8WA 3T00A 3WAYA 3LXQA 1KH4A 3NKOA 2W5QA 2W5XA 1HJKA 3NKRA 4LQYA 2IUCA 1EJJA 1URBA 2W8DA 3SZZA 1ANIA 1KH7A 3M8ZA 3E2DA 1EQJA 3NKNA 1N2LA 3BDHA 4NWXA 4LREA 3MK1A 4MHXA 5IJQA 1FSUA 5KXAA 1ANJA 3SZYA 3NVLA 4LR9A 5AJ9A 2XRGA 2RH6A 1EI6A 1KHNA 4GTYA 1O98A 3TWZA 3WAVA 3KD8A 5DLWA 5LQQA 4UPHA 3MK0A 5GOVA 3BDFA 5LRNA 1AJDA 3TX0A 1AJCA 1ZEBA 3IGZB 1ED9A 4UOOA 4UPLA 2VQRA 3WAXA 1N2KA 1ALHA 2G9YA 4LR7A 3NKPA 1HQAA 1URAA 4MY4A 4CXKA 1KH5A 1EW9A 3IGYB 3TG0A 4LRAA 4ZGAA 3DPCA 1P49A 4CYRA 1ED8A 1E2SP 2W5RA 3M8YA 2D1GA 3BDGA 1E3CP 2IUCB 3UN5A 1EW2A 1ALIA 1HDHA 4KJDA 1E1ZP 2GSNA 4N7TA 1ALKA 4UPKA 4ZG6A 5LRMA 1EW8A 5K4PA 3T01A 5EGEA 3UN3A 2QZUA 5DLVA 4LRDA 3T02A 4KAVA 4GTZA 3WBHA 3DYCA 3WAWA 1ZEFA 4CXSA 4NWJA 4QAXA 5DLTA 2ZKTA 4LRFA 5IJSA 5LIAA 4YR1A 3IDDA 4LR2A 4CYSA 1B8JA 5L0BA 1ELZA 2GSUA 1ALJA 3ED4A 4KJGA 4KM4A 1AJAA 4LRCA 4UPIA 1Y7AA 1K7HA 1ELYA 1KH9A 1AJBA 3Q3QA 5TJ3A 4KAYA 2W5SA 1AUKA 1O99A 4LR8A 4FDIA 5EGHA 3M7VA 5L0KA 5C66A 5L0EA 4ZG7A 3UO0A 4TN0A 1KHJA 2IFYA 2W5WA 1ZEDA 4B56A 2W5VA 4LRBA 3NKMA 3BDGB 5INHA 4ZG9A 3UN2A 4FDJA 4GTXA 3NKQA
chains in the Genus database with same CATH superfamily
1E33P 2NVQK 2GSOA 5GRRA 3UNYA 4UOPA 1TWGK 4GTWA 4KAWX 2X98A 5HRTA 1ELXA 2GLQA 4X6AK 3ADAC 2JA5A 4G0UA 1IE0A 2EBBA 3GTGK 2GA3A 2XR9A 4A3EK 3S1RK 1C0AA 1I3QK 3GEIA 4LK1A 1Y6VA 2W8SA 4GTCA 3N0BA 3T00A 4P5AA 3G4AA 3S14C 4KASA 2VUMC 1B4BA 3JSTA 3N3YA 4XLNA 2W5QA 2W5XA 1HJKA 4OIQA 2R7ZC 3FKIC 2E2IA 3H3VL 1WOOA 3GTLC 4QIWL 2PHCB 3GTPK 2NVTK 3SZZA 2W8DA 2JA7C 1XZQA 1TWFA 1XXBA 2A68A 1WSVA 4G0VA 1O2BA 3FOFA 3NVLA 2XRGA 1I50K 1KHNA 5IYBK 3WAVA 5DLWA 3CQZK 1VRQC 3VA7A 1WCMK 1TWGC 4QJVA 4AH6A 1AJDA 3TX0A 1AJCA 1VLOA 4GT9A 2R7ZA 2XCQA 3FKIA 3IGZB 1ED9A 3WODA 3PO3C 5HL8A 2VQRA 3WAXA 1N2KA 2JA7A 3NUHA 1O2AA 3GTGC 5C4XC 2NVYA 4A3EC 1HQAA 2G9YA 1I3QC 4M1XA 4WJ3M 2GAHC 1YNJA 4O2DA 3S15K 3S1QK 4XCHA 2YU9K 1O27A 4A3GC 4CYRA 1BGWA 3K7AK 2B63K 1WOPA 1EFWA 1E3CP 1TWAC 4GTFA 5L46A 4A3FK 5M5WK 3FHZA 3UN5A 1ALIA 2GSNA 3HKZD 2ZFZA 5LRMA 5E68A 1EW8A 3HOZK 1I50C 3OPFA 4C3HK 4MEYA 3A8KA 4GTZA 1USMA 2JA8C 2WB1L 1ZEFA 2NVXA 2JA6C 1XZPA 4C2MK 1GE9A 4LR2A 3I4NC 3IDDA 4CYSA 2GSUA 4OINA 3S17K 2E2HK 1WCMC 2P5MA 5IP7K 3H3VD 4KM4A 4GTEA 2XCRB 1K7HA 1AB4A 1J98A 1TWAA 3GTOA 5TJ3A 1AJBA 3AQPA 