3T02A

Crystal structure of phosphonoacetate hydrolase from sinorhizobium meliloti 1021 in complex with phosphonoacetate
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
Knots found
sequence length
413
structure length
413
Chain Sequence
MSKISVTVNGRRYPWPRVPAIAVCLDGCEPAYLDAAIDAGLMPALKRIKERGAVRLAHSVIPSFANPNNLSIATGSPPAVHGICGNYLYEPSTGEEVMMNDPKFLRAPTIFQAFYDAGARVAVVTAKDKLRALLGKGLRFDEGRAVCFSSEKSDKATRAEHGIDNASAWLGRPVPEVYSAALSEFVFAAGVKLLREFRPDIMYLTTTDYVQHKYAPGVPEANSFYEMFDRYLAELDGLGAAIVVTADHGMKPKHKADGSPDVIYVQDLLDEWLGKDAARVILPITDPYVVHHGALGSFATAYLPDGCDRSEIMARLKAIQGVDVVLGREEACRRFELPEDRIGDIVLVSSENKTLGTSEHRHDLAALDEPLRSHGGLTEQEVPFIVNRVLPELPNAPRLRNFDAFFYAVTAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords phosphonoacetate hydrolase
publication title Structural and mechanistic insights into C-p bond hydrolysis by phosphonoacetate hydrolase.
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Hydrolase
total genus 126
structure length 413
sequence length 413
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.6.1.9: Nucleotide diphosphatase.
pdb deposition date 2011-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.110 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Domain 2, Phosphonoacetate Hydrolase 3t02A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3t02A01
1ED8A 3UO0A 3SZZA 5TJ3A 2ZKTA 3DYCA 1KHJA 5HRTA 4KAVA 2W5TA 2W5VA 3BDGB 3T00A 2RH6A 1FSUA 2W5WA 4GTXA 4MIVA 1O99A 1P49A 1ELZA 4N7TA 3WBHA 3KD8A 3BDFA 3SZYA 4CXUA 1HQAA 4LRBA 5INHA 4KJGA 2GSUA 4UORA 1ALJA 4FDIA 1KH9A 5LIAA 1HDHA 3MK1A 4CYRA 1HJKA 1EQJA 4LREA 1EW8A 1KHKA 1KH4A 5DLVA 5GRRA 4NWXA 3M8ZA 1ED9A 3TX0A 3WAWA 3NKNA 2W5SA 2XRGA 3WAXA 4GTZA 5IJSA 4YR1A 4LRCA 4CXSA 1E2SP 1N2LA 2GSOA 1AJDA 1B8JA 1URBA 4LQYA 5LQQA 5DLTA 1EI6A 3UN2A 3A52A 4B56A 5C66A 1ZEBA 5L0BA 3CMRA 3M8WA 1E1ZP 3T02A 4LR7A 3NKQA 3TG0A 1ZEDA 5LRNA 1ZEFA 1ELYA 4KM4A 1N2KA 3LXQA 3WAYA 2D1GA 3NVLA 1AJAA 1ANJA 2W5XA 2W5QA 4GTYA 1KH5A 1KH7A 1K7HA 4NWJA 3TWZA 4LRFA 1ALIA 5EGHA 4LR9A 3M7VA 4CYSA 4LR8A 2W5RA 5DLWA 1Y6VA 2IUCA 4UPLA 4UOPA 4TN0A 3MK2A 2IFYA 3UN3A 1EW2A 4UPKA 1E33P 3NKRA 3UN5A 3UNYA 5LRMA 1ELXA 1EW9A 1KHLA 3Q3QA 5KXAA 1ALKA 1E3CP 4UOOA 4ZGAA 2GA3A 3M8YA 3BDGA 2GLQA 4KAYA 2VQRA 1AUKA 1SHNA 5K4PA 3ED4A 3IGZB 2GSNA 4LR2A 4UPIA 3MK0A 5L0EA 4MHXA 2W8SA 1AJCA 3T01A 2X98A 3BDHA 3WAVA 3B5QA 2QZUA 1KHNA 4KJDA 4ZG6A 3DPCA 3NKPA 2W8DA 4ZG7A 1AJBA 5GOVA 1ANIA 3NKOA 5AJ9A 3IGYB 2XR9A 4FDJA 4QAXA 1O98A 5L0KA 4CXKA 5IJQA 1URAA 3NKMA 2ANHA 2IUCB 4GTWA 3OT9A 1EJJA 3IDDA 4ZG9A 4LRDA 3E2DA 1Y7AA 4MY4A 1SHQA 5EGEA 4UPHA 2G9YA 4LRAA 1ALHA
