3T02A

Crystal structure of phosphonoacetate hydrolase from sinorhizobium meliloti 1021 in complex with phosphonoacetate
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
Knots found
sequence length
413
structure length
413
Chain Sequence
b'MSKISVTVNGRRYPWPRVPAIAVCLDGCEPAYLDAAIDAGLMPALKRIKERGAVRLAHSVIPSFANPNNLSIATGSPPAVHGICGNYLYEPSTGEEVMMNDPKFLRAPTIFQAFYDAGARVAVVTAKDKLRALLGKGLRFDEGRAVCFSSEKSDKATRAEHGIDNASAWLGRPVPEVYSAALSEFVFAAGVKLLREFRPDIMYLTTTDYVQHKYAPGVPEANSFYEMFDRYLAELDGLGAAIVVTADHGMKPKHKADGSPDVIYVQDLLDEWLGKDAARVILPITDPYVVHHGALGSFATAYLPDGCDRSEIMARLKAIQGVDVVLGREEACRRFELPEDRIGDIVLVSSENKTLGTSEHRHDLAALDEPLRSHGGLTEQEVPFIVNRVLPELPNAPRLRNFDAFFYAVTAAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords phosphonoacetate hydrolase
publication title Structural and mechanistic insights into C-p bond hydrolysis by phosphonoacetate hydrolase.
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Hydrolase
total genus 126
structure length 413
sequence length 413
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.6.1.9: Nucleotide diphosphatase.
pdb deposition date 2011-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.110 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Domain 2, Phosphonoacetate Hydrolase 3t02A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3t02A01
4GTZA 1KHLA 4LRFA 4KAYA 3BDHA 4ZGAA 4GTWA 2W5TA 4MHXA 4B56A 1AJBA 5GRRA 2IUCA 3LXQA 4NWJA 5HRTA 2G9YA 4QAXA 5LQQA 1ALHA 1E2SP 1KHNA 1E3CP 4MY4A 4LR7A 1ALKA 5C66A 5L0EA 2W5SA 3T01A 1KHJA 4LREA 4YR1A 1ELYA 4GTYA 1P49A 1SHNA 1EW8A 3DPCA 1EI6A 1EW2A 3UN3A 5DLVA 1SHQA 3NKPA 5K4PA 2W5VA 4LR9A 1O99A 3MK0A 4CYSA 5LIAA 1ZEDA 2GSNA 4KM4A 1HJKA 3NKOA 3NKQA 3DYCA 4CXKA 1ZEFA 2GA3A 2W8DA 3MK1A 3NKNA 5DLWA 1ELZA 3T00A 1ELXA 4UPHA 5GOVA 3M8YA 4LR8A 1O98A 2QZUA 4TN0A 1AJDA 4LRBA 4ZG7A 3NKMA 2GSOA 1K7HA 2W5XA 4UOPA 2W5WA 1Y6VA 2D1GA 5LRNA 1ALJA 5TJ3A 4UPLA 1ANJA 4LRAA 4FDIA 1E1ZP 1KH5A 2XR9A 3A52A 3M8WA 3UN5A 2RH6A 1ED8A 1EQJA 4MIVA 3E2DA 4NWXA 5LRMA 2ZKTA 3CMRA 3MK2A 3UN2A 1ALIA 3BDGB 3WAYA 3WAWA 3Q3QA 1URBA 1B8JA 5EGHA 4CXSA 3NVLA 3B5QA 2GSUA 2ANHA 3SZZA 4LRCA 3WAVA 3TWZA 4LQYA 1KHKA 1HQAA 2GLQA 1AJAA 2XRGA 4GTXA 1AUKA 1HDHA 1EW9A 3T02A 4LRDA 4CXUA 5L0BA 1E33P 3M7VA 4LR2A 3WAXA 4UOOA 5IJQA 4ZG6A 3IGZB 4UPKA 3UO0A 3BDFA 2W5QA 1ED9A 1ZEBA 4CYRA 3ED4A 1AJCA 5EGEA 3IDDA 1URAA 1ANIA 4KJGA 1N2LA 2IFYA 3SZYA 3NKRA 3OT9A 4UPIA 5DLTA 3TX0A 5L0KA 3WBHA 5AJ9A 1FSUA 4ZG9A 3TG0A 3UNYA 2W8SA 4KJDA 2W5RA 5INHA 2X98A 4N7TA 5KXAA 1N2KA 3BDGA 3M8ZA 1EJJA 4UORA 3IGYB 5IJSA 2VQRA 1KH7A 2IUCB 1KH4A 3KD8A 4KAVA 1KH9A 1Y7AA 4FDJA