3BP8C 3GTJA 2O5IA 2R92K 3HOVC 1SFOK 2V6UA 2Y0SD 3RZOK 3M7VA 5L0EA 3S15C 3S1QC 2YU9C 3UO0A 5C44C 1I6VA 4Y52K 2JA6A 4OIRA 2W5WA 3K7AC 4FM9A 2B63C 3AD8C 4LRBA 4A3FC 4Q4ZA 1RU0A 1WORA 1PJ5A 1F7UA 4G0WA 3GTQK 3B5QA 3CMRA 4CXUA 1Y1VA 1ZYRA 4XSZA 3S17C 1ZVUA 2E2HC 5IP7C 3OT9A 3WAYA 1TWFK 3GTKK 2ZUEA 3M3YC 5FJ8K 1L0WA 3QX3A 3NKOA 4A3DC 4C45A 2R92C 2IUCA 1SFOC 4BY1K 3RZOC 3PO2C 5M3FK 2XCOA 1ANIA 1KH7A 1EQJA 3HOUK 1N2LA 4LR9A 5AJ9A 4KN7A 1EI6A 1F93A 3A8IA 1DD5A 1K83K 2GAGC 5JVOA 1O98A 4BY7K 3TWZA 4BKWA 4BBRC 3KD8A 3S16C 2R93A 3HKZL 1XZQB 4C3IK 4G7ZA 2FQTA 1F7VA 3MK0A 4WILA 5GOVA 1PJ6A 1Y1WA 1UV7A 1ZEBA 1WQHA 4ILDA 1V5VA 4UOOA 4UPLA 4LR7A 1ALHA 3NKPA 3HOYC 2P8TA 4MY4A 1VH2A 1WIHA 3GTKC 5M5XK 4LRAA 3GTMK 3M8YA 3M4OC 4BY1C 2Y0SL 3LAPA 1R9TK 4PAAA 4KC6A 1HI9A 4ZG6A 1HDHA 1E1ZP 3HOUC 2NVQC 5K4PA 4YFNA 3T01A 2VUMA 4Q5SA 3HOWK 4DDQA 4A3BK 3DYCA 1K83C 4X6AC 1TWCK 1TWHK 3GTLA 1J6VA 4NWJA 4PABA 4BY7C 1KQ4A 5DLTA 3AQOA 5LIAA 1ALJA 3S1RC 4C3IC 3RZDK 3ED4A 3S1NK 5CHPA 4KJGA 4BLAA 3GEHA 1AJAA 4GTAA 3GDZA 1Y7AA 4AYBD 1JOEA 5TMFA 1ELYA 2A6EA 1XZPB 1BS2A 3OEPA 2E2JK 3GTPC 5EGHA 2NVTC 1DCOA 1TWGA 2V6SA 5C66A 4ZG7A 3GIRA 2PA8D 2ZUFA 3GTMC 1X31C 1I6HK 3TFJA 2IFYA 3N0CA 4GTDA 4P5BA 4B56A 3GTGA 2W5VA 4A3KK 5IYBC 4C3JK 3NKMA 3BDGB 1I3QA 1R9TC 1SMYA 1IBAA 2PPBA 3I4MK 1YCLA 1ZXOA 3CQZC 3H0GK 4UORA 3A52A 3HOWC 2A6HA 1TWCC 3G4CA 4WJ4A 4XSXA 1KHKA 3AH5A 1KHLA 1SHQA 3S1NC 2JH3A 1YX2A 4KMDA 3MK2A 3HOXK 1SHNA 1O24A 4A3LK 1I50A 4A3JK 3GSIA 3S2HK 3V4GA 5FLMK 3NKRA 4LQYA 3CQZA 1IL2A 1EJJA 1WCMA 1ZBSA 2JA5K 3M8ZA 1JVIA 3E2DA 3HOZC 5C3EK 5IJQA 3MK1A 5KXAA 4KMUA 3SZYA 4C3HC 5IOQA 4KMAA 2A69A 4A3KC 2RH6A 1DCPA 4C2MC 3I4MC 3H0GC 2YU9A 2E2IK 4UPHA 5LQQA 3BDFA 5LRNA 3S2DK 2B63A 5C4JK 1IS1A 4KM9A 4OIPA 5IYCK 1O25A 1KH5A 3HOXC 3FOEA 4A3LC 1EW9A 4A3JC 1G51A 5D4DA 3S2HC 3L4KA 3TG0A 4AYBL 4Y52C 2O5JA 3DPCA 1VGXA 4LK0A 3S14K 4ZGAA 5IOTA 1ED8A 2FQOA 3TFHA 1E2SP 2D1GA 1EK8A 2E2HA 4YG2A 2R7ZK 3FKIK 1EH1A 3LPXA 2PA8L 2JA7K 1ALKA 2NVYK 5C3EC 3GTQC 1VJEA 3UN3A 4KAVA 3WBHA 1DCHA 1WQGA 2R92A 1SFOA 3WAWA 4CXSA 4BLBA 4QAXA 4LRFA 4YR1A 4GTBA 4OIOA 1ELZA 1ISEA 2E2IC 3MMLB 4YFXA 4RMFA 3S2DC 4MEXA 4QJVB 1TWFC 5C4JC 4GFQA 4LRCA 4UPIA 1KH9A 1O28A 3CAGA 5IYCC 2CFAA 3PO3K 4XLPA 4J3NA 2W5SA 4KAYA 1USOA 