2PCNA

Crystal structure of s-adenosylmethionine: 2-dimethylmenaquinone methyltransferase (gk_1813) from geobacillus kaustophilus hta426
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
161
structure length
161
Chain Sequence
MKTADLCDQFLDELQVCELPFQSYGGKRMFSGPIATVDVFEDNVLVREALETVPPGTVLVVDGKGSRRVALLGDRLAQIACERGLAGVIIHGCIRDSAEIGAMPIGVMAIGTCPVKSKKEGKGARDVVLEFGGVRWEPGAYVYADADGVVVANKDLLAKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-adenosylmethionine:2-demethylmenaquinone methyltransferase
publication title Crystal structure of S-adenosylmethionine:2-dimethylmenaquinone methyltransferase (gk_1813) from geobacillus kaustophilus HTA426
rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase
total genus 45
structure length 161
sequence length 161
ec nomenclature ec 2.1.1.-:
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03737 RraA-like Aldolase/RraA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.40 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Ribonuclease E inhibitor RraA/RraA-like 2pcnA00
2YJVA 3NOJA 1NXJA 1Q5XA 3K4IA 2PCNA 1J3LA 3C8OA 1VI4A 2YJTA
chains in the Genus database with same CATH superfamily
5F1YA 2XEJA 5IR2A 5F9MA 4W9YA 1T36B 4OMEA 5D29A 4NGQA 4C9UA 4CDKA 2B0AA 4P44A 3FEDA 2C5QA 1Z8LA 3D7DA 3NOJA 4C9VA 4COBA 4P4EA 2EZCA 3EZEA 4OC3A 2XEIA 4J0NA 3GJZA 2JBJA 4IIYA 1Y9ZA 4C8CA 2XEGA 4C8TA 3I6SA 4JZ0A 4NGTA 1NBWA 4INJA 4TJVA 4MJXA 2D0PA 5IB9A 2E28A 1VBHA 2HI6A 1Q5XA 4NGRA 3SJEA 4CDJA 3D7FA 1VI4A 1CS0B 4OC5A 1VBGA 3VTAA 4NGMA 1NXJA 2EZAA 4C86A 2EK9A 1KC7A 4MCSA 2MP0A 4E94A 4M8DA 3G23A 5ELYA 1CE8B 3EZBA 3BHXA 1ZYMA 4E5SA 1A9XB 2D0OA 1EZBA 1M6VB 4C85A 3S9NA 1ZL0A 3D7HA 3TLZA 3I74A 4NGSA 2CIJA 3TLCA 1XF1A 4IIXA 1JDBC 2OOTA 2R82A 4NGNA 2HWGA 1J3LA 4C9AA 1ZRSA 4X3RA 2C6CA 3KRVA 3T0TA 1CX8A 4C9RA 4MCRA 2JBKA 5F09A 4NGPA 1JDEA 2C6PA 1DE4C 3TYXA 3S9LA 4CO9A 3U1BA 1BXRB 4OC0A 4OC4A 2YJTA 2XEFA 3RBUA 2GP4A 3TLEA 3IWWA 3T05A 4C99A 3FECA 4CZ1A 2PVWA 3EIFA 1DIKA 2AUNA 2OLSA 2AUMA 2OR4A 4C84A 4P4DA 3SJFA 3ICUA 5JVLA 3K9TA 2DIKA 3T5MA 4MCQA 1WVMA 4C8AA 4C9EA 4P4FA 4OC2A 3TLGB 2PCNA 1KBLA 4C8UA 4TJXA 4YN3A 4JVOA 3TLYA 3EZAA 1R61A 2PVVA 4MI1A 4P4IA 3S9MA 1C30B 3TLBA 5F5XA 4LQGA 4H1HA 4MCPA 4P4BA 2X0SA 4C8FA 1KEEB 4JYWA 4P4JA 2FM4A 3KASA 3IIBA 4P45A 3SJGA 2YJVA 1GGOA 2HROA 4C8PA 4TWEA 5FD8A 4COGA 1V6CA 3C8OA 2EZBA 5JYBA 2EK8A 4KNGE 3BXMA 3BI1A 1EZAA 3T07A 4OC1A 3TLGA 1C3OB 2C6GA 3SJXA 3D7GA 3K4IA 3BI0A 3FEEA 3SR3A 5K99A 4EYSA 3FF3A 3TLAA
