3T02A

Crystal structure of phosphonoacetate hydrolase from sinorhizobium meliloti 1021 in complex with phosphonoacetate
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
Knots found
sequence length
413
structure length
413
Chain Sequence
MSKISVTVNGRRYPWPRVPAIAVCLDGCEPAYLDAAIDAGLMPALKRIKERGAVRLAHSVIPSFANPNNLSIATGSPPAVHGICGNYLYEPSTGEEVMMNDPKFLRAPTIFQAFYDAGARVAVVTAKDKLRALLGKGLRFDEGRAVCFSSEKSDKATRAEHGIDNASAWLGRPVPEVYSAALSEFVFAAGVKLLREFRPDIMYLTTTDYVQHKYAPGVPEANSFYEMFDRYLAELDGLGAAIVVTADHGMKPKHKADGSPDVIYVQDLLDEWLGKDAARVILPITDPYVVHHGALGSFATAYLPDGCDRSEIMARLKAIQGVDVVLGREEACRRFELPEDRIGDIVLVSSENKTLGTSEHRHDLAALDEPLRSHGGLTEQEVPFIVNRVLPELPNAPRLRNFDAFFYAVTAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and mechanistic insights into C-p bond hydrolysis by phosphonoacetate hydrolase.
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Hydrolase
molecule keywords phosphonoacetate hydrolase
total genus 126
structure length 413
sequence length 413
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.6.1.9: Nucleotide diphosphatase.
pdb deposition date 2011-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.110 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Domain 2, Phosphonoacetate Hydrolase 3t02A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3t02A01
4MHXA 4B56A 2ANHA 3MK1A 2IUCA 3BDFA 1N2KA 5HRTA 4YR1A 5K4PA 1E3CP 3NKOA 1AJCA 3TWZA 4KM4A 3UNYA 3WAWA 1K7HA 1AJDA 5INHA 3IDDA 4UPIA 4MY4A 1FSUA 4LR8A 4N7TA 5L0BA 1ALKA 2G9YA 3NKQA 4LR2A 3UN3A 2W8DA 3BDGB 1E2SP 4LRCA 1KH5A 2D1GA 5IJQA 4CXSA 3M7VA 3A52A 1SHNA 5LIAA 5EGHA 3WBHA 1ELYA 5LRMA 1ZEBA 4LR7A 4LRDA 5LRNA 4KAYA 5L0EA 4GTXA 1ZEDA 1EW9A 2GA3A 4ZG7A 4QAXA 4CXUA 4GTWA 5KXAA 4LQYA 5LQQA 2W5SA 1P49A 4UPLA 2W5VA 1N2LA 1EI6A 5DLWA 4LR9A 3NKPA 4UOPA 3WAVA 4GTYA 3NKMA 5DLTA 3M8WA 5GOVA 5TJ3A 3M8ZA 4FDIA 5AJ9A 4CYSA 3WAYA 1ZEFA 1HJKA 1O98A 3T02A 2W5XA 2ZKTA 5C66A 4UOOA 4MIVA 3BDHA 3ED4A 3NVLA 1HDHA 4CXKA 2IUCB 1O99A 4KAVA 4LRBA 1ALHA 1ELXA 1KHNA 2W8SA 3NKRA 4LRAA 4ZGAA 4NWJA 2X98A 1AJBA 1EW2A 1KH4A 1EQJA 2IFYA 3BDGA 3CMRA 1E1ZP 1URBA 4ZG9A 2VQRA 4KJGA 4LREA 2RH6A 4NWXA 3Q3QA 1KHJA 1KHKA 3OT9A 1ALIA 4GTZA 3T01A 2XRGA 1Y6VA 3KD8A 4UORA 2XR9A 4KJDA 1KH7A 5L0KA 1EW8A 3B5QA 3UN5A 1URAA 3M8YA 1ED8A 1EJJA 3IGYB 4UPHA 1ELZA 5EGEA 1ALJA 1E33P 1KHLA 2GLQA 2GSOA 2QZUA 2W5TA 3MK2A 4FDJA 4ZG6A 5IJSA 3MK0A 1AJAA 1B8JA 3UN2A 3SZYA 3TG0A 2W5WA 4UPKA 3TX0A 5GRRA 4LRFA 1ANJA 3SZZA 2GSNA 3IGZB 4TN0A 3UO0A 4CYRA 1KH9A 2W5RA 1ANIA 5DLVA 1ED9A 1HQAA 3DYCA 3T00A 3NKNA 3WAXA 3E2DA 3LXQA 1AUKA 1SHQA 2GSUA 3DPCA 2W5QA 1Y7AA
