3T02A

Crystal structure of phosphonoacetate hydrolase from sinorhizobium meliloti 1021 in complex with phosphonoacetate
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
Knots found
sequence length
413
structure length
413
Chain Sequence
MSKISVTVNGRRYPWPRVPAIAVCLDGCEPAYLDAAIDAGLMPALKRIKERGAVRLAHSVIPSFANPNNLSIATGSPPAVHGICGNYLYEPSTGEEVMMNDPKFLRAPTIFQAFYDAGARVAVVTAKDKLRALLGKGLRFDEGRAVCFSSEKSDKATRAEHGIDNASAWLGRPVPEVYSAALSEFVFAAGVKLLREFRPDIMYLTTTDYVQHKYAPGVPEANSFYEMFDRYLAELDGLGAAIVVTADHGMKPKHKADGSPDVIYVQDLLDEWLGKDAARVILPITDPYVVHHGALGSFATAYLPDGCDRSEIMARLKAIQGVDVVLGREEACRRFELPEDRIGDIVLVSSENKTLGTSEHRHDLAALDEPLRSHGGLTEQEVPFIVNRVLPELPNAPRLRNFDAFFYAVTAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords phosphonoacetate hydrolase
publication title Structural and mechanistic insights into C-p bond hydrolysis by phosphonoacetate hydrolase.
pubmed doi rcsb
source organism Sinorhizobium meliloti
total genus 126
structure length 413
sequence length 413
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.6.1.9: Nucleotide diphosphatase.
pdb deposition date 2011-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.110 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Domain 2, Phosphonoacetate Hydrolase 3t02A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3t02A01
4CYSA 1EJJA 1E33P 4LRDA 3E2DA 4TN0A 1K7HA 3TX0A 1KH4A 2RH6A 3TG0A 1AUKA 1ELZA 3BDFA 4LR8A 3MK2A 1URBA 4UPIA 5EGEA 4NWXA 2GSUA 1KHNA 2IFYA 3BDGB 1Y7AA 3NVLA 1ELXA 2W5VA 3M8ZA 1P49A 1SHQA 4B56A 1ZEBA 3CMRA 3UO0A 1ALIA 1Y6VA 3A52A 3ED4A 4LR9A 2ZKTA 2QZUA 4MHXA 3WAXA 4LRCA 4UOOA 3SZYA 3NKOA 1ED9A 1E3CP 4UPHA 3WAVA 5IJSA 2GSOA 3UN5A 1N2KA 4UPKA 1ED8A 4LRFA 5KXAA 3NKNA 1EW9A 3UN3A 3WBHA 4KAVA 2IUCB 4LRBA 4ZG6A 3IGZB 1KH7A 4MIVA 1HQAA 4CYRA 5DLTA 1EW2A 2W5RA 5GRRA 1ZEFA 3UNYA 3UN2A 1KH9A 5EGHA 2W5WA 5IJQA 2W5XA 1B8JA 5LRNA 2X98A 3WAWA 3T00A 1EW8A 1KHLA 3KD8A 1O98A 3NKPA 4YR1A 1ELYA 3DPCA 1ANJA 4GTYA 5L0EA 1E1ZP 5LRMA 2W5TA 3M7VA 1HJKA 1ZEDA 1ALHA 2GLQA 1N2LA 4LR2A 1ALKA 2W5QA 2G9YA 1KHKA 2D1GA 3M8WA 3NKMA 5INHA 1FSUA 4UOPA 5LIAA 1EQJA 4CXKA 1O99A 4KJDA 3Q3QA 4N7TA 2W8DA 3BDGA 5L0KA 3T01A 1HDHA 3TWZA 5LQQA 4CXUA 4GTZA 3IGYB 4QAXA 4UORA 5C66A 2XR9A 4LREA 4ZG9A 1SHNA 4FDIA 1URAA 3OT9A 4KJGA 2XRGA 4ZG7A 2W8SA 3SZZA 3WAYA 4LRAA 2GA3A 4GTWA 4FDJA 3NKRA 5AJ9A 1KHJA 1AJAA 1ANIA 4CXSA 1AJDA 4UPLA 3MK1A 2IUCA 2ANHA 1AJBA 2GSNA 3LXQA 2W5SA 4LR7A 1AJCA 4KAYA 5GOVA 5L0BA 4ZGAA 4GTXA 4NWJA 5DLVA 4LQYA 3BDHA 4MY4A 5K4PA 4KM4A 1EI6A 2VQRA 3DYCA 3M8YA 3NKQA 3MK0A 5HRTA 3B5QA 1ALJA 1E2SP 3IDDA 3T02A 5TJ3A 1KH5A 5DLWA
