5F1YA

Crystal structure of ba3275, the member of s66 family of serine peptidases
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
343
structure length
343
Chain Sequence
MLIKPKRLQAGDIVATVSPSWGGAGDSEIRWRYEQGVKRLEEVFGLTVVPMPNSLKGSEFIYNNPQARAEDLMTAFQDTRVKAIIANIGGQDSIRLLPYIDFNAIRENPKIFMGYADVTISHLFCHKAGLSSFYGPAILTDFAENVEMDPYTVEMVNRTLFSNEMIGEIQPAPEWTSERLEWIEINKDTRRTMQQNNGYELLQGSTTVQGRLIGGCIEVLEFAKGTELWPEKKHWEDSILFFETSEDHPEPSYIKYWLRNYAAQGILQKAKGIIFGKPKDEMYYEEYKHEILQVMKEHNLEDLPILYNLNFGHTEPKFILPYGSMAEIDCENGSFSILESGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords MccC family protein
publication title Crystal structure of S116A mutant of Ba3275, the member of S66 family of serine peptidases
rcsb
source organism Bacillus cereus (strain atcc 10987 / nrs 248)
total genus 109
structure length 343
sequence length 343
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02016 Peptidase_S66 LD-carboxypeptidase N-terminal domain
A PF17676 Peptidase_S66C LD-carboxypeptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Class I glutamine amidotransferase-like 5f1yA01
3.50.30.60 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 LD-carboxypeptidase A C-terminal domain-like 5f1yA02
5F1YA 3SR3A 3TLEA 3TLBA 5JYBA 4EYSA 5FD8A 4INJA 5K99A 3G23A 2AUNA 4JVOA 3TLAA 4IIYA 3TLZA 3TLYA 4MI1A 5F9MA 4E5SA 3T5MA 3GJZA 1ZL0A 4MJXA 3TYXA 4IIXA 4E94A 4H1HA 2AUMA 1ZRSA 3U1BA 5F5XA 3TLGA 3TLGB 3TLCA
chains in the Genus database with same CATH superfamily
5IT9A 3CF6R 2WJ4A 1DBRA 4N5NA 4UREA 5LJLA 4PHTA 1GARA 5JLAA 4RPCA 4WOJA 3VX3A 4IDBA 3CONA 3R24A 1UADA 2C59A 4DB4A 1MRZA 4FYWA 1TZCA 5FBHA 1J8YF 3SBEA 1QGZA 1P4RA 5AHRA 3F1KA 4EECA 2V45A 2ZRKA 4UHEA 4Z0PA 3RSFA 5BR4A 1TGYA 5AKYA 2VDRB 1JPUA 4BPBA 4L5CA 3LXXA 3P9SA 1XZBA 4FLEA 4D4IA 4Z7OB 1LQUA 1C0LA 4MARA 3M81A 1I1OA 4A10A 1IY1A 1P9OA 3A04A 4GC5A 3M6WA 2I80A 4D8XA 2ZLBA 1OU4A 1A9YA 4Y2VA 3ZWQA 3C7AA 1QTQA 1LPBB 2XKKA 1TJ5A 3QFHA 1DAIA 3AUUA 3PJFA 1V1JA 1SR8A 1ZKDA 3R5TA 3GAAA 4EPTA 1XMQB 3PRJA 1DJLA 1E2IA 2P3LA 2IHNA 3U44B 2JEOA 5TQ0B 4CCYB 1C7IA 2FEWB 1OKKD 1KI1A 3ZGXA 2XTJA 4ZI5A 1R6BX 2M1ZA 3RIHA 1M2HA 1QKJA 4R1NA 2JLUA 1DC6A 2H65A 3FEEA 3S9MA 1E0AA 1XALA 2ZJYA 3HZRA 1LD3A 4EB6B 3BWBA 3FTNA 2AC7A 2B4AA 4IGKA 3W4IA 2R96A 4H0NA 2WUVA 1IK6A 1TM2A 1P0IA 1JDPA 2AKAB 3BBLA 4OQMA 5GM1A 4XJTA 2OYCA 4ENUA 1TK2A 4UHHA 5KNDA 4CMBA 1AUVA 2OLKA 3PKZA 5A4AA 2JLVA 1YULA 1XN4A 4ZVLA 4PYOA 2EATA 1H22A 3G23A 3N2ZB 4MWDA 1NHGA 2PV7A 1E2EA 3LJKA 5E3JA 1E20A 3U7JA 3UJAA 1LY1A 1M72A 3HI4A 2AN5A 3DTVA 4MPTA 3A1EA 1E7SA 5EP4A 4D6XA 2C3YA 5AJXA 1J2RA 2CE7A 2RSLA 3V1YA 5BPHA 3DS8A 2QT0A 1U28C 2ZR0A 1XROA 3PE4A 1ZJJA 2GO1A 1E2KA 1JZQA 2EYUA 1IEVA 4PONA 5KJEA 3FDZA 6REQA 2XXBA 3LCJA 2IS4A 3TCXB 4DXAA 3H4VA 1G60A 3IEMA 5AJYA 3DOIA 5KSZA 2R4UA 3D4NA 2Q45A 3PZRA 3TDKA 2AIRA 5I7UA 4LQ4A 1YACA 3OE5A 3VDMA 5LYJF 2V7XA 3LDHA 3TAHA 5HWSA 4NOJA 2FPOA 4JN6B 2GP4A 3EULA 3QX7A 3T99A 1K6MA 1RCTE 1ZGBA 1HQYE 4FDAA 4UEOA 3WLFA 4ZI7A 1JEEA 1Y5NA 4KDFA 3WLJA 4JLOA 4NSNA 4WFKA 4PYMA 1CIJA 2EFEB 4IQ8A 3D6FA 4NAHA 2GWRA 4ZU6X 1RM5A 4AZ3B 2NIPA 1QH9A 4D9BA 3LYLA 3HFGA 1Z4MA 2P30A 3ANNA 5BOSA 2B5VA 4LGCA 4DQXA 4YMLA 1O94D 2NU8B 4KIFA 2XQIA 4C0JA 3OPVA 2NO0A 1N8TA 4YJ3B 1L5HA 3T9DA 1PWHA 3TX2A 5KBYA 1RXVA 4B87A 5FTLA 4E6PA 5DBIA 1HETA 2R60A 3E22A 1KA9H 1SOMA 2FW7A 4ZXFA 1I2CA 3DBOB 5DNYB 3ZZ1A 1T2EA 2JAWA 2DYKA 2JDIA 3E9DA 2X1HA 3F2VA 2QN8A 1PR0A 2H4XA 5DM4A 1ECJA 1GFIA 4MCAA 4UAGA 1YR7A 2HSJA 4X9XA 5IAEA 4Y1RB 2XMPA 4OOEA 4U7WA 1Z5ZA 4WK6A 5TDHA 1TMGE 2PRSA 2QPAA 1UM8A 2ZSUA 3A25A 2O8DB 4UOEA 5AJTA 4PFSA 3WLIA 4Q21A 3M1LA 4WY8A 4I4IA 4D9GA 2Q8QA 4XIJA 4XWWA 2Q6IA 2P5YA 4EG7A 3DMTC 2R8YA 3V4SA 3QVUA 3N2KB 3EEQA 5BYBA 4EVSA 1DEHA 5JY1A 3NBYC 3EN0A 3GK3A 4IKEA 1M75A 1QZUA 1DOHA 4K9RA 3DAGA 1ZOLA 4IIJB 4HXFB 4K1LA 1EFRD 3I2YX 4QNMA 1WL8A 3THSA 1CLUA 1MAVA 1ZMTA 2XUIA 3I0NA 3UEOA 3NOJA 1I9GA 3L6OO 4RENA 1R6UA 3IA2A 3MOIA 2V6MA 4RJJA 3MC1A 4EVQA 2SNIE 1HOXA 1EM8A 3ETNA 4WAUA 2J9FA 2QTWB 3ROTA 5CAEA 1TT5A 1XMOB 4OL9A 3DQZA 2GK7A 4JASB 3SPXA 1U9IC 4MV3A 1A9XB 2PZBA 2Z5VA 3HYSA 1IVNA 3DWFA 3BN3A 3MIIA 3EJWA 4JOSA 3F6SA 3IQGX 1VE5A 4CFYA 2A1TS 1XEXA 3OUZA 5EJ9A 1Y98A 3CUKA 3K0CA 3LXUX 1QP7A 4CM7A 4DJFC 5GIPE 3FPAA 3WGLA 2QSZA 1U04A 4N1AA 4E22A 1BHO1 3IQFA 3T5BA 2AI1A 4OMUA 3BGWA 1BWQA 1UMBB 1QIJA 3NH9A 4HTAA 2GBLC 3OHSX 3FHLA 4J9VA 2BAGA 4MB0A 5JASA 1AGPA 4BY9E 3QVSA 3EGWA 5JE8A 2VRCA 4JLVA 4FGUA 5EE9A 6AT1A 1L5OA 4C05A 2X4DA 1G8AA 4QREA 3QF4A 1CYDA 1NLFA 2G1JA 3Q3VA 1KNQA 5ECYA 2JZOA 3ND5A 5HKKD 1RTTA 1K9VF 1J09A 5ER6A 2JBWA 3VISA 4W7HA 4E94A 2GJSA 4PQYA 3QM1A 4IUYA 4LYDA 4RCZA 4JYZA 3MAAC 4H7JA 1QIDA 1WPGA 3AEKB 3AVOA 1MKYA 4RMGA 2HW8A 1Y6GA 3DAFA 4FBMA 2J1LA 2O1SA 4MLCA 3HLTA 3PHLA 3SNHA 5JTTA 1P19A 2J45A 4WKCA 1LK0A 4RSGA 2X14A 3AP2A 1GCIA 1WABA 3SF8A 2PPVA 4A0QA 2ZRGA 4JT4A 5IHXA 3E3LA 5HK8A 1SCUA 2GEDA 3HVRA 3DL7A 3O4FA 4LISA 1T3HA 1EHIA 3CF4A 3UYKA 2ZGVA 2HA2A 