chains in the Genus database with same CATH topology
2YJVA 3NOJA 1NXJA 1Q5XA 3K4IA 2PCNA 1J3LA 3C8OA 1VI4A 2YJTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YJV A;  3NOJ A;  1NXJ A;  1Q5X A;  3K4I A;  2PCN A;  1J3L A;  3C8O A;  1VI4 A;  2YJT A; 
#chains in the Genus database with same CATH topology
 5F1Y A;  2XEJ A;  5IR2 A;  5F9M A;  4W9Y A;  1T36 B;  4OME A;  5D29 A;  4NGQ A;  4C9U A;  4CDK A;  2B0A A;  4P44 A;  3FED A;  2C5Q A;  1Z8L A;  3D7D A;  3NOJ A;  4C9V A;  4COB A;  4P4E A;  2EZC A;  3EZE A;  4OC3 A;  2XEI A;  4J0N A;  3GJZ A;  2JBJ A;  4IIY A;  1Y9Z A;  4C8C A;  2XEG A;  4C8T A;  3I6S A;  4JZ0 A;  4NGT A;  1NBW A;  4INJ A;  4TJV A;  4MJX A;  2D0P A;  5IB9 A;  2E28 A;  1VBH A;  2HI6 A;  1Q5X A;  4NGR A;  3SJE A;  4CDJ A;  3D7F A;  1VI4 A;  1CS0 B;  4OC5 A;  1VBG A;  3VTA A;  4NGM A;  1NXJ A;  2EZA A;  4C86 A;  2EK9 A;  1KC7 A;  4MCS A;  2MP0 A;  4E94 A;  4M8D A;  3G23 A;  5ELY A;  1CE8 B;  3EZB A;  3BHX A;  1ZYM A;  4E5S A;  1A9X B;  2D0O A;  1EZB A;  1M6V B;  4C85 A;  3S9N A;  1ZL0 A;  3D7H A;  3TLZ A;  3I74 A;  4NGS A;  2CIJ A;  3TLC A;  1XF1 A;  4IIX A;  1JDB C;  2OOT A;  2R82 A;  4NGN A;  2HWG A;  1J3L A;  4C9A A;  1ZRS A;  4X3R A;  2C6C A;  3KRV A;  3T0T A;  1CX8 A;  4C9R A;  4MCR A;  2JBK A;  5F09 A;  4NGP A;  1JDE A;  2C6P A;  1DE4 C;  3TYX A;  3S9L A;  4CO9 A;  3U1B A;  1BXR B;  4OC0 A;  4OC4 A;  2YJT A;  2XEF A;  3RBU A;  2GP4 A;  3TLE A;  3IWW A;  3T05 A;  4C99 A;  3FEC A;  4CZ1 A;  2PVW A;  3EIF A;  1DIK A;  2AUN A;  2OLS A;  2AUM A;  2OR4 A;  4C84 A;  4P4D A;  3SJF A;  3ICU A;  5JVL A;  3K9T A;  2DIK A;  3T5M A;  4MCQ A;  1WVM A;  4C8A A;  4C9E A;  4P4F A;  4OC2 A;  3TLG B;  2PCN A;  1KBL A;  4C8U A;  4TJX A;  4YN3 A;  4JVO A;  3TLY A;  3EZA A;  1R61 A;  2PVV A;  4MI1 A;  4P4I A;  3S9M A;  1C30 B;  3TLB A;  5F5X A;  4LQG A;  4H1H A;  4MCP A;  4P4B A;  2X0S A;  4C8F A;  1KEE B;  4JYW A;  4P4J A;  2FM4 A;  3KAS A;  3IIB A;  4P45 A;  3SJG A;  2YJV A;  1GGO A;  2HRO A;  4C8P A;  4TWE A;  5FD8 A;  4COG A;  1V6C A;  3C8O A;  2EZB A;  5JYB A;  2EK8 A;  4KNG E;  3BXM A;  3BI1 A;  1EZA A;  3T07 A;  4OC1 A;  3TLG A;  1C3O B;  2C6G A;  3SJX A;  3D7G A;  3K4I A;  3BI0 A;  3FEE A;  3SR3 A;  5K99 A;  4EYS A;  3FF3 A;  3TLA A; 
#chains in the Genus database with same CATH homology
 2YJV A;  3NOJ A;  1NXJ A;  1Q5X A;  3K4I A;  2PCN A;  1J3L A;  3C8O A;  1VI4 A;  2YJT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...