1VI4A

Crystal structure of regulator of ribonuclease activity a protein 1
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
162
structure length
162
Chain Sequence
MRDITPDLCDKYESQVTLLNLPLQNFGQRSAFWGEIVTVRCYHDNSKVRDVLSQNGKGKVLVVDGHGSCHKALMGDQLAILAIKNDWEGVIIYGAVRDVVAMSEMDLGIKALGTSPFKTEKRGAGQVNVTLTMQNQIVEPGDYLYADWNGILMSETALDVAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulator of ribonuclease activity A protein 1
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Structural genomics, unknown function
total genus 45
structure length 162
sequence length 162
ec nomenclature ec 4.1.1.112: Oxaloacetate decarboxylase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03737 RraA-like Aldolase/RraA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.40 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Ribonuclease E inhibitor RraA/RraA-like 1vi4A00
3K4IA 3C8OA 2YJTA 2PCNA 3NOJA 1Q5XA 1J3LA 1VI4A 1NXJA 2YJVA
chains in the Genus database with same CATH superfamily
3TLGA 3GJZA 3I74A 4P4IA 1T36B 5FD8A 3NOJA 1XF1A 4P4EA 3KASA 2OR4A 2YJVA 2PVVA 1WVMA 2HWGA 4JYWA 1VBHA 2C6GA 2XEFA 2EZBA 3FEEA 1M6VB 1A9XB 1Z8LA 4NGQA 4C8CA 3FEDA 3TLYA 3D7DA 4C8AA 2PCNA 4MJXA 3T0TA 1C30B 4IIYA 4C85A 4NGRA 2HI6A 4TJXA 4CDKA 2HROA 3ICUA 2D0OA 1CE8B 1DIKA 2MP0A 1VI4A 4E94A 4X3RA 3T5MA 3TLZA 4NGMA 2EZCA 2EK9A 2EZAA 5F09A 3IIBA 5F9MA 5F1YA 4INJA 2AUNA 3K4IA 4MCRA 4JVOA 4C8UA 5D29A 2CIJA 4H1HA 4KNGE 4P4DA 4OC4A 3RBUA 5F5XA 3TLAA 3KRVA 1BXRB 3T05A 3TYXA 4C9VA 2OLSA 2XEJA 1KBLA 3BI1A 1JDBC 3EIFA 2XEGA 4P45A 3TLGB 4OC2A 4C86A 4MI1A 2DIKA 3EZAA 2C6CA 3D7GA 2C6PA 1KEEB 1Y9ZA 4W9YA 4C9UA 4CDJA 2GP4A 2X0SA 4NGPA 3TLBA 2PVWA 4YN3A 2YJTA 4C8FA 4TWEA 4CZ1A 4MCQA 4C84A 4C99A 3S9NA 3FECA 4COGA 2R82A 3K9TA 1J3LA 2D0PA 4OC0A 4OC5A 2FM4A 1JDEA 4LQGA 3BHXA 4MCSA 4J0NA 4COBA 3BI0A 2E28A 4OC3A 1CS0B 3SJXA 3TLCA 3EZBA 2AUMA 4C9AA 5IR2A 4P4BA 3SJGA 5K99A 4NGSA 4C9RA 4JZ0A 5ELYA 3EZEA 3SJEA 3D7FA 2B0AA 1V6CA 3FF3A 3SR3A 3I6SA 4C8TA 4C8PA 2C5QA 1NBWA 2JBKA 1ZYMA 3S9MA 3T07A 1VBGA 4C9EA 3G23A 1Q5XA 4E5SA 4NGTA 5JYBA 1CX8A 4P44A 4MCPA 1ZL0A 4NGNA 1EZAA 2XEIA 3C8OA 5IB9A 3D7HA 3VTAA 4EYSA 5JVLA 3SJFA 4P4FA 1ZRSA 3BXMA 3IWWA 3S9LA 4OC1A 1GGOA 2JBJA 1KC7A 4M8DA 4IIXA 2EK8A 4OMEA 1C3OB 4P4JA 3TLEA 2OOTA 3U1BA 1EZBA 4TJVA 1DE4C 1NXJA 1R61A 4CO9A
chains in the Genus database with same CATH topology
