4KJGA

Structure of rat intestinal alkaline phosphatase expressed in insect cell
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
Knots found
sequence length
486
structure length
486
Chain Sequence
VIPVEEENPVFWNQKAKEALDVAKKLQPIQTSAKNLILFLGDGMGVPTVTATRILKGQLGGHLGPETPLAMDHFPFTALSKTYNVDRQVPDSAGTATAYLCGVKANYKTIGVSAAARFNQCNSTFGNEVFSVMHRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRDWYSDADMPSSALQEGCKDIATQLISNMDIDVILGGGRKFMFPKGTPDPEYPGDSDQSGVRLDSRNLVEEWLAKYQGTRYVWNREQLMQASQDPAVTRLMGLFEPTEMKYDVNRNASADPSLAEMTEVAVRLLSRNPQGFYLFVEGGRIDQGHHAGTAYLALTEAVMFDSAIEKASQLTNEKDTLTLITADHSHVFAFGGYTLRGTSIFGLAPLNAQDGKSYTSILYGNGPGYVLNSGNRPNVTDAESGDVNYKQQAAVPLSSETHGGEDVAIFARGPQAHLVHGVQEQNYIAHVMAFAGCLEPYTDCGLAPPADEHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Intestinal-type alkaline phosphatase 1
publication title Crystal structure of rat intestinal alkaline phosphatase - Role of crown domain in mammalian alkaline phosphatases.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 174
structure length 486
sequence length 486
chains with identical sequence B
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.1.3.1: Alkaline phosphatase.
pdb deposition date 2013-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00245 Alk_phosphatase Alkaline phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4kjgA00
3WAWA 3DYCA 3KD8A 1ANJA 4KAVA 3E2DA 4LR2A 3Q3QA 1AJCA 1ELYA 3OT9A 5AJ9A 4LRBA 1ZEBA 3B5QA 2XRGA 3NVLA 1ANIA 3CMRA 2W5RA 4CYRA 1O98A 3NKOA 4FDIA 3BDFA 1URAA 1ZEDA 3IDDA 3WBHA 1EJJA 4ZG7A 4FDJA 3BDGA 5DLTA 3UNYA 5DLWA 2QZUA 1SHQA 4GTZA 2W8DA 4GTWA 1KHLA 4TN0A 1AJAA 4LR9A 1ED9A 1EI6A 2D1GA 3UN3A 4UPIA 4N7TA 4CXKA 5HRTA 2VQRA 2XR9A 1O99A 4LR7A 4UPKA 4NWXA 4UOPA 1ZEFA 1ALHA 2X98A 1ALKA 3NKQA 3IGZB 4LRAA 1SHNA 3WAYA 1N2LA 3TG0A 4KAYA 3TX0A 3UN5A 3SZZA 4UOOA 1E3CP 1EW2A 1AJDA 3NKPA 5GOVA 4CXUA 1K7HA 1HDHA 1E2SP 4QAXA 5LIAA 2W5VA 3M8WA 3NKNA 1P49A 1ALJA 3A52A 4GTYA 1N2KA 3WAXA 1ALIA 3ED4A 4LREA 3T01A 5L0KA 1E33P 3BDHA 4MY4A 4ZG6A 1AJBA 2GA3A 2IUCB 3DPCA 2GSNA 1EQJA 1KH9A 1FSUA 3NKMA 2GSOA 3M8YA 1URBA 3MK2A 4MIVA 5IJSA 2W5XA 4UORA 1EW8A 5IJQA 2W8SA 2W5QA 2G9YA 3UN2A 4KM4A 5L0BA 3TWZA 2GSUA 3IGYB 4NWJA 5LRNA 1HQAA 3T00A 4CXSA 