chains in the Genus database with same CATH superfamily
3HOZC 2A69A 1EJJA 4X6AK 4LRDA 4BLBA 3S0XA 4Y7NC 2VUMC 1TWCC 1USOA 3GTJK 1KHNA 2IFYA 1WORA 2JA7A 2PMZL 1ELXA 3NVLA 1P49A 3DXJA 5IYDC 2YU9A 1WIHA 3BUEA 3ED4A 1KQ4A 4A3KK 4KB2A 4UOOA 1IL2A 3GTKC 3HOXK 1V5VA 1E3CP 4UPHA 4YFNA 5IJSA 2GSOA 3GTOK 1N2KA 4UPKA 4G0VA 3FHZA 4Y52K 4QJVA 3GIRA 3UN3A 1XZPA 3FOFA 3GTGC 3WBHA 2IUCB 4A3EK 1SMYA 3AQPA 1C0AA 4A3FK 1TWCA 4C45A 1ZEFA 4AYBD 5FLMC 1KH9A 5IJQA 1YX2A 2WAQD 5FJ8K 3QX3A 3RZDC 3NKPA 3GEEA 4LK1A 4BBSK 2PPBA 1HI9A 2GAHC 1PJ7A 2W5TA 3M7VA 2YU9K 1ALHA 3GTKA 2V6TA 1X31C 2JA5C 2D1GA 2G9YA 3M8WA 1FSUA 1L0WA 2R7ZC 1IW7A 4CXKA 5CJ9A 3Q3QA 4GTFA 4N7TA 3GTGA 3HOZK 1J6XA 4G7HA 3FKIC 2WAQL 4GTZA 4Y7NK 3M4OC 5IOSA 2VUMK 2XR9A 4ZG9A 1TWCK 5IYBK 1URAA 4FDIA 4KMAA 4YFXA 4BLAA 2E2IA 2A6EA 5IYCC 5AJ9A 1Y1WC 3NKRA 5IYDK 2JA6C 2W7VA 3A8IA 3HOWC 4UPLA 2XCQA 1RU0A 4XLPA 2JA5A 3GTKK 3MK1A 2NVXC 3H3VD 2R7ZA 3LXQA 2W5SA 5C4JC 3A8KA 3S1QC 3S2HC 4C3IC 4ZGAA 2FQOA 5DLVA 5TMCA 3GTGK 4GTBA 4MY4A 2VQRA 5FLMK 3B5QA 3IDDA 4KMHA 5DLWA 4C2MC 1ZXOA 1Y1WA 1E33P 3K7AC 3MMLB 3RZDK 3E2DA 1O25A 2JA6A 1AUKA 2E2JC 1O2FB 4KMDA 2Y0SL 3S2DC 2GSUA 2JA5K 3OPFA 3GTMC 2W5VA 2R7ZK 4KASA 4B56A 1XZQB 4G7ZA 4GTDA 4KMUA 5IP9C 3AH5A 3S17C 3CMRA 1PJ5A 1ALIA 3FKIK 3A52A 3WAXA 2KWAA 1Y1VC 4LRCA 1USMA 3WAVA 3M4OK 3CAGA 1EQRA 2D6FC 3UN5A 3N0BA 4O2DA 3HOYC 2JH3A 4BY7C 1BS2A 2ZUFA 4KAVA 5IYCK 1Y1WK 1HQMA 1HQAA 2JA6K 2JA8C 1GE9A 1O27A 4A3MC 1K83C 3HOWK 5EGHA 4GZYA 4BXXC 2NVQC 3GTMA 2W5XA 5LRNA 2X98A 2NVXK 1IBAA 1I6VA 3KD8A 4OIRA 1O98A 5C4JK 1ELYA 1DD5A 2PA8D 3L4KA 1ANJA 4GTYA 3G4CA 1YNJA 2ZFZA 3S2HK 3S1QK 1E1ZP 4C3IK 5LRMA 1Y1VA 3AD7C 1ZEDA 2CFAA 4OIQA 4LK0A 1ZBSA 4KATA 3PO2C 1KHKA 3JSTA 5CHPA 1UV7A 1ZVUA 4KJDA 4C2MK 3HKZD 3BDGA 4A3GC 3K7AK 4XLNA 2V6UA 3S14C 1K83A 2E2JK 4QAXA 4UORA 1VJEA 4LREA 3S2DK 1YCLA 1WOPA 1WSVA 1EH1A 1WQFA 4YG2A 2P8TA 3TFHA 2E2IC 2JA7K 4OIPA 1WQHA 3GTLC 3GTMK 3GDZA 3SZZA 4DDQA 4FM9A 4LRAA 4GTWA 4FDJA 1IE0A 1KHJA 5IP9K 4JK1A 3S17K 5IOQA 3HKZL 4PAAA 4XSXA 4QJVB 1XZPB 1DCHA 4GTAA 3HOUC 3HOYK 4AYBL 4BBRC 5L0BA 4BY7K 3GEIA 3ERED 4KARA 5TMFA 3BDHA 4RMFA 1EI6A 2JA8K 1ISEA 5IOTA 3NKQA 4MEYA 4A3MK 2WB1D 1K83K 3GTLA 2R93C 1E2SP 1ALJA 4BXXK 2NVQK 1B4BA 1KH5A 4CYSA 3S1NC 1BJTA 4A3IC 3IPJA 4TN0A 4P5BA 1DCPA 1K7HA 3TX0A 