2ZB3A 3E15A 3NIBA 5ES3A 2C3OA 3LXMA 5DNAA 2G25A 3DLHA 3OCVA 3U4CA 2JLRA 1BFKA 3LY5A 4LE0A 3WGQA 5KSYA 1V7ZA 2VEOA 4JAVC 1HTTA 5J2UB 3FBGA 3PIIA 5T41A 2M6KA 3JYPA 5IDQA 2I2WA 2QX4A 4ND2A 4CR6A 1NGSA 5DNEA 5T67A 5ALDA 2GR9A 2YWXA 2P2LA 3N5KA 4MRSA 2BOVA 4OVKA 4BTVA 3GJ7A 3DF7A 3ZHVA 2G17A 1M6YA 2C4HA 4WACA 3FHCB 4WSOA 1HM5A 1KMHB 4RV9A 1KPGA 4ZT3A 3TTTA 4HJXA 1PGOA 4BE7B 1RYNA 5AICA 5JWRA 1IUNA 3IUSA 4ZA2A 3NUZA 1HL7A 4DR2B 1BNCA 3JR7A 2OV2A 4H6WA 4K28A 1KDOA 3DZFA 3FPKA 3VR3A 2J3MA 1SVIA 4FGKA 4L16A 2J4CA 2NZXA 1V8OA 4NQZA 3X1MA 1ZGZA 1ZXXA 2HQ1A 1G8GA 1KI3A 1PSDA 1DIRA 1E9SA 3BMNB 3DKIA 3E7PA 3VTAA 4YRTA 4CKWA 1RP1A 3L4EA 1EUDA 4B3MB 2O9JA 1RJDA 3TPZA 1PJLA 3U3ZA 4BRUA 3BWYA 3FE2A 3T5AA 4LCBA 4TS4A 4M0KA 3EVTA 4N39A 1V7PC 4F85A 3KCNA 4OIFA 1E3MA 2PFKA 3PVSA 3A9SA 4G23A 5ERGB 1P7ZA 1RRMA 4OAQA 1NLMA 4S1TA 3C87A 2XT9A 2BUCA 2RGCA 1WV0A 2FVXA 3HLKA 3TNDA 2R751 4XAQA 2J33A 4OYRA 1VGVA 2YJNA 4KO4S 1SQ6A 4CV0A 3SBDA 2WTBA 3ACCA 2RH4A 3A9RA 3BD9A 1A98A 3EXHA 4U8HA 1G3UA 1WCXA 3FY4A 1HK7A 2PNJA 4ZCIA 3UJHA 2EU8A 5C7YA 2HA5A 4RSRA 3ROQA 1J8DA 2GZ2A 5TPZD 4EJSC 1E32A 2IV7A 3ADOA 1U9YA 4FQ5A 3L7KA 1U2EA 4QODA 2XMRA 3L8CA 3VZSA 2Q9AA 2TECE 1G9XA 5EYPB 3WL4A 5H70A 5JJ5A 4BL5A 4MYDA 3R1IA 2TYSB 1TAUA 1XE3A 1PUJA 2QX9A 1KARA 2HA4A 5B1HA 3X1KA 5K8IA 3N5CA 1TYBE 1QHFA 3S1LA 2R00C 1DC3A 4YMHA 1M2KA 3T7EA 3H86A 4A16A 5LPNA 1ZEJA 4P7KA 2O7VA 2PX0A 1LLDA 3A26A 3HKDB 3NP9A 2EL9A 1M9NA 3EIHA 3QMMA 1A8SA 4HPJB 2OAGA 1U0GA 5BW8A 5C32A 1GCOA 5FTMA 5LFAA 1YBFA 1Z17A 2O3SA 1ISGA 2YW9A 3CNBA 3IEPA 4JUBA 4R51A 1P1RA 4NV0A 4WJKB 2B8NA 4TN1A 2H1HA 2HBYA 3D6TB 3JCZA 3K0HA 4LF9B 3D2AA 4MJ7A 2W93A 1BS9A 2Q2NA 4YAFA 1OPRA 4F06A 4M0CA 4J7AA 4TMTA 3DHEA 2B3TA 3CO5A 3V4VB 2ODPA 2W22A 4C5AA 1CS0B 2P4EA 1FUIA 3SEQA 3ZDAA 1GZ7A 1FFEA 2YY5A 3FJOA 4HDSA 1JKMA 4KMMA 4WFIA 3MZ0A 4LDZA 5ARBA 3F4KA 3QVTA 1U80A 5KDDA 2OZVA 4KR6A 1R8QA 3OCJA 1SBCA 3P9PA 4TWIA 4OUDB 4DPLA 3ADKA 4GPD1 2VO1A 4JBXA 3RUHA 1LZLA 3WWOA 2O54A 3EZNA 1VFPA 5KKNB 3IYLW 2WWVD 3TSYA 2P1RA 1VJDA 3L18A 4DV0B 4OC5A 3W2HA 3L6UA 4CQJA 1FP6A 3I1FA 2GAFA 3IPLA 3ZJYA 2CNWA 4FYJA 5HBGA 4M1WA 5EN4A 2AL7A 1KVQA 2PX3A 3V8QA 4LY9A 2D4AA 3AEUA 4GZLA 3ZD9A 3MOSA 1XVVA 3A3KA 4DR1B 3GCWA 4ROTA 1A8IA 4YAGA 1KFEB 4G84A 4QXMA 4I5EA 1JDSA 1FFAA 1PR9A 1U1EA 2JI9A 1A4UA 5DI9A 2WHRA 1HFWA 3WG9A 5KDOA 1BHJA 2CXQA 2VJQA 4JP1A 4M8IA 4WTOA 1Z74A 2ILTA 4Y98A 1AM4D 3MK31 5E1MA 4DUPA 2SCUA 1PN3A 3EMKA 1HORA 4R2WA 4AICA 3EX7C 3PGA1 4K3UA 3UENA 3A32A 3KB6A 2JGIA 1H2BA 4QEZA 3DV0A 1HTBA 2QDXA 3FZQA 1USIA 2P68A 1EP2B 2Y0EA 2P4HX 1QB8A 4MV8A 4U2DA 2VDUE 3QLVA 2HLDD 5DP2A 5CA0A 4D02A 2J6CA 2HRCA 3TFQA 2BGTA 7ADHA 2HJSA 1H2EA 3LDFA 5EPUA 4GOMD 3UMBA 1E2NA 3EDRA 1RW4A 3I30X 1AT1A 1KVSA 4S1NA 3MS7A 1UQTA 1UIRA 2A5JA 2I29A 1Q16A 4TN5A 2CT8A 1FDUA 3NQ41 1SB9A 1E2QA 3ZLVA 1TOAA 3OFND 4K6FA 4JLBA 2OUKA 4QXAA 3BF8A 3T7KA 1R3UA 1ZLYA 2O8BB 2HK8A 3DTYA 2D7JA 2QSJA 3MVEA 1OA1A 4PCAA 7MDHA 4JLNA 3QTTA 4WBSA 3IR5A 4RACA 2V5AA 3MTEA 1ZZGA 2I4RA 4D79A 5JS8A 4X24A 1U0FA 1ZK2A 3CA8A 2W2QA 3PNSA 4R2IA 4YS6A 2H52A 1C4XA 3BJMA 3ZVRA 1JQKA 4EWLA 1K5GA 3IEXA 4V0KA 5J9FA 2OV1A 3LLUA 5FX2A 3AONB 5JYCA 5ARCA 3WIOA 3DR3A 3RKUA 3H5TA 1WSWA 5CCEA 5DTJA 1YA8A 1YR3A 3GBSA 3IKMB 4DCJA 2ZUTA 4ER0A 3SE0A 5K05A 2RGNA 3DEAA 2YNMC 3RASA 3RUIA 2LGJA 2IYSA 2O3JA 4WA8A 1F6BA 4M83A 3DZIA 3G5TA 2JIMA 3LFUA 4QLBA 2NSDA 1OJ7A 2FPKA 3FYHA 1Z68A 3INTA 3ITEA 3OSZA 3OT1B 5CVCA 3U3MA 4DYHA 3LQQA 1LDGA 1G5HA 2AXQA 2BGJA 5JYDA 2ISSD 1U2RA 4DZTA 1XJCA 4NZPA 2RHJA 1T10A 4YP0A 5AKLA 1WKCA 5T57A 3WFJA 3WP0A 1E9EA 3TNFA 5BSHA 4G9GA 4NL4H 1WM1A 2OENG 4X61A 1B8UA 1GKLA 3ANLA 4UAUA 5FO0A 4R16A 1KK3A 4CQLA 4JVOA 5A6SA 5IXYA 3FWHA 3SEZA 2EKQA 5CA1F 1QTNA 3RS4A 3FNGA 4MI6A 2VYND 3U7RA 3ZWVA 1BDHA 2CK3D 3PFFA 4KNWA 4E2WA 3G2HA 3PUYA 3FSGA 1JHZA 1KC3A 4NESA 4Q4CA 4H7KA 3ZY2A 3LOUA 4KO1S 5C52B 1N9GA 4X62B 3ID6C 1U81A 2WWTA 3SQXA 2CUKA 2CBXA 2Y9MB 4LXQA 5AW3A 1GQQA 2I78A 3IX7A 5KOIA 5YASA 5HDBB 1P6QA 1Z8FA 1AD2A 3M6FA 3OIWA 4HZGA 3R7DA 1WDLA 3CF4G 3D8SA 4XX0B 1GQOA 1N9KA 1AHIA 1N2EA 2FF7A 2ZTHA 3IJPA 3OTGA 1LBIA 4LNHA 4UPVA 4QBIA 4AJLA 5ISMA 1UDXA 3TW6A 1ECBA 1R9GA 4RSHA 3H2ZA 3FTFA 5BW4A 1I2DA 3NCHA 1FSFA 4OJYA 1FSSA 2HMWA 1BVUA 4ZFNA 2ANBA 4XGNA 2Y2UA 5M29A 1L7DA 2CDAA 4M9XA 4PAQA 5M2QA 6NULA 2RH8A 1H2FA 3W9BA 1RABA 4Y2QA 1FNCA 2DPHA 2IZ6A 3AW8A 3D8TA 3FDZB 4EEZA 1W5AA 3B1YA 6REQB 4NOMA 3S8EA 4JFAA 1N1MA 1XHEA 2WJWA 1JAZA 4B4UA 3NIWA 1TM3E 4Q1BA 5H8WA 4Y9TA 4DS3A 3VVLA 2W6JD 2X5XA 1NBMA 3K1AA 2P62A 4MVJE 3FLEA 1EUYA 1KE2A 2R7MA 1EWTA 3IT0A 1KSJA 2AYZA 2IHTA 2FP4B 5HQ3B 1NJ1A 1J8FA 2ZR7A 4KWEA 5LZ7A 4B6GA 1QFXA 1OYVA 4NBTA 3UAXA 4ZI7B 2OQ2A 4RTRA 3P9CA 4RQUA 2GEJA 4FEEA 1RFLA 3H2BA 4K3VA 4F2WA 4KJZA 3QU4A 4KBFA 1AK1A 1OXVA 1GFZA 4BV8A 1VE3A 5AK4A 3KJQA 2I1LA 4UD2A 1Z82A 2V7BA 3C3DA 2ZJ0A 3NT5A 4FDTA 1W25A 4KXUA 4R2LA 3T95A 3VBCA 4A9AA 3ZIAA 5CFOA 2XB4A 5ED4A 2GM3A 4JYWA 5U4XA 5JZMA 2PSSA 3MJEA 2Q3DA 4DIBA 1HMPA 