2PCNA

Crystal structure of s-adenosylmethionine: 2-dimethylmenaquinone methyltransferase (gk_1813) from geobacillus kaustophilus hta426
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
161
structure length
161
Chain Sequence
MKTADLCDQFLDELQVCELPFQSYGGKRMFSGPIATVDVFEDNVLVREALETVPPGTVLVVDGKGSRRVALLGDRLAQIACERGLAGVIIHGCIRDSAEIGAMPIGVMAIGTCPVKSKKEGKGARDVVLEFGGVRWEPGAYVYADADGVVVANKDLLAKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of S-adenosylmethionine:2-dimethylmenaquinone methyltransferase (gk_1813) from geobacillus kaustophilus HTA426
rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase
molecule keywords S-adenosylmethionine:2-demethylmenaquinone methyltransferase
total genus 45
structure length 161
sequence length 161
ec nomenclature ec 2.1.1.-:
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03737 RraA-like Aldolase/RraA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.40 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Ribonuclease E inhibitor RraA/RraA-like 2pcnA00
2PCNA 2YJVA 1J3LA 1NXJA 3NOJA 2YJTA 1VI4A 3C8OA 3K4IA 1Q5XA
chains in the Genus database with same CATH superfamily
1WVMA 4OC2A 1KBLA 1DE4C 4NGSA 4P4JA 3VTAA 3IWWA 4C8CA 1EZAA 2AUMA 2FM4A 1CS0B 3SJXA 2XEFA 3U1BA 3IIBA 2D0PA 5K99A 2XEGA 3S9LA 3KASA 1VBGA 2C6GA 1V6CA 3EIFA 1ZYMA 4P44A 4E94A 4C9UA 1KEEB 3BHXA 1T36B 4C84A 4OC1A 4JZ0A 2R82A 2PVVA 4JYWA 2YJTA 4MCQA 4OC0A 2AUNA 3I74A 3TLBA 2E28A 3D7HA 1R61A 1KC7A 4NGMA 2DIKA 1DIKA 1C30B 4NGPA 5F1YA 2XEIA 2PVWA 1GGOA 3FEDA 3G23A 3NOJA 4P4IA 4TJXA 3TLGB 2B0AA 4C85A 3RBUA 4MCSA 3T5MA 4IIXA 4OC3A 5IB9A 4NGNA 4TWEA 2MP0A 1ZL0A 2C6CA 2HI6A 3D7DA 3TLZA 5F09A 1JDEA 2PCNA 5FD8A 4W9YA 1A9XB 3TLGA 3K9TA 3SJEA 2GP4A 3D7GA 4OC5A 3FEEA 3BXMA 2CIJA 2JBJA 4C86A 5JYBA 4CDJA 2C5QA 4H1HA 5IR2A 3S9NA 1NBWA 4OC4A 4NGRA 3S9MA 3TLAA 4C99A 4C8TA 4MI1A 1NXJA 1Y9ZA 3TYXA 1CX8A 4MJXA 3T0TA 2XEJA 4JVOA 1ZRSA 4MCRA 2EZAA 1BXRB 4C9EA 4CDKA 1VI4A 3C8OA 4TJVA 4C8PA 4COGA 3FF3A 1Z8LA 4C8FA 4CO9A 4NGTA 2C6PA 4CZ1A 3TLCA 4LQGA 4KNGE 4P4DA 4E5SA 5ELYA 4M8DA 3EZAA 2JBKA 3TLYA 2X0SA 3ICUA 2D0OA 4COBA 4P4EA 5D29A 3T07A 4INJA 4EYSA 2OR4A 1CE8B 1C3OB 2EK9A 3BI1A 3FECA 4P45A 3KRVA 4YN3A 1VBHA 3SR3A 3K4IA 3BI0A 2HROA 2HWGA 5F5XA 2OLSA 1JDBC 3SJGA 4C8AA 1EZBA 4OMEA 3EZEA 3TLEA 2EK8A 3D7FA 4IIYA 1XF1A 1Q5XA 4P4BA 4C8UA 4J0NA 4X3RA 3T05A 4C9RA 2OOTA 4C9VA 2EZCA 4C9AA 1M6VB 4MCPA 5JVLA 3SJFA 3I6SA 4NGQA 2YJVA 1J3LA 3EZBA 3GJZA 2EZBA 5F9MA 4P4FA