chains in the Genus database with same CATH superfamily
2ANHA 1TWFC 1DCHA 1G51A 2IUCA 2CFAA 4KM8A 3S16K 3M3YK 1E3CP 1AJCA 4BBRK 1F9NA 2E2JC 1K7HA 4KB4A 4OINA 5INHA 3BP8C 1TWGC 2P5MA 1FSUA 1WSVA 4G7HA 2E2IK 2G9YA 3UN3A 2W8DA 4XSZA 3BDGB 2V6SA 1F7UA 5EGHA 1IL2A 3AH5A 2JH3A 1WQGA 5IYBK 5LRNA 4GTXA 4ZG7A 1WCMA 5IP9K 4QAXA 1ZYRA 3I4NK 5LQQA 1P49A 1J98A 2E2IA 4A93C 1N2LA 2VUMK 3K7AC 1J6XA 3WAVA 2YU9A 4FZBA 3NKMA 5DLTA 3M8WA 5L46A 4LOWA 4KDDA 3S2DK 3GIRA 4Y7NK 5M5XK 1R9TA 3I4MK 3T02A 2W5XA 1O2BA 3BDHA 3ED4A 5FLMK 1F7VA 4OIRA 4Y7NC 3HOVC 1O27A 4A3BC 2JA8K 2W8SA 1ZXOA 4A3CC 4BBSC 5JVOA 3AD8C 4NWJA 1Y1VA 3NUHA 4M1XA 4PABA 2IFYA 3FOFA 1IS1A 1ISEA 2RH6A 2R7ZA 1K83K 4C2MK 1KHKA 5IP7K 1B4AA 4C3JK 3OT9A 4G0UA 4P5AA 3RZOC 1WOOA 3HKZL 3HOZC 4GTZA 2CFAB 3DXJA 1B4BA 4KJDA 2JA5K 2YU9K 2R92K 4WJ3M 1XXCA 1URAA 1TWCC 1JOEA 4YFXA 4P5BA 4GT9A 5EGEA 1ELZA 4AYBD 1BS2A 5IJSA 5IP7C 4BY1C 3BUEA 4DDQA 2V6TA 1I50C 1USOA 4G7OA 3JSTA 2W5WA 3S17K 2JA5C 1Y1WA 1TWAK 5M3FK 2KWAA 3ADAC 2GSNA 1WQHA 3SZZA 4TN0A 4CYRA 1KH9A 2W5RA 2VUMC 2P8TA 1ED9A 3WAXA 3E2DA 4OIOA 2Y0SD 1AUKA 4RMFA 4KN7A 2FQTA 2GSUA 3DPCA 2W5QA 4MHXA 2PPBA 4A3DC 3LPXA 1C0AA 3FKIK 3GTGK 1VRQC 3GSIA 3BDFA 5HRTA 3S1NK 5TMCA 3GDZA 2PHCB 1O29A 4AH6A 3GTQA 2WAQL 1HI9A 3TWZA 3GTOC 2E2HK 3HXAA 4KATA 4A3BK 1SFOK 4KMHA 1TWAA 2XCRB 3GTOK 2E2JK 4GTBA 4GZYA 1IBAA 4MY4A 3HOZK 2Y0SL 4A3KC 1E2SP 1KH5A 4BXXK 2D1GA 3WODA 3S2HK 3I4NC 1SHNA 3M7VA 5LIAA 1EFWA 5C4XK 5C3EC 1ELYA 3FOEA 4G7ZA 4FM9A 1GE9A 3A8KA 2A69A 4P9SA 4LRDA 4PAAA 1ZEDA 4A3LK 2GA3A 2PA8D 1F93A 1USMA 1TWHK 5C4JC 4UPLA 3NKPA 1UV7A 1K83C 4GTYA 1L0WA 3GEEA 3GTMA 4A3MK 4OIPA 5TJ3A 1I6HC 1DD5A 4FDIA 1XZQA 5AJ9A 4CYSA 4BBRC 1HJKA 4A3GK 3HOUC 5E68A 5IYCC 1INNA 3AQOA 4ILDA 2ZKTA 5C66A 1WIHA 3GEHA 1Y1VK 1YX2A 3NVLA 1WQFA 1XZQB 2WB1L 4G0WA 2PA8L 2IUCB 4OIQA 1O2AA 3OREA 1SFOA 4LRBA 1ALHA 1KHNA 2NVYA 1VJEA 4MEYA 5CHPA 3HOXC 3NKRA 5M5YK 4G0VA 1VH2A 4LK1A 3GTGC 1EW2A 1KH4A 1EQJA 5IP9C 3I4MC 1IE0A 2XCQA 1URBA 3OPFA 3TFJA 3M4OC 1JQWA 4KJGA 5IYBC 2ZUEA 4LREA 1PJ6A 3HOYC 1O24A 4NWXA 3Q3QA 1I6HK 2R7ZC 4WJ4A 1Y6VA 3GTPA 1TWGK 1KH7A 3G4CA 3PO3K 5L0KA 1Y1WK 3B5QA 1YCLA 1X31C 3GTJA 3AQPA 2RGRA 3HOYK 1ALJA 4FDJA 2A68A 3H0GK 4ZG6A 2GAHC 2O5JA 2R92A 1J6WA 1BGWA 5FJ8K 3HOXK 3UO0A 4A93K 1ANIA 1XZPA 4YFNA 3NKNA 4XCHA 3LXQA 