3T02A

Crystal structure of phosphonoacetate hydrolase from sinorhizobium meliloti 1021 in complex with phosphonoacetate
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
Knots found
sequence length
413
structure length
413
Chain Sequence
MSKISVTVNGRRYPWPRVPAIAVCLDGCEPAYLDAAIDAGLMPALKRIKERGAVRLAHSVIPSFANPNNLSIATGSPPAVHGICGNYLYEPSTGEEVMMNDPKFLRAPTIFQAFYDAGARVAVVTAKDKLRALLGKGLRFDEGRAVCFSSEKSDKATRAEHGIDNASAWLGRPVPEVYSAALSEFVFAAGVKLLREFRPDIMYLTTTDYVQHKYAPGVPEANSFYEMFDRYLAELDGLGAAIVVTADHGMKPKHKADGSPDVIYVQDLLDEWLGKDAARVILPITDPYVVHHGALGSFATAYLPDGCDRSEIMARLKAIQGVDVVLGREEACRRFELPEDRIGDIVLVSSENKTLGTSEHRHDLAALDEPLRSHGGLTEQEVPFIVNRVLPELPNAPRLRNFDAFFYAVTAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and mechanistic insights into C-p bond hydrolysis by phosphonoacetate hydrolase.
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Hydrolase
molecule keywords phosphonoacetate hydrolase
total genus 126
structure length 413
sequence length 413
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.6.1.9: Nucleotide diphosphatase.
pdb deposition date 2011-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.110 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Domain 2, Phosphonoacetate Hydrolase 3t02A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3t02A01
3Q3QA 4GTXA 2ZKTA 3BDFA 3IDDA 1ALIA 2W8SA 2G9YA 5DLVA 3MK2A 1E3CP 4KAVA 2GSOA 1E33P 1ANIA 1KHLA 1O98A 4GTWA 1ELYA 2W5RA 3B5QA 2W5WA 3WAXA 1KH9A 5AJ9A 4NWXA 3ED4A 4UPIA 4CXKA 3UO0A 5L0KA 5C66A 1SHNA 4KJGA 4LRDA 3M8YA 3UNYA 1ALKA 1HJKA 5L0BA 5LQQA 1EW8A 4KM4A 1KHJA 5DLWA 3M8ZA 4UOOA 1KHKA 1AJBA 2IUCA 2W5SA 4NWJA 3E2DA 4FDIA 1N2KA 3DYCA 1AJDA 5EGHA 3IGZB 4QAXA 4UPKA 3IGYB 3A52A 1FSUA 5GRRA 5KXAA 3NKMA 1B8JA 3SZZA 3MK0A 1ED8A 4FDJA 3OT9A 1KH4A 3LXQA 1Y6VA 3T00A 1HDHA 5L0EA 4GTYA 1KHNA 2GLQA 4N7TA 4LRBA 3T02A 1EW2A 3KD8A 1KH7A 3TWZA 4ZG7A 4ZG9A 3NKQA 4UPHA 1ED9A 4LR8A 1AUKA 2W5VA 4B56A 2GA3A 3BDHA 4YR1A 1Y7AA 1EI6A 1E1ZP 2RH6A 1E2SP 2W5TA 4LR2A 2ANHA 4ZGAA 3UN3A 1ANJA 1ALHA 4KAYA 5LRNA 5EGEA 3DPCA 3NKNA 1ZEFA 3MK1A 2W5XA 3TX0A 4CXUA 4LRAA 2IFYA 1AJAA 3NKOA 3TG0A 4LQYA 4MHXA 3WBHA 4TN0A 5LRMA 3WAVA 4UPLA 1AJCA 1EW9A 5DLTA 4CXSA 4MIVA 3WAWA 4CYSA 4MY4A 1EJJA 3M7VA 2VQRA 1URAA 1ALJA 1N2LA 5LIAA 1SHQA 4KJDA 1ELZA 1HQAA 3NKRA 4GTZA 5INHA 4ZG6A 4UOPA 3BDGB 3CMRA 4LR9A 4LR7A 1EQJA 2IUCB 3NVLA 2W8DA 4CYRA 1ZEDA 5IJQA 4LREA 4LRFA 5GOVA 3T01A 2D1GA 1URBA 2GSUA 3UN5A 3NKPA 2X98A 4UORA 5HRTA 2XR9A 1P49A 5IJSA 3BDGA 3SZYA 1O99A 5TJ3A 3M8WA 5K4PA 2W5QA 3WAYA 2GSNA 2XRGA 4LRCA 1ELXA 1ZEBA 1KH5A 2QZUA 3UN2A 1K7HA