4A93K 5C4XK 1AUKA 5IOSA 3GTQA 2NVXK 4LR8A 2WAQD 3AD7C 2KWAA 4TN0A 3A8JA 1KHJA 4A3GK 1ZEDA 1JQWA 5INHA 1TWAK 4BXXK 3GTOK 4A3IK 4GTXA 2NVYC 3NKQA 1YNNA 3GTKA 3GTJK 4MIVA 2ANHA 4KM8A 1J6WA 2V6TA 5CJ9A 4KB2A 2JA8K 2JA6K 3EQLA 3I4NK 2W5TA 4JK1A 4A3CK 4G7HA 1INNA 3M8WA 4NOIA 3LXQA 1K83A 1KH4A 3TFIA 3BP3A 4GTLA 1EQRA 1Y1VK 4A93C 5IYDK 4ZH4A 3TTGA 2NVXC 3HOVK 1BDFA 1URBA 2CW0A 4LLGA 1IQ0A 3NKNA 4NWXA 4A3MK 5C44K 3BDHA 4LREA 4MHXA 1IW7A 1FSUA 1ANJA 4A3BC 2Y3PA 2RGRA 1HQMA 1TWHC 4BXXC 4GTYA 3GTOC 3GTPA 4A3IC 4Y7NK 4KDDA 1ZQ1C 4LJZA 3LAJA 3GTJC 3RZDC 2PMZL 1XPPA 3GTMA 1WQFA 3ERED 1J6XA 4KATA 1R9TA 4BBSK 4FZBA 2E2JC 1BJTA 1WSRA 4A3CC 1URAA 4CXKA 4QIWD 3S1MK 5M5YK 3IGYB 2W7VA 3S0XA 2R93K 1I6HC 1TWCA 1TWHA 3M3YK 3L4JA 1P49A 1O29A 1Y1VC 5IYDC 1Y1WK 2W5RA 4A3DK 4C3JC 3BDGA 2BE5A 4GZYA 2IUCB 1WOSA 2WAQL 5IP9K 3PO2K 3GEEA 3DXJA 1EW2A 4KJDA 4N7TA 4UPKA 4A3MC 5TMCA 5EGEA 2QZUA 5DLVA 4LRDA 3T02A 3OREA 4Y7NC 2ZKTA 5IJSA 5L0BA 1B4AA 3BUEA 1B8JA 4KB4A 4BBRK 3S16K 1XXCA 5M3MK 3HXAA 3AD9C 4BBSC 5FLMC 4G7OA 2VUMK 3Q3QA 3H0GA 3HOYK 1O99A 4FDIA 4YFKA 4KN4A 2JA5C 3S1MC 3GTLK 4MQ9A 5L0KA 4KARA 4LOWA 5JFEA 2R93C 5IORA 2D6FC 1F9NA 4P9SA 2PMZD 1Y1WC 3IPJA 2CFAB 1O2FB 3M4OK 1XXAA 2WB1D 5IP9C 4ZG9A 1PJ7A 1O26A 3UN2A 4FDJA 4KMHA
chains in the Genus database with same CATH topology
1E33P 4MIVA 4UORA 3A52A 2ANHA 3B5QA 2GSOA 3CMRA 5GRRA 3UNYA 4UOPA 4GTWA 4CXUA 2X98A 5HRTA 1ELXA 2GLQA 1KHKA 2W5TA 1KHLA 2GA3A 1SHQA 2XR9A 1Y6VA 2W8SA 1SHNA 3MK2A 3OT9A 3M8WA 3T00A 3WAYA 3LXQA 1KH4A 3NKOA 2W5QA 2W5XA 1HJKA 3NKRA 4LQYA 2IUCA 1EJJA 1URBA 2W8DA 3SZZA 1ANIA 1KH7A 3M8ZA 3E2DA 1EQJA 3NKNA 1N2LA 3BDHA 4NWXA 4LREA 3MK1A 4MHXA 5IJQA 1FSUA 5KXAA 1ANJA 3SZYA 3NVLA 4LR9A 5AJ9A 2XRGA 2RH6A 1EI6A 1KHNA 4GTYA 1O98A 3TWZA 3WAVA 3KD8A 5DLWA 5LQQA 4UPHA 3MK0A 5GOVA 3BDFA 5LRNA 1AJDA 3TX0A 1AJCA 1ZEBA 3IGZB 1ED9A 4UOOA 4UPLA 2VQRA 3WAXA 1N2KA 1ALHA 2G9YA 4LR7A 3NKPA 1HQAA 1URAA 4MY4A 4CXKA 1KH5A 1EW9A 3IGYB 3TG0A 4LRAA 4ZGAA 3DPCA 1P49A 4CYRA 1ED8A 1E2SP 2W5RA 3M8YA 2D1GA 3BDGA 1E3CP 2IUCB 3UN5A 1EW2A 1ALIA 1HDHA 4KJDA 1E1ZP 2GSNA 4N7TA 1ALKA 4UPKA 4ZG6A 5LRMA 1EW8A 5K4PA 3T01A 5EGEA 3UN3A 2QZUA 5DLVA 4LRDA 3T02A 4KAVA 4GTZA 3WBHA 3DYCA 3WAWA 1ZEFA 4CXSA 4NWJA 4QAXA 5DLTA 2ZKTA 4LRFA 5IJSA 