3S16C 5IYDC 3S14C 2E2HC 4A3JC 1TWFK 1Y7AA 1Y1VC 4B56A 4KN4A 1K83A 2NVXC 3GTMC 3S1RC 4A3IC 4C2MC 3RZDK 4YR1A 2O5IA 4GTAA 5K4PA 4C3IC 1ZBSA 5IYDK 4KM4A 3WAWA 3A8JA 3A8IA 3IPJA 1WOPA 4A3KK 3GTOA 4C45A 3HOWC 4UPIA 3GTLC 4N7TA 3S1QK 1ALKA 1J6VA 1SFOC 1VGXA 1PJ7A 1YNNA 3NKQA 1TWCA 4LRCA 1IW7A 5IJQA 3GTQK 3WBHA 4KAWX 2B63A 1TWFA 5LRMA 3OEPA 4KMAA 3S2HC 3S1NC 2CW0A 1O2FB 5IYCK 1ZEBA 3S1QC 2R93A 4X6AC 1R9TK 1EW9A 3CQZA 5C44C 4CXUA 1EK8A 3HOWK 4JK1A 5KXAA 2W5SA 2NVTK 3HKZD 4A3MC 2W5VA 5HL8A 3N0CA 3TFIA 3VA7A 2VUMA 4UOPA 5DLWA 3V4GA 2JA7K 5M5WK 1ZQ1C 5M3MK 1I6VA 4YFKA 4J3NA 1WCMK 4LJZA 4GTCA 3H0GA 4A3LC 1O98A 2NVXK 3S17C 4O2DA 3ERED 5TMFA 4UOOA 4MIVA 2JA7A 3N3YA 3QX3A 1WCMC 4CXKA 3GTPK 1O99A 5C4JK 1IQ0A 4YG2A 4BBSK 1ELXA 2E2IC 4A3FC 4GTEA 3CQZK 4BLBA 5IOQA 3CAGA 3CMRA 2NVQK 2B63K 3BP3A 3S1MK 4WILA 1ZVUA 5IOSA 1Y1WC 2NVXA 4KARA 3LAPA 1EH1A 1HQMA 1ALIA 3T01A 2XRGA 3KD8A 4Q4ZA 4Q5SA 4ZH4A 2XR9A 1DCOA 4BKWA 2JA6C 3UN5A 4NOIA 1I3QA 3M8YA 3GTKK 1EJJA 4UPHA 4KM9A 4GTDA 4KMUA 1E33P 2V6UA 2QZUA 3L4JA 4A3DK 1AB4A 1YNJA 3H3VD 1B8JA 3UN2A 2WAQD 3TX0A 5GRRA 3GEIA 2EBBA 4A3CK 4XLPA 1TWHA 1TWCK 2NVQC 3S14K 5DLVA 1TWAC 2YU9C 1HQAA 2NVYC 4KB2A 4A3FK 4LLGA 3K7AK 1SHQA 1BDFA 5IOTA 4BY1K 1V5VA 4AYBL 1XPPA 3S15K 4A3GC 3MK1A 2PMZD 2ZUFA 3H3VL 3GTJK 4KASA 1N2KA 3S2DC 3NKOA 1TWGA 5IORA 3UNYA 3RZOK 1AJDA 3PO2C 3GTPC 1BJTA 4C3JC 3IDDA 2A6EA 5L0BA 2JA8C 4LR8A 4GTLA 4LR2A 3FKIA 3GTJC 3GTLA 3A52A 1I50K 4X6AK 4QIWL 2BE5A 1O28A 2PMZL 1O26A 4BXXC 4BY7K 4XLNA 3GTKA 3S1MC 4LR7A 1DCPA 3M4OK 4KAYA 1I3QK 5L0EA 2WB1D 4A3EK 4GTWA 3GTQC 4LQYA 2NVYK 3G4AA 1XXBA 1EI6A 1EQRA 4LR9A 5FLMC 5JFEA 4KMDA 1RU0A 5GOVA 1R9TC 1XZPB 1XXAA 2E2HA 4C3HK 4QJVA 3M8ZA 3WAYA 1ZEFA 2JA6A 4A3EC 1I50A 3N0BA 3H0GC 1PJ5A 2JA5A 1KQ4A 2FQOA 4KC6A 3MMLB 3GTLK 4QJVB 3GTMK 1HDHA 1O25A 3LAJA 4KAVA 2JA7C 5D4DA 1WORA 3AD7C 2D6FC 4C3IK 4LRAA 4ZGAA 3TFHA 2R7ZK 3FHZA 1SMYA 3L4KA 4XSXA 2X98A 1AJBA 3BDGA 5C44K 4ZG9A 1E1ZP 3AD9C 3S15C 2VQRA 2GAGC 4QIWD 5CJ9A 1VLOA 2B63C 2XCOA 4A3JK 5C3EK 2R92C 3TTGA 5C4XC 2R93C 1KHJA 3CQZC 1JVIA 4UORA 4MEXA 4MQ9A 4Y52K 3M3YC 1EW8A 4GTFA 2R93K 3S0XA 1ED8A 3IGYB 2Y3PA 3EQLA 3GTGA 4CXSA 4LK0A 1KHLA 1I3QC 2GLQA 2GSOA 1WOSA 2W5TA 3MK2A 4BY7C 3MK0A 3HOUK 1AJAA 4A3IK 3FKIC 3SZYA 3TG0A 4UPKA 2JA6K 3PO3C 4LRFA 3IGZB 2W7VA 3GTKC 4BLAA 4GFQA 4C3HC 2A6HA 2ZFZA 4Y52C 1WSRA 2NVTC 3T00A 3HOVK 1TWHC 3PO2K 3DYCA 3RZDC 1ANJA 3S1RK
chains in the Genus database with same CATH topology