chains in the Genus database with same CATH superfamily
3CQZC 4A3JC 3HKZL 3HOVK 4B56A 1Y1VK 3LXQA 4KMHA 4A93C 4QIWD 4YFXA 1E2SP 3H0GK 2P5MA 5IYDC 4GTAA 4LR7A 1VLOA 3S2HC 4KB4A 4YR1A 4GTEA 3S15K 3BP8C 4AYBD 1EW8A 1EI6A 4A3LK 5DLVA 1ZYRA 5K4PA 4XCHA 4Y7NK 2A69A 4BY7K 2YU9C 2V6TA 4CYSA 1J6XA 3V4GA 3PO2K 4KM4A 1BDFA 3GTOA 4OIOA 1JQWA 1HJKA 4KB2A 3NKOA 3DYCA 1R9TK 4C3HK 2FQTA 1TWGK 5M3FK 1ELXA 1ELZA 5IYCC 4A3BK 4GTFA 3LAPA 3HOYC 2QZUA 4TN0A 4ZG7A 3I4MK 2W5WA 1Y6VA 5LRNA 1YNJA 2NVQK 1BS2A 1F7UA 2NVTK 4GTDA 3TFJA 1ANJA 3GTPC 4LOWA 1E1ZP 3JSTA 2R92A 2R92C 1WQGA 1WIHA 5IP7K 1ZBSA 1IQ0A 1O2FB 4WJ3M 1EQJA 2V6SA 4C2MC 3MK2A 3HOWC 2Y0SD 3WAWA 3GDZA 5IYBC 1O2BA 2GAHC 4XSXA 3S2DK 1WCMA 1WCMC 3SZZA 3H0GA 4LRCA 4C3JC 1KHKA 2JA6K 1VRQC 2WB1L 4WJ4A 1AUKA 3GTJK 1HDHA 2XCRB 4KARA 3I4NC 4LRDA 1E33P 4OIQA 1HI9A 4GTCA 4J3NA 1ZXOA 3ERED 1O26A 3AD7C 1L0WA 2D6FC 1GE9A 1SFOK 3GTLC 4YFNA 2JH3A 3ED4A 2V6UA 2XCOA 1PJ7A 1URAA 4BLAA 3SZYA 4XSZA 3BUEA 3NKRA 1ZVUA 2JA7C 1TWGA 1C0AA 4UPIA 3TX0A 5L0KA 2B63C 4BXXC 3G4AA 4QIWL 1B4AA 1I50K 1TWFA 2BE5A 4WILA 1TWFC 4MEXA 3S14C 4ZG9A 3S17C 4A3GC 4G0UA 4KJDA 2CFAB 1XXBA 2E2JC 4AYBL 3BDGA 2VUMC 1J6VA 3QX3A 3S1NK 2Y3PA 2A6HA 3A8KA 2JA5K 4KMAA 5M3MK 5FLMC 4GT9A 4RMFA 2PA8D 4KAVA 2O5JA 1WSRA 5IOQA 3N3YA 3HOXC 3BDHA 2FQOA 3S1RK 1AJBA 5GRRA 1J98A 3GTQC 5LQQA 1TWCK 4C45A 2JA6A 4G0VA 5TMFA 2E2HK 4G0WA 3GTJA 1DCOA 4A3IC 2W5SA 3EQLA 3S0XA 3FHZA 2WB1D 3S16C 1ELYA 1SMYA 4LREA 3N0BA 1IL2A 3FOEA 1P49A 3DPCA 3UN3A 1EW2A 5IP9K 5C3EK 1SFOA 1UV7A 5M5YK 4A3CC 3NKPA 1XZQB 3MK0A 3A8IA 1TWAC 4LJZA 1EH1A 3NKQA 5IYCK 2Y0SL 4FM9A 2RGRA 4A3KK 2W8DA 3MK1A 3NKNA 3OREA 4NOIA 4LK0A 2GAGC 5GOVA 2E2IA 3HOUC 2E2IC 3AD8C 1I50A 3RZDK 1HQMA 4LRBA 2A68A 3NKMA 2GSOA 2W5XA 1EK8A 4OIRA 3PO3C 1ALJA 5TJ3A 1O24A 4UPLA 3S1QK 4LRAA 4FDIA 4Q5SA 4KN4A 4LLGA 1I6HK 2JA5A 2JA8C 2XR9A 3UN5A 3HOZC 4X6AC 1O28A 4O2DA 2NVXK 1PJ6A 3CMRA 4DDQA 5IYBK 3WAYA 3GTOC 2P8TA 4BKWA 1XPPA 5C4JK 3WODA 3A8JA 3NVLA 4CXSA 3CAGA 4A3DC 1WQHA 1TWCA 5CHPA 3L4JA 2E2HA 1EW9A 3T02A 3GTKA 3FKIA 3FOFA 4BY1C 2CW0A 3FKIC 5C4XC 1WQFA 3IGZB 3GTLK 4YG2A 2PA8L 1TWHK 3TTGA 1F93A 1ZEBA 4CYRA 3RZOC 2R7ZA 4BBRK 3IDDA 1YCLA 2R7ZC 1K83A 4KJGA 1K83C 3M4OK 4Y52K 5HL8A 3OT9A 2W7VA 1Y1VA 3HOVC 3GTMK 1IW7A 5AJ9A 3TFHA 3GTGK 4BBSK 1J6WA 