2PCNA

Crystal structure of s-adenosylmethionine: 2-dimethylmenaquinone methyltransferase (gk_1813) from geobacillus kaustophilus hta426
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
161
structure length
161
Chain Sequence
MKTADLCDQFLDELQVCELPFQSYGGKRMFSGPIATVDVFEDNVLVREALETVPPGTVLVVDGKGSRRVALLGDRLAQIACERGLAGVIIHGCIRDSAEIGAMPIGVMAIGTCPVKSKKEGKGARDVVLEFGGVRWEPGAYVYADADGVVVANKDLLAKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-adenosylmethionine:2-demethylmenaquinone methyltransferase
publication title Crystal structure of S-adenosylmethionine:2-dimethylmenaquinone methyltransferase (gk_1813) from geobacillus kaustophilus HTA426
rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase
total genus 45
structure length 161
sequence length 161
ec nomenclature ec 2.1.1.-:
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03737 RraA-like Aldolase/RraA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.40 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Ribonuclease E inhibitor RraA/RraA-like 2pcnA00
1Q5XA 1VI4A 1NXJA 3K4IA 1J3LA 3NOJA 2YJVA 2PCNA 2YJTA 3C8OA
chains in the Genus database with same CATH superfamily
4JVOA 3RBUA 3EZAA 2OOTA 1JDBC 2R82A 4W9YA 4J0NA 3FEDA 2CIJA 3FEEA 2AUNA 4EYSA 3SJEA 3TLGA 3U1BA 4LQGA 4JYWA 4P4JA 4NGRA 3TLCA 2XEFA 3D7GA 3SJXA 3BXMA 3VTAA 2D0PA 4C8PA 4M8DA 4H1HA 1ZRSA 3I74A 3FECA 4E94A 3D7FA 4NGTA 1NXJA 2C6PA 2MP0A 3TLGB 1DE4C 1VI4A 2D0OA 2PVVA 5FD8A 2PVWA 1M6VB 5JVLA 4CO9A 2XEJA 3T07A 2E28A 3C8OA 4P4FA 2HI6A 3T5MA 2EK9A 3EZBA 2C5QA 4NGSA 2C6CA 1C30B 4MCRA 1WVMA 4P4BA 4IIYA 2EK8A 3BHXA 4C8CA 4X3RA 2XEGA 4COBA 3EZEA 1KBLA 4C85A 5IB9A 2JBJA 4NGNA 1T36B 3G23A 4NGQA 1Y9ZA 4OMEA 3D7DA 2HROA 4INJA 3S9NA 1NBWA 1CS0B 4OC2A 2GP4A 1VBGA 3FF3A 1A9XB 4P4IA 5F1YA 4CZ1A 1GGOA 4MI1A 4MJXA 3KRVA 3SJFA 4OC3A 1J3LA 2XEIA 3TYXA 2JBKA 3GJZA 3I6SA 2HWGA 2EZAA 3S9MA 3SJGA 4C8FA 4P4DA 2C6GA 4CDKA 2YJVA 2PCNA 1Z8LA 1C3OB 1BXRB 1ZYMA 4KNGE 1EZAA 4C9EA 4TJXA 4OC4A 3TLZA 5IR2A 3TLYA 4C8UA 1CE8B 2OR4A 3IWWA 4YN3A 2EZBA 4P45A 5F9MA 4C84A 3K9TA 4CDJA 4P4EA 4TJVA 3D7HA 4OC1A 4C9UA 4TWEA 3T05A 2EZCA 5F5XA 4JZ0A 4C8AA 4COGA 3KASA 4C86A 1DIKA 2FM4A 5ELYA 1VBHA 4C8TA 1R61A 1ZL0A 3S9LA 3SR3A 4C99A 4IIXA 5JYBA 4E5SA 3K4IA 1XF1A 4NGMA 3TLEA 2OLSA 3BI1A 3EIFA 1JDEA 4C9VA 4OC5A 1EZBA 3BI0A 3TLBA 4P44A 1KEEB 2AUMA 4C9AA 2DIKA 2B0AA 1KC7A 5K99A 4MCPA 1V6CA 1Q5XA 2X0SA 4OC0A 3IIBA 5D29A 3ICUA 3T0TA 4MCQA 4C9RA 1CX8A 3TLAA 3NOJA 4MCSA 2YJTA 5F09A 4NGPA