4MHXA 4B56A 2ANHA 3MK1A 2IUCA 3BDFA 1N2KA 5HRTA 4YR1A 5K4PA 1E3CP 3NKOA 1AJCA 3TWZA 4KM4A 3UNYA 3WAWA 1K7HA 1AJDA 5INHA 3IDDA 4UPIA 4MY4A 1FSUA 4LR8A 4N7TA 5L0BA 1ALKA 2G9YA 3NKQA 4LR2A 3UN3A 2W8DA 3BDGB 1E2SP 4LRCA 1KH5A 2D1GA 5IJQA 4CXSA 3M7VA 3A52A 1SHNA 5LIAA 5EGHA 3WBHA 1ELYA 5LRMA 1ZEBA 4LR7A 4LRDA 5LRNA 4KAYA 5L0EA 4GTXA 1ZEDA 1EW9A 2GA3A 4ZG7A 4QAXA 4CXUA 4GTWA 5KXAA 4LQYA 5LQQA 2W5SA 1P49A 4UPLA 2W5VA 1N2LA 1EI6A 5DLWA 4LR9A 3NKPA 4UOPA 3WAVA 4GTYA 3NKMA 5DLTA 3M8WA 5GOVA 5TJ3A 3M8ZA 4FDIA 5AJ9A 4CYSA 3WAYA 1ZEFA 1HJKA 1O98A 3T02A 2W5XA 2ZKTA 5C66A 4UOOA 4MIVA 3BDHA 3ED4A 3NVLA 1HDHA 4CXKA 2IUCB 1O99A 4KAVA 4LRBA 1ALHA 1ELXA 1KHNA 2W8SA 3NKRA 4LRAA 4ZGAA 4NWJA 2X98A 1AJBA 1EW2A 1KH4A 1EQJA 2IFYA 3BDGA 3CMRA 1E1ZP 1URBA 4ZG9A 2VQRA 4KJGA 4LREA 2RH6A 4NWXA 3Q3QA 1KHJA 1KHKA 3OT9A 1ALIA 4GTZA 3T01A 2XRGA 1Y6VA 3KD8A 4UORA 2XR9A 4KJDA 1KH7A 5L0KA 1EW8A 3B5QA 3UN5A 1URAA 3M8YA 1ED8A 1EJJA 3IGYB 4UPHA 1ELZA 5EGEA 1ALJA 1E33P 1KHLA 2GLQA 2GSOA 2QZUA 2W5TA 3MK2A 4FDJA 4ZG6A 5IJSA 3MK0A 1AJAA 1B8JA 3UN2A 3SZYA 3TG0A 2W5WA 4UPKA 3TX0A 5GRRA 4LRFA 1ANJA 3SZZA 2GSNA 3IGZB 4TN0A 3UO0A 4CYRA 1KH9A 2W5RA 1ANIA 5DLVA 1ED9A 1HQAA 3DYCA 3T00A 3NKNA 3WAXA 3E2DA 3LXQA 1AUKA 1SHQA 2GSUA 3DPCA 2W5QA 1Y7AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MHX A;  4B56 A;  2ANH A;  3MK1 A;  2IUC A;  3BDF A;  1N2K A;  5HRT A;  4YR1 A;  5K4P A;  1E3C P;  3NKO A;  1AJC A;  3TWZ A;  4KM4 A;  3UNY A;  3WAW A;  1K7H A;  1AJD A;  5INH A;  3IDD A;  4UPI A;  4MY4 A;  1FSU A;  4LR8 A;  4N7T A;  5L0B A;  1ALK A;  2G9Y A;  3NKQ A;  4LR2 A;  3UN3 A;  2W8D A;  3BDG B;  1E2S P;  4LRC A;  1KH5 A;  2D1G A;  5IJQ A;  4CXS A;  3M7V A;  3A52 A;  1SHN A;  5LIA A;  5EGH A;  3WBH A;  1ELY A;  5LRM A;  1ZEB A;  4LR7 A;  4LRD A;  5LRN A;  4KAY A;  5L0E A;  4GTX A;  1ZED A;  1EW9 A;  2GA3 A;  4ZG7 A;  4QAX A;  4CXU A;  4GTW A;  5KXA A;  4LQY A;  5LQQ A;  2W5S A;  1P49 A;  4UPL A;  2W5V A;  1N2L A;  1EI6 A;  5DLW A;  4LR9 A;  3NKP A;  4UOP A;  3WAV A;  4GTY A;  3NKM A;  5DLT A;  3M8W A;  5GOV A;  5TJ3 A;  3M8Z A;  4FDI A;  5AJ9 A;  4CYS A;  3WAY A;  1ZEF A;  1HJK A;  1O98 A;  3T02 A;  2W5X A;  2ZKT A;  5C66 A;  4UOO A;  4MIV A;  3BDH A;  3ED4 A;  3NVL A;  1HDH A;  4CXK A;  2IUC B;  1O99 A;  4KAV A;  4LRB A;  1ALH A;  1ELX A;  1KHN A;  2W8S A;  3NKR A;  4LRA A;  4ZGA A;  4NWJ A;  2X98 A;  1AJB A;  1EW2 A;  1KH4 A;  1EQJ A;  2IFY A;  3BDG A;  