2VJPA 2AQ8A 2ZVDA 3CNLA 4EG6A 4DMMA 1ODKA 4EKIA 2GUGA 3QVGB 2CDNA 1RRVA 3CRNA 3QVMA 4HEA6 4V03A 1CHNA 3E22B 2ZAYA 3LXRA 4YHHB 2XSZD 3GX1A 2QG6A 1Q7BA 2ATCA 3OURA 2CFTA 5FF9A 5FV7A 3UJCA 5KOYA 2ZIAA 2JCYA 1SBIA 3H3XA 5C7IO 3E3AA 4HPWA 4PC2A 1DTWB 1Y8RA 1T2NA 3ED1A 4U39A 3VYVA 3CR8A 5AHWA 1I2ZA 1SVKA 2D0IA 2Q5FA 2WQZA 5TPWB 4KC0A 5TXGA 3E9ZA 4RDCA 5HM8A 3C85A 5E8JA 2VDWA 2XUHA 3OUUA 1SU4A 2HNKA 1K27A 4BDTA 4C4AA 1PHPA 2Z8YA 3N07A 5KO2A 1SHTX 4BVFA 5HTKA 3F1LA 9GPBA 1YR9A 4Z0HO 1N1EA 1ARZA 1J20A 3PWTA 1J7JA 4O2LA 4BBJA 1K3TA 4K9LA 4Y8VA 4D92A 2RGEA 3O74A 3ZQUA 5JZVA 1GRQA 1ZK4A 4G5GA 3A27A 4P81A 5AM3A 4BNDB 4LAFA 2AKEA 3RTBA 2JGKA 1OA0A 1USKA 4E1BA 4L6IA 3DEKA 1JZSA 4UBOA 1EM8B 3KQTA 3CLKA 4OQ4A 3QX3A 3R3HA 3C43A 2GYYA 3D4OA 5L4NA 8GPBA 1TJPB 1V2HE 1W7AA 3EA5A 4CV1A 1N6NA 1OIWA 2GM5A 3M4JA 4IO0A 4NYMR 4XFJA 4RL4A 3ZCSA 4QUHA 5T4EA 1WNFA 3T5DA 3UCXA 3MWEA 2D13A 3K9GA 2H4HA 5DBHX 1KDZA 2XDWA 1E94E 3H5RA 3IIIA 1IY2A 3WWYA 1J0EA 2R5NA 2D6FA 4RPKA 1TDJA 2GD6A 2W48A 4BNVA 4OYYA 4BQNA 1QKIA 1Y3HA 4Y6LA 5DBGA 4C8PA 3Q7RA 3ZWAA 1S8FA 3QLJA 1CEXA 5EKXA 2A5GA 3W5BA 3EPRA 2H06A 4HX5A 3F5MA 4MS1B 4XDGA 4YWHA 3S1AA 4U9HS 3AF2A 2VPTA 2JIOA 1IN4A 1KFCB 1XYGA 3AFGA 3WWCA 1MXHA 1BXRA 4KQ2A 1O97D 4EKDA 5HNKA 1R27A 2V96A 1VSBA 1RYDA 1SVMA 3FOFC 3MINB 2DKFA 2R4TA 4GI1A 2Q7XA 5HQJA 1YS4A 3LPLA 3AF3A 2Q46A 4UMEA 4FSXA 5C7LO 3JR3A 2Q5QA 2ECOA 3EOAI 3V42A 3HYNA 1SZJG 1M34A 2C3MA 4JJZA 1ZM2A 3VR5H 3L0CA 3BJRA 1GM5A 3VNRA 5CDSA 3QEBZ 1H8HD 3V8MA 3KQNA 2C2XA 3NYIA 3WK8A 1ULTA 2I22A 4ZOAA 5AOAA 5LYYA 4N5LA 5BYKA 2Q1SA 4OU5A 4RKWA 4HYTA 121PA 2WPDD 1Z15A 4GE3A 4JROA 2JH9A 1U3UA 2VPXA 3R3YA 5B7NA 1VQ1A 1TB4A 3A14A 4MR8B 3LVBA 3C1AA 3N3BC 1QQ5A 1YH3A 2LRHA 3YASA 3NGMA 2I03A 2ZB8A 3V2IA 2P67A 2W98A 2CN1A 4UTNA 3K0SA 2FK7A 1XVTA 5HUJA 3AFHA 4HDKA 3RTAA 1KU6A 1NURA 2C5HA 2Q2QA 4U2GA 1OT5A 1QFJA 1TU4A 3RJ5A 1I4WA 1ZVKA 3MMXA 1Q7TA 5SZIA 5U1PA 3SVLA 1B1CA 2R8OA 2IPXA 1YDGA 2K7FA 1B7GO 2W8ZA 1Z7YA 3PQFA 3QUQA 4F91B 5G3YA 3UT5A 4CUJA 1UJBA 1WG8A 2CMFA 2J6IA 2QTLA 3HADA 1PWZA 4RF4A 5CM9C 1Y7HA 1EGMB 1XKLA 3Q8WA 4AJ9A 2BUBA 1TCVA 1GKIA 4YJFA 3KT0A 1JEJA 1UC9A 2K6GA 4KMOA 3F3MA 4I55B 3T61A 3WBJA 2IY8A 3VU9A 2BW0A 4ZEXA 1KBZA 3QE9Y 4ARZA 3SEAA 4R1PA 5HILA 1A4IA 2EG5A 2WJGA 2GZSA 2I4TA 1P9LA 2AOXA 5SZKB 4AROA 3MAJA 5TMEA 4CKWB 3ESAA 1EUDB 1XDSA 2VYVD 3C7KA 3OTQA 3RYIB 3NTUA 1O0SA 1G8MA 1LNSA 2ADMA 1XRSB 2QZJA 3SYKA 1IRIA 3T4EA 2VBCA 5HFJA 3T1TA 1BQ3A 4QPDA 5FOTA 3VV3A 2ZR9A 3T4UA 4AG3A 4EW1A 3CGWA 3QW4B 3RU7A 3BZUA 4J6EA 4RVGA 3LYHA 4IYJA 1X1TA 1YZTA 5DASA 1C7QA 3IS3A 1CUHA 3KOOA 3OEHD 5E4JA 3OTOB 4PLHA 4HEA1 1ZXBA 3CPSA 3JVEA 2AQHA 1SIWA 5EIFA 4Q00A 2YYAA 3V1MA 5HCNA 5KJ1A 3B3GA 1FFCA 3EXHB 4KMSA 3FWYA 2CYBA 3ICPA 1K6IA 2GA8A 1S8OA 3H9GA 4HTFB 3HYTA 2PU5A 2W6OA 3HUDA 1CIVA 1Z3IX 4EEKA 4ZCRA 1V4VA 3HACA 2F9MA 1PWYE 2H54A 3KOUA 1GA1A 3KWLA 5EIXA 1ZJZA 2QKYA 3B2EA 1ISMA 3JRWA 1W8DA 4JP8A 4XQGA 4IIYA 4M3NA 4FSHA 4X7PA 1ATZA 4N01A 1F48A 2Q5OA 3AO0B 4Q6BA 4QBGB 4I1YA 4Z99A 5F64A 4Z2YA 2VWPA 5JECA 1B0ZA 1JBKA 4P33A 1ZPDA 1YAJA 2H48A 2YMLA 4EJFA 1J0DA 4WK2B 4HB0A 4XB1A 2FFJA 2GPNA 4HNHA 4XD7D 5IKEA 4UHBA 1HDOA 5H3LA 2NMVA 5JI3E 3KFVA 3SNKA 3BGVA 3CFYA 2IIBA 4DCUA 3A28A 3T07A 1USWA 1AV6A 1OAOC 2CNNA 1NVVQ 5KYWA 3ANTA 5JAZA 3UFXA 2QUJA 4II3A 3KJHA 1SU7A 2PXXA 4IV0A 4BVGA 1G8JA 4P3PA 1ZMOA 1JI3A 3QQ5A 4TXLA 5BXYA 3K5IA 4RM2A 3WHLA 3C5HA 3LIIA 3QG1A 4G63A 2ZSDA 3U7IA 2YHUA 4DSUA 4DR4B 4BN0A 2YCLA 4ZAFA 3O9VA 2WI8A 4LSWA 4DUZB 1G3IA 2DPLA 1P0CA 2QXTA 3B9PA 1DHTA 3GT7A 4LMPA 4N0DA 4RK7A 2VT6A 5DXAA 5LP1A 4C4YA 1U4OA 2FPIB 4QEKA 5CVTA 4NDZA 1DXHA 1R8JA 1SIUA 2D74A 3C24A 3GVXA 5KEIA 3GWGA 1W36D 4CI0B 1E4VA 1N57A 3E23A 1DKQA 4R1UA 3CEJA 3WZ2A 3T0GA 3IV7A 3KT6A 1DLJA 1G8YA 2I8LA 4B0PA 4FNOA 2R62A 3O47A 1Z62A 2YTZA 4I08A 2GAIA 2UYGA 4GNRA 5I8ZA 5LB4A 1B93A 2Q5LA 4DA9A 2LV8A 3D2LA 4IDFA 4E6EA 5IULC 1YL7A 2BMEA 1JHXA 1QZ3A 3H8VA 3RBXA 2OFPA 1W4ZA 4B9AA 4E08A 4J2HA 5CD1A 2MJLA 3H87A 1DC7A 3BSSA 3ET4A 4ENRA 3A9CA 1SC1A 4J0GA 4OP2A 3FJYA 4BJ5A 2HIGA 3PHHA 4Z0NA 1UC5B 3PPXA 2HL6A 3CRW1 5K5EA 3GJSA 4RUKA 1DG1G 3THXA 4EG1A 5AVRA 4ED9A 3WDMA 3T06B 1TZ2A 3DPUA 1A9SA 2E9SA 4D0RA 1EK0A 4GP9A 2XMCA 1UAYA 1BFUA 2C0CA 4US0R 4ECAA 1J1IA 1NXVA 3BMQA 5KYVA 4KE6A 1E2HA 5HMMA 4WHMA 2XEJA 1UZNA 1ULUA 3S29A 3C7CB 2XOKA 3CH7A 4KQXA 2SHKA 2A33A 3ZDYB 4JA0A 3DV0B 3GRFA 2YC4C 1C30B 4NATA 1G5PA 2XMBA 4KVZA 1ZGGA 2DAPA 2F43A 4W6QA 2RHCA 3FZYA 3M8KA 4XCQA 5AJHA 4BEWA 2PNFA 3O8LA 4QDUA 4R9NA 3SMVA 5EUMA 1M0TA 1TVCA 4IGFA 3CH5A 3KEQA 2RD2A 3E9CA 3TDMA 3QHPA 2R1TA 1U1DA 3P4YA 2ZZNA 1Y33E 1KAGA 4JBNA 4XRGA 3OOWA 3LMKA 1FU8A 4BC1A 2JJ8A 2Z3ZA 2PEYA 2FPPA 3UOAB 5JW6A 1Q20A 5EIHA 5LXTA 2GLXA 4JLKA 2RI6A 3DLCA 3CPHA 1W5FA 2EZ9A 3PNBA 2NU9A 4N3BA 2V7UA 3DL0A 3IT2A 3KZMA 5EMLA 3O03A 4DJTA 2GARA 1C8KA 1F6DA 1U2GA 2XNJA 4MRMA 1JSZA 3UJBA 2WYOA 4WPGA 4P4TA 1QJCA 1YOVA 1TECE 3A7DA 4L85A 4WN3A 1RXWA 2QLTA 1EPUA 4EJSB 2ZSEA 5KYUA 2JIZD 2OHOA 4Z9FA 