4ZG9A 1B8JA 3T02A 5LQQA 5GRRA 4YR1A 1AUKA 1ELXA 1Y6VA 4GTXA 4LRFA 4KJDA 2GLQA 1KH7A 3LXQA 4LRDA 3SZYA 3MK1A 1KH5A 5TJ3A 1HJKA 2ZKTA 5LRMA 1KHNA 1KHJA 5DLVA 5EGEA 3M7VA 5KXAA 1ED8A 2IUCA 5EGHA 3WAVA 4CYSA 4LRCA 4UPHA 1E1ZP 2IFYA 3M8ZA 3MK0A 2W5WA 4LR8A 4UPLA 2ANHA 3BDGB 4LQYA 4MHXA 4KJGA 1KH4A 1Y7AA 2W5TA 5C66A 2W5SA 4B56A 2RH6A 5K4PA 1ELZA 4ZGAA 1KHKA 5L0EA 5INHA 1EW9A 3UO0A 3NKRA
chains in the Genus database with same CATH superfamily
3WAWA 3DYCA 3KD8A 1ANJA 4KAVA 3E2DA 4LR2A 3Q3QA 1AJCA 1ELYA 3OT9A 5AJ9A 4LRBA 1ZEBA 3B5QA 2XRGA 3NVLA 1ANIA 3CMRA 2W5RA 4CYRA 1O98A 3NKOA 4FDIA 3BDFA 1URAA 1ZEDA 3IDDA 3WBHA 1EJJA 4ZG7A 4FDJA 3BDGA 5DLTA 3UNYA 5DLWA 2QZUA 1SHQA 4GTZA 2W8DA 4GTWA 1KHLA 4TN0A 1AJAA 4LR9A 1ED9A 1EI6A 2D1GA 3UN3A 4UPIA 4N7TA 4CXKA 5HRTA 2VQRA 2XR9A 1O99A 4LR7A 4UPKA 4NWXA 4UOPA 1ZEFA 1ALHA 2X98A 1ALKA 3NKQA 3IGZB 4LRAA 1SHNA 3WAYA 1N2LA 3TG0A 4KAYA 3TX0A 3UN5A 3SZZA 4UOOA 1E3CP 1EW2A 1AJDA 3NKPA 5GOVA 4CXUA 1K7HA 1HDHA 1E2SP 4QAXA 5LIAA 2W5VA 3M8WA 3NKNA 1P49A 1ALJA 3A52A 4GTYA 1N2KA 3WAXA 1ALIA 3ED4A 4LREA 3T01A 5L0KA 1E33P 3BDHA 4MY4A 4ZG6A 1AJBA 2GA3A 2IUCB 3DPCA 2GSNA 1EQJA 1KH9A 1FSUA 3NKMA 2GSOA 3M8YA 1URBA 3MK2A 4MIVA 5IJSA 2W5XA 4UORA 1EW8A 5IJQA 2W8SA 2W5QA 2G9YA 3UN2A 4KM4A 5L0BA 3TWZA 2GSUA 3IGYB 4NWJA 5LRNA 1HQAA 3T00A 4CXSA 4ZG9A 1B8JA 3T02A 5LQQA 5GRRA 4YR1A 1AUKA 1ELXA 1Y6VA 4GTXA 4LRFA 4KJDA 2GLQA 1KH7A 3LXQA 4LRDA 3SZYA 3MK1A 1KH5A 5TJ3A 1HJKA 2ZKTA 5LRMA 1KHNA 1KHJA 5DLVA 5EGEA 3M7VA 5KXAA 1ED8A 2IUCA 5EGHA 3WAVA 4CYSA 4LRCA 4UPHA 1E1ZP 2IFYA 3M8ZA 3MK0A 2W5WA 4LR8A 4UPLA 2ANHA 3BDGB 4LQYA 4MHXA 4KJGA 1KH4A 1Y7AA 2W5TA 5C66A 2W5SA 4B56A 2RH6A 5K4PA 1ELZA 4ZGAA 1KHKA 5L0EA 5INHA 1EW9A 3UO0A 3NKRA
chains in the Genus database with same CATH topology
3WAWA 3DYCA 3KD8A 1ANJA 4KAVA 3E2DA 4LR2A 3Q3QA 1AJCA 1ELYA 3OT9A 5AJ9A 4LRBA 1ZEBA 3B5QA 2XRGA 3NVLA 1ANIA 3CMRA 2W5RA 4CYRA 1O98A 3NKOA 4FDIA 3BDFA 1URAA 1ZEDA 3IDDA 3WBHA 1EJJA 4ZG7A 4FDJA 3BDGA 5DLTA 3UNYA 5DLWA 2QZUA 1SHQA 4GTZA 2W8DA 4GTWA 1KHLA 4TN0A 1AJAA 4LR9A 1ED9A 1EI6A 2D1GA 3UN3A 4UPIA 4N7TA 4CXKA 5HRTA 2VQRA 2XR9A 1O99A 4LR7A 4UPKA 4NWXA 4UOPA 1ZEFA 1ALHA 2X98A 1ALKA 3NKQA 3IGZB 4LRAA 1SHNA 3WAYA 1N2LA 3TG0A 4KAYA 3TX0A 