chains in the Genus database with same CATH topology
1Q5XA 1VI4A 1NXJA 3K4IA 1J3LA 3NOJA 2YJVA 2PCNA 2YJTA 3C8OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q5X A;  1VI4 A;  1NXJ A;  3K4I A;  1J3L A;  3NOJ A;  2YJV A;  2PCN A;  2YJT A;  3C8O A; 
#chains in the Genus database with same CATH topology
 4JVO A;  3RBU A;  3EZA A;  2OOT A;  1JDB C;  2R82 A;  4W9Y A;  4J0N A;  3FED A;  2CIJ A;  3FEE A;  2AUN A;  4EYS A;  3SJE A;  3TLG A;  3U1B A;  4LQG A;  4JYW A;  4P4J A;  4NGR A;  3TLC A;  2XEF A;  3D7G A;  3SJX A;  3BXM A;  3VTA A;  2D0P A;  4C8P A;  4M8D A;  4H1H A;  1ZRS A;  3I74 A;  3FEC A;  4E94 A;  3D7F A;  4NGT A;  1NXJ A;  2C6P A;  2MP0 A;  3TLG B;  1DE4 C;  1VI4 A;  2D0O A;  2PVV A;  5FD8 A;  2PVW A;  1M6V B;  5JVL A;  4CO9 A;  2XEJ A;  3T07 A;  2E28 A;  3C8O A;  4P4F A;  2HI6 A;  3T5M A;  2EK9 A;  3EZB A;  2C5Q A;  4NGS A;  2C6C A;  1C30 B;  4MCR A;  1WVM A;  4P4B A;  4IIY A;  2EK8 A;  3BHX A;  4C8C A;  4X3R A;  2XEG A;  4COB A;  3EZE A;  1KBL A;  4C85 A;  5IB9 A;  2JBJ A;  4NGN A;  1T36 B;  3G23 A;  4NGQ A;  1Y9Z A;  4OME A;  3D7D A;  2HRO A;  4INJ A;  3S9N A;  1NBW A;  1CS0 B;  4OC2 A;  2GP4 A;  1VBG A;  3FF3 A;  1A9X B;  4P4I A;  5F1Y A;  4CZ1 A;  1GGO A;  4MI1 A;  4MJX A;  3KRV A;  3SJF A;  4OC3 A;  1J3L A;  2XEI A;  3TYX A;  2JBK A;  3GJZ A;  3I6S A;  2HWG A;  2EZA A;  3S9M A;  3SJG A;  4C8F A;  4P4D A;  2C6G A;  4CDK A;  2YJV A;  2PCN A;  1Z8L A;  1C3O B;  1BXR B;  1ZYM A;  4KNG E;  1EZA A;  4C9E A;  4TJX A;  4OC4 A;  3TLZ A;  5IR2 A;  3TLY A;  4C8U A;  1CE8 B;  2OR4 A;  3IWW A;  4YN3 A;  2EZB A;  4P45 A;  5F9M A;  4C84 A;  3K9T A;  4CDJ A;  4P4E A;  4TJV A;  3D7H A;  4OC1 A;  4C9U A;  4TWE A;  3T05 A;  2EZC A;  5F5X A;  4JZ0 A;  4C8A A;  4COG A;  3KAS A;  4C86 A;  1DIK A;  2FM4 A;  5ELY A;  1VBH A;  4C8T A;  1R61 A;  1ZL0 A;  3S9L A;  3SR3 A;  4C99 A;  4IIX A;  5JYB A;  4E5S A;  3K4I A;  1XF1 A;  4NGM A;  3TLE A;  2OLS A;  3BI1 A;  3EIF A;  1JDE A;  4C9V A;  4OC5 A;  1EZB A;  3BI0 A;  3TLB A;  4P44 A;  1KEE B;  2AUM A;  4C9A A;  2DIK A;  2B0A A;  1KC7 A;  5K99 A;  4MCP A;  1V6C A;  1Q5X A;  2X0S A;  4OC0 A;  3IIB A;  5D29 A;  3ICU A;  3T0T A;  4MCQ A;  4C9R A;  1CX8 A;  3TLA A;  3NOJ A;  4MCS A;  2YJT A;  5F09 A;  4NGP A; 
#chains in the Genus database with same CATH homology
 1Q5X A;  1VI4 A;  1NXJ A;  3K4I A;  1J3L A;  3NOJ A;  2YJV A;  2PCN A;  2YJT A;  3C8O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...