5LIAA 4YR1A 3IDDA 4LR2A 4CYSA 1B8JA 5L0BA 1ELZA 2GSUA 1ALJA 3ED4A 4KJGA 4KM4A 1AJAA 4LRCA 4UPIA 1Y7AA 1K7HA 1ELYA 1KH9A 1AJBA 3Q3QA 5TJ3A 4KAYA 2W5SA 1AUKA 1O99A 4LR8A 4FDIA 5EGHA 3M7VA 5L0KA 5C66A 5L0EA 4ZG7A 3UO0A 4TN0A 1KHJA 2IFYA 2W5WA 1ZEDA 4B56A 2W5VA 4LRBA 3NKMA 3BDGB 5INHA 4ZG9A 3UN2A 4FDJA 4GTXA 3NKQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E33 P;  4MIV A;  4UOR A;  3A52 A;  2ANH A;  3B5Q A;  2GSO A;  3CMR A;  5GRR A;  3UNY A;  4UOP A;  4GTW A;  4CXU A;  2X98 A;  5HRT A;  1ELX A;  2GLQ A;  1KHK A;  2W5T A;  1KHL A;  2GA3 A;  1SHQ A;  2XR9 A;  1Y6V A;  2W8S A;  1SHN A;  3MK2 A;  3OT9 A;  3M8W A;  3T00 A;  3WAY A;  3LXQ A;  1KH4 A;  3NKO A;  2W5Q A;  2W5X A;  1HJK A;  3NKR A;  4LQY A;  2IUC A;  1EJJ A;  1URB A;  2W8D A;  3SZZ A;  1ANI A;  1KH7 A;  3M8Z A;  3E2D A;  1EQJ A;  3NKN A;  1N2L A;  3BDH A;  4NWX A;  4LRE A;  3MK1 A;  4MHX A;  5IJQ A;  1FSU A;  5KXA A;  1ANJ A;  3SZY A;  3NVL A;  4LR9 A;  5AJ9 A;  2XRG A;  2RH6 A;  1EI6 A;  1KHN A;  4GTY A;  1O98 A;  3TWZ A;  3WAV A;  3KD8 A;  5DLW A;  5LQQ A;  4UPH A;  3MK0 A;  5GOV A;  3BDF A;  5LRN A;  1AJD A;  3TX0 A;  1AJC A;  1ZEB A;  3IGZ B;  1ED9 A;  4UOO A;  4UPL A;  2VQR A;  3WAX A;  1N2K A;  1ALH A;  2G9Y A;  4LR7 A;  3NKP A;  1HQA A;  1URA A;  4MY4 A;  4CXK A;  1KH5 A;  1EW9 A;  3IGY B;  3TG0 A;  4LRA A;  4ZGA A;  3DPC A;  1P49 A;  4CYR A;  1ED8 A;  1E2S P;  2W5R A;  3M8Y A;  2D1G A;  3BDG A;  1E3C P;  2IUC B;  3UN5 A;  1EW2 A;  1ALI A;  1HDH A;  4KJD A;  1E1Z P;  2GSN A;  4N7T A;  1ALK A;  4UPK A;  4ZG6 A;  5LRM A;  1EW8 A;  5K4P A;  3T01 A;  5EGE A;  3UN3 A;  2QZU A;  5DLV A;  4LRD A;  3T02 A;  4KAV A;  4GTZ A;  3WBH A;  3DYC A;  3WAW A;  1ZEF A;  4CXS A;  4NWJ A;  4QAX A;  5DLT A;  2ZKT A;  4LRF A;  5IJS A;  5LIA A;  4YR1 A;  3IDD A;  4LR2 A;  4CYS A;  1B8J A;  5L0B A;  1ELZ A;  2GSU A;  1ALJ A;  3ED4 A;  4KJG A;  4KM4 A;  1AJA A;  4LRC A;  4UPI A;  1Y7A A;  1K7H A;  1ELY A;  1KH9 A;  1AJB A;  3Q3Q A;  5TJ3 A;  4KAY A;  2W5S A;  1AUK A;  1O99 A;  4LR8 A;  4FDI A;  5EGH A;  3M7V A;  5L0K A;  5C66 A;  5L0E A;  4ZG7 A;  3UO0 A;  4TN0 A;  1KHJ A;  2IFY A;  2W5W A;  1ZED A;  4B56 A;  2W5V A;  4LRB A;  3NKM A;  3BDG B;  5INH A;  4ZG9 A;  3UN2 A;  4FDJ A;  4GTX A;  3NKQ A; 