chains in the Genus database with same CATH superfamily
3H3VL 4BY7C 3S1NC 1EQRA 3IPJA 2B63A 1DCOA 1TWFK 4BBSK 4KAVA 2W5TA 5CHPA 3I4NK 1P49A 3H3VD 3KD8A 5FLMC 3HOVC 4ILDA 3CQZK 1ALJA 3PO3K 2NVTK 3EQLA 3TFHA 4XCHA 4KDDA 3GTLK 4Y52C 2JA7C 1SFOK 3S16C 1HJKA 2P5MA 2JA6K 4LREA 1HQMA 4YG2A 1I50A 3GTJC 3M8ZA 1USMA 3NKNA 4XLNA 2W5SA 4A3BC 1DCHA 3BUEA 4C2MK 1AB4A 4XSZA 2YU9A 1F7VA 2VUMK 1I3QK 3A52A 3A8KA 2FQOA 1Y1WC 4XLPA 3S15C 5IP9K 2Y0SL 1TWCC 4KARA 1PJ6A 3AD7C 4Q4ZA 1ELYA 4P9SA 4KM4A 2R93K 3LXQA 4QJVA 3WAYA 4Q5SA 3GTKC 1ANJA 1DD5A 4GTYA 2Y0SD 1KH5A 4NWJA 3TWZA 4LRFA 1ALIA 3HKZL 1J6WA 2A6EA 3HOXC 4UPLA 4UOPA 3L4KA 4C45A 2WB1L 3GTQC 3HOYK 4QJVB 1TWGK 4YFNA 4A3KC 1EH1A 3S2DC 3RZOK 1JQWA 2R92A 2PHCB 3HKZD 4A93C 5LRMA 5KXAA 2A6HA 2WB1D 4KASA 2CFAA 2PA8L 4BBSC 5C3EK 5IP7K 1EFWA 5TMFA 1AUKA 1ZVUA 1I6HC 1WCMA 4A3MK 2B63K 5L0EA 4MHXA 3FKIC 4RMFA 2W8SA 3FHZA 4BXXC 5IYBC 2PA8D 1R9TC 3GTOA 2NVXA 2X98A 5TMCA 3HOWC 1EK8A 4KJDA 3DPCA 2Y3PA 3VA7A 4ZG7A 3NKOA 1XXBA 4FDJA 5L0KA 4OIOA 4Y7NC 3S1QC 2NVYC 3GEIA 4CXKA 3AQPA 4NOIA 2ANHA 2IUCB 4GTWA 4G7OA 3OT9A 4P5BA 1O2FB 4ZG9A 3E2DA 4KM9A 4MEXA 3V4GA 4A3EK 3ADAC 3BP3A 1I50K 2G9YA 4LRAA 4X6AK 1WQFA 1WOPA 3SZZA 2VUMC 1YCLA 1KHJA 4A3IC 3GDZA 5M3MK 2RH6A 3T00A 4BBRK 2YU9K 4GTXA 1YNJA 3WBHA 1ELZA 3BDFA 1J98A 3SZYA 4BKWA 3S17K 4GTDA 3GTMA 3H0GK 4GTEA 4FDIA 1O28A 4A3DC 4KN4A 3HOZC 1USOA 5M5XK 4LK0A 3TTGA 2JH3A 1EQJA 1EW8A 2GAHC 1KH4A 1TWHC 4NWXA 4A3CK 4C3IC 2NVQK 1ED9A 3TX0A 1WQHA 1VRQC 4GTFA 1O2BA 2R7ZA 5C4JK 2FQTA 1N2LA 4KB2A 2R92K 3GTGA 2CW0A 1ZBSA 3LPXA 5M5WK 2JA5K 5C44K 5DLTA 1EI6A 5C66A 5LQQA 3AD8C 1ZEBA 4BY1C 3M8WA 1E1ZP 3T02A 1WSRA 1BJTA 4KMAA 3TG0A 1ZEDA 5LRNA 3M3YC 4QIWL 1WCMK 1ZYRA 3K7AK 1N2KA 4A3LK 4OINA 1J6XA 2V6SA 3GTOK 2NVXK 1RU0A 2W5XA 2W7VA 4KMDA 4QIWD 3S1RC 3JSTA 4KATA 4A3GC 4C3JC 1F93A 3M7VA 1JVIA 2W5RA 1Y6VA 3S14C 2JA7A 3WODA 3CAGA 5IYCK 4TN0A 4A3JK 3I4MK 2E2IC 1EW2A 3RZDK 1E33P 3GTJA 5IYDC 1XZQA 1ELXA 4X6AC 1KHLA 1I6VA 4GTBA 4BLAA 4UOOA 2GA3A 3M8YA 3BDGA 2VQRA 5K4PA 2YU9C 3IGZB 2GSNA 1F9NA 1K83C 5IOQA 3FOEA 1Y1WA 5JVOA 2A69A 3T01A 2JA8C 3BDHA 1O29A 3H0GC 3S1MC 1TWCA 1KHNA 1VGXA 2EBBA 3G4AA 4MQ9A 4A3FK 2W8DA 1TWAC 2A68A 2V6TA 4C3HK 2ZUFA 1SMYA 2E2HC 3HOUC 3GTMK 3S2HK 3GTKA 1O98A 2E2JK 3GTPC 2XCOA 1XZPA 5IJQA 4KB4A 3NKMA 