2E0IA 3L92A 4IUCS 4KQWA 2QW1A 4NU8X 3G6WA 3IMFA 3SFVA 2NX2A 1C3JA 1NLZA 2IKQA 3VSBA 3G6KA 4IW3B 3A4TA 4ND1A 1PJ4A 2VXCA 4KNVA 1U6IA 1UMDA 1HF3A 2HHLA 4TRRA 1M76A 3PA8A 5DI3B 2PS0A 2REBA 3G82C 4O63O 3AG5A 2PZLA 1BVYF 2G72A 1Z6ZA 1ZDMA 4WBNA 6CHYA 5EUQB 2QK4A 3OEEA 4FW9A 4OHUA 1SN7A 1HI9A 3GJ5A 2X6RA 2VK2A 4E5NA 1U7TA 2Z08A 5CXXA 3NB0A 1O8CA 2HBRA 1Y7TA 4GW3A 1X74A 4KQGA 1JW9B 1JG4A 2PIAA 3DE1X 4C6HA 4CLEA 4GUDA 1C3LA 2O4CA 2ZVPX 4O1MA 3LOPA 1X9HA 3PVZA 5IYZA 2IGBA 2WJHA 1L4GA 3QXXA 1V1RA 2E5FA 1NBIA 4CV3A 3PQ4A 2XQFA 4CV2A 4I5GA 4DTCA 1LDYA 2VP3A 3FFXA 3TNYA 2G76A 5PGMA 1E1MA 4JJIA 3IIEA 2HAEA 4POOA 5JCOC 3LP8A 1L4UA 1SHLA 1Q91A 4HWRA 5DRYA 3ZWCA 1BGXT 3EGIA 4EITA 5CA0F 4ZOBA 3UYLA 2UUOA 1B3BA 2IOHA 1EX1A 1DHRA 4P54A 1JYFA 1X7GA 1T0PA 4OQEA 4EW3A 4M37A 3DW3X 1EEXB 4FHFA 4MUFA 5I6DA 2F7SA 3L8FA 3R8FA 1D2EA 2DWPA 1M0EA 3ZV4A 1D03A 3FPCA 4NVRA 4OLJA 3TLBA 2GXQA 4AF7A 3ESXA 3JQ7A 3MCTA 1G9SA 1AHHA 2GMWA 5ERYA 1FVHA 3DT8A 4QASA 5HIKA 1Q17A 2JFVA 3CZCA 4ACAA 3CIFA 1PZMA 1T5LA 4YONB 3L0IB 3D3JA 5CYOA 4E88A 3NTXA 5A6VA 5C5EA 4MWOA 4RZIA 1H6DA 3NDIA 2JCXA 3V6MA 2XB2A 4RO0A 1YVUA 3ETJA 3ICUA 1DIBA 4EG3A 4KUEA 3PTLA 2R6ZA 1YVEI 3I6IA 3EMBA 4IXWA 1TK9A 4JP2A 1M8FA 1PO7A 2OHFA 1IY0A 3KWJA 4DE5A 1HLPA 2A0WA 5UKDA 5KSWB 1Q1NA 5JXWA 3FPGA 1QDLB 1WMSA 1RPTA 3ZDXB 1BN7A 2I7VA 3JPYA 3FF4A 4XSGA 2ZULA 1OFGA 2Z5FA 1U8TA 5TGTA 1N3LA 2GB4A 2JGMA 2VA8A 3KD2A 3LLCA 2KLBA 4GS5A 4U3JB 2P9EA 1ILWA 2OUIA 1G5IA 1MTZA 3HO1A 2NAFA 1VCNA 2WVJA 3LT1A 1Q0PA 2HZ7A 2NPOA 4MR7A 1L4NA 5AKEA 3UB4A 3UKDA 4MEAA 5LQSA 2O19A 1C9NA 1L7BA 1DARA 2G06A 3N0XA 2IP1A 1ZI8A 3W7AA 3HV0A 3I32A 1OQAA 1RQ7A 1XKXA 2ZQZA 5BWOA 4D80A 3RDPA 2Y77A 3FBTA 1XCPA 4WL0A 1M8PA 3ETDA 3EQ9A 4JKOA 4PSVA 2L18A 2P9YA 3DMGA 4BO2A 2J5KA 3BQ9A 4GL4A 3B6ZA 2POQX 2WWRA 1VJCA 4GVXA 4LX8A 2BM1A 4P32A 4YFYA 3SYTA 3VNQA 2UUBB 3D7DA 4ESOA 3NUQA 3BK2A 4PC1A 1QQBA 1MG5A 5TEVA 4CMCA 4DABA 2QAGC 4NGPA 1L5WA 4HVCA 3I1IA 3F7MA 1MF7A 2P27A 3K0FB 4W1SA 5LNK1 1BVHA 1VLQA 5ECGC 4GI2A 4IZHA 3RREA 5LQDA 3ROXA 2I9KA 3HA7A 2OCXA 1GGOA 1CCWA 4AG6A 4ZN6A 2B4KA 3FHJA 1PK7A 3IXLA 5B58C 3NT4A 3EXEB 4OH7A 4RPIA 3D5TA 4LZWA 5DCUA 1FX1A 2WWFA 3GOQA 1FIUA 1MXFA 3NHFA 1KVUA 5DCLA 2QYSA 3C3WA 1H4TA 2PD3A 1FVFA 1KQOA 4EFKA 1ZSVA 2X0EA 1JR3A 4ITRC 2LDBA 5AUQA 1E5VA 3ITKA 3FZNA 1UT6A 3A3YA 1GV0A 3HVJA 4Q7LA 5K0SA 3DE0X 5LUBA 2J8ZA 4O0MA 1TX4B 4BV3A 2GEKA 3I6YA 5A4IS 1XZFA 4I3HA 1AKTA 4O3FA 4EMSA 3ELWA 2IPLA 3NEJA 1E1RD 2GSDA 2JGDA 1H1TA 4FCCA 4QFMA 4NNPA 1D09A 1XDUA 2A9KA 3IDSA 5E2AA 4DA7A 1TK3A 3DFIA 1YHZA 1K4MA 1MVNA 1T8PA 2EW8A 2ZWIA 4NDAA 4OLFA 4DR3B 1KC7A 4OC2A 3PHIA 4PZLA 4PZPA 1Z4IA 2OKGA 4RA9A 1G5QA 3ZWYA 3S2EA 2Z2XA 2LNDA 4GLJA 4RZQA 2G07A 4CUZA 3H97A 3NRBA 4MIKA 4TWBA 4YCBA 2PH3A 2W83A 1RWQA 1EJ6A 4BDSA 2DWUA 3EEFA 2V74B 5LUAA 3W77A 1G9TA 4M4SA 1BG6A 1FYWA 4R2HA 3IP6A 3KV1A 2J0QA 4NKRA 3R9KA 3GUZA 4JI4B 1YKGA 2ZE5A 4CDJA 1DIAA 3AI1A 2VHTA 1SD2A 3FOWA 4MP3A 2QVBA 1W85A 4G5OA 4ZO9A 3VO9A 3ZZNA 3CURA 3SDZA 4E12A 3NFYA 1FJGB 5I9BA 1HE8B 1XZKA 2RKBA 3I53A 2X76A 2ZIEA 5A4FS 1ISIA 2CXPA 4Q3EA 1RWKA 4OAOA 2NNLD 3IVXA 3IUPA 2IZ5A 3F5SA 2GCPA 4WINA 5BWMA 4RGVA 2DQ4A 4C4ZA 4UMDA 1JFSA 1D2MA 5CGZA 2HYDA 2J3EA 4TV9A 3D7MA 1FNSA 2EC5A 1DC5A 5LB2A 4BZPA 5ICGA 4BLTA 1Y8AA 2F90A 4UDOA 3RNLA 4E3WA 1QH1A 4HNQA 5AKHA 4DCSA 2JFNA 4LDAA 2YN4A 3PR3A 1D6NA 4JMPA 3L49A 5F98A 3EWAA 3N7TA 5DM0A 4CMGA 3QVXA 4FD2A 5ELYA 2Y1GA 2IU3A 3R7AA 3ZE1B 2C4WA 5CDFA 2IXFA 1LZKA 3QEKA 3GRZA 2GYVA 7YASA 3O75A 4WA7A 1J1ZA 4UZSA 4OQQA 4BNYA 4CMJA 4LRUA 1JVBA 3PXCX 2QYHA 4QE3A 4I9NA 5G0VA 4XDYA 3R7WB 3C41J 2MMCA 2WSMA 4V24A 3JAKB 4NZOA 3SZ3A 1KU0A 1YMQA 1YJXA 2R82A 5KYTA 4G2NA 5ERXA 4JBWA 3V8NA 3KKKA 4J0HA 1LUAA 2OCPA 1EFLA 1NW5A 4L8VA 1Q11A 3BA1A 4YCNA 3U17A 1K66A 2G9QA 3O73A 3VOAA 4BUCA 2A92A 2AG5A 2QJWA 2D2VA 3JQPA 1L5LA 1CYEA 2Q1YA 4CQNA 1PGPA 4GVLA 3WP1B 4IHKA 5DM60 1JX6A 4TKLA 2XZLA 3I28A 1ZOIA 3ZHSA 3PX3A 2ZJAA 3PS9A 1UL1X 1Y34E 1JKJB 4K2HA 2HM7A 4FFBB 1MDBA 3JV7A 4ZVQA 4WK0B 3B5IA 5BY2A 4D41A 1FVXA 2XY4A 5L4SA 2H00A 1GGMA 1HKUA 2QZSA 1N7IA 2XV1A 3CN7A 1IUKA 3AJEA 2PUVA 5DN6A 5C5IA 3CW9A 5K0BA 4MRAA 1N1GA 2R1UA 2I4IA 1MPTA 1QZXA 2W8BB 2Y1DA 3B7PA 4IH1A 4S1VA 1MMFB 1G38A 3QVJA 5GQSA 1QYXA 2BHLA 3GZNB 1GIAA 3TOVA 3AUXA 5B57C 5A62A 4IS2A 3WBBA 4AYWA 1U5BA 2G9NA 4JI6B 4CNBA 2H9AA 4ERXA 4RTMA 2V0NA 2YYSA 3HUTA 3MCZA 3PRHA 3AVWA 1PJRA 1WHSB 4NGRA 5THXA 2DFLA 3PXXA 2B6NA 5ITZA 1FTQA 5GV8A 3JQFC 4YRPA 3VR4D 4CDKA 3WL5A 4EY5A 1ODSA 5FNVF 3PEUA 4IEIA 1GU0A 1SH7A 2XJ9A 3RTGA 1DIKA 1T3GA 1ZJ5A 3DAHA 3NW9A 4B7XA 4QBKA 3KVRA 4M7OA 1DAFA 4TVKA 3O2NA 1VCHA 2I87A 2VH1A 1JEDA 4HWKA 3AHEA 2QUIA 3CB2A 4IXTA 4JYMA 3NGLA 4Z0TA 3IGFA 5JHGB 4E2XA 3EVEA 4H7PA 3L7JA 2H0QA 2V7TA 3K9HA 1X1RA 1XU7A 4ZHQF 1NPDA 5K0JA 3I8OA 3AGQA 3PQ8A 3V6LA 4G5YA 1JSLA 4PHFA 2C5SA 3CKLA 2W2NA 5I9IA 1HE5A 3ITNA 1JHOA 2O6HA 3PP8A 3ZDQA 4COOA 1QYWA 3V1TC 3OTWA 2NTVA 3U4MA 4U0KA 1E3IA 5JCJD 4GLOA 1CPYA 3L40A 1NXPA 2JLQA 