1VI4A

Crystal structure of regulator of ribonuclease activity a protein 1
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
162
structure length
162
Chain Sequence
MRDITPDLCDKYESQVTLLNLPLQNFGQRSAFWGEIVTVRCYHDNSKVRDVLSQNGKGKVLVVDGHGSCHKALMGDQLAILAIKNDWEGVIIYGAVRDVVAMSEMDLGIKALGTSPFKTEKRGAGQVNVTLTMQNQIVEPGDYLYADWNGILMSETALDVAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Regulator of ribonuclease activity A protein 1
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Vibrio cholerae
total genus 45
structure length 162
sequence length 162
ec nomenclature ec 4.1.1.112: Oxaloacetate decarboxylase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03737 RraA-like Aldolase/RraA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.40 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Ribonuclease E inhibitor RraA/RraA-like 1vi4A00
1VI4A 1NXJA 3K4IA 1Q5XA 3C8OA 3NOJA 2PCNA 1J3LA 2YJTA 2YJVA
chains in the Genus database with same CATH superfamily
1VBGA 4NGQA 2EZCA 4CO9A 4P4DA 4OC5A 4OC3A 1KEEB 1CS0B 4C9UA 2HROA 4C8UA 4J0NA 3U1BA 4NGMA 4MJXA 4C9VA 4JVOA 5JVLA 1T36B 5F5XA 3S9LA 3SJFA 1NBWA 2MP0A 2XEJA 4P45A 3RBUA 1DIKA 3T07A 1NXJA 2HI6A 3I6SA 4NGTA 4P4IA 5IB9A 1Y9ZA 3ICUA 2D0PA 4H1HA 4COGA 5JYBA 3K9TA 4IIYA 4OC2A 1EZAA 4NGRA 4P4JA 2PVWA 2XEFA 1JDBC 1V6CA 3KRVA 4JYWA 4INJA 3D7DA 3TLGB 2D0OA 2X0SA 4C84A 4CZ1A 3EZEA 3I74A 4NGPA 4NGNA 3T5MA 3TLBA 4C85A 5F1YA 4IIXA 2EK9A 2OOTA 4C8CA 4C86A 4TJXA 2GP4A 2OR4A 4MI1A 5K99A 3TLZA 2XEGA 3D7GA 4OC0A 3G23A 4COBA 5ELYA 2PVVA 4X3RA 4C8AA 3FEEA 3BI1A 3BI0A 4C8TA 2C6GA 3D7HA 2JBKA 1BXRB 3C8OA 5F9MA 2EZBA 1ZYMA 4C99A 1J3LA 2C6PA 3FEDA 4MCSA 2XEIA 4OC4A 1DE4C 2R82A 2B0AA 2E28A 3SJGA 1VI4A 3TLGA 2C5QA 3BHXA 4EYSA 1ZRSA 2EZAA 2C6CA 1XF1A 3EZBA 3SJEA 1Z8LA 3S9MA 2OLSA 3D7FA 2HWGA 4P44A 4OMEA 4MCQA 1JDEA 3K4IA 3SJXA 1GGOA 1Q5XA 4KNGE 3TLCA 4C9EA 1EZBA 3IWWA 1A9XB 3BXMA 3FF3A 4MCRA 4JZ0A 5D29A 2DIKA 4C8PA 2FM4A 4TWEA 4P4BA 4CDKA 1WVMA 2YJTA 4C9RA 3TLYA 4LQGA 4MCPA 5F09A 1C30B 3EZAA 1CX8A 5IR2A 4OC1A 3NOJA 3IIBA 3FECA 2EK8A 4P4FA 1CE8B 2JBJA 4W9YA 3GJZA 5FD8A 3SR3A 3VTAA 4M8DA 2PCNA 1KC7A 3S9NA 3EIFA 4C9AA 3T05A 1R61A 1M6VB 4E5SA 1KBLA 2AUMA 3TLAA 4CDJA 1VBHA 3TLEA 4C8FA 4E94A 4TJVA 4YN3A 3KASA 2AUNA 3T0TA 4P4EA 1ZL0A 2CIJA 4NGSA 3TYXA 1C3OB 2YJVA
chains in the Genus database with same CATH topology