1WSVA 3MMLB 4P5AA 2ZFZA 4YFXA 1EJJA 3IDDA 4GTLA 3GTQA 4LRDA 1TWFC 4GTCA 1C0AA 3PO2K 5EGEA 2PPBA 1O27A 3I4NC 2JA5C 4J3NA 5C4XK 3UO0A 4KN7A 5TJ3A 4KC6A 5L46A 2R7ZK 3DYCA 3AH5A 5IOSA 5HRTA 2CFAB 3GTGK 3CQZC 3PO3C 2W5WA 2NVTC 5M3FK 1O99A 4N7TA 2XCRB 4G0UA 4JK1A 3GTLC 4BY7K 1SFOC 4CXUA 4O2DA 3FKIA 3N0BA 3LAJA 3AQOA 5JFEA 4LRBA 2GSUA 2JA6C 4UORA 5INHA 3OPFA 1R9TA 3LAPA 5LIAA 2P8TA 3GEEA 4CYRA 5FLMK 1IL2A 3HOVK 1Y1VA 1KHKA 4C2MC 2NVYA 1I3QC 2JA7K 4Y52K 4DDQA 3WAWA 1L0WA 2XRGA 3WAXA 4GTZA 4YR1A 4LRCA 1E2SP 5IP9C 1JOEA 1DCPA 2GSOA 1AJDA 4GZYA 1O26A 4LQYA 4B56A 2VUMA 1O2AA 2R93C 4A3BK 4KMHA 1ZEFA 1XXCA 2D1GA 1Y1WK 3HOYC 3NVLA 1TWGC 1AJAA 1B4AA 2W5QA 4OIQA 1KH7A 1UV7A 1TWCK 3RZOC 2XCQA 3A8IA 5EGHA 4LR9A 4CYSA 4LR8A 5DLWA 4BLBA 2GAGC 5D4DA 4AH6A 4G0VA 2D6FC 5C3EC 5IP7C 3NKRA 4KMUA 1TWHA 5E68A 3HOXK 5CJ9A 4A3MC 2B63C 1E3CP 3GTQK 4ZGAA 1VH2A 4A3KK 5IORA 4MEYA 5HL8A 2GLQA 4A93K 3ED4A 4LR2A 4ZH4A 4G0WA 4UPIA 4PABA 3MK0A 4LK1A 3TFIA 5FJ8K 1AJCA 3WAVA 3N0CA 1PJ5A 2QZUA 1I6HK 3L4JA 1AJBA 1ANIA 3FKIK 5IOTA 4BXXK 4FZBA 5IYBK 1R9TK 4A3EC 1I50C 3HOWK 1O25A 1URAA 1Y1VK 3QX3A 1Y7AA 4MY4A 1INNA 4Y7NK 2NVYK 4G7HA 3S1QK 4BBRC 2E2IA 1XZQB 1ED8A 1IQ0A 2ZKTA 4LJZA 3A8JA 3S17C 1YNNA 2W5VA 3BDGB 4MIVA 1J6VA 1FSUA 3GSIA 1ISEA 1HI9A 3AD9C 3M4OK 3HXAA 2O5IA 4OIRA 3N3YA 1HQAA 1G51A 1K83A 4KJGA 4A3IK 1ZXOA 1BGWA 3H0GA 1WIHA 4A3CC 1KH9A 2NVQC 1HDHA 3MK1A 1TWAA 5M5YK 1WQGA 1ZQ1C 2E2HA 5C4JC 2R92C 1PJ7A 5DLVA 3GTPA 5GRRA 4A3DK 2KWAA 1XZPB 5C44C 3HOZK 4XSXA 1X31C 2O5JA 1VJEA 2PMZL 3OEPA 3OREA 4CXSA 5IJSA 1TWFA 1VLOA 4G7ZA 1WOOA 1TWHK 4PAAA 1B8JA 1URBA 4C3IK 3S1NK 3BP8C 3UN2A 1WCMC 2JA5A 5L0BA 3CMRA 3G4CA 3K7AC 2PMZD 4A3LC 3GTOC 2NVXC 4LR7A 3NKQA 4LOWA 3CQZA 3FOFA 1GE9A 1XPPA 4YFKA 3GTLA 1XXAA 4BY1K 1BS2A 1SFOA 2V6UA 5IYCC 2JA6A 4A3JC 3I4MC 2RGRA 1K7HA 3M3YK 3RZDC 3GIRA 4GT9A 3S16K 2IUCA 2ZUEA 1Y1VC 3MK2A 4OIPA 2IFYA 3UN3A 3GTJK 4UPKA 4LLGA 4M1XA 3S1RK 4A3GK 3UN5A 3UNYA 4C3JK 1YX2A 1EW9A 3Q3QA 1IBAA 1I3QA 3S14K 1ALKA 1IS1A 2WAQL 2E2IK 4KAWX 4KAYA 1SHNA 1B4BA 5IYDK 3NUHA 4AYBL 1IW7A 4KM8A 4A3FC 3M4OC 4C3HC 2R93A 4GFQA 4GTAA 3S15K 1WORA 3GTMC 2WAQD 3S2HC 4WJ3M 2E2JC 3B5QA 1F7UA 4ZG6A 4AYBD 3TFJA 3NKPA 4WJ4A 5GOVA 3S0XA 1K83K 3GTKK 4WILA 5AJ9A 3IGYB 2XR9A 4QAXA 3DXJA 1BDFA 1IE0A 1V5VA 1TWGA 2JA8K 3PO2C 3S1MK 3GEHA 5C4XC 1TWAK 2R7ZC 2E2HK 1O24A 4FM9A 3HOUK 3ERED 3S2DK 3GTGC 2BE5A 3GTPK 1SHQA 4UPHA 1WOSA 1ALHA 1KQ4A
chains in the Genus database with same CATH topology