1KH4A 3TG0A 1ELZA 4GTCA 3BDFA 4LR8A 4GT9A 3HOVC 5M3MK 1URBA 4UPIA 5EGEA 4NWXA 3PO2K 1O26A 4A3BC 4A3LC 2EBBA 3EQLA 1ZEBA 4LOWA 3UO0A 3I4MC 2FQTA 4A3GK 4LR9A 2ZKTA 2QZUA 4MHXA 4WJ4A 3BP8C 4KB4A 3LAPA 1XXCA 3S14K 3NKOA 2A6HA 2R93A 1O28A 3TTGA 2BE5A 4XCHA 1ED8A 4LRFA 3GEHA 3GTLK 2E2IK 5E68A 3GTPC 2A68A 3H3VL 1R9TC 3S1MC 3CQZA 3IGZB 4ZG6A 4MIVA 5JFEA 1I3QC 1EW2A 2W5RA 5DLTA 4KDDA 3OREA 3UN2A 4J3NA 2W5WA 5M5YK 3S15C 1B8JA 1F93A 1AB4A 3WAWA 1EW8A 3HOUK 1VLOA 2Y3PA 3DPCA 1VGXA 5C3EC 4WILA 4BBRK 5L0EA 1I50C 1HJKA 1SFOC 2E2HC 1N2LA 4PABA 1TWAC 3GTJA 5INHA 5LIAA 3TFJA 2V6SA 4A3CC 2R93K 1EQJA 3GTPA 3S1NK 2W8DA 1R9TA 5L0KA 4A3IK 3V4GA 3T01A 1EFWA 1TWFC 2XCOA 2B63C 3TWZA 1I3QA 3OEPA 2PMZD 3ADAC 4A93C 4Q4ZA 4A3JC 5C66A 3HOVK 1B4AA 1O2AA 4KM8A 4LLGA 3N0CA 1SHNA 2XRGA 4ZG7A 4Q5SA 5C4XC 2W8SA 3LAJA 1WSRA 3H0GC 4KAWX 4A3BK 1J98A 4A3LK 2GA3A 3WAYA 4YFKA 4KN4A 5L46A 1TWHC 4NOIA 2NVYC 1I50A 2RGRA 1SFOA 3PO3C 2E2HA 3I4MK 1TWAA 1YNNA 4CXSA 1AJDA 1XPPA 3RZOC 2IUCA 3AD9C 2ANHA 2GSNA 3TFIA 5IYBC 1O2BA 1AJCA 4KAYA 5GOVA 4GFQA 3NUHA 1XXAA 3GTPK 1TWFA 2B63A 4GTXA 4NWJA 3G4AA 4LQYA 5IP7C 1R9TK 3S1MK 1WCMC 4C3JC 2PA8L 1I3QK 1VRQC 4GTEA 4KM4A 3DYCA 4ZH4A 1VH2A 4FZBA 3M8YA 3MK0A 5D4DA 5HRTA 1ZYRA 4MQ9A 3T02A 4OINA 5TJ3A 3H0GA 2R92C 3M3YC 3S15K 1TWGC 1DCOA 2CFAB 1I6HC 5JVOA 5C44C 1IQ0A 1ZQ1C 1TWHA 3VA7A 2NVYA 5C3EK 3GTQC 2RH6A 1Y1VK 1I50K 3MK2A 4KM9A 1SFOK 2E2HK 2VUMA 1TWAK 2CW0A 5M5WK 3S1RC 1JVIA 4GTLA 3BDGB 4OIOA 2O5IA 1Y7AA 1WOOA 3AD8C 3M8ZA 3AQOA 4C3HC 1SHQA 4A3CK 4M1XA 1WQGA 1WCMA 1Y6VA 1BDFA 4BY1C 4KC6A 1TWFK 2B63K 4G0UA 3SZYA 1F9NA 1ED9A 4A93K 4A3JK 4QIWD 2R92A 1TWGA 1BGWA 4A3DC 5C4XK 2O5JA 5KXAA 3NKNA 3H0GK 1EW9A 1G51A 3S16C 1JOEA 1IS1A 3CQZC 4MEXA 3GTQA 4LRBA 1TWHK 1KH7A 2NVYK 4CYRA 5GRRA 3I4NC 3PO3K 3UNYA 4G7OA 3RZOK 1O24A 1PJ6A 2NVTC 1F7UA 3T00A 1KHLA 4X6AC 4YR1A 2WB1L 4QIWL 5IP7K 3GSIA 2GLQA 1INNA 1WCMK 4C3JK 4LR2A 4XSZA 2XCRB 3GTJC 1ALKA 2W5QA 3NKMA 1EK8A 4UOPA 5M5XK 3FOEA 2R92K 3M3YK 1O99A 1TWGK 4P5AA 1I6HK 2Y0SD 5C44K 3N3YA 4A3KC 1HDHA 3HXAA 3FKIA 4CXUA 5LQQA 2PHCB 3GTQK 1XZQA 3HOXC 3IGYB 3A8JA 1J6VA 1JQWA 4ILDA 3GTOC 3S1RK 2ZUEA 3OT9A 2P5MA 4KJGA 4Y52C 3BP3A 4LJZA 4C3HK 4G0WA 3WODA 4A3EC 5IORA 4WJ3M 1AJAA 4A3FC 1ANIA 5M3FK 4BY1K 3LPXA 1F7VA 2GAGC 1AJBA 2NVXA 4LR7A 1J6WA 4P9SA 2JA7C 4BBSC 4A3DK 5HL8A 3S16K 2YU9C 4AH6A 3CQZK 3L4JA 4BKWA 5K4PA 3I4NK 1WOSA 3GTOA 1O29A 4KN7A 1XXBA 2NVTK
chains in the Genus database with same CATH topology