3CMR A;  1E1Z P;  1URB A;  4ZG9 A;  2VQR A;  4KJG A;  4LRE A;  2RH6 A;  4NWX A;  3Q3Q A;  1KHJ A;  1KHK A;  3OT9 A;  1ALI A;  4GTZ A;  3T01 A;  2XRG A;  1Y6V A;  3KD8 A;  4UOR A;  2XR9 A;  4KJD A;  1KH7 A;  5L0K A;  1EW8 A;  3B5Q A;  3UN5 A;  1URA A;  3M8Y A;  1ED8 A;  1EJJ A;  3IGY B;  4UPH A;  1ELZ A;  5EGE A;  1ALJ A;  1E33 P;  1KHL A;  2GLQ A;  2GSO A;  2QZU A;  2W5T A;  3MK2 A;  4FDJ A;  4ZG6 A;  5IJS A;  3MK0 A;  1AJA A;  1B8J A;  3UN2 A;  3SZY A;  3TG0 A;  2W5W A;  4UPK A;  3TX0 A;  5GRR A;  4LRF A;  1ANJ A;  3SZZ A;  2GSN A;  3IGZ B;  4TN0 A;  3UO0 A;  4CYR A;  1KH9 A;  2W5R A;  1ANI A;  5DLV A;  1ED9 A;  1HQA A;  3DYC A;  3T00 A;  3NKN A;  3WAX A;  3E2D A;  3LXQ A;  1AUK A;  1SHQ A;  2GSU A;  3DPC A;  2W5Q A;  1Y7A A; 
#chains in the Genus database with same CATH topology
 2ANH A;  1TWF C;  1DCH A;  1G51 A;  2IUC A;  2CFA A;  4KM8 A;  3S16 K;  3M3Y K;  1E3C P;  1AJC A;  4BBR K;  1F9N A;  2E2J C;  1K7H A;  4KB4 A;  4OIN A;  5INH A;  3BP8 C;  1TWG C;  2P5M A;  1FSU A;  1WSV A;  4G7H A;  2E2I K;  2G9Y A;  3UN3 A;  2W8D A;  4XSZ A;  3BDG B;  2V6S A;  1F7U A;  5EGH A;  1IL2 A;  3AH5 A;  2JH3 A;  1WQG A;  5IYB K;  5LRN A;  4GTX A;  4ZG7 A;  1WCM A;  5IP9 K;  4QAX A;  1ZYR A;  3I4N K;  5LQQ A;  1P49 A;  1J98 A;  2E2I A;  4A93 C;  1N2L A;  2VUM K;  3K7A C;  1J6X A;  3WAV A;  2YU9 A;  4FZB A;  3NKM A;  5DLT A;  3M8W A;  5L46 A;  4LOW A;  4KDD A;  3S2D K;  3GIR A;  4Y7N K;  5M5X K;  1R9T A;  3I4M K;  3T02 A;  2W5X A;  1O2B A;  3BDH A;  3ED4 A;  5FLM K;  1F7V A;  4OIR A;  4Y7N C;  3HOV C;  1O27 A;  4A3B C;  2JA8 K;  2W8S A;  1ZXO A;  4A3C C;  4BBS C;  5JVO A;  3AD8 C;  4NWJ A;  1Y1V A;  3NUH A;  4M1X A;  4PAB A;  2IFY A;  3FOF A;  1IS1 A;  1ISE A;  2RH6 A;  2R7Z A;  1K83 K;  4C2M K;  1KHK A;  5IP7 K;  1B4A A;  4C3J K;  3OT9 A;  4G0U A;  4P5A A;  3RZO C;  1WOO A;  3HKZ L;  3HOZ C;  4GTZ A;  2CFA B;  3DXJ A;  1B4B A;  4KJD A;  2JA5 K;  2YU9 K;  2R92 K;  4WJ3 M;  1XXC A;  1URA A;  1TWC C;  1JOE A;  4YFX A;  4P5B A;  4GT9 A;  5EGE A;  1ELZ A;  4AYB D;  1BS2 A;  5IJS A;  5IP7 C;  4BY1 C;  3BUE A;  4DDQ A;  2V6T A;  1I50 C;  1USO A;  4G7O A;  3JST A;  2W5W A;  3S17 K;  2JA5 C;  1Y1W A;  1TWA K;  5M3F K;  2KWA A;  3ADA C;  2GSN A;  1WQH A;  3SZZ A;  4TN0 A;  4CYR A;  1KH9 A;  2W5R A;  2VUM C;  2P8T A;  1ED9 A;  3WAX A;  3E2D A;  4OIO A;  2Y0S D;  1AUK A;  4RMF A;  4KN7 A;  2FQT A;  2GSU A;  3DPC A;  2W5Q A;  4MHX