2PCNA

Crystal structure of s-adenosylmethionine: 2-dimethylmenaquinone methyltransferase (gk_1813) from geobacillus kaustophilus hta426
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
161
structure length
161
Chain Sequence
MKTADLCDQFLDELQVCELPFQSYGGKRMFSGPIATVDVFEDNVLVREALETVPPGTVLVVDGKGSRRVALLGDRLAQIACERGLAGVIIHGCIRDSAEIGAMPIGVMAIGTCPVKSKKEGKGARDVVLEFGGVRWEPGAYVYADADGVVVANKDLLAKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of S-adenosylmethionine:2-dimethylmenaquinone methyltransferase (gk_1813) from geobacillus kaustophilus HTA426
rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase
molecule keywords S-adenosylmethionine:2-demethylmenaquinone methyltransferase
total genus 45
structure length 161
sequence length 161
ec nomenclature ec 2.1.1.-:
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03737 RraA-like Aldolase/RraA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.40 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Ribonuclease E inhibitor RraA/RraA-like 2pcnA00
1VI4A 2PCNA 2YJTA 1J3LA 1NXJA 3NOJA 3K4IA 3C8OA 1Q5XA 2YJVA
chains in the Genus database with same CATH superfamily
1VBHA 4C84A 2AUMA 4KNGE 2HWGA 2XEIA 2XEFA 4NGNA 1R61A 4COBA 4OC4A 1T36B 5IR2A 3T07A 4OC5A 1XF1A 1Q5XA 3T0TA 4YN3A 2PCNA 5ELYA 4P4DA 2OR4A 3S9NA 3TLBA 1V6CA 2R82A 5F9MA 3SR3A 4P4IA 4P4BA 3T05A 2C6CA 3FF3A 1J3LA 4C9RA 4C8UA 4MCPA 2C6PA 3RBUA 4JZ0A 2C5QA 4JYWA 2AUNA 4OMEA 4EYSA 1C3OB 4NGMA 1M6VB 4NGTA 5F1YA 5K99A 1ZRSA 1KEEB 2D0PA 3GJZA 2C6GA 1DIKA 3D7GA 4MCSA 4CDJA 3S9LA 4MJXA 4W9YA 1VBGA 5F09A 5D29A 4C99A 4C8CA 3SJXA 5F5XA 3D7DA 3S9MA 4OC3A 2EK9A 1KBLA 4P4JA 1A9XB 3T5MA 2JBKA 4C86A 1CE8B 4H1HA 4OC1A 1CX8A 4LQGA 4C9EA 4IIYA 4JVOA 4OC2A 4M8DA 1ZYMA 3IIBA 3U1BA 3ICUA 2EZBA 1EZBA 1DE4C 2XEJA 1JDBC 3BI1A 3EZAA 2MP0A 1JDEA 1WVMA 4P4EA 3G23A 5FD8A 2D0OA 2EZCA 2DIKA 4MI1A 4INJA 3VTAA 2HROA 1EZAA 3FEEA 3IWWA 4IIXA 4MCQA 1Y9ZA 4TWEA 1VI4A 3EZBA 1KC7A 2JBJA 3I74A 4NGSA 2GP4A 5JVLA 3C8OA 4CDKA 3SJGA 1GGOA 4P44A 1C30B 3K9TA 3KRVA 1NXJA 2OOTA 3TLZA 3NOJA 2X0SA 3K4IA 2E28A 4J0NA 4COGA 4C9UA 1NBWA 4E5SA 3FEDA 1ZL0A 3KASA 2YJTA 4TJVA 3TLGA 5JYBA 3BXMA 2B0AA 3TLYA 4C9VA 2PVVA 3BHXA 3TLEA 4C8PA 1Z8LA 3BI0A 2CIJA 4C8TA 2EZAA 4TJXA 4MCRA 2OLSA 3EZEA 2FM4A 1BXRB 4P45A 3SJFA 4X3RA 4NGPA 4NGQA 3I6SA 4C9AA 3SJEA 4NGRA 1CS0B 4CO9A 4OC0A 4C8FA 4P4FA 2HI6A 3FECA 3TYXA 3EIFA 2PVWA 2XEGA 3D7FA 4E94A 5IB9A 2YJVA 4CZ1A 2EK8A 3TLCA 3TLGB 4C85A 4C8AA 3TLAA 3D7HA