1ED8A 3UO0A 3SZZA 5TJ3A 2ZKTA 3DYCA 1KHJA 5HRTA 4KAVA 2W5TA 2W5VA 3BDGB 3T00A 2RH6A 1FSUA 2W5WA 4GTXA 4MIVA 1O99A 1P49A 1ELZA 4N7TA 3WBHA 3KD8A 3BDFA 3SZYA 4CXUA 1HQAA 4LRBA 5INHA 4KJGA 2GSUA 4UORA 1ALJA 4FDIA 1KH9A 5LIAA 1HDHA 3MK1A 4CYRA 1HJKA 1EQJA 4LREA 1EW8A 1KHKA 1KH4A 5DLVA 5GRRA 4NWXA 3M8ZA 1ED9A 3TX0A 3WAWA 3NKNA 2W5SA 2XRGA 3WAXA 4GTZA 5IJSA 4YR1A 4LRCA 4CXSA 1E2SP 1N2LA 2GSOA 1AJDA 1B8JA 1URBA 4LQYA 5LQQA 5DLTA 1EI6A 3UN2A 3A52A 4B56A 5C66A 1ZEBA 5L0BA 3CMRA 3M8WA 1E1ZP 3T02A 4LR7A 3NKQA 3TG0A 1ZEDA 5LRNA 1ZEFA 1ELYA 4KM4A 1N2KA 3LXQA 3WAYA 2D1GA 3NVLA 1AJAA 1ANJA 2W5XA 2W5QA 4GTYA 1KH5A 1KH7A 1K7HA 4NWJA 3TWZA 4LRFA 1ALIA 5EGHA 4LR9A 3M7VA 4CYSA 4LR8A 2W5RA 5DLWA 1Y6VA 2IUCA 4UPLA 4UOPA 4TN0A 3MK2A 2IFYA 3UN3A 1EW2A 4UPKA 1E33P 3NKRA 3UN5A 3UNYA 5LRMA 1ELXA 1EW9A 1KHLA 3Q3QA 5KXAA 1ALKA 1E3CP 4UOOA 4ZGAA 2GA3A 3M8YA 3BDGA 2GLQA 4KAYA 2VQRA 1AUKA 1SHNA 5K4PA 3ED4A 3IGZB 2GSNA 4LR2A 4UPIA 3MK0A 5L0EA 4MHXA 2W8SA 1AJCA 3T01A 2X98A 3BDHA 3WAVA 3B5QA 2QZUA 1KHNA 4KJDA 4ZG6A 3DPCA 3NKPA 2W8DA 4ZG7A 1AJBA 5GOVA 1ANIA 3NKOA 5AJ9A 3IGYB 2XR9A 4FDJA 4QAXA 1O98A 5L0KA 4CXKA 5IJQA 1URAA 3NKMA 2ANHA 2IUCB 4GTWA 3OT9A 1EJJA 3IDDA 4ZG9A 4LRDA 3E2DA 1Y7AA 4MY4A 1SHQA 5EGEA 4UPHA 2G9YA 4LRAA 1ALHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ED8 A;  3UO0 A;  3SZZ A;  5TJ3 A;  2ZKT A;  3DYC A;  1KHJ A;  5HRT A;  4KAV A;  2W5T A;  2W5V A;  3BDG B;  3T00 A;  2RH6 A;  1FSU A;  2W5W A;  4GTX A;  4MIV A;  1O99 A;  1P49 A;  1ELZ A;  4N7T A;  3WBH A;  3KD8 A;  3BDF A;  3SZY A;  4CXU A;  1HQA A;  4LRB A;  5INH A;  4KJG A;  2GSU A;  4UOR A;  1ALJ A;  4FDI A;  1KH9 A;  5LIA A;  1HDH A;  3MK1 A;  4CYR A;  1HJK A;  1EQJ A;  4LRE A;  1EW8 A;  1KHK A;  1KH4 A;  5DLV A;  5GRR A;  4NWX A;  3M8Z A;  1ED9 A;  3TX0 A;  3WAW A;  3NKN A;  2W5S A;  2XRG A;  3WAX A;  4GTZ A;  5IJS A;  4YR1 A;  4LRC A;  4CXS A;  1E2S P;  1N2L A;  2GSO A;  1AJD A;  1B8J A;  1URB A;  4LQY A;  5LQQ A;  5DLT A;  1EI6 A;  3UN2 A;  3A52 A;  4B56 A;  5C66 A;  1ZEB A;  5L0B A;  3CMR A;  3M8W A;  1E1Z P;  3T02 A;  4LR7 A;  3NKQ A;  3TG0 A;  1ZED A;  5LRN A;  1ZEF A;  1ELY A;  4KM4 A;  1N2K A;  3LXQ A;  3WAY A;  2D1G A;  3NVL A;  1AJA A;  1ANJ A;  2W5X A;  2W5Q A;  4GTY A;  1KH5 A;  1KH7 A;  1K7H A;  4NWJ A;  3TWZ A;  4LRF A;  1ALI A;  5EGH A;  4LR9 A;  3M7V A;  4CYS A;  4LR8 A;  2W5R A;  5DLW A;  1Y6V A;  2IUC A;  4UPL A;  4UOP A;  4TN0 A;  