4CYSA 1EJJA 1E33P 4LRDA 3E2DA 4TN0A 1K7HA 3TX0A 1KH4A 2RH6A 3TG0A 1AUKA 1ELZA 3BDFA 4LR8A 3MK2A 1URBA 4UPIA 5EGEA 4NWXA 2GSUA 1KHNA 2IFYA 3BDGB 1Y7AA 3NVLA 1ELXA 2W5VA 3M8ZA 1P49A 1SHQA 4B56A 1ZEBA 3CMRA 3UO0A 1ALIA 1Y6VA 3A52A 3ED4A 4LR9A 2ZKTA 2QZUA 4MHXA 3WAXA 4LRCA 4UOOA 3SZYA 3NKOA 1ED9A 1E3CP 4UPHA 3WAVA 5IJSA 2GSOA 3UN5A 1N2KA 4UPKA 1ED8A 4LRFA 5KXAA 3NKNA 1EW9A 3UN3A 3WBHA 4KAVA 2IUCB 4LRBA 4ZG6A 3IGZB 1KH7A 4MIVA 1HQAA 4CYRA 5DLTA 1EW2A 2W5RA 5GRRA 1ZEFA 3UNYA 3UN2A 1KH9A 5EGHA 2W5WA 5IJQA 2W5XA 1B8JA 5LRNA 2X98A 3WAWA 3T00A 1EW8A 1KHLA 3KD8A 1O98A 3NKPA 4YR1A 1ELYA 3DPCA 1ANJA 4GTYA 5L0EA 1E1ZP 5LRMA 2W5TA 3M7VA 1HJKA 1ZEDA 1ALHA 2GLQA 1N2LA 4LR2A 1ALKA 2W5QA 2G9YA 1KHKA 2D1GA 3M8WA 3NKMA 5INHA 1FSUA 4UOPA 5LIAA 1EQJA 4CXKA 1O99A 4KJDA 3Q3QA 4N7TA 2W8DA 3BDGA 5L0KA 3T01A 1HDHA 3TWZA 5LQQA 4CXUA 4GTZA 3IGYB 4QAXA 4UORA 5C66A 2XR9A 4LREA 4ZG9A 1SHNA 4FDIA 1URAA 3OT9A 4KJGA 2XRGA 4ZG7A 2W8SA 3SZZA 3WAYA 4LRAA 2GA3A 4GTWA 4FDJA 3NKRA 5AJ9A 1KHJA 1AJAA 1ANIA 4CXSA 1AJDA 4UPLA 3MK1A 2IUCA 2ANHA 1AJBA 2GSNA 3LXQA 2W5SA 4LR7A 1AJCA 4KAYA 5GOVA 5L0BA 4ZGAA 4GTXA 4NWJA 5DLVA 4LQYA 3BDHA 4MY4A 5K4PA 4KM4A 1EI6A 2VQRA 3DYCA 3M8YA 3NKQA 3MK0A 5HRTA 3B5QA 1ALJA 1E2SP 3IDDA 3T02A 5TJ3A 1KH5A 5DLWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CYS A;  1EJJ A;  1E33 P;  4LRD A;  3E2D A;  4TN0 A;  1K7H A;  3TX0 A;  1KH4 A;  2RH6 A;  3TG0 A;  1AUK A;  1ELZ A;  3BDF A;  4LR8 A;  3MK2 A;  1URB A;  4UPI A;  5EGE A;  4NWX A;  2GSU A;  1KHN A;  2IFY A;  3BDG B;  1Y7A A;  3NVL A;  1ELX A;  2W5V A;  3M8Z A;  1P49 A;  1SHQ A;  4B56 A;  1ZEB A;  3CMR A;  3UO0 A;  1ALI A;  1Y6V A;  3A52 A;  3ED4 A;  4LR9 A;  2ZKT A;  2QZU A;  4MHX A;  3WAX A;  4LRC A;  4UOO A;  3SZY A;  3NKO A;  1ED9 A;  1E3C P;  4UPH A;  3WAV A;  5IJS A;  2GSO A;  3UN5 A;  1N2K A;  4UPK A;  1ED8 A;  4LRF A;  5KXA A;  3NKN A;  1EW9 A;  3UN3 A;  3WBH A;  4KAV A;  2IUC B;  4LRB A;  4ZG6 A;  3IGZ B;  1KH7 A;  4MIV A;  1HQA A;  4CYR A;  5DLT A;  1EW2 A;  2W5R A;  5GRR A;  1ZEF A;  3UNY A;  3UN2 A;  1KH9 A;  5EGH A;  2W5W A;  5IJQ A;  2W5X A;  1B8J A;  5LRN A;  2X98 A;  3WAW A;  3T00 A;  1EW8 A;  1KHL A;  3KD8 A;  1O98 A;  3NKP A;  4YR1 A;  1ELY A;  3DPC A;  1ANJ A;  4GTY A;  5L0E A;  1E1Z P;  5LRM A;  2W5T A;  3M7V A;  1HJK A;  1ZED A;  1ALH A;  2GLQ A;  1N2L A;  4LR2 A;  1ALK A;  2W5Q A;  2G9Y A;  1KHK A;  2D1G A;  3M8W A;  3NKM A;  5INH A;  1FSU