chains in the Genus database with same CATH superfamily
1ZQ1C 2NVTK 4P5AA 4BY1K 3S1MK 3GTKK 2O5JA 4QIWD 1I6HK 2NVYA 3MK2A 3K7AC 3L4KA 1ANIA 5JFEA 4OINA 5HL8A 4AYBD 3B5QA 2W5WA 2E2HC 4AH6A 3GTMC 4NWXA 3ED4A 4UPIA 4MEYA 5L46A 3S1RK 2BE5A 1SHNA 3CQZC 4A3IK 2JA5K 4A3GC 2B63A 4O2DA 1ALKA 3A8JA 1EFWA 2PPBA 4KB4A 4YFKA 4GTLA 4KM9A 3I4NK 1KHJA 2R92A 4GTEA 4QJVB 3AD9C 4X6AK 2A6HA 4YFXA 1N2KA 4JK1A 3M4OC 3HKZD 3DYCA 5IOQA 1XZQB 1VRQC 4QAXA 4KB2A 4UPKA 4BXXC 3DXJA 3IGYB 1FSUA 1I3QC 3TTGA 3MMLB 4PABA 3OT9A 4A3DK 3N3YA 3T00A 5FLMC 1HDHA 2GLQA 4KN7A 1Y1VC 2V6SA 3GDZA 3OEPA 3T02A 3GIRA 1F93A 5C4XC 1EW2A 3KD8A 1KH7A 3TWZA 4ZG9A 3FHZA 5IYCK 2PA8L 2ZUFA 1AUKA 4B56A 2JA5A 5LQQA 1TWFA 2RH6A 1E1ZP 2ANHA 4ZGAA 4C2MK 4A3LK 3HOYK 3NKNA 1ZEFA 3CAGA 3S16C 2W5XA 1AJAA 1I50C 1WCMC 4TN0A 4XLNA 1TWFC 4UPLA 5C4JK 4YG2A 1K83K 2CFAA 4A3JC 1F7VA 3WAWA 3AD7C 4A3KC 3TFHA 4MY4A 4BY1C 3FOFA 4XSXA 1EJJA 5M5XK 3HOWC 2FQOA 2VUMC 4GTDA 4ZG6A 3FKIK 4KMDA 2IUCB 3NUHA 3GTQA 3NVLA 1XZPA 1SFOK 1ZEDA 4XLPA 4LREA 4LRFA 1WSVA 1JVIA 5CJ9A 3T01A 4XCHA 2GSUA 3GTMA 2NVQC 3GEIA 3NKPA 1WOOA 3GTOA 3OREA 4QJVA 5IJSA 4C3HK 3BDGA 3SZYA 2W5QA 2GSNA 3RZDK 3PO2C 1TWGC 4ILDA 1ZEBA 5M3MK 2JA6A 2NVXC 4GTXA 2Y0SL 3AD8C 3GTPC 3IDDA 1DCPA 2W8SA 4C3IC 1KQ4A 3HOWK 4M1XA 3RZOK 4KAVA 1E33P 3GTKA 1KHLA 1O98A 1O2AA 3HOVK 1I3QK 5IP9C 1KH9A 5AJ9A 4KAWX 2Y0SD 1J6WA 2JA6C 4A3DC 3UO0A 5L0KA 2XCRB 5C3EC 3GTLK 5IYDK 1WOSA 4OIRA 4OIQA 4LJZA 3M8YA 1EH1A 1TWHK 2ZUEA 3I4NC 3H0GK 4Q4ZA 3I4MK 4GTCA 5M5YK 2B63C 2GAGC 3A8KA 1IL2A 5DLWA 3M8ZA 2NVTC 1AJBA 1EQRA 4NWJA 4C3IK 3GTOK 1J6XA 5EGHA 1DD5A 3HOYC 3IGZB 2ZFZA 4LK0A 3A52A 4P9SA 3NKMA 3BP8C 1PJ7A 1WIHA 4PAAA 3SZZA 5TMCA 1PJ6A 1TWCA 2W7VA 4C3JK 1Y1VK 3BP3A 1F9NA 5IOTA 4NOIA 1KHNA 1ZYRA 4BBSK 1JOEA 4N7TA 5IYBC 4KN4A 3S2HC 4BY7K 1ZBSA 2V6TA 4ZH4A 4QIWL 3NKQA 4UPHA 4GTFA 1ED9A 5IORA 3PO3K 1Y1WA 1XZQA 1UV7A 1E2SP 1O25A 2R93K 4GTAA 5C44K 4RMFA 1SFOC 4KAYA 2PA8D 5EGEA 3JSTA 3TX0A 3M3YK 4G0UA 3NKOA 1B4AA 1WSRA 1TWFK 4AYBL 3S2DK 3L4JA 5LRMA 3GSIA 2R7ZA 1ZXOA 3TFJA 4BBRC 5DLTA 1EW9A 1WCMA 3I4MC 4CYSA 1SFOA 2E2JC 3M7VA 2VQRA 1YNJA 1SHQA 4LLGA 1HQAA 4A3BC 3HOUC 4UOPA 3S0XA 2JA8C 3CMRA 3OPFA 3N0BA 3HOVC 1DCHA 3GTMK 4Y52C 4CYRA 2NVQK 1ZVUA 1IE0A 4KM8A 3S1NK 3H0GA 5M3FK 1URBA 4A3GK 1R9TA 2A68A 1BJTA 2P8TA 2JA7A 2XR9A 