3MK2 A;  2IFY A;  3UN3 A;  1EW2 A;  4UPK A;  1E33 P;  3NKR A;  3UN5 A;  3UNY A;  5LRM A;  1ELX A;  1EW9 A;  1KHL A;  3Q3Q A;  5KXA A;  1ALK A;  1E3C P;  4UOO A;  4ZGA A;  2GA3 A;  3M8Y A;  3BDG A;  2GLQ A;  4KAY A;  2VQR A;  1AUK A;  1SHN A;  5K4P A;  3ED4 A;  3IGZ B;  2GSN A;  4LR2 A;  4UPI A;  3MK0 A;  5L0E A;  4MHX A;  2W8S A;  1AJC A;  3T01 A;  2X98 A;  3BDH A;  3WAV A;  3B5Q A;  2QZU A;  1KHN A;  4KJD A;  4ZG6 A;  3DPC A;  3NKP A;  2W8D A;  4ZG7 A;  1AJB A;  5GOV A;  1ANI A;  3NKO A;  5AJ9 A;  3IGY B;  2XR9 A;  4FDJ A;  4QAX A;  1O98 A;  5L0K A;  4CXK A;  5IJQ A;  1URA A;  3NKM A;  2ANH A;  2IUC B;  4GTW A;  3OT9 A;  1EJJ A;  3IDD A;  4ZG9 A;  4LRD A;  3E2D A;  1Y7A A;  4MY4 A;  1SHQ A;  5EGE A;  4UPH A;  2G9Y A;  4LRA A;  1ALH A; 
#chains in the Genus database with same CATH topology
 3H3V L;  4BY7 C;  3S1N C;  1EQR A;  3IPJ A;  2B63 A;  1DCO A;  1TWF K;  4BBS K;  4KAV A;  2W5T A;  5CHP A;  3I4N K;  1P49 A;  3H3V D;  3KD8 A;  5FLM C;  3HOV C;  4ILD A;  3CQZ K;  1ALJ A;  3PO3 K;  2NVT K;  3EQL A;  3TFH A;  4XCH A;  4KDD A;  3GTL K;  4Y52 C;  2JA7 C;  1SFO K;  3S16 C;  1HJK A;  2P5M A;  2JA6 K;  4LRE A;  1HQM A;  4YG2 A;  1I50 A;  3GTJ C;  3M8Z A;  1USM A;  3NKN A;  4XLN A;  2W5S A;  4A3B C;  1DCH A;  3BUE A;  4C2M K;  1AB4 A;  4XSZ A;  2YU9 A;  1F7V A;  2VUM K;  1I3Q K;  3A52 A;  3A8K A;  2FQO A;  1Y1W C;  4XLP A;  3S15 C;  5IP9 K;  2Y0S L;  1TWC C;  4KAR A;  1PJ6 A;  3AD7 C;  4Q4Z A;  1ELY A;  4P9S A;  4KM4 A;  2R93 K;  3LXQ A;  4QJV A;  3WAY A;  4Q5S A;  3GTK C;  1ANJ A;  1DD5 A;  4GTY A;  2Y0S D;  1KH5 A;  4NWJ A;  3TWZ A;  4LRF A;  1ALI A;  3HKZ L;  1J6W A;  2A6E A;  3HOX C;  4UPL A;  4UOP A;  3L4K A;  4C45 A;  2WB1 L;  3GTQ C;  3HOY K;  4QJV B;  1TWG K;  4YFN A;  4A3K C;  1EH1 A;  3S2D C;  3RZO K;  1JQW A;  2R92 A;  2PHC B;  3HKZ D;  4A93 C;  5LRM A;  5KXA A;  2A6H A;  2WB1 D;  4KAS A;  2CFA A;  2PA8 L;  4BBS C;  5C3E K;  5IP7 K;  1EFW A;  5TMF A;  1AUK A;  1ZVU A;  1I6H C;  1WCM A;  4A3M K;  2B63 K;  5L0E A;  4MHX A;  3FKI C;  4RMF A;  2W8S A;  3FHZ A;  4BXX C;  5IYB C;  2PA8 D;  1R9T C;  3GTO A;  2NVX A;  2X98 A;  5TMC A;  3HOW C;  1EK8 A;  4KJD A;  3DPC A;  2Y3P A;  3VA7 A;  4ZG7 A;  3NKO A;  1XXB A;  4FDJ A;  5L0K A;  4OIO A;  4Y7N C;  3S1Q C;  2NVY C;  3GEI A;  4CXK A;  3AQP A;  4NOI A;  2ANH A;  2IUC B;  4GTW A;  4G7O A;  3OT9 A;  4P5B A;  1O2F B;  4ZG9 A;  3E2D A;  4KM9 A;  4MEX A;  3V4G A;  