1VI4A

Crystal structure of regulator of ribonuclease activity a protein 1
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
162
structure length
162
Chain Sequence
b'MRDITPDLCDKYESQVTLLNLPLQNFGQRSAFWGEIVTVRCYHDNSKVRDVLSQNGKGKVLVVDGHGSCHKALMGDQLAILAIKNDWEGVIIYGAVRDVVAMSEMDLGIKALGTSPFKTEKRGAGQVNVTLTMQNQIVEPGDYLYADWNGILMSETALDVAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulator of ribonuclease activity A protein 1
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Structural genomics, unknown function
total genus 45
structure length 162
sequence length 162
ec nomenclature ec 4.1.1.112: Oxaloacetate decarboxylase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03737 RraA-like Aldolase/RraA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.40 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Ribonuclease E inhibitor RraA/RraA-like 1vi4A00
3NOJA 1Q5XA 1NXJA 2PCNA 1VI4A 1J3LA 3K4IA 2YJVA 3C8OA 2YJTA
chains in the Genus database with same CATH superfamily
1XF1A 2HWGA 4P4FA 5FD8A 1GGOA 1ZL0A 4CDJA 3T0TA 1KC7A 4NGSA 2XEIA 4X3RA 4C8UA 3FEDA 4MJXA 2OLSA 4P4JA 3TYXA 1J3LA 2OOTA 4E5SA 4CO9A 4OC3A 2C5QA 2OR4A 5IB9A 3BI1A 3TLGA 3BXMA 3S9MA 1C3OB 2JBKA 4C85A 1Q5XA 3SR3A 3T07A 2DIKA 1JDBC 4M8DA 3TLAA 4C9UA 2EZBA 2R82A 4C9RA 3S9NA 4C84A 1Y9ZA 4C8FA 3FECA 3I6SA 4C9AA 2EZCA 1R61A 1VBHA 4E94A 4OC4A 3TLGB 3TLEA 4NGTA 1VI4A 3EZBA 4P45A 4MCPA 1Z8LA 2YJTA 4NGPA 3U1BA 3TLZA 3NOJA 4MCRA 1ZRSA 2C6PA 2XEFA 4OC5A 4TJXA 5F09A 4MI1A 3D7GA 1KEEB 3K9TA 1VBGA 2EZAA 4C9EA 2HI6A 3S9LA 3BI0A 4OC2A 4P4IA 3VTAA 4C9VA 4YN3A 4C8PA 3GJZA 4NGNA 4P44A 2CIJA 2XEJA 2JBJA 2E28A 4NGMA 1EZBA 3K4IA 1JDEA 2AUNA 4P4DA 3SJEA 2C6GA 1ZYMA 3IIBA 4CZ1A 1NBWA 1BXRB 2PVWA 2PCNA 5ELYA 4OC0A 4IIXA 2EK9A 4C99A 5JYBA 3SJFA 3D7HA 2YJVA 2XEGA 3TLCA 4OC1A 4P4BA 4JVOA 3ICUA 1NXJA 3KRVA 3TLBA 2AUMA 2HROA 4CDKA 2FM4A 3BHXA 4LQGA 4C8CA 5F5XA 1CE8B 3D7DA 4W9YA 4EYSA 3TLYA 2D0PA 1A9XB 2GP4A 4J0NA 5JVLA 4COBA 4NGRA 3RBUA 3FEEA 3G23A 2D0OA 5F9MA 5IR2A 1T36B 3IWWA 4TJVA 5K99A 1EZAA 1DIKA 3I74A 3SJXA 2C6CA 4OMEA 1DE4C 4MCQA 4INJA 1CX8A 4H1HA 4NGQA 5D29A 3C8OA 3FF3A 3SJGA 3KASA 4C8TA 3T05A 2PVVA 3EIFA 4COGA 4C8AA 4JYWA 1KBLA 3EZAA 4C86A 1WVMA 3EZEA 3T5MA 2EK8A 4TWEA 3D7FA 1CS0B 4MCSA 2X0SA 4P4EA 5F1YA 1C30B 1M6VB 4IIYA 4KNGE 1V6CA 4JZ0A 2MP0A 2B0AA
chains in the Genus database with same CATH topology