A;  4UOP A;  5LIA A;  1EQJ A;  4CXK A;  1O99 A;  4KJD A;  3Q3Q A;  4N7T A;  2W8D A;  3BDG A;  5L0K A;  3T01 A;  1HDH A;  3TWZ A;  5LQQ A;  4CXU A;  4GTZ A;  3IGY B;  4QAX A;  4UOR A;  5C66 A;  2XR9 A;  4LRE A;  4ZG9 A;  1SHN A;  4FDI A;  1URA A;  3OT9 A;  4KJG A;  2XRG A;  4ZG7 A;  2W8S A;  3SZZ A;  3WAY A;  4LRA A;  2GA3 A;  4GTW A;  4FDJ A;  3NKR A;  5AJ9 A;  1KHJ A;  1AJA A;  1ANI A;  4CXS A;  1AJD A;  4UPL A;  3MK1 A;  2IUC A;  2ANH A;  1AJB A;  2GSN A;  3LXQ A;  2W5S A;  4LR7 A;  1AJC A;  4KAY A;  5GOV A;  5L0B A;  4ZGA A;  4GTX A;  4NWJ A;  5DLV A;  4LQY A;  3BDH A;  4MY4 A;  5K4P A;  4KM4 A;  1EI6 A;  2VQR A;  3DYC A;  3M8Y A;  3NKQ A;  3MK0 A;  5HRT A;  3B5Q A;  1ALJ A;  1E2S P;  3IDD A;  3T02 A;  5TJ3 A;  1KH5 A;  5DLW A; 
#chains in the Genus database with same CATH topology
 3HOZ C;  2A69 A;  1EJJ A;  4X6A K;  4LRD A;  4BLB A;  3S0X A;  4Y7N C;  2VUM C;  1TWC C;  1USO A;  3GTJ K;  1KHN A;  2IFY A;  1WOR A;  2JA7 A;  2PMZ L;  1ELX A;  3NVL A;  1P49 A;  3DXJ A;  5IYD C;  2YU9 A;  1WIH A;  3BUE A;  3ED4 A;  1KQ4 A;  4A3K K;  4KB2 A;  4UOO A;  1IL2 A;  3GTK C;  3HOX K;  1V5V A;  1E3C P;  4UPH A;  4YFN A;  5IJS A;  2GSO A;  3GTO K;  1N2K A;  4UPK A;  4G0V A;  3FHZ A;  4Y52 K;  4QJV A;  3GIR A;  3UN3 A;  1XZP A;  3FOF A;  3GTG C;  3WBH A;  2IUC B;  4A3E K;  1SMY A;  3AQP A;  1C0A A;  4A3F K;  1TWC A;  4C45 A;  1ZEF A;  4AYB D;  5FLM C;  1KH9 A;  5IJQ A;  1YX2 A;  2WAQ D;  5FJ8 K;  3QX3 A;  3RZD C;  3NKP A;  3GEE A;  4LK1 A;  4BBS K;  2PPB A;  1HI9 A;  2GAH C;  1PJ7 A;  2W5T A;  3M7V A;  2YU9 K;  1ALH A;  3GTK A;  2V6T A;  1X31 C;  2JA5 C;  2D1G A;  2G9Y A;  3M8W A;  1FSU A;  1L0W A;  2R7Z C;  1IW7 A;  4CXK A;  5CJ9 A;  3Q3Q A;  4GTF A;  4N7T A;  3GTG A;  3HOZ K;  1J6X A;  4G7H A;  3FKI C;  2WAQ L;  4GTZ A;  4Y7N K;  3M4O C;  5IOS A;  2VUM K;  2XR9 A;  4ZG9 A;  1TWC K;  5IYB K;  1URA A;  4FDI A;  4KMA A;  4YFX A;  4BLA A;  2E2I A;  2A6E A;  5IYC C;  5AJ9 A;  1Y1W C;  3NKR A;  5IYD K;  2JA6 C;  2W7V A;  3A8I A;  3HOW C;  4UPL A;  2XCQ A;  1RU0 A;  4XLP A;  2JA5 A;  3GTK K;  3MK1 A;  2NVX C;  3H3V D;  2R7Z A;  3LXQ A;  2W5S A;  5C4J C;  3A8K A;  3S1Q C;  3S2H C;  4C3I C;  4ZGA A;  2FQO A;  5DLV A;  5TMC A;  3GTG K;  4GTB A;  4MY4 A;  2VQR A;  5FLM K;  3B5Q A;  3IDD A;  4KMH A;  5DLW A;  4C2M C;  1ZXO A;  1Y1W A;  1E33 P;  3K7A C;  3MML B;  3RZD K;  3E2D A;  1O25 A;  2JA6 A;  1AUK A;  2E2J C;  1O2F B;  