#chains in the Genus database with same CATH topology
 1E33 P;  2NVQ K;  2GSO A;  5GRR A;  3UNY A;  4UOP A;  1TWG K;  4GTW A;  4KAW X;  2X98 A;  5HRT A;  1ELX A;  2GLQ A;  4X6A K;  3ADA C;  2JA5 A;  4G0U A;  1IE0 A;  2EBB A;  3GTG K;  2GA3 A;  2XR9 A;  4A3E K;  3S1R K;  1C0A A;  1I3Q K;  3GEI A;  4LK1 A;  1Y6V A;  2W8S A;  4GTC A;  3N0B A;  3T00 A;  4P5A A;  3G4A A;  3S14 C;  4KAS A;  2VUM C;  1B4B A;  3JST A;  3N3Y A;  4XLN A;  2W5Q A;  2W5X A;  1HJK A;  4OIQ A;  2R7Z C;  3FKI C;  2E2I A;  3H3V L;  1WOO A;  3GTL C;  4QIW L;  2PHC B;  3GTP K;  2NVT K;  3SZZ A;  2W8D A;  2JA7 C;  1XZQ A;  1TWF A;  1XXB A;  2A68 A;  1WSV A;  4G0V A;  1O2B A;  3FOF A;  3NVL A;  2XRG A;  1I50 K;  1KHN A;  5IYB K;  3WAV A;  5DLW A;  3CQZ K;  1VRQ C;  3VA7 A;  1WCM K;  1TWG C;  4QJV A;  4AH6 A;  1AJD A;  3TX0 A;  1AJC A;  1VLO A;  4GT9 A;  2R7Z A;  2XCQ A;  3FKI A;  3IGZ B;  1ED9 A;  3WOD A;  3PO3 C;  5HL8 A;  2VQR A;  3WAX A;  1N2K A;  2JA7 A;  3NUH A;  1O2A A;  3GTG C;  5C4X C;  2NVY A;  4A3E C;  1HQA A;  2G9Y A;  1I3Q C;  4M1X A;  4WJ3 M;  2GAH C;  1YNJ A;  4O2D A;  3S15 K;  3S1Q K;  4XCH A;  2YU9 K;  1O27 A;  4A3G C;  4CYR A;  1BGW A;  3K7A K;  2B63 K;  1WOP A;  1EFW A;  1E3C P;  1TWA C;  4GTF A;  5L46 A;  4A3F K;  5M5W K;  3FHZ A;  3UN5 A;  1ALI A;  2GSN A;  3HKZ D;  2ZFZ A;  5LRM A;  5E68 A;  1EW8 A;  3HOZ K;  1I50 C;  3OPF A;  4C3H K;  4MEY A;  3A8K A;  4GTZ A;  1USM A;  2JA8 C;  2WB1 L;  1ZEF A;  2NVX A;  2JA6 C;  1XZP A;  4C2M K;  1GE9 A;  4LR2 A;  3I4N C;  3IDD A;  4CYS A;  2GSU A;  4OIN A;  3S17 K;  2E2H K;  1WCM C;  2P5M A;  5IP7 K;  3H3V D;  4KM4 A;  4GTE A;  2XCR B;  1K7H A;  1AB4 A;  1J98 A;  1TWA A;  3GTO A;  5TJ3 A;  1AJB A;  3AQP A;  3BP8 C;  3GTJ A;  2O5I A;  2R92 K;  3HOV C;  1SFO K;  2V6U A;  2Y0S D;  3RZO K;  3M7V A;  5L0E A;  3S15 C;  3S1Q C;  2YU9 C;  3UO0 A;  5C44 C;  1I6V A;  4Y52 K;  2JA6 A;  4OIR A;  2W5W A;  3K7A C;  4FM9 A;  2B63 C;  3AD8 C;  4LRB A;  4A3F C;  4Q4Z A;  1RU0 A;  1WOR A;  1PJ5 A;  1F7U A;  4G0W A;  3GTQ K;  3B5Q A;  3CMR A;  4CXU A;  1Y1V A;  1ZYR A;  4XSZ A;  3S17 C;  1ZVU A;  2E2H C;  5IP7 C;  3OT9 A;  3WAY A;  1TWF K;  3GTK K;  2ZUE A;  3M3Y C;  5FJ8 K;  1L0W A;  3QX3 A;  3NKO A;  4A3D C;  