3M70A 3JALB 2ONJA 4AC9A 1LF5A 3TO5A 5H9WA 2W6IA 3A2NA 5D1HA 3ZEIA 1F4VA 2WM3A 2UUAB 1MX5A 5LP6F 2WSBA 3AVQA 3NNNA 1DCKA 1YB1A 1CDZA 3ORFA 2VJMA 5KZMB 1MB3A 3MPOA 4NF2A 5H02A 3QEAZ 3ZJ5A 4IFEA 1CQJB 3UGJA 2VDJA 4LMBA 2IYXA 4E14A 4EHJA 3TD9A 3W3AH 3W6NA 1E2GA 4LIPD 4RQAA 1RZUA 3CLRC 3F47A 4Q4HA 2VPPA 4A91A 4B4WA 4TYMA 4U7JA 4LBZA 3TRJA 1T0IA 2BM9A 1BSVA 1WDMA 1L1RA 1KPIA 2ONCA 3VFDA 1LTHR 1O1YA 4CMIA 3TMAA 4QFBA 4A8TA 1X7ZB 2OP0A 5NLLA 4DAOA 1W52X 5B4TA 3NAQA 1BDMA 2QN7A 2FQXA 3RBAA 4HC4A 4WXMA 1QVVA 4YPFA 3I5MA 1RRKA 1KORA 1UWKA 2VJLA 4H6VA 1O95A 4C29A 3DHNA 4JJ8A 4JLUA 1SEVA 3I5AA 5EXXA 1E2MA 3E2PA 3KS9A 3D1LA 1ULHA 4LZLA 4K5QA 4O25A 1AZTA 1HDXA 1WXFA 5KQPA 2DY1A 3DKKA 2XNCA 5EHGA 3P2YA 2XTNA 4UTXA 4XTRA 1T1SA 2X5OA 3BB1A 2QP9X 1EAMA 4HWOA 5LNK6 4L3VA 2VHVA 2QUHA 4NENB 1XNGA 4YV2A 2JG3A 3BAFA 4BVAA 1JH8A 3EG9A 1KERA 2C2OA 1NR1A 1YXMA 2AN1A 2RHWA 3L77A 4NLLA 5F5NA 1L5NA 5AW1A 2WTUA 1DO2A 2ZCUA 1ETUA 1KY2A 4HGPA 2AV6A 3MXTA 3EA0A 3K1ZA 1ZMRA 5A4KA 3QUAA 3IV6A 2W42A 1JECA 1JR4A 2R1TB 2WT4A 4E7OA 2XIJA 4LF4B 4LCJA 3JARA 4OHKA 1VMDA 3GVIA 4BN5A 1EXWA 3OY7A 1DX9A 4LRSB 3OQVA 4Z4EA 1EFVB 3KE9A 5F35A 2BFEB 1XZDA 2HK9A 5MN5A 2YWHA 3CVJA 2JJ1D 4DCMA 3QXCA 4RAQA 3GEPA 5ANRB 3I52A 5H81A 4MRMB 4CM5A 3NBUA 2FMUA 1VLJA 2H1OA 1QIKA 4G67A 1IIRA 2IXEA 1L1QA 5ES4B 1ZUNB 1M6HA 3FCXA 1KAQA 2C58A 2HJRA 2MR6A 3Q88A 1CUZA 2HMSA 2FWJA 1HQDA 1YS9A 2C88A 2WUEA 3MIZA 1DINA 3OOHA 3E81A 3VSCA 5JPDA 4WI1A 2XXAB 3G0HA 1CR6A 3LT2A 4DQKA 1VMKA 2VOEA 5DX0A 2YWGA 3GLKA 2R4QA 4LYYA 1NR5A 4AL4A 1R9NA 6GPBA 4I81A 1MOPA 5DDIP 1P7YA 2BFDA 3S7ZA 3RSOA 4FS3A 1NKVA 3LRTA 4PPFA 4DLXA 1NQTA 4OMEA 1VHWA 2OLJA 4LJKA 4WBNB 4QHSA 1P7WA 5BN5A 4E46A 4GEKA 2GF2A 1CUXA 4X0EA 2FFAA 1RWXA 3L04A 1L4BA 2WE7A 1I6MA 2F59A 2YS6A 3M6LA 3P0FA 4KFUA 3T54A 4EUNA 1O9GA 3KR1A 2EW1A 1DBWA 4YCJA 1UKAA 3SJ7A 3ZWKA 5I7HA 3PLAE 1C7EA 2E49A 3RO7A 2O8FA 3MM4A 1AU9A 1NI4B 1UINA 3LGAA 5COAA 3BB3A 2PEZA 4Y30A 4YVFA 3NBMA 3ACBA 4E4YA 5J4HA 1PTKA 4MROA 4UDXX 1H8EA 5BSGA 5ED0A 1IQRA 3O92A 2OBYA 1Y5LA 3IBFA 4L0DA 1A8QA 3UW3A 4DM3A 1WETA 5BQ5A 1Z2NX 1Y37A 3ZDCA 1YFLA 2JGJA 4HI0E 3ZGLA 4DDTA 2PXHA 3B3QA 3EXG2 1WTAA 1AE1A 4LHSA 2WM9B 1QE3A 2VYFA 4R1SA 3ZI4A 1HFJA 3JQCA 8OHMA 1FTYA 3WNDA 4UNIA 4WZBA 3ZH2A 2PGNA 3P20A 5BN4A 4KLAA 3AR8A 3G88A 2FN8A 1JHDA 4WKBA 2JCVA 3E5MA 5LXTF 1TE2A 1UPCA 2PX6A 1M2FA 4DCVA 1QOPB 1Q7EA 2DUMA 5LLSA 2AZDA 1Y3CE 2ONZA 4WZZA 3LT4A 1GDDA 4NV3A 3TUJC 4TVOA 1S5PA 4E2ZA 5JZBA 1XJ5A 2DXIA 3B38A 1KKMA 2A35A 3OEWA 3AU9A 4W1RA 1WZCA 3L6BA 1PFKA 3CZPA 5FBRB 4D5EA 5A4JA 5FYDA 3V9PA 1RI3A 4D8WA 1UH5A 3B53X 5DTRA 4YCSA 5E4TA 1KZGB 1ZD1A 4Q9LA 1ZSNA 2QD5A 3N74A 4A23A 1D5CA 2FPGB 1OKKA 1W6RA 3Q3CA 4H3KB 2ZUWA 2X9QA 5HKLA 5KYGA 2BONA 1BWPA 1RBQA 1XCMA 3QV2A 2EOAA 3GLIE 3PQEA 3L4BC 4KAJA 5BSWA 2GEFA 3LVRE 4M46A 4MULA 3ZK9A 4AZ0A 3PQ3A 4JC4A 4IIVA 2NP7A 1ZY2A 3I2JA 4I4NA 1O58A 3PXAA 2XYQA 1D4ZA 1G8FA 1YS2X 2B4YA 4B6SA 4N0QA 3HH8A 3OC6A 1SHUX 4HFMA 1QJ4A 1WMBA 3F8WA 4KDCA 1MJGM 1OXSC 4MR7B 4EB8A 4GOKA 2QVZX 4CODB 2WZBA 4DUYB 4RJKA 4Q9AA 5IYZF 1RRGA 1AK9A 2O1XA 1LI4A 1WKBA 2ZDHA 3AXTA 4RGBA 2B7LA 1YZUA 1I01A 2NYAA 3E8SA 4XVHA 5JSYA 3WYFA 4XGRA 5BUSA 4E13A 2WU4A 1MBZA 2RARA 3RUEA 1T8TA 5TNXA 3QQPA 1KWKA 3K4PA 5IFKA 5LDDC 1M8JA 3QG5A 2CMGA 1QAQA 1XDZA 4UQLA 2C84A 2X2EA 4EW2A 1V6AA 1DFGA 1XWWA 4PS0A 1F2UA 4NEGA 3CWZA 4BGIA 4ZYTA 1X7HA 2GBGA 4I1SA 3GL9A 5IW8A 5B55A 1SCKA 2M6LA 1CJVC 3UGTA 1ESEA 3R4VA 2FPUA 1G6Q1 3R8CA 4Z3OA 4LW8A 4RGQA 2Q5HA 3O8OA 1RKVA 1FY2A 2QVYX 4BLPA 2XEGA 4EHDA 1CF9A 1VPLA 4XLLA 1CY6A 3GFFA 3A8TA 1QC5A 1L7OA 2V9CA 1PEKE 3ENZA 4WXHA 3WVNA 1KQ3A 4FKMA 4B3RB 3NHMA 1R0ZA 4H7IA 3GRCA 5K0GA 1WW2A 2WTNA 1XNQB 1ZISA 3HPQA 4C8FA 2FSPA 1HZZA 3LI2A 1PFGA 4HS9A 4IHQA 1JKIA 3BH6A 4RHEA 4B0OA 4NXMB 3EPHA 1ZM3A 1RLMA 3GP5A 3BE4A 1VKRA 3KB8A 5C8YA 1OD6A 1O94A 2ECKA 3PJEA 4GEGA 2D54A 3OJEA 1RYEA 4LJ7A 4NV1A 4YJGA 3EZFA 1UJ6A 1IULA 3TCNA 1AQNA 3E2IA 5A71A 2Q5CA 1VA5A 3VO2A 5I47A 1QQAA 1Q21A 3OTIA 4DVJA 4DKXA 1EB9A 2NXJA 3HCOA 4XEHA 5FWNA 4JFRA 5HSGA 1KNXA 3AVPA 3JVUA 3AQIA 2QTHA 2Y0DA 5F2KA 5I7SA 1PBNA 2JIDA 3TECE 5ALMA 2BI8A 2X19A 2C2GA 3A9VA 4BMZA 2I3GA 3OJOA 4D9MA 4IL5A 5HBRA 1POWA 3C1TA 3S44A 1YC5A 1NQXA 2WZDA 4R9UC 2OHGA 5KJFA 4PSKA 1ESDA 1DPGA 2IEDA 4ROSA 10MHA 1N0WA 3HVUA 1IIBA 5KINB 1CRWG 3EPKA 2E5WA 3N0VA 4HH3C 3GLGE 1HNWB 5CIWA 2C4KA 1WZIA 3LPCA 2QLFA 1DCFA 4WESB 3WA7A 3D7GA 2RGRA 3DBHA 1JB1A 2DSTA 3EOZA 1DIGA 3WXBA 4ASUD 3N75A 4OM7A 3NTVA 4OX9B 3CMMA 5A3VA 2IYNA 2CLFB 3VKWA 3DVLA 1FW8A 5FKJA 1CSEE 3D3WA 2CLDX 3DOCA 4ZRMA 3RAFC 2XRZA 1KSFX 4FFOA 1RZ3A 4LBVA 4LY0A 1B1AA 1E1NA 3L0BA 2DTXA 1JLSA 1JFRA 2MMGA 3DMDA 3PR2B 5EWJA 4BLOA 4D3ZA 3B6IA 3EXAA 4KI0A 4PY2A 3M9XA 2E4AA 4WJZA 3LLSA 5FTNA 3U37A 3VH2A 4B7UA 1W5SA 2B8WA 3UO8B 2P69A 4G65A 1O5TA 2VAVA 4FMPA 2YWDA 1MRSA 2ZZMA 4NEHB 3WL6A 1P60A 1TIBA 5IT0A 3UWMA 2F67A 4TUYB 3NONA 5KNCH 3GFPA 2WB4A 2H3HA 2BKEA 3UK7A 1IJFA 3DTNA 4JQSA 3MJDA 4O4HA 4WIAA 4PXAA 