A;  2PPB A;  4A3D C;  3LPX A;  1C0A A;  3FKI K;  3GTG K;  1VRQ C;  3GSI A;  3BDF A;  5HRT A;  3S1N K;  5TMC A;  3GDZ A;  2PHC B;  1O29 A;  4AH6 A;  3GTQ A;  2WAQ L;  1HI9 A;  3TWZ A;  3GTO C;  2E2H K;  3HXA A;  4KAT A;  4A3B K;  1SFO K;  4KMH A;  1TWA A;  2XCR B;  3GTO K;  2E2J K;  4GTB A;  4GZY A;  1IBA A;  4MY4 A;  3HOZ K;  2Y0S L;  4A3K C;  1E2S P;  1KH5 A;  4BXX K;  2D1G A;  3WOD A;  3S2H K;  3I4N C;  1SHN A;  3M7V A;  5LIA A;  1EFW A;  5C4X K;  5C3E C;  1ELY A;  3FOE A;  4G7Z A;  4FM9 A;  1GE9 A;  3A8K A;  2A69 A;  4P9S A;  4LRD A;  4PAA A;  1ZED A;  4A3L K;  2GA3 A;  2PA8 D;  1F93 A;  1USM A;  1TWH K;  5C4J C;  4UPL A;  3NKP A;  1UV7 A;  1K83 C;  4GTY A;  1L0W A;  3GEE A;  3GTM A;  4A3M K;  4OIP A;  5TJ3 A;  1I6H C;  1DD5 A;  4FDI A;  1XZQ A;  5AJ9 A;  4CYS A;  4BBR C;  1HJK A;  4A3G K;  3HOU C;  5E68 A;  5IYC C;  1INN A;  3AQO A;  4ILD A;  2ZKT A;  5C66 A;  1WIH A;  3GEH A;  1Y1V K;  1YX2 A;  3NVL A;  1WQF A;  1XZQ B;  2WB1 L;  4G0W A;  2PA8 L;  2IUC B;  4OIQ A;  1O2A A;  3ORE A;  1SFO A;  4LRB A;  1ALH A;  1KHN A;  2NVY A;  1VJE A;  4MEY A;  5CHP A;  3HOX C;  3NKR A;  5M5Y K;  4G0V A;  1VH2 A;  4LK1 A;  3GTG C;  1EW2 A;  1KH4 A;  1EQJ A;  5IP9 C;  3I4M C;  1IE0 A;  2XCQ A;  1URB A;  3OPF A;  3TFJ A;  3M4O C;  1JQW A;  4KJG A;  5IYB C;  2ZUE A;  4LRE A;  1PJ6 A;  3HOY C;  1O24 A;  4NWX A;  3Q3Q A;  1I6H K;  2R7Z C;  4WJ4 A;  1Y6V A;  3GTP A;  1TWG K;  1KH7 A;  3G4C A;  3PO3 K;  5L0K A;  1Y1W K;  3B5Q A;  1YCL A;  1X31 C;  3GTJ A;  3AQP A;  2RGR A;  3HOY K;  1ALJ A;  4FDJ A;  2A68 A;  3H0G K;  4ZG6 A;  2GAH C;  2O5J A;  2R92 A;  1J6W A;  1BGW A;  5FJ8 K;  3HOX K;  3UO0 A;  4A93 K;  1ANI A;  1XZP A;  4YFN A;  3NKN A;  4XCH A;  3LXQ A;  3S16 C;  5IYD C;  3S14 C;  2E2H C;  4A3J C;  1TWF K;  1Y7A A;  1Y1V C;  4B56 A;  4KN4 A;  1K83 A;  2NVX C;  3GTM C;  3S1R C;  4A3I C;  4C2M C;  3RZD K;  4YR1 A;  2O5I A;  4GTA A;  5K4P A;  4C3I C;  1ZBS A;  5IYD K;  4KM4 A;  3WAW A;  3A8J A;  3A8I A;  3IPJ A;  1WOP A;  4A3K K;  3GTO A;  4C45 A;  3HOW C;  4UPI A;  3GTL C;  4N7T A;  3S1Q K;  1ALK A;  1J6V A;  1SFO C;  1VGX A;  1PJ7 A;  1YNN A;  3NKQ A;  1TWC A;  4LRC A;  1IW7 A;  5IJQ A;  3GTQ K;  3WBH A;  4KAW X;  2B63 A;  1TWF A;  5LRM A;  3OEP A;  4KMA A;  3S2H C;  3S1N C;  2CW0 A;  1O2F B;  5IYC K;  1ZEB A;  3S1Q C;  2R93 A;  4X6A C;  1R9T K;  1EW9 A;  3CQZ A;  5C44 C;  4CXU A;  1EK8 A;  3HOW K;  4JK1 A;  5KXA A;  