4A3E K;  3ADA C;  3BP3 A;  1I50 K;  2G9Y A;  4LRA A;  4X6A K;  1WQF A;  1WOP A;  3SZZ A;  2VUM C;  1YCL A;  1KHJ A;  4A3I C;  3GDZ A;  5M3M K;  2RH6 A;  3T00 A;  4BBR K;  2YU9 K;  4GTX A;  1YNJ A;  3WBH A;  1ELZ A;  3BDF A;  1J98 A;  3SZY A;  4BKW A;  3S17 K;  4GTD A;  3GTM A;  3H0G K;  4GTE A;  4FDI A;  1O28 A;  4A3D C;  4KN4 A;  3HOZ C;  1USO A;  5M5X K;  4LK0 A;  3TTG A;  2JH3 A;  1EQJ A;  1EW8 A;  2GAH C;  1KH4 A;  1TWH C;  4NWX A;  4A3C K;  4C3I C;  2NVQ K;  1ED9 A;  3TX0 A;  1WQH A;  1VRQ C;  4GTF A;  1O2B A;  2R7Z A;  5C4J K;  2FQT A;  1N2L A;  4KB2 A;  2R92 K;  3GTG A;  2CW0 A;  1ZBS A;  3LPX A;  5M5W K;  2JA5 K;  5C44 K;  5DLT A;  1EI6 A;  5C66 A;  5LQQ A;  3AD8 C;  1ZEB A;  4BY1 C;  3M8W A;  1E1Z P;  3T02 A;  1WSR A;  1BJT A;  4KMA A;  3TG0 A;  1ZED A;  5LRN A;  3M3Y C;  4QIW L;  1WCM K;  1ZYR A;  3K7A K;  1N2K A;  4A3L K;  4OIN A;  1J6X A;  2V6S A;  3GTO K;  2NVX K;  1RU0 A;  2W5X A;  2W7V A;  4KMD A;  4QIW D;  3S1R C;  3JST A;  4KAT A;  4A3G C;  4C3J C;  1F93 A;  3M7V A;  1JVI A;  2W5R A;  1Y6V A;  3S14 C;  2JA7 A;  3WOD A;  3CAG A;  5IYC K;  4TN0 A;  4A3J K;  3I4M K;  2E2I C;  1EW2 A;  3RZD K;  1E33 P;  3GTJ A;  5IYD C;  1XZQ A;  1ELX A;  4X6A C;  1KHL A;  1I6V A;  4GTB A;  4BLA A;  4UOO A;  2GA3 A;  3M8Y A;  3BDG A;  2VQR A;  5K4P A;  2YU9 C;  3IGZ B;  2GSN A;  1F9N A;  1K83 C;  5IOQ A;  3FOE A;  1Y1W A;  5JVO A;  2A69 A;  3T01 A;  2JA8 C;  3BDH A;  1O29 A;  3H0G C;  3S1M C;  1TWC A;  1KHN A;  1VGX A;  2EBB A;  3G4A A;  4MQ9 A;  4A3F K;  2W8D A;  1TWA C;  2A68 A;  2V6T A;  4C3H K;  2ZUF A;  1SMY A;  2E2H C;  3HOU C;  3GTM K;  3S2H K;  3GTK A;  1O98 A;  2E2J K;  3GTP C;  2XCO A;  1XZP A;  5IJQ A;  4KB4 A;  3NKM A;  1WSV A;  3MML B;  4P5A A;  2ZFZ A;  4YFX A;  1EJJ A;  3IDD A;  4GTL A;  3GTQ A;  4LRD A;  1TWF C;  4GTC A;  1C0A A;  3PO2 K;  5EGE A;  2PPB A;  1O27 A;  3I4N C;  2JA5 C;  4J3N A;  5C4X K;  3UO0 A;  4KN7 A;  5TJ3 A;  4KC6 A;  5L46 A;  2R7Z K;  3DYC A;  3AH5 A;  5IOS A;  5HRT A;  2CFA B;  3GTG K;  3CQZ C;  3PO3 C;  2W5W A;  2NVT C;  5M3F K;  1O99 A;  4N7T A;  2XCR B;  4G0U A;  4JK1 A;  3GTL C;  4BY7 K;  1SFO C;  4CXU A;  4O2D A;  3FKI A;  3N0B A;  3LAJ A;  3AQO A;  5JFE A;  4LRB A;  2GSU A;  2JA6 C;  4UOR A;  5INH A;  3OPF A;  1R9T A;  3LAP A;  5LIA A;  2P8T A;  3GEE A;  4CYR A;  5FLM K;  1IL2 A;  3HOV K;  1Y1V A;  1KHK A;  4C2M C;  2NVY A;  1I3Q C;  2JA7 K;  4Y52 K;  4DDQ A;  3WAW A;  