3K4IA 3C8OA 2YJTA 2PCNA 3NOJA 1Q5XA 1J3LA 1VI4A 1NXJA 2YJVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K4I A;  3C8O A;  2YJT A;  2PCN A;  3NOJ A;  1Q5X A;  1J3L A;  1VI4 A;  1NXJ A;  2YJV A; 
#chains in the Genus database with same CATH topology
 3TLG A;  3GJZ A;  3I74 A;  4P4I A;  1T36 B;  5FD8 A;  3NOJ A;  1XF1 A;  4P4E A;  3KAS A;  2OR4 A;  2YJV A;  2PVV A;  1WVM A;  2HWG A;  4JYW A;  1VBH A;  2C6G A;  2XEF A;  2EZB A;  3FEE A;  1M6V B;  1A9X B;  1Z8L A;  4NGQ A;  4C8C A;  3FED A;  3TLY A;  3D7D A;  4C8A A;  2PCN A;  4MJX A;  3T0T A;  1C30 B;  4IIY A;  4C85 A;  4NGR A;  2HI6 A;  4TJX A;  4CDK A;  2HRO A;  3ICU A;  2D0O A;  1CE8 B;  1DIK A;  2MP0 A;  1VI4 A;  4E94 A;  4X3R A;  3T5M A;  3TLZ A;  4NGM A;  2EZC A;  2EK9 A;  2EZA A;  5F09 A;  3IIB A;  5F9M A;  5F1Y A;  4INJ A;  2AUN A;  3K4I A;  4MCR A;  4JVO A;  4C8U A;  5D29 A;  2CIJ A;  4H1H A;  4KNG E;  4P4D A;  4OC4 A;  3RBU A;  5F5X A;  3TLA A;  3KRV A;  1BXR B;  3T05 A;  3TYX A;  4C9V A;  2OLS A;  2XEJ A;  1KBL A;  3BI1 A;  1JDB C;  3EIF A;  2XEG A;  4P45 A;  3TLG B;  4OC2 A;  4C86 A;  4MI1 A;  2DIK A;  3EZA A;  2C6C A;  3D7G A;  2C6P A;  1KEE B;  1Y9Z A;  4W9Y A;  4C9U A;  4CDJ A;  2GP4 A;  2X0S A;  4NGP A;  3TLB A;  2PVW A;  4YN3 A;  2YJT A;  4C8F A;  4TWE A;  4CZ1 A;  4MCQ A;  4C84 A;  4C99 A;  3S9N A;  3FEC A;  4COG A;  2R82 A;  3K9T A;  1J3L A;  2D0P A;  4OC0 A;  4OC5 A;  2FM4 A;  1JDE A;  4LQG A;  3BHX A;  4MCS A;  4J0N A;  4COB A;  3BI0 A;  2E28 A;  4OC3 A;  1CS0 B;  3SJX A;  3TLC A;  3EZB A;  2AUM A;  4C9A A;  5IR2 A;  4P4B A;  3SJG A;  5K99 A;  4NGS A;  4C9R A;  4JZ0 A;  5ELY A;  3EZE A;  3SJE A;  3D7F A;  2B0A A;  1V6C A;  3FF3 A;  3SR3 A;  3I6S A;  4C8T A;  4C8P A;  2C5Q A;  1NBW A;  2JBK A;  1ZYM A;  3S9M A;  3T07 A;  1VBG A;  4C9E A;  3G23 A;  1Q5X A;  4E5S A;  4NGT A;  5JYB A;  1CX8 A;  4P44 A;  4MCP A;  1ZL0 A;  4NGN A;  1EZA A;  2XEI A;  3C8O A;  5IB9 A;  3D7H A;  3VTA A;  4EYS A;  5JVL A;  3SJF A;  4P4F A;  1ZRS A;  3BXM A;  3IWW A;  3S9L A;  4OC1 A;  1GGO A;  2JBJ A;  1KC7 A;  4M8D A;  4IIX A;  2EK8 A;  4OME A;  1C3O B;  4P4J A;  3TLE A;  2OOT A;  3U1B A;  1EZB A;  4TJV A;  1DE4 C;  1NXJ A;  1R61 A;  4CO9 A; 
#chains in the Genus database with same CATH homology
 3K4I A;  3C8O A;  2YJT A;  2PCN A;  3NOJ A;  1Q5X A;  1J3L A;  1VI4 A;  1NXJ A;  2YJV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...