4KMD A;  2Y0S L;  3S2D C;  2GSU A;  2JA5 K;  3OPF A;  3GTM C;  2W5V A;  2R7Z K;  4KAS A;  4B56 A;  1XZQ B;  4G7Z A;  4GTD A;  4KMU A;  5IP9 C;  3AH5 A;  3S17 C;  3CMR A;  1PJ5 A;  1ALI A;  3FKI K;  3A52 A;  3WAX A;  2KWA A;  1Y1V C;  4LRC A;  1USM A;  3WAV A;  3M4O K;  3CAG A;  1EQR A;  2D6F C;  3UN5 A;  3N0B A;  4O2D A;  3HOY C;  2JH3 A;  4BY7 C;  1BS2 A;  2ZUF A;  4KAV A;  5IYC K;  1Y1W K;  1HQM A;  1HQA A;  2JA6 K;  2JA8 C;  1GE9 A;  1O27 A;  4A3M C;  1K83 C;  3HOW K;  5EGH A;  4GZY A;  4BXX C;  2NVQ C;  3GTM A;  2W5X A;  5LRN A;  2X98 A;  2NVX K;  1IBA A;  1I6V A;  3KD8 A;  4OIR A;  1O98 A;  5C4J K;  1ELY A;  1DD5 A;  2PA8 D;  3L4K A;  1ANJ A;  4GTY A;  3G4C A;  1YNJ A;  2ZFZ A;  3S2H K;  3S1Q K;  1E1Z P;  4C3I K;  5LRM A;  1Y1V A;  3AD7 C;  1ZED A;  2CFA A;  4OIQ A;  4LK0 A;  1ZBS A;  4KAT A;  3PO2 C;  1KHK A;  3JST A;  5CHP A;  1UV7 A;  1ZVU A;  4KJD A;  4C2M K;  3HKZ D;  3BDG A;  4A3G C;  3K7A K;  4XLN A;  2V6U A;  3S14 C;  1K83 A;  2E2J K;  4QAX A;  4UOR A;  1VJE A;  4LRE A;  3S2D K;  1YCL A;  1WOP A;  1WSV A;  1EH1 A;  1WQF A;  4YG2 A;  2P8T A;  3TFH A;  2E2I C;  2JA7 K;  4OIP A;  1WQH A;  3GTL C;  3GTM K;  3GDZ A;  3SZZ A;  4DDQ A;  4FM9 A;  4LRA A;  4GTW A;  4FDJ A;  1IE0 A;  1KHJ A;  5IP9 K;  4JK1 A;  3S17 K;  5IOQ A;  3HKZ L;  4PAA A;  4XSX A;  4QJV B;  1XZP B;  1DCH A;  4GTA A;  3HOU C;  3HOY K;  4AYB L;  4BBR C;  5L0B A;  4BY7 K;  3GEI A;  3ERE D;  4KAR A;  5TMF A;  3BDH A;  4RMF A;  1EI6 A;  2JA8 K;  1ISE A;  5IOT A;  3NKQ A;  4MEY A;  4A3M K;  2WB1 D;  1K83 K;  3GTL A;  2R93 C;  1E2S P;  1ALJ A;  4BXX K;  2NVQ K;  1B4B A;  1KH5 A;  4CYS A;  3S1N C;  1BJT A;  4A3I C;  3IPJ A;  4TN0 A;  4P5B A;  1DCP A;  1K7H A;  3TX0 A;  1KH4 A;  3TG0 A;  1ELZ A;  4GTC A;  3BDF A;  4LR8 A;  4GT9 A;  3HOV C;  5M3M K;  1URB A;  4UPI A;  5EGE A;  4NWX A;  3PO2 K;  1O26 A;  4A3B C;  4A3L C;  2EBB A;  3EQL A;  1ZEB A;  4LOW A;  3UO0 A;  3I4M C;  2FQT A;  4A3G K;  4LR9 A;  2ZKT A;  2QZU A;  4MHX A;  4WJ4 A;  3BP8 C;  4KB4 A;  3LAP A;  1XXC A;  3S14 K;  3NKO A;  2A6H A;  2R93 A;  1O28 A;  3TTG A;  2BE5 A;  4XCH A;  1ED8 A;  4LRF A;  3GEH A;  3GTL K;  2E2I K;  5E68 A;  3GTP C;  2A68 A;  3H3V L;  1R9T C;  3S1M C;  3CQZ A;  3IGZ B;  4ZG6 A;  4MIV A;  5JFE A;  1I3Q C;  1EW2 A;  2W5R A;  5DLT A;  4KDD A;  3ORE A;  3UN2 A;  4J3N A;  2W5W A;  5M5Y K;  3S15 C;  1B8J A;  1F93 A;  1AB4 A;  3WAW A;  1EW8 A;  3HOU K;  1VLO A;  