1L0W A;  2XRG A;  3WAX A;  4GTZ A;  4YR1 A;  4LRC A;  1E2S P;  5IP9 C;  1JOE A;  1DCP A;  2GSO A;  1AJD A;  4GZY A;  1O26 A;  4LQY A;  4B56 A;  2VUM A;  1O2A A;  2R93 C;  4A3B K;  4KMH A;  1ZEF A;  1XXC A;  2D1G A;  1Y1W K;  3HOY C;  3NVL A;  1TWG C;  1AJA A;  1B4A A;  2W5Q A;  4OIQ A;  1KH7 A;  1UV7 A;  1TWC K;  3RZO C;  2XCQ A;  3A8I A;  5EGH A;  4LR9 A;  4CYS A;  4LR8 A;  5DLW A;  4BLB A;  2GAG C;  5D4D A;  4AH6 A;  4G0V A;  2D6F C;  5C3E C;  5IP7 C;  3NKR A;  4KMU A;  1TWH A;  5E68 A;  3HOX K;  5CJ9 A;  4A3M C;  2B63 C;  1E3C P;  3GTQ K;  4ZGA A;  1VH2 A;  4A3K K;  5IOR A;  4MEY A;  5HL8 A;  2GLQ A;  4A93 K;  3ED4 A;  4LR2 A;  4ZH4 A;  4G0W A;  4UPI A;  4PAB A;  3MK0 A;  4LK1 A;  3TFI A;  5FJ8 K;  1AJC A;  3WAV A;  3N0C A;  1PJ5 A;  2QZU A;  1I6H K;  3L4J A;  1AJB A;  1ANI A;  3FKI K;  5IOT A;  4BXX K;  4FZB A;  5IYB K;  1R9T K;  4A3E C;  1I50 C;  3HOW K;  1O25 A;  1URA A;  1Y1V K;  3QX3 A;  1Y7A A;  4MY4 A;  1INN A;  4Y7N K;  2NVY K;  4G7H A;  3S1Q K;  4BBR C;  2E2I A;  1XZQ B;  1ED8 A;  1IQ0 A;  2ZKT A;  4LJZ A;  3A8J A;  3S17 C;  1YNN A;  2W5V A;  3BDG B;  4MIV A;  1J6V A;  1FSU A;  3GSI A;  1ISE A;  1HI9 A;  3AD9 C;  3M4O K;  3HXA A;  2O5I A;  4OIR A;  3N3Y A;  1HQA A;  1G51 A;  1K83 A;  4KJG A;  4A3I K;  1ZXO A;  1BGW A;  3H0G A;  1WIH A;  4A3C C;  1KH9 A;  2NVQ C;  1HDH A;  3MK1 A;  1TWA A;  5M5Y K;  1WQG A;  1ZQ1 C;  2E2H A;  5C4J C;  2R92 C;  1PJ7 A;  5DLV A;  3GTP A;  5GRR A;  4A3D K;  2KWA A;  1XZP B;  5C44 C;  3HOZ K;  4XSX A;  1X31 C;  2O5J A;  1VJE A;  2PMZ L;  3OEP A;  3ORE A;  4CXS A;  5IJS A;  1TWF A;  1VLO A;  4G7Z A;  1WOO A;  1TWH K;  4PAA A;  1B8J A;  1URB A;  4C3I K;  3S1N K;  3BP8 C;  3UN2 A;  1WCM C;  2JA5 A;  5L0B A;  3CMR A;  3G4C A;  3K7A C;  2PMZ D;  4A3L C;  3GTO C;  2NVX C;  4LR7 A;  3NKQ A;  4LOW A;  3CQZ A;  3FOF A;  1GE9 A;  1XPP A;  4YFK A;  3GTL A;  1XXA A;  4BY1 K;  1BS2 A;  1SFO A;  2V6U A;  5IYC C;  2JA6 A;  4A3J C;  3I4M C;  2RGR A;  1K7H A;  3M3Y K;  3RZD C;  3GIR A;  4GT9 A;  3S16 K;  2IUC A;  2ZUE A;  1Y1V C;  3MK2 A;  4OIP A;  2IFY A;  3UN3 A;  3GTJ K;  4UPK A;  4LLG A;  4M1X A;  3S1R K;  4A3G K;  3UN5 A;  3UNY A;  4C3J K;  1YX2 A;  1EW9 A;  3Q3Q A;  1IBA A;  1I3Q A;  3S14 K;  1ALK A;  1IS1 A;  2WAQ L;  2E2I K;  4KAW X;  4KAY A;  1SHN A;  1B4B A;  5IYD K;  3NUH A;  4AYB L;  1IW7 A;  4KM8 A;  4A3F C;  3M4O C;  4C3H C;  2R93 A;  4GFQ A;  4GTA A;  3S15 K;  1WOR A;  