3HOXK 3GTJC 2WB1L 3WAYA 3GEEA 1J98A 1V5VA 1EQJA 1K7HA 3Q3QA 1I6HC 2ZKTA 4G0WA 2XCOA 3S17C 1O28A 5DLVA 1E3CP 4BKWA 2JA7C 5C44C 3S15C 2O5IA 3GTPA 4GTWA 2WAQL 4GZYA 2W5RA 2JA6K 1I6VA 1O26A 5M5WK 4CXKA 2FQTA 3LAJA 4G7HA 3GEHA 4FM9A 3H3VL 4KJGA 4BBRK 4LRDA 1VLOA 4A3CC 4J3NA 4A3JK 4A3IC 2JA5C 3GTGC 3EQLA 4WILA 1HJKA 5L0BA 2A69A 3G4AA 2YU9K 1EW8A 3GTQK 4KM4A 3ERED 4UOOA 3S1QK 4Y7NK 1F7UA 1PJ5A 2NVXK 4A3BK 1KHKA 3N0CA 1WQGA 2JA7K 4DDQA 1SMYA 1AJDA 1WOPA 1DCOA 5KXAA 4OIPA 1K83A 1B8JA 4FDJA 1ED8A 3S14K 4BXXK 2V6UA 4A3MK 1KH4A 3GTJK 1Y6VA 3WODA 3TFIA 2E2IK 3HXAA 4GTYA 2R7ZC 5FJ8K 1TWGK 1HI9A 3H3VD 2R92K 5JVOA 1USMA 4G0VA 4LOWA 4Q5SA 1C0AA 3GTQC 3GTPK 3A8IA 2B63K 4YR1A 3HOUK 1YNNA 2GAHC 3V4GA 5C4XK 4KMHA 2NVYK 1Y7AA 1EI6A 4A3FK 2GA3A 3GTOC 1ANJA 1ALHA 1Y1WC 5LRNA 2CFAB 4KC6A 3DPCA 3MK1A 2JH3A 4LRAA 1TWGA 1RU0A 2IFYA 3HOZK 1XXCA 5CHPA 3HOXC 3S14C 4LK1A 3GTJA 1I50K 4A3KK 2E2JK 1AJCA 2YU9C 3S1MC 4BLBA 4KASA 3GTKC 1INNA 2PMZD 1URAA 1ALJA 1N2LA 3RZOC 1Y1VA 3NKRA 4GTZA 1TWCK 4KMUA 5IYCC 3BDGB 1R9TK 3PO3C 3ADAC 4LR7A 4LR9A 2XCQA 3HKZL 3FKIC 1WQFA 4GTBA 2YU9A 2D6FC 5IYDC 5C3EK 4C3HC 2X98A 4A3EK 5HRTA 3S16K 1P49A 4KMAA 1O24A 1XXBA 3H0GC 1WQHA 5FLMK 4BBSC 1IQ0A 3GTGK 1IW7A 2WAQD 2XRGA 1ELXA 1KH5A 2QZUA 4GT9A 3UNYA 4X6AC 3RZDC 3PO2K 1TWAK 4FZBA 2PMZL 1L0WA 3BDFA 1BS2A 4GFQA 1ALIA 1XXAA 3M4OK 2G9YA 3GTLA 3LAPA 1BDFA 2GSOA 2E2HA 1TWCC 3AQPA 2VUMK 2EBBA 1ELYA 3WAXA 2CW0A 1VJEA 4WJ3M 1O2BA 4C3JC 2VUMA 2R93A 2RGRA 2E2HK 4A3CK 1HQMA 5C66A 5E68A 5TMFA 3G4CA 3GTLC 2R92C 3VA7A 4KARA 1TWHC 4XSZA 3GTGA 1XPPA 2IUCA 2NVYC 3FOEA 2R93C 2W5SA 3AQOA 3E2DA 4FDIA 2PHCB 3S17K 4KDDA 1O27A 4Y52K 3IPJA 3M3YC 2Y3PA 4A3MC 5GRRA 1J6VA 1WCMK 4G7ZA 3S2DC 1TWHA 3MK0A 4MEXA 2R7ZK 3CQZA 3LXQA 1K83C 5L0EA 4BY7C 4P5BA 4G7OA 4LRBA 2P5MA 1USOA 5IYBK 1ISEA 4ZG7A 4A3FC 1IS1A 2JA8K 1IBAA 2W5VA 4LR8A 1JQWA 3BDHA 1Y1WK 2A6EA 4LR2A 4Y7NC 1R9TC 3BUEA 3S15K 2W5TA 3UN3A 3S1NC 4OIOA 4BLAA 1TWAA 4A93C 4C45A 5IP7K 1I3QA 5IP9K 4CXUA 1O29A 4YFNA 1XZPB 4A3EC 3TG0A 4LQYA 4MHXA 3S1RC 3WBHA 3CQZK 1O2FB 5IOSA 2KWAA 3AH5A 4MQ9A 3WAVA 4CXSA 1EK8A 4MIVA 1TWAC 1VGXA 1G51A 5C4JC 1WORA 4KATA 3S2HK 4WJ4A 5LIAA 4KJDA 2E2IA 1ELZA 1X31C 1YX2A 1B4BA 3K7AK 5INHA 1VH2A 2WB1D 1BGWA 1GE9A 2W8DA 4C2MC 4A3LC 5IJQA 4A93K 5IP7C 5GOVA 5D4DA 1AB4A 3LPXA 2D1GA 3UN5A 1I50A 3FKIA 4UORA 2E2IC 3HOZC 2NVXA 1O99A 5TJ3A 3M8WA 5K4PA 4LRCA 3QX3A 3UN2A 1YCLA 3S1QC
chains in the Genus database with same CATH topology