2W5S A;  2NVT K;  3HKZ D;  4A3M C;  2W5V A;  5HL8 A;  3N0C A;  3TFI A;  3VA7 A;  2VUM A;  4UOP A;  5DLW A;  3V4G A;  2JA7 K;  5M5W K;  1ZQ1 C;  5M3M K;  1I6V A;  4YFK A;  4J3N A;  1WCM K;  4LJZ A;  4GTC A;  3H0G A;  4A3L C;  1O98 A;  2NVX K;  3S17 C;  4O2D A;  3ERE D;  5TMF A;  4UOO A;  4MIV A;  2JA7 A;  3N3Y A;  3QX3 A;  1WCM C;  4CXK A;  3GTP K;  1O99 A;  5C4J K;  1IQ0 A;  4YG2 A;  4BBS K;  1ELX A;  2E2I C;  4A3F C;  4GTE A;  3CQZ K;  4BLB A;  5IOQ A;  3CAG A;  3CMR A;  2NVQ K;  2B63 K;  3BP3 A;  3S1M K;  4WIL A;  1ZVU A;  5IOS A;  1Y1W C;  2NVX A;  4KAR A;  3LAP A;  1EH1 A;  1HQM A;  1ALI A;  3T01 A;  2XRG A;  3KD8 A;  4Q4Z A;  4Q5S A;  4ZH4 A;  2XR9 A;  1DCO A;  4BKW A;  2JA6 C;  3UN5 A;  4NOI A;  1I3Q A;  3M8Y A;  3GTK K;  1EJJ A;  4UPH A;  4KM9 A;  4GTD A;  4KMU A;  1E33 P;  2V6U A;  2QZU A;  3L4J A;  4A3D K;  1AB4 A;  1YNJ A;  3H3V D;  1B8J A;  3UN2 A;  2WAQ D;  3TX0 A;  5GRR A;  3GEI A;  2EBB A;  4A3C K;  4XLP A;  1TWH A;  1TWC K;  2NVQ C;  3S14 K;  5DLV A;  1TWA C;  2YU9 C;  1HQA A;  2NVY C;  4KB2 A;  4A3F K;  4LLG A;  3K7A K;  1SHQ A;  1BDF A;  5IOT A;  4BY1 K;  1V5V A;  4AYB L;  1XPP A;  3S15 K;  4A3G C;  3MK1 A;  2PMZ D;  2ZUF A;  3H3V L;  3GTJ K;  4KAS A;  1N2K A;  3S2D C;  3NKO A;  1TWG A;  5IOR A;  3UNY A;  3RZO K;  1AJD A;  3PO2 C;  3GTP C;  1BJT A;  4C3J C;  3IDD A;  2A6E A;  5L0B A;  2JA8 C;  4LR8 A;  4GTL A;  4LR2 A;  3FKI A;  3GTJ C;  3GTL A;  3A52 A;  1I50 K;  4X6A K;  4QIW L;  2BE5 A;  1O28 A;  2PMZ L;  1O26 A;  4BXX C;  4BY7 K;  4XLN A;  3GTK A;  3S1M C;  4LR7 A;  1DCP A;  3M4O K;  4KAY A;  1I3Q K;  5L0E A;  2WB1 D;  4A3E K;  4GTW A;  3GTQ C;  4LQY A;  2NVY K;  3G4A A;  1XXB A;  1EI6 A;  1EQR A;  4LR9 A;  5FLM C;  5JFE A;  4KMD A;  1RU0 A;  5GOV A;  1R9T C;  1XZP B;  1XXA A;  2E2H A;  4C3H K;  4QJV A;  3M8Z A;  3WAY A;  1ZEF A;  2JA6 A;  4A3E C;  1I50 A;  3N0B A;  3H0G C;  1PJ5 A;  2JA5 A;  1KQ4 A;  2FQO A;  4KC6 A;  3MML B;  3GTL K;  4QJV B;  3GTM K;  1HDH A;  1O25 A;  3LAJ A;  4KAV A;  2JA7 C;  5D4D A;  1WOR A;  3AD7 C;  2D6F C;  4C3I K;  4LRA A;  4ZGA A;  3TFH A;  2R7Z K;  3FHZ A;  1SMY A;  3L4K A;  4XSX A;  2X98 A;  1AJB A;  3BDG A;  5C44 K;  4ZG9 A;  1E1Z P;  3AD9 C;  3S15 C;  2VQR A;  2GAG C;  4QIW D;  5CJ9 A;  1VLO A;  2B63 C;  2XCO A;  4A3J K;  5C3E K;  2R92 C;  3TTG A;  5C4X C;  2R93 C;  1KHJ A;  3CQZ C;  1JVI A;  4UOR A;  4MEX A;  4MQ9 A;  4Y52 K;  3M3Y C;  1EW8 A;  4GTF A;  