4C45 A;  2R92 C;  2IUC A;  1SFO C;  4BY1 K;  3RZO C;  3PO2 C;  5M3F K;  2XCO A;  1ANI A;  1KH7 A;  1EQJ A;  3HOU K;  1N2L A;  4LR9 A;  5AJ9 A;  4KN7 A;  1EI6 A;  1F93 A;  3A8I A;  1DD5 A;  1K83 K;  2GAG C;  5JVO A;  1O98 A;  4BY7 K;  3TWZ A;  4BKW A;  4BBR C;  3KD8 A;  3S16 C;  2R93 A;  3HKZ L;  1XZQ B;  4C3I K;  4G7Z A;  2FQT A;  1F7V A;  3MK0 A;  4WIL A;  5GOV A;  1PJ6 A;  1Y1W A;  1UV7 A;  1ZEB A;  1WQH A;  4ILD A;  1V5V A;  4UOO A;  4UPL A;  4LR7 A;  1ALH A;  3NKP A;  3HOY C;  2P8T A;  4MY4 A;  1VH2 A;  1WIH A;  3GTK C;  5M5X K;  4LRA A;  3GTM K;  3M8Y A;  3M4O C;  4BY1 C;  2Y0S L;  3LAP A;  1R9T K;  4PAA A;  4KC6 A;  1HI9 A;  4ZG6 A;  1HDH A;  1E1Z P;  3HOU C;  2NVQ C;  5K4P A;  4YFN A;  3T01 A;  2VUM A;  4Q5S A;  3HOW K;  4DDQ A;  4A3B K;  3DYC A;  1K83 C;  4X6A C;  1TWC K;  1TWH K;  3GTL A;  1J6V A;  4NWJ A;  4PAB A;  4BY7 C;  1KQ4 A;  5DLT A;  3AQO A;  5LIA A;  1ALJ A;  3S1R C;  4C3I C;  3RZD K;  3ED4 A;  3S1N K;  5CHP A;  4KJG A;  4BLA A;  3GEH A;  1AJA A;  4GTA A;  3GDZ A;  1Y7A A;  4AYB D;  1JOE A;  5TMF A;  1ELY A;  2A6E A;  1XZP B;  1BS2 A;  3OEP A;  2E2J K;  3GTP C;  5EGH A;  2NVT C;  1DCO A;  1TWG A;  2V6S A;  5C66 A;  4ZG7 A;  3GIR A;  2PA8 D;  2ZUF A;  3GTM C;  1X31 C;  1I6H K;  3TFJ A;  2IFY A;  3N0C A;  4GTD A;  4P5B A;  4B56 A;  3GTG A;  2W5V A;  4A3K K;  5IYB C;  4C3J K;  3NKM A;  3BDG B;  1I3Q A;  1R9T C;  1SMY A;  1IBA A;  2PPB A;  3I4M K;  1YCL A;  1ZXO A;  3CQZ C;  3H0G K;  4UOR A;  3A52 A;  3HOW C;  2A6H A;  1TWC C;  3G4C A;  4WJ4 A;  4XSX A;  1KHK A;  3AH5 A;  1KHL A;  1SHQ A;  3S1N C;  2JH3 A;  1YX2 A;  4KMD A;  3MK2 A;  3HOX K;  1SHN A;  1O24 A;  4A3L K;  1I50 A;  4A3J K;  3GSI A;  3S2H K;  3V4G A;  5FLM K;  3NKR A;  4LQY A;  3CQZ A;  1IL2 A;  1EJJ A;  1WCM A;  1ZBS A;  2JA5 K;  3M8Z A;  1JVI A;  3E2D A;  3HOZ C;  5C3E K;  5IJQ A;  3MK1 A;  5KXA A;  4KMU A;  3SZY A;  4C3H C;  5IOQ A;  4KMA A;  2A69 A;  4A3K C;  2RH6 A;  1DCP A;  4C2M C;  3I4M C;  3H0G C;  2YU9 A;  2E2I K;  4UPH A;  5LQQ A;  3BDF A;  5LRN A;  3S2D K;  2B63 A;  5C4J K;  1IS1 A;  4KM9 A;  4OIP A;  5IYC K;  1O25 A;  1KH5 A;  3HOX C;  3FOE A;  4A3L C;  1EW9 A;  4A3J C;  1G51 A;  5D4D A;  3S2H C;  3L4K A;  3TG0 A;  4AYB L;  4Y52 C;  2O5J