3Q3QA 4GTXA 2ZKTA 3BDFA 3IDDA 1ALIA 2W8SA 2G9YA 5DLVA 3MK2A 1E3CP 4KAVA 2GSOA 1E33P 1ANIA 1KHLA 1O98A 4GTWA 1ELYA 2W5RA 3B5QA 2W5WA 3WAXA 1KH9A 5AJ9A 4NWXA 3ED4A 4UPIA 4CXKA 3UO0A 5L0KA 5C66A 1SHNA 4KJGA 4LRDA 3M8YA 3UNYA 1ALKA 1HJKA 5L0BA 5LQQA 1EW8A 4KM4A 1KHJA 5DLWA 3M8ZA 4UOOA 1KHKA 1AJBA 2IUCA 2W5SA 4NWJA 3E2DA 4FDIA 1N2KA 3DYCA 1AJDA 5EGHA 3IGZB 4QAXA 4UPKA 3IGYB 3A52A 1FSUA 5GRRA 5KXAA 3NKMA 1B8JA 3SZZA 3MK0A 1ED8A 4FDJA 3OT9A 1KH4A 3LXQA 1Y6VA 3T00A 1HDHA 5L0EA 4GTYA 1KHNA 2GLQA 4N7TA 4LRBA 3T02A 1EW2A 3KD8A 1KH7A 3TWZA 4ZG7A 4ZG9A 3NKQA 4UPHA 1ED9A 4LR8A 1AUKA 2W5VA 4B56A 2GA3A 3BDHA 4YR1A 1Y7AA 1EI6A 1E1ZP 2RH6A 1E2SP 2W5TA 4LR2A 2ANHA 4ZGAA 3UN3A 1ANJA 1ALHA 4KAYA 5LRNA 5EGEA 3DPCA 3NKNA 1ZEFA 3MK1A 2W5XA 3TX0A 4CXUA 4LRAA 2IFYA 1AJAA 3NKOA 3TG0A 4LQYA 4MHXA 3WBHA 4TN0A 5LRMA 3WAVA 4UPLA 1AJCA 1EW9A 5DLTA 4CXSA 4MIVA 3WAWA 4CYSA 4MY4A 1EJJA 3M7VA 2VQRA 1URAA 1ALJA 1N2LA 5LIAA 1SHQA 4KJDA 1ELZA 1HQAA 3NKRA 4GTZA 5INHA 4ZG6A 4UOPA 3BDGB 3CMRA 4LR9A 4LR7A 1EQJA 2IUCB 3NVLA 2W8DA 4CYRA 1ZEDA 5IJQA 4LREA 4LRFA 5GOVA 3T01A 2D1GA 1URBA 2GSUA 3UN5A 3NKPA 2X98A 4UORA 5HRTA 2XR9A 1P49A 5IJSA 3BDGA 3SZYA 1O99A 5TJ3A 3M8WA 5K4PA 2W5QA 3WAYA 2GSNA 2XRGA 4LRCA 1ELXA 1ZEBA 1KH5A 2QZUA 3UN2A 1K7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q3Q A;  4GTX A;  2ZKT A;  3BDF A;  3IDD A;  1ALI A;  2W8S A;  2G9Y A;  5DLV A;  3MK2 A;  1E3C P;  4KAV A;  2GSO A;  1E33 P;  1ANI A;  1KHL A;  1O98 A;  4GTW A;  1ELY A;  2W5R A;  3B5Q A;  2W5W A;  3WAX A;  1KH9 A;  5AJ9 A;  4NWX A;  3ED4 A;  4UPI A;  4CXK A;  3UO0 A;  5L0K A;  5C66 A;  1SHN A;  4KJG A;  4LRD A;  3M8Y A;  3UNY A;  1ALK A;  1HJK A;  5L0B A;  5LQQ A;  1EW8 A;  4KM4 A;  1KHJ A;  5DLW A;  3M8Z A;  4UOO A;  1KHK A;  1AJB A;  2IUC A;  2W5S A;  4NWJ A;  3E2D A;  4FDI A;  1N2K A;  3DYC A;  1AJD A;  5EGH A;  3IGZ B;  4QAX A;  4UPK A;  3IGY B;  3A52 A;  1FSU A;  5GRR A;  5KXA A;  3NKM A;  1B8J A;  3SZZ A;  3MK0 A;  1ED8 A;  4FDJ A;  3OT9 A;  1KH4 A;  3LXQ A;  1Y6V A;  3T00 A;  1HDH A;  5L0E A;  4GTY A;  1KHN A;  2GLQ A;  4N7T A;  4LRB A;  3T02 A;  1EW2 A;  3KD8 A;  1KH7 A;  3TWZ A;  4ZG7 A;  4ZG9 A;  3NKQ A;  4UPH A;  1ED9 A;  4LR8 A;  1AUK A;  2W5V A;  4B56 A;  2GA3 A;  3BDH A;  4YR1 A;  1Y7A A;  1EI6 A;  1E1Z P;  2RH6 A;  1E2S P;  2W5T A;  4LR2 A;  2ANH A;  4ZGA A;  3UN3 A;  1ANJ A;  1ALH A;  4KAY A;  5LRN A;  5EGE A;  3DPC A;  3NKN A;  1ZEF A;  3MK1 A;  