2PCNA

Crystal structure of s-adenosylmethionine: 2-dimethylmenaquinone methyltransferase (gk_1813) from geobacillus kaustophilus hta426
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
161
structure length
161
Chain Sequence
MKTADLCDQFLDELQVCELPFQSYGGKRMFSGPIATVDVFEDNVLVREALETVPPGTVLVVDGKGSRRVALLGDRLAQIACERGLAGVIIHGCIRDSAEIGAMPIGVMAIGTCPVKSKKEGKGARDVVLEFGGVRWEPGAYVYADADGVVVANKDLLAKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords S-adenosylmethionine:2-demethylmenaquinone methyltransferase
publication title Crystal structure of S-adenosylmethionine:2-dimethylmenaquinone methyltransferase (gk_1813) from geobacillus kaustophilus HTA426
rcsb
source organism Geobacillus kaustophilus
total genus 45
structure length 161
sequence length 161
ec nomenclature ec 2.1.1.-:
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03737 RraA-like Aldolase/RraA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.40 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Ribonuclease E inhibitor RraA/RraA-like 2pcnA00
3K4IA 2YJVA 1VI4A 2PCNA 1NXJA 3C8OA 3NOJA 1Q5XA 1J3LA 2YJTA
chains in the Genus database with same CATH superfamily
4C9RA 3D7HA 1BXRB 4NGSA 1A9XB 3IWWA 1Y9ZA 3RBUA 3TLGB 1Z8LA 4YN3A 4P4FA 4JYWA 5F09A 1NBWA 3EZEA 4P4IA 2OOTA 4C84A 3D7DA 1VBGA 1Q5XA 4OC2A 3U1BA 3K9TA 4INJA 4COGA 3G23A 3S9MA 1DIKA 4MCQA 4C8TA 4CDJA 1ZL0A 3IIBA 2EZCA 1J3LA 5JYBA 1KEEB 2C6CA 3K4IA 3SJEA 4E5SA 3TLCA 5F5XA 2PVVA 1VBHA 5IR2A 2R82A 2C6GA 3TLAA 1ZYMA 1JDEA 4OC1A 1CX8A 4P4DA 2DIKA 4JZ0A 3TLZA 3TYXA 3GJZA 2EK9A 3I6SA 1WVMA 2D0PA 4NGQA 3T0TA 2B0AA 4IIYA 1M6VB 4C9UA 3SJFA 2JBKA 4NGTA 4MCSA 3KRVA 4P44A 4COBA 4OC5A 4TJVA 2XEJA 3C8OA 4P45A 2YJVA 3TLYA 3BI1A 3T07A 3TLBA 1C30B 4MCRA 2AUMA 1CS0B 1R61A 4P4JA 1CE8B 2OR4A 1XF1A 4J0NA 3FECA 2EK8A 5FD8A 2EZAA 2PVWA 4C8UA 4C9EA 3FEEA 1EZAA 4OC4A 2EZBA 4W9YA 2HI6A 2XEGA 4NGNA 3EZAA 4P4BA 4NGPA 1EZBA 4IIXA 1T36B 2JBJA 2YJTA 5IB9A 4X3RA 3SJGA 4E94A 4MCPA 3TLGA 2E28A 4MJXA 2MP0A 3BHXA 3EZBA 1VI4A 2HWGA 2PCNA 3FF3A 3SJXA 4C8FA 4NGRA 3NOJA 3TLEA 2AUNA 2OLSA 4TWEA 3T5MA 4M8DA 3SR3A 1ZRSA 4CO9A 1KC7A 1DE4C 2GP4A 4C9VA 4C8PA 4JVOA 1JDBC 4NGMA 4KNGE 3BI0A 5F9MA 4H1HA 2XEFA 1GGOA 1C3OB 4TJXA 4OMEA 4C9AA 2C6PA 4C99A 3I74A 4C8CA 3D7FA 4CZ1A 3BXMA 2D0OA 4C86A 3S9LA 2C5QA 3S9NA 1KBLA 1NXJA 3VTAA 1V6CA 5K99A 5D29A 3KASA 5F1YA 5ELYA 4C85A 4C8AA 2CIJA 4OC0A 3D7GA 4EYSA 4P4EA 4OC3A 2XEIA 3FEDA 2HROA 4LQGA 4CDKA 4MI1A 3T05A 2X0SA 3EIFA 5JVLA 2FM4A 3ICUA