chains in the Genus database with same CATH topology
1VI4A 2PCNA 2YJTA 1J3LA 1NXJA 3NOJA 3K4IA 3C8OA 1Q5XA 2YJVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VI4 A;  2PCN A;  2YJT A;  1J3L A;  1NXJ A;  3NOJ A;  3K4I A;  3C8O A;  1Q5X A;  2YJV A; 
#chains in the Genus database with same CATH topology
 1VBH A;  4C84 A;  2AUM A;  4KNG E;  2HWG A;  2XEI A;  2XEF A;  4NGN A;  1R61 A;  4COB A;  4OC4 A;  1T36 B;  5IR2 A;  3T07 A;  4OC5 A;  1XF1 A;  1Q5X A;  3T0T A;  4YN3 A;  2PCN A;  5ELY A;  4P4D A;  2OR4 A;  3S9N A;  3TLB A;  1V6C A;  2R82 A;  5F9M A;  3SR3 A;  4P4I A;  4P4B A;  3T05 A;  2C6C A;  3FF3 A;  1J3L A;  4C9R A;  4C8U A;  4MCP A;  2C6P A;  3RBU A;  4JZ0 A;  2C5Q A;  4JYW A;  2AUN A;  4OME A;  4EYS A;  1C3O B;  4NGM A;  1M6V B;  4NGT A;  5F1Y A;  5K99 A;  1ZRS A;  1KEE B;  2D0P A;  3GJZ A;  2C6G A;  1DIK A;  3D7G A;  4MCS A;  4CDJ A;  3S9L A;  4MJX A;  4W9Y A;  1VBG A;  5F09 A;  5D29 A;  4C99 A;  4C8C A;  3SJX A;  5F5X A;  3D7D A;  3S9M A;  4OC3 A;  2EK9 A;  1KBL A;  4P4J A;  1A9X B;  3T5M A;  2JBK A;  4C86 A;  1CE8 B;  4H1H A;  4OC1 A;  1CX8 A;  4LQG A;  4C9E A;  4IIY A;  4JVO A;  4OC2 A;  4M8D A;  1ZYM A;  3IIB A;  3U1B A;  3ICU A;  2EZB A;  1EZB A;  1DE4 C;  2XEJ A;  1JDB C;  3BI1 A;  3EZA A;  2MP0 A;  1JDE A;  1WVM A;  4P4E A;  3G23 A;  5FD8 A;  2D0O A;  2EZC A;  2DIK A;  4MI1 A;  4INJ A;  3VTA A;  2HRO A;  1EZA A;  3FEE A;  3IWW A;  4IIX A;  4MCQ A;  1Y9Z A;  4TWE A;  1VI4 A;  3EZB A;  1KC7 A;  2JBJ A;  3I74 A;  4NGS A;  2GP4 A;  5JVL A;  3C8O A;  4CDK A;  3SJG A;  1GGO A;  4P44 A;  1C30 B;  3K9T A;  3KRV A;  1NXJ A;  2OOT A;  3TLZ A;  3NOJ A;  2X0S A;  3K4I A;  2E28 A;  4J0N A;  4COG A;  4C9U A;  1NBW A;  4E5S A;  3FED A;  1ZL0 A;  3KAS A;  2YJT A;  4TJV A;  3TLG A;  5JYB A;  3BXM A;  2B0A A;  3TLY A;  4C9V A;  2PVV A;  3BHX A;  3TLE A;  4C8P A;  1Z8L A;  3BI0 A;  2CIJ A;  4C8T A;  2EZA A;  4TJX A;  4MCR A;  2OLS A;  3EZE A;  2FM4 A;  1BXR B;  4P45 A;  3SJF A;  4X3R A;  4NGP A;  4NGQ A;  3I6S A;  4C9A A;  3SJE A;  4NGR A;  1CS0 B;  4CO9 A;  4OC0 A;  4C8F A;  4P4F A;  2HI6 A;  3FEC A;  3TYX A;  3EIF A;  2PVW A;  2XEG A;  3D7F A;  4E94 A;  5IB9 A;  2YJV A;  4CZ1 A;  2EK8 A;  3TLC A;  3TLG B;  4C85 A;  4C8A A;  3TLA A;  3D7H A; 
#chains in the Genus database with same CATH homology
 1VI4 A;  2PCN A;  2YJT A;  1J3L A;  1NXJ A;  3NOJ A;  3K4I A;  3C8O A;  1Q5X A;  2YJV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...