2W5X A;  3TX0 A;  4CXU A;  4LRA A;  2IFY A;  1AJA A;  3NKO A;  3TG0 A;  4LQY A;  4MHX A;  3WBH A;  4TN0 A;  5LRM A;  3WAV A;  4UPL A;  1AJC A;  1EW9 A;  5DLT A;  4CXS A;  4MIV A;  3WAW A;  4CYS A;  4MY4 A;  1EJJ A;  3M7V A;  2VQR A;  1URA A;  1ALJ A;  1N2L A;  5LIA A;  1SHQ A;  4KJD A;  1ELZ A;  1HQA A;  3NKR A;  4GTZ A;  5INH A;  4ZG6 A;  4UOP A;  3BDG B;  3CMR A;  4LR9 A;  4LR7 A;  1EQJ A;  2IUC B;  3NVL A;  2W8D A;  4CYR A;  1ZED A;  5IJQ A;  4LRE A;  4LRF A;  5GOV A;  3T01 A;  2D1G A;  1URB A;  2GSU A;  3UN5 A;  3NKP A;  2X98 A;  4UOR A;  5HRT A;  2XR9 A;  1P49 A;  5IJS A;  3BDG A;  3SZY A;  1O99 A;  5TJ3 A;  3M8W A;  5K4P A;  2W5Q A;  3WAY A;  2GSN A;  2XRG A;  4LRC A;  1ELX A;  1ZEB A;  1KH5 A;  2QZU A;  3UN2 A;  1K7H A; 
#chains in the Genus database with same CATH topology
 1ZQ1 C;  2NVT K;  4P5A A;  4BY1 K;  3S1M K;  3GTK K;  2O5J A;  4QIW D;  1I6H K;  2NVY A;  3MK2 A;  3K7A C;  3L4K A;  1ANI A;  5JFE A;  4OIN A;  5HL8 A;  4AYB D;  3B5Q A;  2W5W A;  2E2H C;  4AH6 A;  3GTM C;  4NWX A;  3ED4 A;  4UPI A;  4MEY A;  5L46 A;  3S1R K;  2BE5 A;  1SHN A;  3CQZ C;  4A3I K;  2JA5 K;  4A3G C;  2B63 A;  4O2D A;  1ALK A;  3A8J A;  1EFW A;  2PPB A;  4KB4 A;  4YFK A;  4GTL A;  4KM9 A;  3I4N K;  1KHJ A;  2R92 A;  4GTE A;  4QJV B;  3AD9 C;  4X6A K;  2A6H A;  4YFX A;  1N2K A;  4JK1 A;  3M4O C;  3HKZ D;  3DYC A;  5IOQ A;  1XZQ B;  1VRQ C;  4QAX A;  4KB2 A;  4UPK A;  4BXX C;  3DXJ A;  3IGY B;  1FSU A;  1I3Q C;  3TTG A;  3MML B;  4PAB A;  3OT9 A;  4A3D K;  3N3Y A;  3T00 A;  5FLM C;  1HDH A;  2GLQ A;  4KN7 A;  1Y1V C;  2V6S A;  3GDZ A;  3OEP A;  3T02 A;  3GIR A;  1F93 A;  5C4X C;  1EW2 A;  3KD8 A;  1KH7 A;  3TWZ A;  4ZG9 A;  3FHZ A;  5IYC K;  2PA8 L;  2ZUF A;  1AUK A;  4B56 A;  2JA5 A;  5LQQ A;  1TWF A;  2RH6 A;  1E1Z P;  2ANH A;  4ZGA A;  4C2M K;  4A3L K;  3HOY K;  3NKN A;  1ZEF A;  3CAG A;  3S16 C;  2W5X A;  1AJA A;  1I50 C;  1WCM C;  4TN0 A;  4XLN A;  1TWF C;  4UPL A;  5C4J K;  4YG2 A;  1K83 K;  2CFA A;  4A3J C;  1F7V A;  3WAW A;  3AD7 C;  4A3K C;  3TFH A;  4MY4 A;  4BY1 C;  3FOF A;  4XSX A;  1EJJ A;  5M5X K;  3HOW C;  2FQO A;  2VUM C;  4GTD A;  4ZG6 A;  3FKI K;  4KMD A;  2IUC B;  3NUH A;  3GTQ A;  3NVL A;  1XZP A;  1SFO K;  1ZED A;  4XLP A;  4LRE A;  4LRF A;  1WSV A;  1JVI A;  5CJ9 A;  3T01 A;  4XCH A;  2GSU A;  3GTM A;  2NVQ C;  3GEI A;  3NKP A;  1WOO A;  3GTO A;  3ORE A;  4QJV A;  5IJS A;  4C3H K;  3BDG A;  3SZY