A;  3DPC A;  1VGX A;  4LK0 A;  3S14 K;  4ZGA A;  5IOT A;  1ED8 A;  2FQO A;  3TFH A;  1E2S P;  2D1G A;  1EK8 A;  2E2H A;  4YG2 A;  2R7Z K;  3FKI K;  1EH1 A;  3LPX A;  2PA8 L;  2JA7 K;  1ALK A;  2NVY K;  5C3E C;  3GTQ C;  1VJE A;  3UN3 A;  4KAV A;  3WBH A;  1DCH A;  1WQG A;  2R92 A;  1SFO A;  3WAW A;  4CXS A;  4BLB A;  4QAX A;  4LRF A;  4YR1 A;  4GTB A;  4OIO A;  1ELZ A;  1ISE A;  2E2I C;  3MML B;  4YFX A;  4RMF A;  3S2D C;  4MEX A;  4QJV B;  1TWF C;  5C4J C;  4GFQ A;  4LRC A;  4UPI A;  1KH9 A;  1O28 A;  3CAG A;  5IYC C;  2CFA A;  3PO3 K;  4XLP A;  4J3N A;  2W5S A;  4KAY A;  1USO A;  4A93 K;  5C4X K;  1AUK A;  5IOS A;  3GTQ A;  2NVX K;  4LR8 A;  2WAQ D;  3AD7 C;  2KWA A;  4TN0 A;  3A8J A;  1KHJ A;  4A3G K;  1ZED A;  1JQW A;  5INH A;  1TWA K;  4BXX K;  3GTO K;  4A3I K;  4GTX A;  2NVY C;  3NKQ A;  1YNN A;  3GTK A;  3GTJ K;  4MIV A;  2ANH A;  4KM8 A;  1J6W A;  2V6T A;  5CJ9 A;  4KB2 A;  2JA8 K;  2JA6 K;  3EQL A;  3I4N K;  2W5T A;  4JK1 A;  4A3C K;  4G7H A;  1INN A;  3M8W A;  4NOI A;  3LXQ A;  1K83 A;  1KH4 A;  3TFI A;  3BP3 A;  4GTL A;  1EQR A;  1Y1V K;  4A93 C;  5IYD K;  4ZH4 A;  3TTG A;  2NVX C;  3HOV K;  1BDF A;  1URB A;  2CW0 A;  4LLG A;  1IQ0 A;  3NKN A;  4NWX A;  4A3M K;  5C44 K;  3BDH A;  4LRE A;  4MHX A;  1IW7 A;  1FSU A;  1ANJ A;  4A3B C;  2Y3P A;  2RGR A;  1HQM A;  1TWH C;  4BXX C;  4GTY A;  3GTO C;  3GTP A;  4A3I C;  4Y7N K;  4KDD A;  1ZQ1 C;  4LJZ A;  3LAJ A;  3GTJ C;  3RZD C;  2PMZ L;  1XPP A;  3GTM A;  1WQF A;  3ERE D;  1J6X A;  4KAT A;  1R9T A;  4BBS K;  4FZB A;  2E2J C;  1BJT A;  1WSR A;  4A3C C;  1URA A;  4CXK A;  4QIW D;  3S1M K;  5M5Y K;  3IGY B;  2W7V A;  3S0X A;  2R93 K;  1I6H C;  1TWC A;  1TWH A;  3M3Y K;  3L4J A;  1P49 A;  1O29 A;  1Y1V C;  5IYD C;  1Y1W K;  2W5R A;  4A3D K;  4C3J C;  3BDG A;  2BE5 A;  4GZY A;  2IUC B;  1WOS A;  2WAQ L;  5IP9 K;  3PO2 K;  3GEE A;  3DXJ A;  1EW2 A;  4KJD A;  4N7T A;  4UPK A;  4A3M C;  5TMC A;  5EGE A;  2QZU A;  5DLV A;  4LRD A;  3T02 A;  3ORE A;  4Y7N C;  2ZKT A;  5IJS A;  5L0B A;  1B4A A;  3BUE A;  1B8J A;  4KB4 A;  4BBR K;  3S16 K;  1XXC A;  5M3M K;  3HXA A;  3AD9 C;  4BBS C;  5FLM C;  4G7O A;  2VUM K;  3Q3Q A;  3H0G A;  3HOY K;  1O99 A;  4FDI A;  4YFK A;  4KN4 A;  2JA5 C;  3S1M C;  3GTL K;  4MQ9 A;  5L0K A;  4KAR A;  4LOW A;  5JFE A;  2R93 C;  5IOR A;  2D6F C;  1F9N A;  4P9S A;  2PMZ D;  1Y1W C;  3IPJ A;  2CFA B;  1O2F B;  3M4O K;  1XXA A;  2WB1 D;  5IP9 C;  4ZG9 A;  1PJ7 A;  1O26 A;  3UN2 A;  4FDJ A;  4KMH A; 