3H0GC 2W8SA 5KXAA 3M3YK 4N7TA 1F7VA 4UORA 3IGYB 2PMZL 3S15C 3H3VD 2VQRA 5IJSA 2IUCB 2R93K 4A3LC 3KD8A 1O29A 3HOXK 1VGXA 2NVXA 4Y7NC 1KHLA 4BY7C 4C3IC 1Y1WK 3PO2C 1I3QK 3AD9C 4A3EK 1R9TA 4XLNA 4MHXA 1R9TC 1DCHA 2IUCA 5FJ8K 4C3HC 5HRTA 1TWGC 2NVYK 3ADAC 3OEPA 1ALHA 4KN7A 5JFEA 4A3BC 1E3CP 4AH6A 4MY4A 4A3MK 3GEEA 1ALKA 5L0EA 3I4MC 3T01A 1KHJA 2NVQC 2NVTC 4GTYA 1PJ5A 3AQPA 2A6EA 4KMUA 4A3FK 1BJTA 5C44K 2W5VA 3K7AC 3CQZK 1O99A 5IP7C 4LR9A 1INNA 4A3JK 3OPFA 5L46A 1ZEDA 2GSNA 1ZQ1C 5D4DA 2CFAA 4CXKA 1ZEFA 2GA3A 1WSVA 3LPXA 3T00A 5TMCA 3LAJA 4A93K 4LK1A 5IYDK 1KQ4A 3M8YA 4LR8A 3S2DC 3VA7A 1Y7AA 3GTGA 1G51A 4UOPA 3S2HK 1BGWA 2JA6C 1IBAA 3GTJC 2PHCB 3AH5A 1KH5A 3IPJA 4XLPA 2R93A 2PMZD 3M8WA 2YU9K 1SFOC 4KATA 2ZKTA 3UN2A 3DXJA 3S1MC 1ALIA 5M5XK 1Y1WA 1I3QA 3Q3QA 1B8JA 2EBBA 3HOYK 2NVYA 4PAAA 2ANHA 4QJVB 1I50C 1IE0A 1XZQA 2GLQA 1AJAA 4FZBA 3GTPK 5L0BA 1O2AA 2R92K 3H3VL 3BDFA 3N0CA 3HXAA 3S1NC 2JA5C 4C2MK 1O25A 3CQZA 2KWAA 4KM9A 5EGEA 1AJCA 1DD5A 1USOA 4Q4ZA 3HOWK 1ANIA 4P5BA 2IFYA 4GFQA 5DLTA 5C44C 3S1RC 1WCMK 3WBHA 4C3JK 5E68A 1WOOA 1FSUA 1VH2A 4YFKA 4BLBA 4G7HA 3I4NK 1TWCC 5INHA 2X98A 2E2HC 3M8ZA 3GTKC 1YX2A 1EJJA 3MMLB 4KM8A 4GTLA 3TFIA 1B4BA 5IP9C 5C3EC 3GEIA 2YU9A 4GZYA 4C3IK 4KAWX 4KMDA 4FDJA 4P9SA 4GTZA 4LRFA 4KAYA 1AB4A 4ZGAA 2JA7K 4GTWA 2W5TA 2B63K 3NUHA 4BXXK 4A3KC 1XZPB 1TWFK 3S14K 3G4CA 4NWJA 3S17K 2G9YA 4QAXA 4JK1A 4A3GK 1Y1VC 1KHNA 3RZDC 5C66A 3GTPA 2E2JK 2VUMK 2WAQL 2O5IA 1YNNA 1SHNA 3S1QC 5FLMK 1V5VA 1IS1A 1XZPA 3K7AK 5M5WK 1I6HC 1SHQA 4KC6A 1X31C 4P5AA 5LIAA 2NVXC 3HKZD 3GTQK 5DLWA 3BP3A 4UPHA 5C4JC 1O98A 4MEYA 3L4KA 1AJDA 1K7HA 4A3IK 2PPBA 2D1GA 3S16K 1WOSA 4OIPA 1JVIA 2XCQA 2ZUEA 4A3CK 3GTLA 4ZH4A 2ZUFA 3A52A 1TWHA 1TWAK 2RH6A 4G7OA 1ED8A 1TWHC 4MIVA 3S1MK 3E2DA 4NWXA 5LRMA 1F9NA 4BBRC 3BDGB 3GEHA 2JA7A 2B63A 3HOUK 1URBA 5EGHA 2E2IK 4KASA 4Y52C 1EFWA 3M4OC 3B5QA 2GSUA 5JVOA 4PABA 3GTMA 3GTMC 3WAVA 3PO3K 3TWZA 4LQYA 1JOEA 1HQAA 3GTGC 4BBSC 2XRGA 4GTXA 5IORA 2VUMA 4CXUA 4G7ZA 3M7VA 4LR2A 3M3YC 1WOPA 3WAXA 1USMA 1WORA 2JA8K 5IJQA 2WAQD 4UOOA 4UPKA 4ZG6A 3UO0A 1EQRA 2W5QA 1ED9A 3HOZK 2R93C 3AQOA 2ZFZA 4X6AK 4ILDA 4MQ9A 1XXCA 4M1XA 3GTOK 1I6VA 1N2LA 1DCPA 3GTQA 1O27A 1Y1WC 1I3QC 4A3EC 4A3DK 1ISEA 1VJEA 4GTBA 4OINA 2NVYC 3TG0A 3UNYA 5CJ9A 4BY1K 3GTKK 3FKIK 5C4XK 4A3MC 2W5RA 5IOTA 1N2KA 1RU0A 4KDDA 1KH7A 3GIRA 1TWAA 4A3FC 3RZOK 1KH4A 1XXAA 1KH9A 2R7ZK 4QJVA 5IOSA 3GSIA 1K83K
chains in the Genus database with same CATH topology