A;  2W5Q A;  2GSN A;  3RZD K;  3PO2 C;  1TWG C;  4ILD A;  1ZEB A;  5M3M K;  2JA6 A;  2NVX C;  4GTX A;  2Y0S L;  3AD8 C;  3GTP C;  3IDD A;  1DCP A;  2W8S A;  4C3I C;  1KQ4 A;  3HOW K;  4M1X A;  3RZO K;  4KAV A;  1E33 P;  3GTK A;  1KHL A;  1O98 A;  1O2A A;  3HOV K;  1I3Q K;  5IP9 C;  1KH9 A;  5AJ9 A;  4KAW X;  2Y0S D;  1J6W A;  2JA6 C;  4A3D C;  3UO0 A;  5L0K A;  2XCR B;  5C3E C;  3GTL K;  5IYD K;  1WOS A;  4OIR A;  4OIQ A;  4LJZ A;  3M8Y A;  1EH1 A;  1TWH K;  2ZUE A;  3I4N C;  3H0G K;  4Q4Z A;  3I4M K;  4GTC A;  5M5Y K;  2B63 C;  2GAG C;  3A8K A;  1IL2 A;  5DLW A;  3M8Z A;  2NVT C;  1AJB A;  1EQR A;  4NWJ A;  4C3I K;  3GTO K;  1J6X A;  5EGH A;  1DD5 A;  3HOY C;  3IGZ B;  2ZFZ A;  4LK0 A;  3A52 A;  4P9S A;  3NKM A;  3BP8 C;  1PJ7 A;  1WIH A;  4PAA A;  3SZZ A;  5TMC A;  1PJ6 A;  1TWC A;  2W7V A;  4C3J K;  1Y1V K;  3BP3 A;  1F9N A;  5IOT A;  4NOI A;  1KHN A;  1ZYR A;  4BBS K;  1JOE A;  4N7T A;  5IYB C;  4KN4 A;  3S2H C;  4BY7 K;  1ZBS A;  2V6T A;  4ZH4 A;  4QIW L;  3NKQ A;  4UPH A;  4GTF A;  1ED9 A;  5IOR A;  3PO3 K;  1Y1W A;  1XZQ A;  1UV7 A;  1E2S P;  1O25 A;  2R93 K;  4GTA A;  5C44 K;  4RMF A;  1SFO C;  4KAY A;  2PA8 D;  5EGE A;  3JST A;  3TX0 A;  3M3Y K;  4G0U A;  3NKO A;  1B4A A;  1WSR A;  1TWF K;  4AYB L;  3S2D K;  3L4J A;  5LRM A;  3GSI A;  2R7Z A;  1ZXO A;  3TFJ A;  4BBR C;  5DLT A;  1EW9 A;  1WCM A;  3I4M C;  4CYS A;  1SFO A;  2E2J C;  3M7V A;  2VQR A;  1YNJ A;  1SHQ A;  4LLG A;  1HQA A;  4A3B C;  3HOU C;  4UOP A;  3S0X A;  2JA8 C;  3CMR A;  3OPF A;  3N0B A;  3HOV C;  1DCH A;  3GTM K;  4Y52 C;  4CYR A;  2NVQ K;  1ZVU A;  1IE0 A;  4KM8 A;  3S1N K;  3H0G A;  5M3F K;  1URB A;  4A3G K;  1R9T A;  2A68 A;  1BJT A;  2P8T A;  2JA7 A;  2XR9 A;  3HOX K;  3GTJ C;  2WB1 L;  3WAY A;  3GEE A;  1J98 A;  1V5V A;  1EQJ A;  1K7H A;  3Q3Q A;  1I6H C;  2ZKT A;  4G0W A;  2XCO A;  3S17 C;  1O28 A;  5DLV A;  1E3C P;  4BKW A;  2JA7 C;  5C44 C;  3S15 C;  2O5I A;  3GTP A;  4GTW A;  2WAQ L;  4GZY A;  2W5R A;  2JA6 K;  1I6V A;  1O26 A;  5M5W K;  4CXK A;  2FQT A;  3LAJ A;  4G7H A;  3GEH A;  4FM9 A;  3H3V L;  4KJG A;  4BBR K;  4LRD A;  1VLO A;  4A3C C;  4J3N A;  4A3J K;  4A3I C;  2JA5 C;  3GTG C;  3EQL A;  4WIL A;  1HJK A;  5L0B A;  2A69 A;  3G4A A;  2YU9 K;  1EW8 A;  3GTQ K;  4KM4 A;  3ERE D;  4UOO A;  3S1Q K;  4Y7N K;  1F7U A;  1PJ5 A;  2NVX K;  4A3B K;  1KHK A;  3N0C A;  1WQG A;  2JA7 K;  4DDQ A;  1SMY A;  1AJD A;  1WOP A;  