3OJCA 5BPFA 4TWEA 1GCUA 2J08A 4KIJA 2B78A 4BZQA 2JCBA 5KPJA 2UZ1A 1AMOA 1JHYA 1MDFA 3FOBA 3FG9A 2FZWA 3VPBA 3QGMA 3VZRA 3T9FA 2NZWA 3T15A 2ZPTX 4P44A 3T7DA 5EWMA 1UFRA 1KEZA 3CUWA 3LQYA 4LC0A 1A9OA 1RR6A 1FLDA 2FRXA 4WASA 5ALLA 4IGAA 4MS3B 5EHNA 5SZJA 3RARA 2AE2A 3W5VA 3GNTA 1KKUA 4OHZA 4JD5A 3RS7A 5GWXA 1PU2A 5HKKA 1XTRA 3BWXA 5C5DA 4AKGA 4M8NE 1QU3A 1KJYA 4EUHA 4LDJA 4LJSA 1RAGA 4YXFA 4KXLA 1IONA 1T6YA 1VXRA 4RNDB 5FA5A 2H2DA 2QXUA 3PIRA 3DPIA 1X2BA 4OQDA 4CU2A 1KZ9A 2YHIA 4KQ1A 3KQPA 2YXDA 3HK2A 4PGGA 3DONA 4O02B 2QAGB 3GMIA 3K92A 2DT5A 1YZYA 2I99A 3DDHA 1E62A 2GPWA 3EGVA 2WSLA 3PL5A 4LDRA 4RK6A 3UT0A 5CFLA 3LHFA 5F9FA 3ROFA 5A03A 3K4IA 2F1JA 3QFRA 1JJVA 1HSOA 2ZB4A 4LECA 4LY3A 4CFZA 3H7IA 3ISTA 4KXVA 4AUNA 1K5HA 4TKMA 5JMOA 4JXXA 1BOOA 4LXTA 2OB1A 3PD1A 3EUWA 2P6UA 4DJEC 5WRFA 3O8CA 4LXXA 3THYA 3UIEA 1NM5A 3RODA 4UEQA 3JPWA 1Z8HA 2LD4A 3DDZX 5CX4A 5MN4A 1GN9A 3B1WA 4KN5A 2VHWA 4MEJA 4Y67A 4ZZ2A 4WNAB 4RPLA 3WLEA 3JZDA 4ARSA 2YQZA 3PFGA 1LVUA 1F8GA 2HF8A 4NBRA 4XJVA 4X7MA 5DTIA 1H2AS 1T4CA 5MFPA 5EMHA 3T8YA 4EI2A 4F6CA 3M33A 4KRYA 3DEJA 1Q0TA 1Y7PA 2Q5IA 1A7UA 4TV9F 3WGVA 1XSEA 2O7QA 1CJSA 3CVXA 1CX9B 1CFJA 3ZNOA 4YWJA 1ZGCA 3S2FA 2JLZA 2B30A 4B84A 4G0VA 2HPAA 4F3YA 1V4BA 3JVDA 4O4LB 5MGNA 1XRNA 4KRGA 1X8KA 3FZGA 4CNQA 4QULA 2JLAA 5GTDA 1QLWA 3FOEC 1T3TA 2DEUA 2B2CA 1EWYA 4FTWA 4JJ7A 3TJZA 3RSZA 8MHTA 3D5EA 5AQEA 4KR2A 4YGYA 3B1JA 4ESHA 1EYZA 5DLDA 5HX7A 1T9HA 2VCHA 4GGMX 2QTTA 2YZ7A 1UJ4A 1IK4A 4YR7A 2B98A 5D5PA 3EVFA 4DIDA 1D2NA 3SQOA 4B09A 1EVIA 3A6FA 4N5HX 1P4JA 4W9RA 1NN5A 3N8DA 1TQ2A 3TLEA 3SJAA 2AFHE 1BDBA 3D9QX 3IC5A 2HMUA 3IWWA 3RIYA 4N8SA 1YQ9A 1D2CA 1UKEA 1JIVA 3ND7A 4IG9A 2GHQA 1PGNA 4ARVA 4U0JA 4C04A 2W00A 2BFNA 4WLOA 4KB5A 1SOWA 1D5WA 4FFMA 2PIDA 1AGXA 3K31A 3U4QA 1I94B 1GGEA 3H83A 2WLSA 3IMEA 2JHCA 1Y6QA 1MIOA 1VBFA 1ZBQA 4RZ3A 3A31A 5HEKA 2C9DA 3G5AA 5JVDF 3B7GA 2AYXA 3C8HA 5TPZA 1C9JA 2OZLB 1E7RA 3LSTA 1VCIA 5A5DA 3UKOA 3VVBA 1CQWA 4PHHA 1G5TA 4BQPA 1U1IA 1EHYA 5EKDA 1HOTA 5TV2A 1MCZA 2C96A 1RLJA 2O5RA 3IAM1 2NTJA 3UHPA 4JJGA 1A7AA 1QVAA 3ZC3A 2ANCA 2BMFA 2MINB 2A9OA 3QIAA 4FLMA 4XASA 5EERA 3UTDA 2O6LA 2A1UB 5DSTA 2PWAA 5BQFA 5JSZA 2H63A 4UVGA 4EKYA 1ZUIA 3JQEA 4NZYA 3R5SA 2LKDA 2HWWA 2FEOA 4DPMA 4J1QA 4X93A 2Z4RA 1RJ9B 1ZYUA 5K9ZA 5AI8A 1FMFA 1XZGA 4QRHA 1J24A 2PH5A 4NBVA 1QONA 2EJVA 2V5VA 1J0AA 4QGBA 1R9JA 1EEHA 2VQDA 1GXSB 4UKDA 3BXPA 4MCHA 2J3IA 1S2MA 3V7FA 3J80A 3ZXSA 3CS3A 3WKAA 3TB4A 3M2TA 3G8DA 3W8DA 1CEYA 2W6ZA 1PJSA 2AW5A 4J0CA 4WEOA 1KWGA 1XLTA 1KEEB 3EG9B 4OQXA 2XECA 1QHYA 5IMBA 5B1DA 1HE2A 3AZOA 3ZNPA 2Z0MA 4PZZA 1X7WB 2QJTA 3G17A 3IJRA 2VUTA 1G4UR 4BU1A 2PH7A 4BGUA 2ID7A 3IQZA 4BYGA 3QSYA 4RCYA 2WY2D 2ZVJA 4R8KA 3R3VA 2GCOA 1QO9A 4MLPA 4HRXA 2IFTA 4TT8A 1H2HA 4MYRA 5JDIA 4FM9A 5JMTA 1BOFA 1XAHA 5AJUA 5I9TA 3G2OA 2XBUA 2IEZA 1N2SA 2YXLA 2ZIGA 3O7WA 4RPJA 3AEXA 4JQZA 4JLMA 2BBWA 2WYUA 5B3AA 5L45A 3TW8B 1U0OC 1DFHA 2XYGA 2WF6A 5KNDH 1ZJWA 2PTGA 5DE3A 3K1YA 1JL3A 1VLVA 2JW5A 2AG1A 2ZJ7A 3LOQA 4C01A 4PHCA 4YMTA 4YECA 4HLUA 2CL6X 1A5TA 1H85A 4LWPA 3LH5A 3P2IA 4ZAVA 3SM9A 4PQGA 3QKWA 4D4JA 1ZG3A 1QF6A 1DIOB 1SUAA 4P2BA 4DA8A 2WMNB 4OGKA 2ZJ2A 3P71T 1M1NA 1TUEA 2ODTX 1CR0A 1LK5A 2C9MA 2C2WA 1YR6A 2PZFA 3OKAA 3H0EA 1BZYA 1TADA 2XUPA 2ON6A 3UJ7A 3ZCQA 4JI3B 3NKVA 2VQSA 2YVQA 3L6EA 1WO8A 3QFCA 2NG1A 4F38A 4OOFA 4RF2A 1CUIA 3C5EA 4IH4A 4ISCA 2VAXA 2X41A 4P7JA 3W3ZB 5EJ8A 2CV1A 2HLDA 2ZRBA 2QX8A 2I6GA 3MUNA 3DT9A 1OBVA 2WU1A 3LF2A 4HFJA 1LBTA 5DISB 1RI2A 3U26A 3KQLA 2HGZA 2FDXA 1W4CA 2JH8A 3ANXA 5FUXA 2YVLA 2Q3CA 2IUFA 3BHIA 3KTFA 1L4EA 5TARA 3KXLA 4LA4A 4LJ8A 2VAWA 1LXCA 3OFNA 1EZ4A 5EIBD 2RCNA 2SBTA 5FULA 1DDIA 1HRDA 3ODGA 2DCUA 2P3OA 3OLCX 2J67A 4HYQA 2ORED 4FCVA 3R76A 3TZQA 3DW1X 5C9ZA 4R98A 2A88A 1YSCA 4ND5A 3QYAA 1KYQA 4RHTA 5EHXA 5EVCA 1R16A 3KJIA 1J97A 1NDUA 3NZEA 4Q03A 4NBKA 4O4JB 3FMVA 4URWR 5AM2A 1VBHA 3S9NA 2IPMA 2C9YA 1ETHA 4PU0A 3TRIA 1M7BA 3QI7A 1F8UA 1VPEA 1AQIA 2HEIA 2WU3A 4ZKEA 3ADDA 3P9RA 1C14A 3BCUA 1MJFA 5K4AA 5LA6A 2D3TA 2A0FA 2PQ6A 4DHEA 3RCBA 3UWSA 4EMBA 2Q3JA 1V26A 2VLBA 2Z2ZA 1DBPA 5G41A 1CUEA 5FAKA 5JR3A 1IXYA 3O3MB 1WZNA 4ES6A 4EG5A 5EJFA 4G0XA 1ZHHA 2H18A 4QIHA 1JDNA 4UFNA 1W1IA 3SJBA 2GOYA 2DC1A 3O95A 5L7WA 1WF3A 5B6IA 2HLHA 2BDUA 4UUNA 1P74A 1T4MA 1GADO 4CTJA 1MEOA 4M38A 3AZPA 2HPVA 4XUDA 3RTCA 5M7EA 4B35A 3GLFA 2VYNA 4Q4AB 1AH2A 2CK3A 1U98A 2AMFA 5D3MB 2D0DA 1PQUA 4GXQA 4M0DA 4OGWA 5TSDA 4AZ0B 2ETVA 5H80A 4WLEA 4HGNA 2AC4A 2QW8A 4CCAA 2OPHA 2V8OA 3NIFB 1N4AA 5LQAA 5G2OA 1ZM7A 5ALTA 1OSNA 4Y2JA 3RT7A 2CMKA 2A1TR 5F12A 5IK2D 4PO8A 1W75A 3JQ9A 3RTEA 4BC0A 3G85A 2JFPA 1O6BA 1S2DA 3H13A 1JZTA 1OF1A 3WTCA 3X2FA 1KI4A 4TYNA 1M74A 3Q6IA 1K3FA 1LNZA 1E5XA 4WV3A 1T29A 1YC2A 3UUGA 5CP8A 2WT9A 1YTUA 4B40A 1I9CA 5J5VA 4KFSA 4JBLA 3RVSA 4B48A 5TMPA 3TPFA 4K8OA 4A6EA 2ZUVA 3UA4A 4D9NA 4BB9A 2JFQA 3JW8A 5JRDS 1DNPA 4QU0A 1HMYA 3C1UA 4I4TB 2ZRLA 1A88A 4DLTA 1MW8X 1FZQA 3JAWA 2PWZA 5DX1A 1N2CB 2QZZA 3AVXA 