3GTM C;  2WAQ D;  3S2H C;  4WJ3 M;  2E2J C;  3B5Q A;  1F7U A;  4ZG6 A;  4AYB D;  3TFJ A;  3NKP A;  4WJ4 A;  5GOV A;  3S0X A;  1K83 K;  3GTK K;  4WIL A;  5AJ9 A;  3IGY B;  2XR9 A;  4QAX A;  3DXJ A;  1BDF A;  1IE0 A;  1V5V A;  1TWG A;  2JA8 K;  3PO2 C;  3S1M K;  3GEH A;  5C4X C;  1TWA K;  2R7Z C;  2E2H K;  1O24 A;  4FM9 A;  3HOU K;  3ERE D;  3S2D K;  3GTG C;  2BE5 A;  3GTP K;  1SHQ A;  4UPH A;  1WOS A;  1ALH A;  1KQ4 A; 
#chains in the Genus database with same CATH homology
 1ED8 A;  3UO0 A;  3SZZ A;  5TJ3 A;  2ZKT A;  3DYC A;  1KHJ A;  5HRT A;  4KAV A;  2W5T A;  2W5V A;  3BDG B;  3T00 A;  2RH6 A;  1FSU A;  2W5W A;  4GTX A;  4MIV A;  1O99 A;  1P49 A;  1ELZ A;  4N7T A;  3WBH A;  3KD8 A;  3BDF A;  3SZY A;  4CXU A;  1HQA A;  4LRB A;  5INH A;  4KJG A;  2GSU A;  4UOR A;  1ALJ A;  4FDI A;  1KH9 A;  5LIA A;  1HDH A;  3MK1 A;  4CYR A;  1HJK A;  1EQJ A;  4LRE A;  1EW8 A;  1KHK A;  1KH4 A;  5DLV A;  5GRR A;  4NWX A;  3M8Z A;  1ED9 A;  3TX0 A;  3WAW A;  3NKN A;  2W5S A;  2XRG A;  3WAX A;  4GTZ A;  5IJS A;  4YR1 A;  4LRC A;  4CXS A;  1E2S P;  1N2L A;  2GSO A;  1AJD A;  1B8J A;  1URB A;  4LQY A;  5LQQ A;  5DLT A;  1EI6 A;  3UN2 A;  3A52 A;  4B56 A;  5C66 A;  1ZEB A;  5L0B A;  3CMR A;  3M8W A;  1E1Z P;  3T02 A;  4LR7 A;  3NKQ A;  3TG0 A;  1ZED A;  5LRN A;  1ZEF A;  1ELY A;  4KM4 A;  1N2K A;  3LXQ A;  3WAY A;  2D1G A;  3NVL A;  1AJA A;  1ANJ A;  2W5X A;  2W5Q A;  4GTY A;  1KH5 A;  1KH7 A;  1K7H A;  4NWJ A;  3TWZ A;  4LRF A;  1ALI A;  5EGH A;  4LR9 A;  3M7V A;  4CYS A;  4LR8 A;  2W5R A;  5DLW A;  1Y6V A;  2IUC A;  4UPL A;  4UOP A;  4TN0 A;  3MK2 A;  2IFY A;  3UN3 A;  1EW2 A;  4UPK A;  1E33 P;  3NKR A;  3UN5 A;  3UNY A;  5LRM A;  1ELX A;  1EW9 A;  1KHL A;  3Q3Q A;  5KXA A;  1ALK A;  1E3C P;  4UOO A;  4ZGA A;  2GA3 A;  3M8Y A;  3BDG A;  2GLQ A;  4KAY A;  2VQR A;  1AUK A;  1SHN A;  5K4P A;  3ED4 A;  3IGZ B;  2GSN A;  4LR2 A;  4UPI A;  3MK0 A;  5L0E A;  4MHX A;  2W8S A;  1AJC A;  3T01 A;  2X98 A;  3BDH A;  3WAV A;  3B5Q A;  2QZU A;  1KHN A;  4KJD A;  4ZG6 A;  3DPC A;  3NKP A;  2W8D A;  4ZG7 A;  1AJB A;  5GOV A;  1ANI A;  3NKO A;  5AJ9 A;  3IGY B;  2XR9 A;  4FDJ A;  4QAX A;  1O98 A;  5L0K A;  4CXK A;  5IJQ A;  1URA A;  3NKM A;  2ANH A;  2IUC B;  4GTW A;  3OT9 A;  1EJJ A;  3IDD A;  4ZG9 A;  4LRD A;  3E2D A;  1Y7A A;  4MY4 A;  1SHQ A;  5EGE A;  4UPH A;  2G9Y A;  4LRA A;  1ALH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...