2Y3P A;  3DPC A;  1VGX A;  5C3E C;  4WIL A;  4BBR K;  5L0E A;  1I50 C;  1HJK A;  1SFO C;  2E2H C;  1N2L A;  4PAB A;  1TWA C;  3GTJ A;  5INH A;  5LIA A;  3TFJ A;  2V6S A;  4A3C C;  2R93 K;  1EQJ A;  3GTP A;  3S1N K;  2W8D A;  1R9T A;  5L0K A;  4A3I K;  3V4G A;  3T01 A;  1EFW A;  1TWF C;  2XCO A;  2B63 C;  3TWZ A;  1I3Q A;  3OEP A;  2PMZ D;  3ADA C;  4A93 C;  4Q4Z A;  4A3J C;  5C66 A;  3HOV K;  1B4A A;  1O2A A;  4KM8 A;  4LLG A;  3N0C A;  1SHN A;  2XRG A;  4ZG7 A;  4Q5S A;  5C4X C;  2W8S A;  3LAJ A;  1WSR A;  3H0G C;  4KAW X;  4A3B K;  1J98 A;  4A3L K;  2GA3 A;  3WAY A;  4YFK A;  4KN4 A;  5L46 A;  1TWH C;  4NOI A;  2NVY C;  1I50 A;  2RGR A;  1SFO A;  3PO3 C;  2E2H A;  3I4M K;  1TWA A;  1YNN A;  4CXS A;  1AJD A;  1XPP A;  3RZO C;  2IUC A;  3AD9 C;  2ANH A;  2GSN A;  3TFI A;  5IYB C;  1O2B A;  1AJC A;  4KAY A;  5GOV A;  4GFQ A;  3NUH A;  1XXA A;  3GTP K;  1TWF A;  2B63 A;  4GTX A;  4NWJ A;  3G4A A;  4LQY A;  5IP7 C;  1R9T K;  3S1M K;  1WCM C;  4C3J C;  2PA8 L;  1I3Q K;  1VRQ C;  4GTE A;  4KM4 A;  3DYC A;  4ZH4 A;  1VH2 A;  4FZB A;  3M8Y A;  3MK0 A;  5D4D A;  5HRT A;  1ZYR A;  4MQ9 A;  3T02 A;  4OIN A;  5TJ3 A;  3H0G A;  2R92 C;  3M3Y C;  3S15 K;  1TWG C;  1DCO A;  2CFA B;  1I6H C;  5JVO A;  5C44 C;  1IQ0 A;  1ZQ1 C;  1TWH A;  3VA7 A;  2NVY A;  5C3E K;  3GTQ C;  2RH6 A;  1Y1V K;  1I50 K;  3MK2 A;  4KM9 A;  1SFO K;  2E2H K;  2VUM A;  1TWA K;  2CW0 A;  5M5W K;  3S1R C;  1JVI A;  4GTL A;  3BDG B;  4OIO A;  2O5I A;  1Y7A A;  1WOO A;  3AD8 C;  3M8Z A;  3AQO A;  4C3H C;  1SHQ A;  4A3C K;  4M1X A;  1WQG A;  1WCM A;  1Y6V A;  1BDF A;  4BY1 C;  4KC6 A;  1TWF K;  2B63 K;  4G0U A;  3SZY A;  1F9N A;  1ED9 A;  4A93 K;  4A3J K;  4QIW D;  2R92 A;  1TWG A;  1BGW A;  4A3D C;  5C4X K;  2O5J A;  5KXA A;  3NKN A;  3H0G K;  1EW9 A;  1G51 A;  3S16 C;  1JOE A;  1IS1 A;  3CQZ C;  4MEX A;  3GTQ A;  4LRB A;  1TWH K;  1KH7 A;  2NVY K;  4CYR A;  5GRR A;  3I4N C;  3PO3 K;  3UNY A;  4G7O A;  3RZO K;  1O24 A;  1PJ6 A;  2NVT C;  1F7U A;  3T00 A;  1KHL A;  4X6A C;  4YR1 A;  2WB1 L;  4QIW L;  5IP7 K;  3GSI A;  2GLQ A;  1INN A;  1WCM K;  4C3J K;  4LR2 A;  4XSZ A;  2XCR B;  3GTJ C;  1ALK A;  2W5Q A;  3NKM A;  1EK8 A;  4UOP A;  5M5X K;  3FOE A;  2R92 K;  3M3Y K;  1O99 A;  1TWG K;  4P5A A;  1I6H K;  2Y0S D;  5C44 K;  3N3Y A;  4A3K C;  1HDH A;  3HXA A;  3FKI A;  4CXU A;  5LQQ A;  2PHC B;  3GTQ K;  1XZQ A;  3HOX C;  3IGY B;  3A8J A;  1J6V A;  1JQW A;  