3UN5A 3SZZA 4UOOA 1E3CP 1EW2A 1AJDA 3NKPA 5GOVA 4CXUA 1K7HA 1HDHA 1E2SP 4QAXA 5LIAA 2W5VA 3M8WA 3NKNA 1P49A 1ALJA 3A52A 4GTYA 1N2KA 3WAXA 1ALIA 3ED4A 4LREA 3T01A 5L0KA 1E33P 3BDHA 4MY4A 4ZG6A 1AJBA 2GA3A 2IUCB 3DPCA 2GSNA 1EQJA 1KH9A 1FSUA 3NKMA 2GSOA 3M8YA 1URBA 3MK2A 4MIVA 5IJSA 2W5XA 4UORA 1EW8A 5IJQA 2W8SA 2W5QA 2G9YA 3UN2A 4KM4A 5L0BA 3TWZA 2GSUA 3IGYB 4NWJA 5LRNA 1HQAA 3T00A 4CXSA 4ZG9A 1B8JA 3T02A 5LQQA 5GRRA 4YR1A 1AUKA 1ELXA 1Y6VA 4GTXA 4LRFA 4KJDA 2GLQA 1KH7A 3LXQA 4LRDA 3SZYA 3MK1A 1KH5A 5TJ3A 1HJKA 2ZKTA 5LRMA 1KHNA 1KHJA 5DLVA 5EGEA 3M7VA 5KXAA 1ED8A 2IUCA 5EGHA 3WAVA 4CYSA 4LRCA 4UPHA 1E1ZP 2IFYA 3M8ZA 3MK0A 2W5WA 4LR8A 4UPLA 2ANHA 3BDGB 4LQYA 4MHXA 4KJGA 1KH4A 1Y7AA 2W5TA 5C66A 2W5SA 4B56A 2RH6A 5K4PA 1ELZA 4ZGAA 1KHKA 5L0EA 5INHA 1EW9A 3UO0A 3NKRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WAW A;  3DYC A;  3KD8 A;  1ANJ A;  4KAV A;  3E2D A;  4LR2 A;  3Q3Q A;  1AJC A;  1ELY A;  3OT9 A;  5AJ9 A;  4LRB A;  1ZEB A;  3B5Q A;  2XRG A;  3NVL A;  1ANI A;  3CMR A;  2W5R A;  4CYR A;  1O98 A;  3NKO A;  4FDI A;  3BDF A;  1URA A;  1ZED A;  3IDD A;  3WBH A;  1EJJ A;  4ZG7 A;  4FDJ A;  3BDG A;  5DLT A;  3UNY A;  5DLW A;  2QZU A;  1SHQ A;  4GTZ A;  2W8D A;  4GTW A;  1KHL A;  4TN0 A;  1AJA A;  4LR9 A;  1ED9 A;  1EI6 A;  2D1G A;  3UN3 A;  4UPI A;  4N7T A;  4CXK A;  5HRT A;  2VQR A;  2XR9 A;  1O99 A;  4LR7 A;  4UPK A;  4NWX A;  4UOP A;  1ZEF A;  1ALH A;  2X98 A;  1ALK A;  3NKQ A;  3IGZ B;  4LRA A;  1SHN A;  3WAY A;  1N2L A;  3TG0 A;  4KAY A;  3TX0 A;  3UN5 A;  3SZZ A;  4UOO A;  1E3C P;  1EW2 A;  1AJD A;  3NKP A;  5GOV A;  4CXU A;  1K7H A;  1HDH A;  1E2S P;  4QAX A;  5LIA A;  2W5V A;  3M8W A;  3NKN A;  1P49 A;  1ALJ A;  3A52 A;  4GTY A;  1N2K A;  3WAX A;  1ALI A;  3ED4 A;  4LRE A;  3T01 A;  5L0K A;  1E33 P;  3BDH A;  4MY4 A;  4ZG6 A;  1AJB A;  2GA3 A;  2IUC B;  3DPC A;  2GSN A;  1EQJ A;  1KH9 A;  1FSU A;  3NKM A;  2GSO A;  3M8Y A;  1URB A;  3MK2 A;  4MIV A;  5IJS A;  2W5X A;  4UOR A;  1EW8 A;  5IJQ A;  2W8S A;  2W5Q A;  2G9Y A;  3UN2 A;  4KM4 A;  5L0B A;  3TWZ A;  2GSU A;  3IGY B;  4NWJ A;  5LRN A;  1HQA A;  3T00 A;  4CXS A;  4ZG9 A;  1B8J A;  3T02 A;  5LQQ A;  5GRR A;  4YR1 A;  1AUK A;  1ELX A;  1Y6V A;  