4GTZA 1KHLA 4LRFA 4KAYA 3BDHA 4ZGAA 4GTWA 2W5TA 4MHXA 4B56A 1AJBA 5GRRA 2IUCA 3LXQA 4NWJA 5HRTA 2G9YA 4QAXA 5LQQA 1ALHA 1E2SP 1KHNA 1E3CP 4MY4A 4LR7A 1ALKA 5C66A 5L0EA 2W5SA 3T01A 1KHJA 4LREA 4YR1A 1ELYA 4GTYA 1P49A 1SHNA 1EW8A 3DPCA 1EI6A 1EW2A 3UN3A 5DLVA 1SHQA 3NKPA 5K4PA 2W5VA 4LR9A 1O99A 3MK0A 4CYSA 5LIAA 1ZEDA 2GSNA 4KM4A 1HJKA 3NKOA 3NKQA 3DYCA 4CXKA 1ZEFA 2GA3A 2W8DA 3MK1A 3NKNA 5DLWA 1ELZA 3T00A 1ELXA 4UPHA 5GOVA 3M8YA 4LR8A 1O98A 2QZUA 4TN0A 1AJDA 4LRBA 4ZG7A 3NKMA 2GSOA 1K7HA 2W5XA 4UOPA 2W5WA 1Y6VA 2D1GA 5LRNA 1ALJA 5TJ3A 4UPLA 1ANJA 4LRAA 4FDIA 1E1ZP 1KH5A 2XR9A 3A52A 3M8WA 3UN5A 2RH6A 1ED8A 1EQJA 4MIVA 3E2DA 4NWXA 5LRMA 2ZKTA 3CMRA 3MK2A 3UN2A 1ALIA 3BDGB 3WAYA 3WAWA 3Q3QA 1URBA 1B8JA 5EGHA 4CXSA 3NVLA 3B5QA 2GSUA 2ANHA 3SZZA 4LRCA 3WAVA 3TWZA 4LQYA 1KHKA 1HQAA 2GLQA 1AJAA 2XRGA 4GTXA 1AUKA 1HDHA 1EW9A 3T02A 4LRDA 4CXUA 5L0BA 1E33P 3M7VA 4LR2A 3WAXA 4UOOA 5IJQA 4ZG6A 3IGZB 4UPKA 3UO0A 3BDFA 2W5QA 1ED9A 1ZEBA 4CYRA 3ED4A 1AJCA 5EGEA 3IDDA 1URAA 1ANIA 4KJGA 1N2LA 2IFYA 3SZYA 3NKRA 3OT9A 4UPIA 5DLTA 3TX0A 5L0KA 3WBHA 5AJ9A 1FSUA 4ZG9A 3TG0A 3UNYA 2W8SA 4KJDA 2W5RA 5INHA 2X98A 4N7TA 5KXAA 1N2KA 3BDGA 3M8ZA 1EJJA 4UORA 3IGYB 5IJSA 2VQRA 1KH7A 2IUCB 1KH4A 3KD8A 4KAVA 1KH9A 1Y7AA 4FDJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GTZ A;  1KHL A;  4LRF A;  4KAY A;  3BDH A;  4ZGA A;  4GTW A;  2W5T A;  4MHX A;  4B56 A;  1AJB A;  5GRR A;  2IUC A;  3LXQ A;  4NWJ A;  5HRT A;  2G9Y A;  4QAX A;  5LQQ A;  1ALH A;  1E2S P;  1KHN A;  1E3C P;  4MY4 A;  4LR7 A;  1ALK A;  5C66 A;  5L0E A;  2W5S A;  3T01 A;  1KHJ A;  4LRE A;  4YR1 A;  1ELY A;  4GTY A;  1P49 A;  1SHN A;  1EW8 A;  3DPC A;  1EI6 A;  1EW2 A;  3UN3 A;  5DLV A;  1SHQ A;  3NKP A;  5K4P A;  2W5V A;  4LR9 A;  1O99 A;  3MK0 A;  4CYS A;  5LIA A;  1ZED A;  2GSN A;  4KM4 A;  1HJK A;  3NKO A;  3NKQ A;  3DYC A;  4CXK A;  1ZEF A;  2GA3 A;  2W8D A;  3MK1 A;  3NKN A;  5DLW A;  1ELZ A;  3T00 A;  1ELX A;  4UPH A;  5GOV A;  3M8Y A;  4LR8 A;  1O98 A;  2QZU A;  4TN0 A;  1AJD A;  4LRB A;  4ZG7 A;  3NKM A;  2GSO A;  1K7H A;  2W5X A;  4UOP A;  2W5W A;  1Y6V A;  2D1G A;  5LRN A;  1ALJ A;  5TJ3 A;  4UPL A;  1ANJ A;  4LRA A;  4FDI A;  1E1Z P;  1KH5 A;  2XR9 A;  3A52 A;  3M8W A;  3UN5 A;  2RH6 A;  1ED8 A;  1EQJ A;  4MIV A;  3E2D A;  4NWX A;  5LRM A;  2ZKT A;  3CMR A;  3MK2 A;  3UN2 A;  1ALI A;  3BDG B;  3WAY A;  3WAW A;  3Q3Q A;  1URB A;  1B8J A;  5EGH A;  