1DCO A;  5KXA A;  4OIP A;  1K83 A;  1B8J A;  4FDJ A;  1ED8 A;  3S14 K;  4BXX K;  2V6U A;  4A3M K;  1KH4 A;  3GTJ K;  1Y6V A;  3WOD A;  3TFI A;  2E2I K;  3HXA A;  4GTY A;  2R7Z C;  5FJ8 K;  1TWG K;  1HI9 A;  3H3V D;  2R92 K;  5JVO A;  1USM A;  4G0V A;  4LOW A;  4Q5S A;  1C0A A;  3GTQ C;  3GTP K;  3A8I A;  2B63 K;  4YR1 A;  3HOU K;  1YNN A;  2GAH C;  3V4G A;  5C4X K;  4KMH A;  2NVY K;  1Y7A A;  1EI6 A;  4A3F K;  2GA3 A;  3GTO C;  1ANJ A;  1ALH A;  1Y1W C;  5LRN A;  2CFA B;  4KC6 A;  3DPC A;  3MK1 A;  2JH3 A;  4LRA A;  1TWG A;  1RU0 A;  2IFY A;  3HOZ K;  1XXC A;  5CHP A;  3HOX C;  3S14 C;  4LK1 A;  3GTJ A;  1I50 K;  4A3K K;  2E2J K;  1AJC A;  2YU9 C;  3S1M C;  4BLB A;  4KAS A;  3GTK C;  1INN A;  2PMZ D;  1URA A;  1ALJ A;  1N2L A;  3RZO C;  1Y1V A;  3NKR A;  4GTZ A;  1TWC K;  4KMU A;  5IYC C;  3BDG B;  1R9T K;  3PO3 C;  3ADA C;  4LR7 A;  4LR9 A;  2XCQ A;  3HKZ L;  3FKI C;  1WQF A;  4GTB A;  2YU9 A;  2D6F C;  5IYD C;  5C3E K;  4C3H C;  2X98 A;  4A3E K;  5HRT A;  3S16 K;  1P49 A;  4KMA A;  1O24 A;  1XXB A;  3H0G C;  1WQH A;  5FLM K;  4BBS C;  1IQ0 A;  3GTG K;  1IW7 A;  2WAQ D;  2XRG A;  1ELX A;  1KH5 A;  2QZU A;  4GT9 A;  3UNY A;  4X6A C;  3RZD C;  3PO2 K;  1TWA K;  4FZB A;  2PMZ L;  1L0W A;  3BDF A;  1BS2 A;  4GFQ A;  1ALI A;  1XXA A;  3M4O K;  2G9Y A;  3GTL A;  3LAP A;  1BDF A;  2GSO A;  2E2H A;  1TWC C;  3AQP A;  2VUM K;  2EBB A;  1ELY A;  3WAX A;  2CW0 A;  1VJE A;  4WJ3 M;  1O2B A;  4C3J C;  2VUM A;  2R93 A;  2RGR A;  2E2H K;  4A3C K;  1HQM A;  5C66 A;  5E68 A;  5TMF A;  3G4C A;  3GTL C;  2R92 C;  3VA7 A;  4KAR A;  1TWH C;  4XSZ A;  3GTG A;  1XPP A;  2IUC A;  2NVY C;  3FOE A;  2R93 C;  2W5S A;  3AQO A;  3E2D A;  4FDI A;  2PHC B;  3S17 K;  4KDD A;  1O27 A;  4Y52 K;  3IPJ A;  3M3Y C;  2Y3P A;  4A3M C;  5GRR A;  1J6V A;  1WCM K;  4G7Z A;  3S2D C;  1TWH A;  3MK0 A;  4MEX A;  2R7Z K;  3CQZ A;  3LXQ A;  1K83 C;  5L0E A;  4BY7 C;  4P5B A;  4G7O A;  4LRB A;  2P5M A;  1USO A;  5IYB K;  1ISE A;  4ZG7 A;  4A3F C;  1IS1 A;  2JA8 K;  1IBA A;  2W5V A;  4LR8 A;  1JQW A;  3BDH A;  1Y1W K;  2A6E A;  4LR2 A;  4Y7N C;  1R9T C;  3BUE A;  3S15 K;  2W5T A;  3UN3 A;  3S1N C;  4OIO A;  4BLA A;  1TWA A;  4A93 C;  4C45 A;  5IP7 K;  1I3Q A;  5IP9 K;  4CXU A;  1O29 A;  4YFN A;  1XZP B;  4A3E C;  3TG0 A;  4LQY A;  4MHX A;  3S1R C;  3WBH A;  3CQZ K;  1O2F B;  5IOS A;  2KWA A;  3AH5 A;  4MQ9 A;  3WAV A;  4CXS A;  1EK8 A;  4MIV A;  1TWA C;  