chains in the Genus database with same CATH topology
3K4IA 2YJVA 1VI4A 2PCNA 1NXJA 3C8OA 3NOJA 1Q5XA 1J3LA 2YJTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K4I A;  2YJV A;  1VI4 A;  2PCN A;  1NXJ A;  3C8O A;  3NOJ A;  1Q5X A;  1J3L A;  2YJT A; 
#chains in the Genus database with same CATH topology
 4C9R A;  3D7H A;  1BXR B;  4NGS A;  1A9X B;  3IWW A;  1Y9Z A;  3RBU A;  3TLG B;  1Z8L A;  4YN3 A;  4P4F A;  4JYW A;  5F09 A;  1NBW A;  3EZE A;  4P4I A;  2OOT A;  4C84 A;  3D7D A;  1VBG A;  1Q5X A;  4OC2 A;  3U1B A;  3K9T A;  4INJ A;  4COG A;  3G23 A;  3S9M A;  1DIK A;  4MCQ A;  4C8T A;  4CDJ A;  1ZL0 A;  3IIB A;  2EZC A;  1J3L A;  5JYB A;  1KEE B;  2C6C A;  3K4I A;  3SJE A;  4E5S A;  3TLC A;  5F5X A;  2PVV A;  1VBH A;  5IR2 A;  2R82 A;  2C6G A;  3TLA A;  1ZYM A;  1JDE A;  4OC1 A;  1CX8 A;  4P4D A;  2DIK A;  4JZ0 A;  3TLZ A;  3TYX A;  3GJZ A;  2EK9 A;  3I6S A;  1WVM A;  2D0P A;  4NGQ A;  3T0T A;  2B0A A;  4IIY A;  1M6V B;  4C9U A;  3SJF A;  2JBK A;  4NGT A;  4MCS A;  3KRV A;  4P44 A;  4COB A;  4OC5 A;  4TJV A;  2XEJ A;  3C8O A;  4P45 A;  2YJV A;  3TLY A;  3BI1 A;  3T07 A;  3TLB A;  1C30 B;  4MCR A;  2AUM A;  1CS0 B;  1R61 A;  4P4J A;  1CE8 B;  2OR4 A;  1XF1 A;  4J0N A;  3FEC A;  2EK8 A;  5FD8 A;  2EZA A;  2PVW A;  4C8U A;  4C9E A;  3FEE A;  1EZA A;  4OC4 A;  2EZB A;  4W9Y A;  2HI6 A;  2XEG A;  4NGN A;  3EZA A;  4P4B A;  4NGP A;  1EZB A;  4IIX A;  1T36 B;  2JBJ A;  2YJT A;  5IB9 A;  4X3R A;  3SJG A;  4E94 A;  4MCP A;  3TLG A;  2E28 A;  4MJX A;  2MP0 A;  3BHX A;  3EZB A;  1VI4 A;  2HWG A;  2PCN A;  3FF3 A;  3SJX A;  4C8F A;  4NGR A;  3NOJ A;  3TLE A;  2AUN A;  2OLS A;  4TWE A;  3T5M A;  4M8D A;  3SR3 A;  1ZRS A;  4CO9 A;  1KC7 A;  1DE4 C;  2GP4 A;  4C9V A;  4C8P A;  4JVO A;  1JDB C;  4NGM A;  4KNG E;  3BI0 A;  5F9M A;  4H1H A;  2XEF A;  1GGO A;  1C3O B;  4TJX A;  4OME A;  4C9A A;  2C6P A;  4C99 A;  3I74 A;  4C8C A;  3D7F A;  4CZ1 A;  3BXM A;  2D0O A;  4C86 A;  3S9L A;  2C5Q A;  3S9N A;  1KBL A;  1NXJ A;  3VTA A;  1V6C A;  5K99 A;  5D29 A;  3KAS A;  5F1Y A;  5ELY A;  4C85 A;  4C8A A;  2CIJ A;  4OC0 A;  3D7G A;  4EYS A;  4P4E A;  4OC3 A;  2XEI A;  3FED A;  2HRO A;  4LQG A;  4CDK A;  4MI1 A;  3T05 A;  2X0S A;  3EIF A;  5JVL A;  2FM4 A;  3ICU A; 
#chains in the Genus database with same CATH homology
 3K4I A;  2YJV A;  1VI4 A;  2PCN A;  1NXJ A;  3C8O A;  3NOJ A;  1Q5X A;  1J3L A;  2YJT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...