4GTX A;  4LRF A;  4KJD A;  2GLQ A;  1KH7 A;  3LXQ A;  4LRD A;  3SZY A;  3MK1 A;  1KH5 A;  5TJ3 A;  1HJK A;  2ZKT A;  5LRM A;  1KHN A;  1KHJ A;  5DLV A;  5EGE A;  3M7V A;  5KXA A;  1ED8 A;  2IUC A;  5EGH A;  3WAV A;  4CYS A;  4LRC A;  4UPH A;  1E1Z P;  2IFY A;  3M8Z A;  3MK0 A;  2W5W A;  4LR8 A;  4UPL A;  2ANH A;  3BDG B;  4LQY A;  4MHX A;  4KJG A;  1KH4 A;  1Y7A A;  2W5T A;  5C66 A;  2W5S A;  4B56 A;  2RH6 A;  5K4P A;  1ELZ A;  4ZGA A;  1KHK A;  5L0E A;  5INH A;  1EW9 A;  3UO0 A;  3NKR A; 
#chains in the Genus database with same CATH topology
 3WAW A;  3DYC A;  3KD8 A;  1ANJ A;  4KAV A;  3E2D A;  4LR2 A;  3Q3Q A;  1AJC A;  1ELY A;  3OT9 A;  5AJ9 A;  4LRB A;  1ZEB A;  3B5Q A;  2XRG A;  3NVL A;  1ANI A;  3CMR A;  2W5R A;  4CYR A;  1O98 A;  3NKO A;  4FDI A;  3BDF A;  1URA A;  1ZED A;  3IDD A;  3WBH A;  1EJJ A;  4ZG7 A;  4FDJ A;  3BDG A;  5DLT A;  3UNY A;  5DLW A;  2QZU A;  1SHQ A;  4GTZ A;  2W8D A;  4GTW A;  1KHL A;  4TN0 A;  1AJA A;  4LR9 A;  1ED9 A;  1EI6 A;  2D1G A;  3UN3 A;  4UPI A;  4N7T A;  4CXK A;  5HRT A;  2VQR A;  2XR9 A;  1O99 A;  4LR7 A;  4UPK A;  4NWX A;  4UOP A;  1ZEF A;  1ALH A;  2X98 A;  1ALK A;  3NKQ A;  3IGZ B;  4LRA A;  1SHN A;  3WAY A;  1N2L A;  3TG0 A;  4KAY A;  3TX0 A;  3UN5 A;  3SZZ A;  4UOO A;  1E3C P;  1EW2 A;  1AJD A;  3NKP A;  5GOV A;  4CXU A;  1K7H A;  1HDH A;  1E2S P;  4QAX A;  5LIA A;  2W5V A;  3M8W A;  3NKN A;  1P49 A;  1ALJ A;  3A52 A;  4GTY A;  1N2K A;  3WAX A;  1ALI A;  3ED4 A;  4LRE A;  3T01 A;  5L0K A;  1E33 P;  3BDH A;  4MY4 A;  4ZG6 A;  1AJB A;  2GA3 A;  2IUC B;  3DPC A;  2GSN A;  1EQJ A;  1KH9 A;  1FSU A;  3NKM A;  2GSO A;  3M8Y A;  1URB A;  3MK2 A;  4MIV A;  5IJS A;  2W5X A;  4UOR A;  1EW8 A;  5IJQ A;  2W8S A;  2W5Q A;  2G9Y A;  3UN2 A;  4KM4 A;  5L0B A;  3TWZ A;  2GSU A;  3IGY B;  4NWJ A;  5LRN A;  1HQA A;  3T00 A;  4CXS A;  4ZG9 A;  1B8J A;  3T02 A;  5LQQ A;  5GRR A;  4YR1 A;  1AUK A;  1ELX A;  1Y6V A;  4GTX A;  4LRF A;  4KJD A;  2GLQ A;  1KH7 A;  3LXQ A;  4LRD A;  3SZY A;  3MK1 A;  1KH5 A;  5TJ3 A;  1HJK A;  2ZKT A;  5LRM A;  1KHN A;  1KHJ A;  5DLV A;  5EGE A;  3M7V A;  5KXA A;  1ED8 A;  2IUC A;  5EGH A;  3WAV A;  4CYS A;  4LRC A;  4UPH A;  1E1Z P;  2IFY A;  3M8Z A;  3MK0 A;  2W5W A;  4LR8 A;  4UPL A;  2ANH A;  3BDG B;  4LQY A;  4MHX A;  4KJG A;  1KH4 A;  1Y7A A;  2W5T A;  5C66 A;  2W5S A;  4B56 A;  2RH6 A;  5K4P A;  1ELZ A;  4ZGA A;  1KHK A;  5L0E A;  5INH A;  1EW9 A;  3UO0 A;  3NKR A; 