2R93 K;  3S0X A;  1ED8 A;  3IGY B;  2Y3P A;  3EQL A;  3GTG A;  4CXS A;  4LK0 A;  1KHL A;  1I3Q C;  2GLQ A;  2GSO A;  1WOS A;  2W5T A;  3MK2 A;  4BY7 C;  3MK0 A;  3HOU K;  1AJA A;  4A3I K;  3FKI C;  3SZY A;  3TG0 A;  4UPK A;  2JA6 K;  3PO3 C;  4LRF A;  3IGZ B;  2W7V A;  3GTK C;  4BLA A;  4GFQ A;  4C3H C;  2A6H A;  2ZFZ A;  4Y52 C;  1WSR A;  2NVT C;  3T00 A;  3HOV K;  1TWH C;  3PO2 K;  3DYC A;  3RZD C;  1ANJ A;  3S1R K; 
#chains in the Genus database with same CATH homology
 4MHX A;  4B56 A;  2ANH A;  3MK1 A;  2IUC A;  3BDF A;  1N2K A;  5HRT A;  4YR1 A;  5K4P A;  1E3C P;  3NKO A;  1AJC A;  3TWZ A;  4KM4 A;  3UNY A;  3WAW A;  1K7H A;  1AJD A;  5INH A;  3IDD A;  4UPI A;  4MY4 A;  1FSU A;  4LR8 A;  4N7T A;  5L0B A;  1ALK A;  2G9Y A;  3NKQ A;  4LR2 A;  3UN3 A;  2W8D A;  3BDG B;  1E2S P;  4LRC A;  1KH5 A;  2D1G A;  5IJQ A;  4CXS A;  3M7V A;  3A52 A;  1SHN A;  5LIA A;  5EGH A;  3WBH A;  1ELY A;  5LRM A;  1ZEB A;  4LR7 A;  4LRD A;  5LRN A;  4KAY A;  5L0E A;  4GTX A;  1ZED A;  1EW9 A;  2GA3 A;  4ZG7 A;  4QAX A;  4CXU A;  4GTW A;  5KXA A;  4LQY A;  5LQQ A;  2W5S A;  1P49 A;  4UPL A;  2W5V A;  1N2L A;  1EI6 A;  5DLW A;  4LR9 A;  3NKP A;  4UOP A;  3WAV A;  4GTY A;  3NKM A;  5DLT A;  3M8W A;  5GOV A;  5TJ3 A;  3M8Z A;  4FDI A;  5AJ9 A;  4CYS A;  3WAY A;  1ZEF A;  1HJK A;  1O98 A;  3T02 A;  2W5X A;  2ZKT A;  5C66 A;  4UOO A;  4MIV A;  3BDH A;  3ED4 A;  3NVL A;  1HDH A;  4CXK A;  2IUC B;  1O99 A;  4KAV A;  4LRB A;  1ALH A;  1ELX A;  1KHN A;  2W8S A;  3NKR A;  4LRA A;  4ZGA A;  4NWJ A;  2X98 A;  1AJB A;  1EW2 A;  1KH4 A;  1EQJ A;  2IFY A;  3BDG A;  3CMR A;  1E1Z P;  1URB A;  4ZG9 A;  2VQR A;  4KJG A;  4LRE A;  2RH6 A;  4NWX A;  3Q3Q A;  1KHJ A;  1KHK A;  3OT9 A;  1ALI A;  4GTZ A;  3T01 A;  2XRG A;  1Y6V A;  3KD8 A;  4UOR A;  2XR9 A;  4KJD A;  1KH7 A;  5L0K A;  1EW8 A;  3B5Q A;  3UN5 A;  1URA A;  3M8Y A;  1ED8 A;  1EJJ A;  3IGY B;  4UPH A;  1ELZ A;  5EGE A;  1ALJ A;  1E33 P;  1KHL A;  2GLQ A;  2GSO A;  2QZU A;  2W5T A;  3MK2 A;  4FDJ A;  4ZG6 A;  5IJS A;  3MK0 A;  1AJA A;  1B8J A;  3UN2 A;  3SZY A;  3TG0 A;  2W5W A;  4UPK A;  3TX0 A;  5GRR A;  4LRF A;  1ANJ A;  3SZZ A;  2GSN A;  3IGZ B;  4TN0 A;  3UO0 A;  4CYR A;  1KH9 A;  2W5R A;  1ANI A;  5DLV A;  1ED9 A;  1HQA A;  3DYC A;  3T00 A;  3NKN A;  3WAX A;  3E2D A;  3LXQ A;  1AUK A;  1SHQ A;  2GSU A;  3DPC A;  2W5Q A;  1Y7A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...