3RHSA 3WGZA 4RFVA 3L6CA 4CIWA 3LY7A 2BRUA 2X86A 2OFFA 3O2QB 3OZVA 4FKZA 2FZ5A 2W6JA 3WRYA 2C2ZA 3Q8MA 2DULA 3IR6A 5CLIA 3QHAA 4DDWA 1YZFA 3O8OB 4M89A 4XUEA 3RC8A 1XQYA 4BP8A 3KTOA 2C7PA 1WRBA 5LP6C 3MWFA 1KAOA 2BM8A 2L19A 4EAAA 3CN9A 1FQOA 4HN2A 1PJBA 1NVEA 1F2TA 1K68A 3ZHXA 4DL9A 2VKTA 1MO3A 5EGSA 4DQ0A 4UW9A 2AEJA 1IOWA 1Q83A 4X20B 5ALFA 4Q3DA 1XTBA 2W2TA 4JLAA 1HT1E 3EUEA 2VHEA 3TI7A 1HE4A 4N47A 4KN6A 2P1ZA 3KJGA 3HDVA 3Q3HA 4H7DA 3QKSA 3SYRA 1TMOA 3CUUA 3QJ5A 2HF2A 1XZEA 2FK8A 4KCGA 3X1ZA 3MGKA 2XB6A 4ZEWA 3WB9A 4GX5A 2QX6A 2W71A 2ZTUA 1T24A 5EXTA 5FRDA 1XGKA 1EVYA 1XP5A 2P35A 2QUAA 2YOFA 5F1KA 3EHDA 1ZUWA 2W2OA 4JR2A 2GWHA 2XSZA 2V6BA 1W1UA 3CINA 3I12A 1YU9A 4AKSA 3L8EA 1TO6A 1SA0A 2IEIA 5C8VA 4NFHA 2ZSIA 5K6AC 1V11A 1RKBA 3KQUA 5IASA 3HY4A 4I50F 3P8ZA 1C3EA 3M6XA 3MQ2A 4MQEB 3HA2A 4FILA 1R74A 1T4DA 3C14C 4HXGA 4ZEVA 2WP0A 4ZEOA 2JRCA 5CJ2A 4MKIA 3ZGOA 4UXHA 3FNIA 1U0NA 2NTEA 2X3YA 4Q48A 2NW6A 5F5LA 3NDJA 1CUJA 1YV9A 1TQHA 4BV9A 1AUQA 3IALA 3FNBA 1F2DA 3O8BA 4ZVMA 4N8DA 5EE0A 2W0MA 4A8JC 4CMEC 4BAUA 3H9UA 4QUGA 3TN7A 4JR1A 1BROA 3ZNQA 1QGUB 3I01M 3Q0TA 1E5LA 4RL6A 3F6YA 1P7PA 1DE0A 2GZDA 5FOSA 2J7KA 4IGEA 5SV2A 2W2XA 4MW2A 2O07A 1OLXA 4Y9DA 4INOA 1YQEA 3ZDZB 1NYQA 2JBJA 3R7SA 3D3WB 3L43A 4Z3DA 1P2VA 5CB4A 1NN0A 1LK7A 2NO5A 3RS5A 4KSCA 3EARA 1MB9A 4C0KA 1JQAA 3PYMA 2C98A 2D5CA 2GD1O 3DXYA 3P9NA 4QELA 1E3DA 1A1VA 3O84A 7ABPA 1U7DA 1QDUA 2C6CA 4MUAA 1W8IA 5D00A 1D1QA 4QDJA 1LI7A 2V8BA 1D1SA 3X2EA 4HBGA 4NCJA 2Q3HA 3A4MA 2VTVA 3NRJA 4RKEA 4TMKA 4OC4A 2ZU0C 1NAIA 2OLSA 3Q40A 2XKBA 1C4OA 3VZDA 4EIWA 3F9IA 4L8FA 4K9NA 3U6BA 2VXOA 4M55A 4BNGA 4FX5A 4RK4A 3B6KA 5C8YF 4ESVA 2QUKA 1NG9A 1I4EB 2V4ZA 2FQQA 2YYYA 2A6PA 3I5XA 2FRDA 1NT2A 2OHXA 5KYXB 2PUCA 2CD7A 3MEQA 5T8KC 5TVKA 3UK0A 4CKEB 4I9UA 5FUMA 1Q57A 1TEVA 3OUTA 4C2UA 1GZ4A 1N2GA 4BO0A 2O8EA 3L7AA 2ZFUA 1JLRA 1IY9A 2X5JO 3A05A 3CE6A 3Q7SA 4MUKA 4OJKA 4W82A 3V2UA 1UDWA 3R41A 3WADA 4R3NA 4TL8A 3EEYA 3IAUA 5GGXA 1M8KA 2FOXA 4AJJA 4Z4FA 3WNBA 1AOXA 4RJ2A 5IF3A 3DMFA 5JNSA 2FJPA 2X8WA 2IYZA 1F20A 4KDEA 3ZU6A 2BEVB 2PRZA 2JGNA 1R50A 2FWAA 4D9CA 3CZ4A 1FC0A 2XRFA 4OIMA 4JI1B 2JAPA 4OXRA 4EGFA 3R3ZA 2RI0A 3C5VA 4DMHA 1ELOA 2YHSA 3QJYA 2X5KO 4ZJYA 1H8HA 2I6UA 3P19A 2OBMA 4FMDB 2K7ZA 1T2FA 1U7PA 2Y92A 3PITA 5LWQA 2WW8A 1ZGAA 4UTPA 2WPDA 5IABA 5SY6A 1ZVQA 3COVA 2YFHA 1MU0A 3UM9A 5K20A 3THYB 2EZ4A 5G4LA 4MV1A 2QLNA 3M6VA 4HFRA 3AKZA 3S99A 1B76A 3ZN2A 4RYLA 5JLJA 3IL2A 4HZIA 1NBHA 1CJMA 3V1KA 3FNEA 3FHOA 3L2OB 1DJQA 3ANSA 1XQ6A 2TMGA 4AX4A 1SUDA 3HDHA 3A36A 3D7FA 3GEDA 2ZRJA 2VDOB 2YDXA 2P4QA 4M1OA 1G1MA 3OQHA 5EWLB 1SD1A 4D42A 3OCUA 1W88A 5D3KA 1FXUA 1QFZA 1EDBA 2HDHA 2NYVA 2P9QA 3AB8A 4IQFA 4Z8XA 1NFQA 1RJEA 4BFWA 4M76B 4RV5A 3ZK8A 4O4HF 3LFTA 1GA4A 4QG7A 1EFTA 2V58A 1URPA 3HBAA 4NU0A 2PH1A 4IJUA 3B13B 4J6FA 5BSTA 3IQDB 1JHPA 2FY8A 3CZMA 3WZMA 1LPPA 5A3JA 5IVKA 2JA2A 2QY9A 1CULC 2Y1CA 2PT9A 4DF3A 5B30A 2ZSHA 1T1IA 3PA6A 2OA0A 1JV2B 1Z75A 221PA 2ACVA 1NQ5A 2Q1UA 3F5FA 4FFPA 5DGHA 2VYVA 1LF0A 4HLQB 4FGSA 3U19A 3U1BA 3USCS 4XVRA 4YH1A 3QMVA 4LVNA 1B0AA 4S2UA 2C07A 1NLUA 1XD2B 2HWUA 2HDOA 3OZRA 4G5SA 3LYAA 3VZCA 1Y3BE 3DZBA 2F4NA 3J81k 4F3CA 1OI2A 4ZWNA 1DBQA 3FR8A 3LHDA 4OI2A 3T5PA 4AZTA 4AQDA 4IQGA 4PVDA 1K1EA 1W2HA 4GYJA 4BKPA 5GIOE 1AZWA 4OF4A 4L07A 1N1DA 1KVTA 3RWOA 3GJ6A 2OM2A 3V7NA 5KVVA 2Q0XA 2GFIA 2IIQA 1HH4A 4HQLA 1L5SA 3HJHA 3L9WA 4FMCF 5JWHA 1KQNA 4R2XA 4F6RB 2A59A 5JDCA 3QOFA 1A97A 1E98A 1MIOB 2F3QA 4PNPA 5HQ3A 5C8DA 3EEIA 3PQ5A 3TTVA 2DQYA 4MXDA 4KH0A 2HSEA 3BD8A 4OLBA 2ZSFA 3T41A 5KQMA 3A6LA 4DY4A 2OORA 1NNUA 4V0LA 3CE9A 4QUJA 5CFNA 2K2WA 4G4IA 2VDNB 1FL9A 5DU2A 2RKOA 1W2WB 4EL0A 5K99A 1LI5A 4OK6A 4Q4LA 2NTNA 4HNVA 3Q3GE 1HYBA 3FNHA 1WPQA 4BQSA 5L4LA 3D4PA 2YYZA 4IJMA 4XD7A 2PKQO 4J4HA 4MAMA 4OHYA 2PMWB 2QOEA 5F21A 3Q3IA 3GUVA 3BMCA 4BVEA 5HOQA 3A1VA 1RU3A 1ZSYA 5DKFA 3AX6A 2X2FA 2H5LA 1KETA 3HDYA 1W19A 3K94A 4YJ2A 1EZBA 3MG9A 4HB4A 4OXNA 1A4XA 3GYGA 2F1OA 2JL1A 4WLUA 2OOKA 2AX3A 4X6YA 4JVSB 1DEXA 1Q2XA 2QM0A 3WWDA 3ENKA 1U11A 2RHOA 3FXAA 3NHUA 1YBMA 4GH5A 4DV5B 1JU9A 3Q12A 5B6JA 1QH8A 1XDBA 3B89A 3F9RA 3NBZC 4LJ4A 4Z9XA 3U80A 3WJAA 1ECLA 1RXUA 1A27A 4N3NA 4YBRA 3ZBUA 2YMQA 1Y80A 5CBPB 4QM6A 3STUA 2IA5A 2QTZA 3GVPA 5EJAA 3VPSA 4R71A 1NF3A 2WHXA 5AM1A 3F6PA 1GUDA 1N75A 4L2IA 3LNCA 3P2KA 3VPFA 1UPTA 2O5VA 3FMGA 3QU7A 4DWWA 2UYOA 3C8UA 3PC8C 2IS1A 2AFRA 1P18A 2E1RA 2PL1A 2W58A 2RAPA 3HS3A 2ZAGA 3OWXA 4NCIA 4PNHA 5JFOA 4YJHB 3N0TA 1TVKB 3EBLA 1ZAYA 3G2KA 4DDKA 4J91A 2B3DA 1BE1A 3O4GA 4ENPA 2WV7A 3QPBA 4M2LA 3ZCUA 5CLHA 3IKJA 4EF5A 4WN9B 8AT1A 2FZVA 3MQ4A 4RX1A 5FXMA 3I9V6 5KDLA 2X8JB 4Y9SA 3MRVA 2Q8PA 1RYZA 1WDWB 2Q2VA 2WIBA 3MJCA 4P7BA 1XD8A 4DG9A 2FR8A 4ZAGA 3Q8KA 4IJ5A 5A0TA 5DWQA 3HTXA 4NQRA 2NZ2A 4IS3A 2I6SA 2Q50A 2ZJ6A 1RRFA 3AOEA 3GD7A 1G55A 2G9VA 1DI0A 3C15C 3F78A 2WIAA 1ST3A 3ELYA 4LHVA 4OP3A 1G4HA 1KSGA 2HHHB 2MYNA 1L7RA 1N5OX 1KZ7B 3I9FA 4Q7JB 3LKDA 5JJLA 4J8PA 2POCA 3BXMA 5GGYA 