4CXS A;  3NVL A;  3B5Q A;  2GSU A;  2ANH A;  3SZZ A;  4LRC A;  3WAV A;  3TWZ A;  4LQY A;  1KHK A;  1HQA A;  2GLQ A;  1AJA A;  2XRG A;  4GTX A;  1AUK A;  1HDH A;  1EW9 A;  3T02 A;  4LRD A;  4CXU A;  5L0B A;  1E33 P;  3M7V A;  4LR2 A;  3WAX A;  4UOO A;  5IJQ A;  4ZG6 A;  3IGZ B;  4UPK A;  3UO0 A;  3BDF A;  2W5Q A;  1ED9 A;  1ZEB A;  4CYR A;  3ED4 A;  1AJC A;  5EGE A;  3IDD A;  1URA A;  1ANI A;  4KJG A;  1N2L A;  2IFY A;  3SZY A;  3NKR A;  3OT9 A;  4UPI A;  5DLT A;  3TX0 A;  5L0K A;  3WBH A;  5AJ9 A;  1FSU A;  4ZG9 A;  3TG0 A;  3UNY A;  2W8S A;  4KJD A;  2W5R A;  5INH A;  2X98 A;  4N7T A;  5KXA A;  1N2K A;  3BDG A;  3M8Z A;  1EJJ A;  4UOR A;  3IGY B;  5IJS A;  2VQR A;  1KH7 A;  2IUC B;  1KH4 A;  3KD8 A;  4KAV A;  1KH9 A;  1Y7A A;  4FDJ A; 
#chains in the Genus database with same CATH topology
 3CQZ C;  4A3J C;  3HKZ L;  3HOV K;  4B56 A;  1Y1V K;  3LXQ A;  4KMH A;  4A93 C;  4QIW D;  4YFX A;  1E2S P;  3H0G K;  2P5M A;  5IYD C;  4GTA A;  4LR7 A;  1VLO A;  3S2H C;  4KB4 A;  4YR1 A;  4GTE A;  3S15 K;  3BP8 C;  4AYB D;  1EW8 A;  1EI6 A;  4A3L K;  5DLV A;  1ZYR A;  5K4P A;  4XCH A;  4Y7N K;  2A69 A;  4BY7 K;  2YU9 C;  2V6T A;  4CYS A;  1J6X A;  3V4G A;  3PO2 K;  4KM4 A;  1BDF A;  3GTO A;  4OIO A;  1JQW A;  1HJK A;  4KB2 A;  3NKO A;  3DYC A;  1R9T K;  4C3H K;  2FQT A;  1TWG K;  5M3F K;  1ELX A;  1ELZ A;  5IYC C;  4A3B K;  4GTF A;  3LAP A;  3HOY C;  2QZU A;  4TN0 A;  4ZG7 A;  3I4M K;  2W5W A;  1Y6V A;  5LRN A;  1YNJ A;  2NVQ K;  1BS2 A;  1F7U A;  2NVT K;  4GTD A;  3TFJ A;  1ANJ A;  3GTP C;  4LOW A;  1E1Z P;  3JST A;  2R92 A;  2R92 C;  1WQG A;  1WIH A;  5IP7 K;  1ZBS A;  1IQ0 A;  1O2F B;  4WJ3 M;  1EQJ A;  2V6S A;  4C2M C;  3MK2 A;  3HOW C;  2Y0S D;  3WAW A;  3GDZ A;  5IYB C;  1O2B A;  2GAH C;  4XSX A;  3S2D K;  1WCM A;  1WCM C;  3SZZ A;  3H0G A;  4LRC A;  4C3J C;  1KHK A;  2JA6 K;  1VRQ C;  2WB1 L;  4WJ4 A;  1AUK A;  3GTJ K;  1HDH A;  2XCR B;  4KAR A;  3I4N C;  4LRD A;  1E33 P;  4OIQ A;  1HI9 A;  4GTC A;  4J3N A;  1ZXO A;  3ERE D;  1O26 A;  3AD7 C;  1L0W A;  2D6F C;  1GE9 A;  1SFO K;  3GTL C;  4YFN A;  2JH3 A;  3ED4 A;  2V6U A;  2XCO A;  1PJ7 A;  1URA A;  4BLA A;  3SZY A;  4XSZ A;  3BUE A;  3NKR A;  1ZVU A;  2JA7 C;  1TWG A;  1C0A A;  4UPI A;  3TX0 A;  5L0K A;  2B63 C;  4BXX C;  3G4A A;  4QIW L;  1B4A A;  1I50 K;  1TWF A;  2BE5 A;  4WIL A;  1TWF C;  4MEX A;  3S14 C;  4ZG9 A;  3S17 C;  4A3G C;  4G0U A;  4KJD A;  2CFA