#chains in the Genus database with same CATH homology
 1E33 P;  4MIV A;  4UOR A;  3A52 A;  2ANH A;  3B5Q A;  2GSO A;  3CMR A;  5GRR A;  3UNY A;  4UOP A;  4GTW A;  4CXU A;  2X98 A;  5HRT A;  1ELX A;  2GLQ A;  1KHK A;  2W5T A;  1KHL A;  2GA3 A;  1SHQ A;  2XR9 A;  1Y6V A;  2W8S A;  1SHN A;  3MK2 A;  3OT9 A;  3M8W A;  3T00 A;  3WAY A;  3LXQ A;  1KH4 A;  3NKO A;  2W5Q A;  2W5X A;  1HJK A;  3NKR A;  4LQY A;  2IUC A;  1EJJ A;  1URB A;  2W8D A;  3SZZ A;  1ANI A;  1KH7 A;  3M8Z A;  3E2D A;  1EQJ A;  3NKN A;  1N2L A;  3BDH A;  4NWX A;  4LRE A;  3MK1 A;  4MHX A;  5IJQ A;  1FSU A;  5KXA A;  1ANJ A;  3SZY A;  3NVL A;  4LR9 A;  5AJ9 A;  2XRG A;  2RH6 A;  1EI6 A;  1KHN A;  4GTY A;  1O98 A;  3TWZ A;  3WAV A;  3KD8 A;  5DLW A;  5LQQ A;  4UPH A;  3MK0 A;  5GOV A;  3BDF A;  5LRN A;  1AJD A;  3TX0 A;  1AJC A;  1ZEB A;  3IGZ B;  1ED9 A;  4UOO A;  4UPL A;  2VQR A;  3WAX A;  1N2K A;  1ALH A;  2G9Y A;  4LR7 A;  3NKP A;  1HQA A;  1URA A;  4MY4 A;  4CXK A;  1KH5 A;  1EW9 A;  3IGY B;  3TG0 A;  4LRA A;  4ZGA A;  3DPC A;  1P49 A;  4CYR A;  1ED8 A;  1E2S P;  2W5R A;  3M8Y A;  2D1G A;  3BDG A;  1E3C P;  2IUC B;  3UN5 A;  1EW2 A;  1ALI A;  1HDH A;  4KJD A;  1E1Z P;  2GSN A;  4N7T A;  1ALK A;  4UPK A;  4ZG6 A;  5LRM A;  1EW8 A;  5K4P A;  3T01 A;  5EGE A;  3UN3 A;  2QZU A;  5DLV A;  4LRD A;  3T02 A;  4KAV A;  4GTZ A;  3WBH A;  3DYC A;  3WAW A;  1ZEF A;  4CXS A;  4NWJ A;  4QAX A;  5DLT A;  2ZKT A;  4LRF A;  5IJS A;  5LIA A;  4YR1 A;  3IDD A;  4LR2 A;  4CYS A;  1B8J A;  5L0B A;  1ELZ A;  2GSU A;  1ALJ A;  3ED4 A;  4KJG A;  4KM4 A;  1AJA A;  4LRC A;  4UPI A;  1Y7A A;  1K7H A;  1ELY A;  1KH9 A;  1AJB A;  3Q3Q A;  5TJ3 A;  4KAY A;  2W5S A;  1AUK A;  1O99 A;  4LR8 A;  4FDI A;  5EGH A;  3M7V A;  5L0K A;  5C66 A;  5L0E A;  4ZG7 A;  3UO0 A;  4TN0 A;  1KHJ A;  2IFY A;  2W5W A;  1ZED A;  4B56 A;  2W5V A;  4LRB A;  3NKM A;  3BDG B;  5INH A;  4ZG9 A;  3UN2 A;  4FDJ A;  4GTX A;  3NKQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...