#chains in the Genus database with same CATH homology
 3WAW A;  3DYC A;  3KD8 A;  1ANJ A;  4KAV A;  3E2D A;  4LR2 A;  3Q3Q A;  1AJC A;  1ELY A;  3OT9 A;  5AJ9 A;  4LRB A;  1ZEB A;  3B5Q A;  2XRG A;  3NVL A;  1ANI A;  3CMR A;  2W5R A;  4CYR A;  1O98 A;  3NKO A;  4FDI A;  3BDF A;  1URA A;  1ZED A;  3IDD A;  3WBH A;  1EJJ A;  4ZG7 A;  4FDJ A;  3BDG A;  5DLT A;  3UNY A;  5DLW A;  2QZU A;  1SHQ A;  4GTZ A;  2W8D A;  4GTW A;  1KHL A;  4TN0 A;  1AJA A;  4LR9 A;  1ED9 A;  1EI6 A;  2D1G A;  3UN3 A;  4UPI A;  4N7T A;  4CXK A;  5HRT A;  2VQR A;  2XR9 A;  1O99 A;  4LR7 A;  4UPK A;  4NWX A;  4UOP A;  1ZEF A;  1ALH A;  2X98 A;  1ALK A;  3NKQ A;  3IGZ B;  4LRA A;  1SHN A;  3WAY A;  1N2L A;  3TG0 A;  4KAY A;  3TX0 A;  3UN5 A;  3SZZ A;  4UOO A;  1E3C P;  1EW2 A;  1AJD A;  3NKP A;  5GOV A;  4CXU A;  1K7H A;  1HDH A;  1E2S P;  4QAX A;  5LIA A;  2W5V A;  3M8W A;  3NKN A;  1P49 A;  1ALJ A;  3A52 A;  4GTY A;  1N2K A;  3WAX A;  1ALI A;  3ED4 A;  4LRE A;  3T01 A;  5L0K A;  1E33 P;  3BDH A;  4MY4 A;  4ZG6 A;  1AJB A;  2GA3 A;  2IUC B;  3DPC A;  2GSN A;  1EQJ A;  1KH9 A;  1FSU A;  3NKM A;  2GSO A;  3M8Y A;  1URB A;  3MK2 A;  4MIV A;  5IJS A;  2W5X A;  4UOR A;  1EW8 A;  5IJQ A;  2W8S A;  2W5Q A;  2G9Y A;  3UN2 A;  4KM4 A;  5L0B A;  3TWZ A;  2GSU A;  3IGY B;  4NWJ A;  5LRN A;  1HQA A;  3T00 A;  4CXS A;  4ZG9 A;  1B8J A;  3T02 A;  5LQQ A;  5GRR A;  4YR1 A;  1AUK A;  1ELX A;  1Y6V A;  4GTX A;  4LRF A;  4KJD A;  2GLQ A;  1KH7 A;  3LXQ A;  4LRD A;  3SZY A;  3MK1 A;  1KH5 A;  5TJ3 A;  1HJK A;  2ZKT A;  5LRM A;  1KHN A;  1KHJ A;  5DLV A;  5EGE A;  3M7V A;  5KXA A;  1ED8 A;  2IUC A;  5EGH A;  3WAV A;  4CYS A;  4LRC A;  4UPH A;  1E1Z P;  2IFY A;  3M8Z A;  3MK0 A;  2W5W A;  4LR8 A;  4UPL A;  2ANH A;  3BDG B;  4LQY A;  4MHX A;  4KJG A;  1KH4 A;  1Y7A A;  2W5T A;  5C66 A;  2W5S A;  4B56 A;  2RH6 A;  5K4P A;  1ELZ A;  4ZGA A;  1KHK A;  5L0E A;  5INH A;  1EW9 A;  3UO0 A;  3NKR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...