B;  1XXB A;  2E2J C;  4AYB L;  3BDG A;  2VUM C;  1J6V A;  3QX3 A;  3S1N K;  2Y3P A;  2A6H A;  3A8K A;  2JA5 K;  4KMA A;  5M3M K;  5FLM C;  4GT9 A;  4RMF A;  2PA8 D;  4KAV A;  2O5J A;  1WSR A;  5IOQ A;  3N3Y A;  3HOX C;  3BDH A;  2FQO A;  3S1R K;  1AJB A;  5GRR A;  1J98 A;  3GTQ C;  5LQQ A;  1TWC K;  4C45 A;  2JA6 A;  4G0V A;  5TMF A;  2E2H K;  4G0W A;  3GTJ A;  1DCO A;  4A3I C;  2W5S A;  3EQL A;  3S0X A;  3FHZ A;  2WB1 D;  3S16 C;  1ELY A;  1SMY A;  4LRE A;  3N0B A;  1IL2 A;  3FOE A;  1P49 A;  3DPC A;  3UN3 A;  1EW2 A;  5IP9 K;  5C3E K;  1SFO A;  1UV7 A;  5M5Y K;  4A3C C;  3NKP A;  1XZQ B;  3MK0 A;  3A8I A;  1TWA C;  4LJZ A;  1EH1 A;  3NKQ A;  5IYC K;  2Y0S L;  4FM9 A;  2RGR A;  4A3K K;  2W8D A;  3MK1 A;  3NKN A;  3ORE A;  4NOI A;  4LK0 A;  2GAG C;  5GOV A;  2E2I A;  3HOU C;  2E2I C;  3AD8 C;  1I50 A;  3RZD K;  1HQM A;  4LRB A;  2A68 A;  3NKM A;  2GSO A;  2W5X A;  1EK8 A;  4OIR A;  3PO3 C;  1ALJ A;  5TJ3 A;  1O24 A;  4UPL A;  3S1Q K;  4LRA A;  4FDI A;  4Q5S A;  4KN4 A;  4LLG A;  1I6H K;  2JA5 A;  2JA8 C;  2XR9 A;  3UN5 A;  3HOZ C;  4X6A C;  1O28 A;  4O2D A;  2NVX K;  1PJ6 A;  3CMR A;  4DDQ A;  5IYB K;  3WAY A;  3GTO C;  2P8T A;  4BKW A;  1XPP A;  5C4J K;  3WOD A;  3A8J A;  3NVL A;  4CXS A;  3CAG A;  4A3D C;  1WQH A;  1TWC A;  5CHP A;  3L4J A;  2E2H A;  1EW9 A;  3T02 A;  3GTK A;  3FKI A;  3FOF A;  4BY1 C;  2CW0 A;  3FKI C;  5C4X C;  1WQF A;  3IGZ B;  3GTL K;  4YG2 A;  2PA8 L;  1TWH K;  3TTG A;  1F93 A;  1ZEB A;  4CYR A;  3RZO C;  2R7Z A;  4BBR K;  3IDD A;  1YCL A;  2R7Z C;  1K83 A;  4KJG A;  1K83 C;  3M4O K;  4Y52 K;  5HL8 A;  3OT9 A;  2W7V A;  1Y1V A;  3HOV C;  3GTM K;  1IW7 A;  5AJ9 A;  3TFH A;  3GTG K;  4BBS K;  1J6W A;  3H0G C;  2W8S A;  5KXA A;  3M3Y K;  4N7T A;  1F7V A;  4UOR A;  3IGY B;  2PMZ L;  3S15 C;  3H3V D;  2VQR A;  5IJS A;  2IUC B;  2R93 K;  4A3L C;  3KD8 A;  1O29 A;  3HOX K;  1VGX A;  2NVX A;  4Y7N C;  1KHL A;  4BY7 C;  4C3I C;  1Y1W K;  3PO2 C;  1I3Q K;  3AD9 C;  4A3E K;  1R9T A;  4XLN A;  4MHX A;  1R9T C;  1DCH A;  2IUC A;  5FJ8 K;  4C3H C;  5HRT A;  1TWG C;  2NVY K;  3ADA C;  3OEP A;  1ALH A;  4KN7 A;  5JFE A;  4A3B C;  1E3C P;  4AH6 A;  4MY4 A;  4A3M K;  3GEE A;  1ALK A;  5L0E A;  3I4M C;  3T01 A;  1KHJ A;  2NVQ C;  2NVT C;  4GTY A;  1PJ5 A;  3AQP A;  2A6E A;  4KMU A;  4A3F K;  1BJT A;  5C44 K;  2W5V A;  3K7A C;  3CQZ K;  1O99 A;  5IP7 C;  4LR9 A;  1INN A;  4A3J K;  3OPF A;  5L46 A;  1ZED