1VGX A;  1G51 A;  5C4J C;  1WOR A;  4KAT A;  3S2H K;  4WJ4 A;  5LIA A;  4KJD A;  2E2I A;  1ELZ A;  1X31 C;  1YX2 A;  1B4B A;  3K7A K;  5INH A;  1VH2 A;  2WB1 D;  1BGW A;  1GE9 A;  2W8D A;  4C2M C;  4A3L C;  5IJQ A;  4A93 K;  5IP7 C;  5GOV A;  5D4D A;  1AB4 A;  3LPX A;  2D1G A;  3UN5 A;  1I50 A;  3FKI A;  4UOR A;  2E2I C;  3HOZ C;  2NVX A;  1O99 A;  5TJ3 A;  3M8W A;  5K4P A;  4LRC A;  3QX3 A;  3UN2 A;  1YCL A;  3S1Q C; 
#chains in the Genus database with same CATH homology
 3Q3Q A;  4GTX A;  2ZKT A;  3BDF A;  3IDD A;  1ALI A;  2W8S A;  2G9Y A;  5DLV A;  3MK2 A;  1E3C P;  4KAV A;  2GSO A;  1E33 P;  1ANI A;  1KHL A;  1O98 A;  4GTW A;  1ELY A;  2W5R A;  3B5Q A;  2W5W A;  3WAX A;  1KH9 A;  5AJ9 A;  4NWX A;  3ED4 A;  4UPI A;  4CXK A;  3UO0 A;  5L0K A;  5C66 A;  1SHN A;  4KJG A;  4LRD A;  3M8Y A;  3UNY A;  1ALK A;  1HJK A;  5L0B A;  5LQQ A;  1EW8 A;  4KM4 A;  1KHJ A;  5DLW A;  3M8Z A;  4UOO A;  1KHK A;  1AJB A;  2IUC A;  2W5S A;  4NWJ A;  3E2D A;  4FDI A;  1N2K A;  3DYC A;  1AJD A;  5EGH A;  3IGZ B;  4QAX A;  4UPK A;  3IGY B;  3A52 A;  1FSU A;  5GRR A;  5KXA A;  3NKM A;  1B8J A;  3SZZ A;  3MK0 A;  1ED8 A;  4FDJ A;  3OT9 A;  1KH4 A;  3LXQ A;  1Y6V A;  3T00 A;  1HDH A;  5L0E A;  4GTY A;  1KHN A;  2GLQ A;  4N7T A;  4LRB A;  3T02 A;  1EW2 A;  3KD8 A;  1KH7 A;  3TWZ A;  4ZG7 A;  4ZG9 A;  3NKQ A;  4UPH A;  1ED9 A;  4LR8 A;  1AUK A;  2W5V A;  4B56 A;  2GA3 A;  3BDH A;  4YR1 A;  1Y7A A;  1EI6 A;  1E1Z P;  2RH6 A;  1E2S P;  2W5T A;  4LR2 A;  2ANH A;  4ZGA A;  3UN3 A;  1ANJ A;  1ALH A;  4KAY A;  5LRN A;  5EGE A;  3DPC A;  3NKN A;  1ZEF A;  3MK1 A;  2W5X A;  3TX0 A;  4CXU A;  4LRA A;  2IFY A;  1AJA A;  3NKO A;  3TG0 A;  4LQY A;  4MHX A;  3WBH A;  4TN0 A;  5LRM A;  3WAV A;  4UPL A;  1AJC A;  1EW9 A;  5DLT A;  4CXS A;  4MIV A;  3WAW A;  4CYS A;  4MY4 A;  1EJJ A;  3M7V A;  2VQR A;  1URA A;  1ALJ A;  1N2L A;  5LIA A;  1SHQ A;  4KJD A;  1ELZ A;  1HQA A;  3NKR A;  4GTZ A;  5INH A;  4ZG6 A;  4UOP A;  3BDG B;  3CMR A;  4LR9 A;  4LR7 A;  1EQJ A;  2IUC B;  3NVL A;  2W8D A;  4CYR A;  1ZED A;  5IJQ A;  4LRE A;  4LRF A;  5GOV A;  3T01 A;  2D1G A;  1URB A;  2GSU A;  3UN5 A;  3NKP A;  2X98 A;  4UOR A;  5HRT A;  2XR9 A;  1P49 A;  5IJS A;  3BDG A;  3SZY A;  1O99 A;  5TJ3 A;  3M8W A;  5K4P A;  2W5Q A;  3WAY A;  2GSN A;  2XRG A;  4LRC A;  1ELX A;  1ZEB A;  1KH5 A;  2QZU A;  3UN2 A;  1K7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...