3NOJA 1Q5XA 1NXJA 2PCNA 1VI4A 1J3LA 3K4IA 2YJVA 3C8OA 2YJTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NOJ A;  1Q5X A;  1NXJ A;  2PCN A;  1VI4 A;  1J3L A;  3K4I A;  2YJV A;  3C8O A;  2YJT A; 
#chains in the Genus database with same CATH topology
 1XF1 A;  2HWG A;  4P4F A;  5FD8 A;  1GGO A;  1ZL0 A;  4CDJ A;  3T0T A;  1KC7 A;  4NGS A;  2XEI A;  4X3R A;  4C8U A;  3FED A;  4MJX A;  2OLS A;  4P4J A;  3TYX A;  1J3L A;  2OOT A;  4E5S A;  4CO9 A;  4OC3 A;  2C5Q A;  2OR4 A;  5IB9 A;  3BI1 A;  3TLG A;  3BXM A;  3S9M A;  1C3O B;  2JBK A;  4C85 A;  1Q5X A;  3SR3 A;  3T07 A;  2DIK A;  1JDB C;  4M8D A;  3TLA A;  4C9U A;  2EZB A;  2R82 A;  4C9R A;  3S9N A;  4C84 A;  1Y9Z A;  4C8F A;  3FEC A;  3I6S A;  4C9A A;  2EZC A;  1R61 A;  1VBH A;  4E94 A;  4OC4 A;  3TLG B;  3TLE A;  4NGT A;  1VI4 A;  3EZB A;  4P45 A;  4MCP A;  1Z8L A;  2YJT A;  4NGP A;  3U1B A;  3TLZ A;  3NOJ A;  4MCR A;  1ZRS A;  2C6P A;  2XEF A;  4OC5 A;  4TJX A;  5F09 A;  4MI1 A;  3D7G A;  1KEE B;  3K9T A;  1VBG A;  2EZA A;  4C9E A;  2HI6 A;  3S9L A;  3BI0 A;  4OC2 A;  4P4I A;  3VTA A;  4C9V A;  4YN3 A;  4C8P A;  3GJZ A;  4NGN A;  4P44 A;  2CIJ A;  2XEJ A;  2JBJ A;  2E28 A;  4NGM A;  1EZB A;  3K4I A;  1JDE A;  2AUN A;  4P4D A;  3SJE A;  2C6G A;  1ZYM A;  3IIB A;  4CZ1 A;  1NBW A;  1BXR B;  2PVW A;  2PCN A;  5ELY A;  4OC0 A;  4IIX A;  2EK9 A;  4C99 A;  5JYB A;  3SJF A;  3D7H A;  2YJV A;  2XEG A;  3TLC A;  4OC1 A;  4P4B A;  4JVO A;  3ICU A;  1NXJ A;  3KRV A;  3TLB A;  2AUM A;  2HRO A;  4CDK A;  2FM4 A;  3BHX A;  4LQG A;  4C8C A;  5F5X A;  1CE8 B;  3D7D A;  4W9Y A;  4EYS A;  3TLY A;  2D0P A;  1A9X B;  2GP4 A;  4J0N A;  5JVL A;  4COB A;  4NGR A;  3RBU A;  3FEE A;  3G23 A;  2D0O A;  5F9M A;  5IR2 A;  1T36 B;  3IWW A;  4TJV A;  5K99 A;  1EZA A;  1DIK A;  3I74 A;  3SJX A;  2C6C A;  4OME A;  1DE4 C;  4MCQ A;  4INJ A;  1CX8 A;  4H1H A;  4NGQ A;  5D29 A;  3C8O A;  3FF3 A;  3SJG A;  3KAS A;  4C8T A;  3T05 A;  2PVV A;  3EIF A;  4COG A;  4C8A A;  4JYW A;  1KBL A;  3EZA A;  4C86 A;  1WVM A;  3EZE A;  3T5M A;  2EK8 A;  4TWE A;  3D7F A;  1CS0 B;  4MCS A;  2X0S A;  4P4E A;  5F1Y A;  1C30 B;  1M6V B;  4IIY A;  4KNG E;  1V6C A;  4JZ0 A;  2MP0 A;  2B0A A; 
#chains in the Genus database with same CATH homology
 3NOJ A;  1Q5X A;  1NXJ A;  2PCN A;  1VI4 A;  1J3L A;  3K4I A;  2YJV A;  3C8O A;  2YJT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...