A;  2GSN A;  1ZQ1 C;  5D4D A;  2CFA A;  4CXK A;  1ZEF A;  2GA3 A;  1WSV A;  3LPX A;  3T00 A;  5TMC A;  3LAJ A;  4A93 K;  4LK1 A;  5IYD K;  1KQ4 A;  3M8Y A;  4LR8 A;  3S2D C;  3VA7 A;  1Y7A A;  3GTG A;  1G51 A;  4UOP A;  3S2H K;  1BGW A;  2JA6 C;  1IBA A;  3GTJ C;  2PHC B;  3AH5 A;  1KH5 A;  3IPJ A;  4XLP A;  2R93 A;  2PMZ D;  3M8W A;  2YU9 K;  1SFO C;  4KAT A;  2ZKT A;  3UN2 A;  3DXJ A;  3S1M C;  1ALI A;  5M5X K;  1Y1W A;  1I3Q A;  3Q3Q A;  1B8J A;  2EBB A;  3HOY K;  2NVY A;  4PAA A;  2ANH A;  4QJV B;  1I50 C;  1IE0 A;  1XZQ A;  2GLQ A;  1AJA A;  4FZB A;  3GTP K;  5L0B A;  1O2A A;  2R92 K;  3H3V L;  3BDF A;  3N0C A;  3HXA A;  3S1N C;  2JA5 C;  4C2M K;  1O25 A;  3CQZ A;  2KWA A;  4KM9 A;  5EGE A;  1AJC A;  1DD5 A;  1USO A;  4Q4Z A;  3HOW K;  1ANI A;  4P5B A;  2IFY A;  4GFQ A;  5DLT A;  5C44 C;  3S1R C;  1WCM K;  3WBH A;  4C3J K;  5E68 A;  1WOO A;  1FSU A;  1VH2 A;  4YFK A;  4BLB A;  4G7H A;  3I4N K;  1TWC C;  5INH A;  2X98 A;  2E2H C;  3M8Z A;  3GTK C;  1YX2 A;  1EJJ A;  3MML B;  4KM8 A;  4GTL A;  3TFI A;  1B4B A;  5IP9 C;  5C3E C;  3GEI A;  2YU9 A;  4GZY A;  4C3I K;  4KAW X;  4KMD A;  4FDJ A;  4P9S A;  4GTZ A;  4LRF A;  4KAY A;  1AB4 A;  4ZGA A;  2JA7 K;  4GTW A;  2W5T A;  2B63 K;  3NUH A;  4BXX K;  4A3K C;  1XZP B;  1TWF K;  3S14 K;  3G4C A;  4NWJ A;  3S17 K;  2G9Y A;  4QAX A;  4JK1 A;  4A3G K;  1Y1V C;  1KHN A;  3RZD C;  5C66 A;  3GTP A;  2E2J K;  2VUM K;  2WAQ L;  2O5I A;  1YNN A;  1SHN A;  3S1Q C;  5FLM K;  1V5V A;  1IS1 A;  1XZP A;  3K7A K;  5M5W K;  1I6H C;  1SHQ A;  4KC6 A;  1X31 C;  4P5A A;  5LIA A;  2NVX C;  3HKZ D;  3GTQ K;  5DLW A;  3BP3 A;  4UPH A;  5C4J C;  1O98 A;  4MEY A;  3L4K A;  1AJD A;  1K7H A;  4A3I K;  2PPB A;  2D1G A;  3S16 K;  1WOS A;  4OIP A;  1JVI A;  2XCQ A;  2ZUE A;  4A3C K;  3GTL A;  4ZH4 A;  2ZUF A;  3A52 A;  1TWH A;  1TWA K;  2RH6 A;  4G7O A;  1ED8 A;  1TWH C;  4MIV A;  3S1M K;  3E2D A;  4NWX A;  5LRM A;  1F9N A;  4BBR C;  3BDG B;  3GEH A;  2JA7 A;  2B63 A;  3HOU K;  1URB A;  5EGH A;  2E2I K;  4KAS A;  4Y52 C;  1EFW A;  3M4O C;  3B5Q A;  2GSU A;  5JVO A;  4PAB A;  3GTM A;  3GTM C;  3WAV A;  3PO3 K;  3TWZ A;  4LQY A;  1JOE A;  1HQA A;  3GTG C;  4BBS C;  2XRG A;  4GTX A;  5IOR A;  2VUM A;  4CXU A;  4G7Z A;  3M7V A;  4LR2 A;  3M3Y C;  1WOP A;  3WAX A;  1USM A;  1WOR A;  2JA8 K;  5IJQ A;  2WAQ D;  4UOO A;  4UPK A;  4ZG6 A;  3UO0 A;  1EQR A;  2W5Q A;  1ED9 A;  3HOZ K;  2R93 C;  3AQO