chains in the Genus database with same CATH topology
2PCNA 2YJVA 1J3LA 1NXJA 3NOJA 2YJTA 1VI4A 3C8OA 3K4IA 1Q5XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PCN A;  2YJV A;  1J3L A;  1NXJ A;  3NOJ A;  2YJT A;  1VI4 A;  3C8O A;  3K4I A;  1Q5X A; 
#chains in the Genus database with same CATH topology
 1WVM A;  4OC2 A;  1KBL A;  1DE4 C;  4NGS A;  4P4J A;  3VTA A;  3IWW A;  4C8C A;  1EZA A;  2AUM A;  2FM4 A;  1CS0 B;  3SJX A;  2XEF A;  3U1B A;  3IIB A;  2D0P A;  5K99 A;  2XEG A;  3S9L A;  3KAS A;  1VBG A;  2C6G A;  1V6C A;  3EIF A;  1ZYM A;  4P44 A;  4E94 A;  4C9U A;  1KEE B;  3BHX A;  1T36 B;  4C84 A;  4OC1 A;  4JZ0 A;  2R82 A;  2PVV A;  4JYW A;  2YJT A;  4MCQ A;  4OC0 A;  2AUN A;  3I74 A;  3TLB A;  2E28 A;  3D7H A;  1R61 A;  1KC7 A;  4NGM A;  2DIK A;  1DIK A;  1C30 B;  4NGP A;  5F1Y A;  2XEI A;  2PVW A;  1GGO A;  3FED A;  3G23 A;  3NOJ A;  4P4I A;  4TJX A;  3TLG B;  2B0A A;  4C85 A;  3RBU A;  4MCS A;  3T5M A;  4IIX A;  4OC3 A;  5IB9 A;  4NGN A;  4TWE A;  2MP0 A;  1ZL0 A;  2C6C A;  2HI6 A;  3D7D A;  3TLZ A;  5F09 A;  1JDE A;  2PCN A;  5FD8 A;  4W9Y A;  1A9X B;  3TLG A;  3K9T A;  3SJE A;  2GP4 A;  3D7G A;  4OC5 A;  3FEE A;  3BXM A;  2CIJ A;  2JBJ A;  4C86 A;  5JYB A;  4CDJ A;  2C5Q A;  4H1H A;  5IR2 A;  3S9N A;  1NBW A;  4OC4 A;  4NGR A;  3S9M A;  3TLA A;  4C99 A;  4C8T A;  4MI1 A;  1NXJ A;  1Y9Z A;  3TYX A;  1CX8 A;  4MJX A;  3T0T A;  2XEJ A;  4JVO A;  1ZRS A;  4MCR A;  2EZA A;  1BXR B;  4C9E A;  4CDK A;  1VI4 A;  3C8O A;  4TJV A;  4C8P A;  4COG A;  3FF3 A;  1Z8L A;  4C8F A;  4CO9 A;  4NGT A;  2C6P A;  4CZ1 A;  3TLC A;  4LQG A;  4KNG E;  4P4D A;  4E5S A;  5ELY A;  4M8D A;  3EZA A;  2JBK A;  3TLY A;  2X0S A;  3ICU A;  2D0O A;  4COB A;  4P4E A;  5D29 A;  3T07 A;  4INJ A;  4EYS A;  2OR4 A;  1CE8 B;  1C3O B;  2EK9 A;  3BI1 A;  3FEC A;  4P45 A;  3KRV A;  4YN3 A;  1VBH A;  3SR3 A;  3K4I A;  3BI0 A;  2HRO A;  2HWG A;  5F5X A;  2OLS A;  1JDB C;  3SJG A;  4C8A A;  1EZB A;  4OME A;  3EZE A;  3TLE A;  2EK8 A;  3D7F A;  4IIY A;  1XF1 A;  1Q5X A;  4P4B A;  4C8U A;  4J0N A;  4X3R A;  3T05 A;  4C9R A;  2OOT A;  4C9V A;  2EZC A;  4C9A A;  1M6V B;  4MCP A;  5JVL A;  3SJF A;  3I6S A;  4NGQ A;  2YJV A;  1J3L A;  3EZB A;  3GJZ A;  2EZB A;  5F9M A;  4P4F A; 
#chains in the Genus database with same CATH homology
 2PCN A;  2YJV A;  1J3L A;  1NXJ A;  3NOJ A;  2YJT A;  1VI4 A;  3C8O A;  3K4I A;  1Q5X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...