4ILD A;  3GTO C;  3S1R K;  2ZUE A;  3OT9 A;  2P5M A;  4KJG A;  4Y52 C;  3BP3 A;  4LJZ A;  4C3H K;  4G0W A;  3WOD A;  4A3E C;  5IOR A;  4WJ3 M;  1AJA A;  4A3F C;  1ANI A;  5M3F K;  4BY1 K;  3LPX A;  1F7V A;  2GAG C;  1AJB A;  2NVX A;  4LR7 A;  1J6W A;  4P9S A;  2JA7 C;  4BBS C;  4A3D K;  5HL8 A;  3S16 K;  2YU9 C;  4AH6 A;  3CQZ K;  3L4J A;  4BKW A;  5K4P A;  3I4N K;  1WOS A;  3GTO A;  1O29 A;  4KN7 A;  1XXB A;  2NVT K; 
#chains in the Genus database with same CATH homology
 4CYS A;  1EJJ A;  1E33 P;  4LRD A;  3E2D A;  4TN0 A;  1K7H A;  3TX0 A;  1KH4 A;  2RH6 A;  3TG0 A;  1AUK A;  1ELZ A;  3BDF A;  4LR8 A;  3MK2 A;  1URB A;  4UPI A;  5EGE A;  4NWX A;  2GSU A;  1KHN A;  2IFY A;  3BDG B;  1Y7A A;  3NVL A;  1ELX A;  2W5V A;  3M8Z A;  1P49 A;  1SHQ A;  4B56 A;  1ZEB A;  3CMR A;  3UO0 A;  1ALI A;  1Y6V A;  3A52 A;  3ED4 A;  4LR9 A;  2ZKT A;  2QZU A;  4MHX A;  3WAX A;  4LRC A;  4UOO A;  3SZY A;  3NKO A;  1ED9 A;  1E3C P;  4UPH A;  3WAV A;  5IJS A;  2GSO A;  3UN5 A;  1N2K A;  4UPK A;  1ED8 A;  4LRF A;  5KXA A;  3NKN A;  1EW9 A;  3UN3 A;  3WBH A;  4KAV A;  2IUC B;  4LRB A;  4ZG6 A;  3IGZ B;  1KH7 A;  4MIV A;  1HQA A;  4CYR A;  5DLT A;  1EW2 A;  2W5R A;  5GRR A;  1ZEF A;  3UNY A;  3UN2 A;  1KH9 A;  5EGH A;  2W5W A;  5IJQ A;  2W5X A;  1B8J A;  5LRN A;  2X98 A;  3WAW A;  3T00 A;  1EW8 A;  1KHL A;  3KD8 A;  1O98 A;  3NKP A;  4YR1 A;  1ELY A;  3DPC A;  1ANJ A;  4GTY A;  5L0E A;  1E1Z P;  5LRM A;  2W5T A;  3M7V A;  1HJK A;  1ZED A;  1ALH A;  2GLQ A;  1N2L A;  4LR2 A;  1ALK A;  2W5Q A;  2G9Y A;  1KHK A;  2D1G A;  3M8W A;  3NKM A;  5INH A;  1FSU A;  4UOP A;  5LIA A;  1EQJ A;  4CXK A;  1O99 A;  4KJD A;  3Q3Q A;  4N7T A;  2W8D A;  3BDG A;  5L0K A;  3T01 A;  1HDH A;  3TWZ A;  5LQQ A;  4CXU A;  4GTZ A;  3IGY B;  4QAX A;  4UOR A;  5C66 A;  2XR9 A;  4LRE A;  4ZG9 A;  1SHN A;  4FDI A;  1URA A;  3OT9 A;  4KJG A;  2XRG A;  4ZG7 A;  2W8S A;  3SZZ A;  3WAY A;  4LRA A;  2GA3 A;  4GTW A;  4FDJ A;  3NKR A;  5AJ9 A;  1KHJ A;  1AJA A;  1ANI A;  4CXS A;  1AJD A;  4UPL A;  3MK1 A;  2IUC A;  2ANH A;  1AJB A;  2GSN A;  3LXQ A;  2W5S A;  4LR7 A;  1AJC A;  4KAY A;  5GOV A;  5L0B A;  4ZGA A;  4GTX A;  4NWJ A;  5DLV A;  4LQY A;  3BDH A;  4MY4 A;  5K4P A;  4KM4 A;  1EI6 A;  2VQR A;  3DYC A;  3M8Y A;  3NKQ A;  3MK0 A;  5HRT A;  3B5Q A;  1ALJ A;  1E2S P;  3IDD A;  3T02 A;  5TJ3 A;  1KH5 A;  5DLW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...