A;  2ZFZ A;  4X6A K;  4ILD A;  4MQ9 A;  1XXC A;  4M1X A;  3GTO K;  1I6V A;  1N2L A;  1DCP A;  3GTQ A;  1O27 A;  1Y1W C;  1I3Q C;  4A3E C;  4A3D K;  1ISE A;  1VJE A;  4GTB A;  4OIN A;  2NVY C;  3TG0 A;  3UNY A;  5CJ9 A;  4BY1 K;  3GTK K;  3FKI K;  5C4X K;  4A3M C;  2W5R A;  5IOT A;  1N2K A;  1RU0 A;  4KDD A;  1KH7 A;  3GIR A;  1TWA A;  4A3F C;  3RZO K;  1KH4 A;  1XXA A;  1KH9 A;  2R7Z K;  4QJV A;  5IOS A;  3GSI A;  1K83 K; 
#chains in the Genus database with same CATH homology
 4GTZ A;  1KHL A;  4LRF A;  4KAY A;  3BDH A;  4ZGA A;  4GTW A;  2W5T A;  4MHX A;  4B56 A;  1AJB A;  5GRR A;  2IUC A;  3LXQ A;  4NWJ A;  5HRT A;  2G9Y A;  4QAX A;  5LQQ A;  1ALH A;  1E2S P;  1KHN A;  1E3C P;  4MY4 A;  4LR7 A;  1ALK A;  5C66 A;  5L0E A;  2W5S A;  3T01 A;  1KHJ A;  4LRE A;  4YR1 A;  1ELY A;  4GTY A;  1P49 A;  1SHN A;  1EW8 A;  3DPC A;  1EI6 A;  1EW2 A;  3UN3 A;  5DLV A;  1SHQ A;  3NKP A;  5K4P A;  2W5V A;  4LR9 A;  1O99 A;  3MK0 A;  4CYS A;  5LIA A;  1ZED A;  2GSN A;  4KM4 A;  1HJK A;  3NKO A;  3NKQ A;  3DYC A;  4CXK A;  1ZEF A;  2GA3 A;  2W8D A;  3MK1 A;  3NKN A;  5DLW A;  1ELZ A;  3T00 A;  1ELX A;  4UPH A;  5GOV A;  3M8Y A;  4LR8 A;  1O98 A;  2QZU A;  4TN0 A;  1AJD A;  4LRB A;  4ZG7 A;  3NKM A;  2GSO A;  1K7H A;  2W5X A;  4UOP A;  2W5W A;  1Y6V A;  2D1G A;  5LRN A;  1ALJ A;  5TJ3 A;  4UPL A;  1ANJ A;  4LRA A;  4FDI A;  1E1Z P;  1KH5 A;  2XR9 A;  3A52 A;  3M8W A;  3UN5 A;  2RH6 A;  1ED8 A;  1EQJ A;  4MIV A;  3E2D A;  4NWX A;  5LRM A;  2ZKT A;  3CMR A;  3MK2 A;  3UN2 A;  1ALI A;  3BDG B;  3WAY A;  3WAW A;  3Q3Q A;  1URB A;  1B8J A;  5EGH A;  4CXS A;  3NVL A;  3B5Q A;  2GSU A;  2ANH A;  3SZZ A;  4LRC A;  3WAV A;  3TWZ A;  4LQY A;  1KHK A;  1HQA A;  2GLQ A;  1AJA A;  2XRG A;  4GTX A;  1AUK A;  1HDH A;  1EW9 A;  3T02 A;  4LRD A;  4CXU A;  5L0B A;  1E33 P;  3M7V A;  4LR2 A;  3WAX A;  4UOO A;  5IJQ A;  4ZG6 A;  3IGZ B;  4UPK A;  3UO0 A;  3BDF A;  2W5Q A;  1ED9 A;  1ZEB A;  4CYR A;  3ED4 A;  1AJC A;  5EGE A;  3IDD A;  1URA A;  1ANI A;  4KJG A;  1N2L A;  2IFY A;  3SZY A;  3NKR A;  3OT9 A;  4UPI A;  5DLT A;  3TX0 A;  5L0K A;  3WBH A;  5AJ9 A;  1FSU A;  4ZG9 A;  3TG0 A;  3UNY A;  2W8S A;  4KJD A;  2W5R A;  5INH A;  2X98 A;  4N7T A;  5KXA A;  1N2K A;  3BDG A;  3M8Z A;  1EJJ A;  4UOR A;  3IGY B;  5IJS A;  2VQR A;  1KH7 A;  2IUC B;  1KH4 A;  3KD8 A;  4KAV A;  1KH9 A;  1Y7A A;  4FDJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...