1VI4A 1NXJA 3K4IA 1Q5XA 3C8OA 3NOJA 2PCNA 1J3LA 2YJTA 2YJVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VI4 A;  1NXJ A;  3K4I A;  1Q5X A;  3C8O A;  3NOJ A;  2PCN A;  1J3L A;  2YJT A;  2YJV A; 
#chains in the Genus database with same CATH topology
 1VBG A;  4NGQ A;  2EZC A;  4CO9 A;  4P4D A;  4OC5 A;  4OC3 A;  1KEE B;  1CS0 B;  4C9U A;  2HRO A;  4C8U A;  4J0N A;  3U1B A;  4NGM A;  4MJX A;  4C9V A;  4JVO A;  5JVL A;  1T36 B;  5F5X A;  3S9L A;  3SJF A;  1NBW A;  2MP0 A;  2XEJ A;  4P45 A;  3RBU A;  1DIK A;  3T07 A;  1NXJ A;  2HI6 A;  3I6S A;  4NGT A;  4P4I A;  5IB9 A;  1Y9Z A;  3ICU A;  2D0P A;  4H1H A;  4COG A;  5JYB A;  3K9T A;  4IIY A;  4OC2 A;  1EZA A;  4NGR A;  4P4J A;  2PVW A;  2XEF A;  1JDB C;  1V6C A;  3KRV A;  4JYW A;  4INJ A;  3D7D A;  3TLG B;  2D0O A;  2X0S A;  4C84 A;  4CZ1 A;  3EZE A;  3I74 A;  4NGP A;  4NGN A;  3T5M A;  3TLB A;  4C85 A;  5F1Y A;  4IIX A;  2EK9 A;  2OOT A;  4C8C A;  4C86 A;  4TJX A;  2GP4 A;  2OR4 A;  4MI1 A;  5K99 A;  3TLZ A;  2XEG A;  3D7G A;  4OC0 A;  3G23 A;  4COB A;  5ELY A;  2PVV A;  4X3R A;  4C8A A;  3FEE A;  3BI1 A;  3BI0 A;  4C8T A;  2C6G A;  3D7H A;  2JBK A;  1BXR B;  3C8O A;  5F9M A;  2EZB A;  1ZYM A;  4C99 A;  1J3L A;  2C6P A;  3FED A;  4MCS A;  2XEI A;  4OC4 A;  1DE4 C;  2R82 A;  2B0A A;  2E28 A;  3SJG A;  1VI4 A;  3TLG A;  2C5Q A;  3BHX A;  4EYS A;  1ZRS A;  2EZA A;  2C6C A;  1XF1 A;  3EZB A;  3SJE A;  1Z8L A;  3S9M A;  2OLS A;  3D7F A;  2HWG A;  4P44 A;  4OME A;  4MCQ A;  1JDE A;  3K4I A;  3SJX A;  1GGO A;  1Q5X A;  4KNG E;  3TLC A;  4C9E A;  1EZB A;  3IWW A;  1A9X B;  3BXM A;  3FF3 A;  4MCR A;  4JZ0 A;  5D29 A;  2DIK A;  4C8P A;  2FM4 A;  4TWE A;  4P4B A;  4CDK A;  1WVM A;  2YJT A;  4C9R A;  3TLY A;  4LQG A;  4MCP A;  5F09 A;  1C30 B;  3EZA A;  1CX8 A;  5IR2 A;  4OC1 A;  3NOJ A;  3IIB A;  3FEC A;  2EK8 A;  4P4F A;  1CE8 B;  2JBJ A;  4W9Y A;  3GJZ A;  5FD8 A;  3SR3 A;  3VTA A;  4M8D A;  2PCN A;  1KC7 A;  3S9N A;  3EIF A;  4C9A A;  3T05 A;  1R61 A;  1M6V B;  4E5S A;  1KBL A;  2AUM A;  3TLA A;  4CDJ A;  1VBH A;  3TLE A;  4C8F A;  4E94 A;  4TJV A;  4YN3 A;  3KAS A;  2AUN A;  3T0T A;  4P4E A;  1ZL0 A;  2CIJ A;  4NGS A;  3TYX A;  1C3O B;  2YJV A; 
#chains in the Genus database with same CATH homology
 1VI4 A;  1NXJ A;  3K4I A;  1Q5X A;  3C8O A;  3NOJ A;  2PCN A;  1J3L A;  2YJT A;  2YJV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...