5I3CA 2GZAA 4HHEA 1IU9A 4MWEA 4P4GA 5BV1A 3OZFA 2NWQA 3PPVA 4PHGA 1RP7A 4C9AA 1TCBA 3BH7A 3DPSA 3K5WA 1FW6A 2MSCB 2EBWA 3K7EA 1B6RA 1N5IA 2G0NA 2Q28A 4NMXB 4YQZA 4F46A 5LQCA 2EIHA 3SZMA 1A5ZA 3EZ9A 3GY0A 3P2OA 3K6SA 2UYHA 1LDEA 2A0UA 2VAPA 2FPSA 4BN4A 1QQTA 2C5FA 4IYRA 5LBUA 1NSFA 2AXEA 1JDZA 1MAHA 3B3AA 2EDCA 3IO5A 3KVNA 4NAVA 4UCWA 3Q15C 3QU5A 1LVGA 2ZYWX 4WMLA 3CJTA 4F4UA 4K9PA 4FBGA 4BEVA 3KXKA 4C7VA 2R9VA 1HV8A 4LQCA 2BH9A 4PQEA 3DULA 2Z9BA 5ALNA 3V3TA 4X94A 5F2OA 4L5YA 1K06A 1CP2A 3GFVA 4IOKA 5E1BA 1CB7A 1YA4A 2EZAA 2JJYA 1I6KA 2P5TB 1GRRA 2EGUA 2JIZA 2PRJA 5TRTA 3D64A 4F71A 1A9TA 2WUDA 4B83A 2JBAB 2O4UX 2H59A 2I5PO 1R0SA 2XJ4A 4RVDA 1P2SA 1II0A 1VL0A 3NBKA 3WOVA 4B34A 4CKXA 4ZYYA 1NNSA 2W37A 3VR5D 1SUWA 2BGUA 1CY7A 1NKSA 2N75A 3KAPA 3L0ZA 4ZGGA 3WQSB 3H2HA 3NS7A 2X15A 5FOQA 2NO6A 4ZQCB 4IOJA 4HQ6A 5AK6A 4W1QA 4HB2A 3G9TA 3V33A 4A3SA 4FGJA 3NX4A 2D7CA 4L6AA 4MV4A 2XHEA 1FFYA 3K53A 4FE7A 2BSXA 1ZOOA 3NLLA 4LHWA 3DVSX 3F0TA 3JSAA 3WFIA 4YCLA 2CJWA 3LUJA 2PWPA 5BVHB 2QF7A 4JBGA 2B2XA 1YZGA 2CFSA 1GL3A 4GKKB 2ZUFA 2J7PD 1B6GA 1HUQA 4M1EA 1FUKA 1WSBA 2H0AA 1XA4A 4YK7A 5GJVC 4EYQA 1VP9A 3HBNA 3I2IA 4JS0A 1KI6B 1XTVA 4H77A 2OO5C 4TXMA 1QMGA 1YR1A 4MQLA 1JLMA 1ZN7A 3RJTA 4JI8B 2LZ0A 3VZQA 1S2LA 5LWHA 1GPAA 3FYTA 3U2QA 2B6HA 3DCJA 1I3OA 1U31A 1YFKA 5ESDA 3HJBA 1DRKA 3AUTA 2P9TA 5JFTA 1UOOA 3SG0A 1ZH2A 1F4LA 4N18A 1SXJC 1KR2A 2ZOSA 2X1VA 5D6NA 1JGTA 3FYSA 2JK1A 3A06A 3CZ5A 4LRQA 5EZQA 4BHTA 4Q7QA 1JBEA 1WLSA 4DEYA 2DGDA 4AO8A 2VG8A 4KPYA 2PA0A 4NJMA 4C20A 3KHTA 5A9SA 2GM4A 4I8DA 4K9DA 2ZYIA 4ALNA 4LQLA 2EBUA 1PF7E 1P1KA 2GFQA 5EFZA 2WHPA 2ZYSA 4GECA 5D87A 5TB5A 2QW0X 2LP4Y 1P4HA 3BKXA 4MYHA 1W94A 1YD7A 2R86A 3H9QA 1EM6A 5EJ7A 4HUJA 1FUUA 1Q77A 3LQRA 5T4BA 3OCCA 4M87A 3FWKA 5JCPA 1DEKA 1LH0A 1SHZA 2O20A 3C98A 3JAWB 1KMNA 2GLUA 3VDXA 5HCUA 4C0LA 3KYCA 1GWNA 3ZPXA 3M34A 2GCEA 3PI6A 3IP3A 2MIIA 3QE2A 4R9VA 4MQMA 3W2GA 2C4VA 3TZLA 4K1XA 3EY9A 4RIEA 1C1XB 1BDIA 1YASA 2HXSA 3IBCA 1J42A 3PF9A 5IWAB 2BMAA 1KZHA 5LA6F 3PU6A 1JEQB 1SUBA 4FOOA 1NBWA 2FOLA 3ROZA 3O21A 5AXBA 4ZJUA 4F7WA 2C4NA 2WSIA 3SJFA 2IHZA 3ZHOA 5IC4A 3TTSA 4O6VA 1X87A 2CL5A 1R64A 2RGUA 2W6NA 3O9ZA 2G9ZA 1D2AA 4XFDA 1BU8A 3OWOA 2RCYA 1E1LA 3LWZA 4WK4B 4DWOA 5KTNA 3AVVA 1HLDA 4NJOA 4R8RA 3UT6A 3T94A 2BHNA 2CUZA 1DKPA 3DNMA 3GEGA 2QTCA 3JATB 3KJZA 3GEEA 4RY0A 3N6XA 4ZAWA 4A0HA 4C6TB 1PJ8A 1OGYA 5DHUA 5DN9A 4D4GA 3HKEB 3W2EA 5CEEA 3R6WA 2VP0A 4EB0A 1VPDA 1LTQA 3I76A 1UK6A 5FQNA 1MRNA 1AC5A 3D2BA 2ODBA 2PJUA 4G1CA 1FP2A 4TJVA 2W6MA 3SS8A 1J06A 1EKXA 2ZT5A 2LWIA 3FFWA 4PWYA 3IRVA 4IIBA 4BFLA 5B4VA 1GG5A 3MWDA 1YQDA 2IUSA 4MW9A 2VF8A 4EA8A 3B5JA 4FB5A 2PSFA 2NZUG 1ZNQO 3UCEA 5E38A 4ZICA 1ID8A 4LUCA 3X1JA 4K6KA 5FOWA 4YB8A 3WZLA 4MCRA 1B42A 3T7AA 1G2PA 1MX3A 2CVQA 5A02A 3AVTA 2CMDA 5JD3A 2JFOA 2AD1A 1NWCA 2NVUA 1OTYA 3GWZA 3OAAD 1XC7A 3TM5A 1GZDA 1Z88A 2GPJA 3HB5X 4NCXA 4CG1A 4QBHA 2NSYA 2I67A 3TLGA 1OAKA 2PK3A 1XD9A 2O2GA 4P98A 4D8TA 1PEYA 5AVZA 4EO7A 2NQ2C 4EYKA 3RUPA 2REQA 2YHAA 4D4HA 1PQWA 1QS0A 2JJMA 1ZK1A 1Y0BA 4MA0A 4QOGA 4BGVA 5EJ5A 4IMPA 5JH7A 3I5YA 2RJNA 3N0WA 4OJTA 3C3YA 5AO9A 5JMPA 2WHYA 1CXZA 1I3NA 1NXWA 1KJ9A 5AMXA 1UXHA 4I2VA 5AIAA 5FL3A 3RUAA 3TMKA 5BWCA 4RIGA 1YDEA 3D8RA 1B16A 2B5OA 2O52A 4DNOA 1Y1TA 4Q05A 2QLMA 4JUIA 4MTLA 5IDYA 5F1OA 2JFWA 3R3SA 1CQIA 2EARA 4J07A 3WL7A 5JRJA 3UG6A 4JI7B 3M1YA 4KR0A 4MEBA 3KJXA 4OQYA 1E1RA 3NVDA 1TZKA 4JJEA 1A77A 4QPPA 1AKEA 3R5KA 4M99A 2RGDA 2XUDA 3GLHB 4LXHA 4O4IA 2J3DA 2WIDA 4CTOA 3DGEC 2A9RA 3NHBA 1T8RA 1VGRA 3S1SA 1LDMA 1ZRMA 4RVCA 4NTZA 2YL2A 3BWVA 3GIWA 2CCGA 1ZNYA 5CVJA 3THRA 4MVJP 2TMDA 1Y7IA 3F98A 1PTJA 3ZKAA 2WFLA 5LBTA 3GJ0A 2W6PA 1F6WA 1P5HA 1Y9AA 2GJ9A 2VF7A 3K0BA 3PQCA 5HFAA 3IPRA 4HV4A 5J40A 1UBGA 2Z9DA 4ZV9A 3RLFA 1KJNA 1E6WA 2CNKA 3IP8A 3NV7A 4IHJA 4LDPA 5EQFA 2RGYA 3HRKA 3QEMB 3K4QA 4AIIA 3EGCA 4U7GA 1Z4LA 1GZVA 5EOVA 4A7PA 4ALMA 1K4YA 4X41A 4KQEA 4HGYA 1KK0A 3K73O 4QYIB 3GBPA 3SR4A 1H93A 1Z0SA 3VC3A 4JX9A 4MX8A 1DDOA 1W5TA 4CG0A 3WIVA 3TH5A 5JALA 1L7AA 2YV4A 3B8HA 3NOXA 5J4LA 2NXNA 3CNEA 3K2EA 3C7DB 3SMQA 2PPLA 4F2PA 5LZ9A 2VA9A 2QRQA 1VDZA 2QTAA 2ODQA 3F8TA 4FHDA 4PQFA 2BDEA 4PZCA 2F8TA 4E31A 3P0EA 4WLNA 3L7NA 4WFJA 3MF4A 3OCWA 4H60A 4AF6A 2JJQA 5AXCA 3KLBA 1FSZA 2FSVA 3FOAA 1GLGA 2DE0X 1DAGA 4U7HA 1REQA 1L8QA 1OH5A 1BJKA 1XZHA 5CB4F 2VQ6A 4RULA 1THGA 1GUAA 4BP9A 2YFKA 2QIPA 5DWVA 5F5XA 3FSJX 4RNCA 2RHRA 3S8YA 2Q8NA 5KYYA 3VGPA 2KMLA 1QGDA 5ELMA 1MC4A 2NO7A 2XGGA 4RA6B 4JP3A 2QX7A 3SFTA 1QAMA 1IB6A 4UM5A 3A1WA 1K97A 4I1PA 3QLUC 3WMXA 4E0BA 2RIPA 4LPSA 4I36A 3IIMA 4E5YA 2CHGA 2HRZA 1LSJA 3GUCA 2C1XA 3LHKA 3SKVA 1U0TA 3ENQA 4JR0A 3IB6A 3BFJA 1X70A 2RH9B 4YJKA 3JQ8A 3PTAA 3DCYA 4G41A 1Z6QA 4H3VA 1NI3A 2ZJ5A 3E3MA 4EVRA 3KQWA 5G0SA 1KTVA 3BJEA 1MAUA 4O2AA 4P3YA 2W2VA 4A8JB 3CJQA 4XWOA 1J6UA 4OC3A 2G80A 2EHJA 2XT0A 3U4DA 3EFEA 3TNLA 4AD8A 5JAUA 5MHTA 3RVDA 1SJ9A 2QP4A 4HN4B 4MV6A 1RACA 2ZIVB 3RRJA 1M2GA 1NE2A 4F92B 5IDWA 1TLLA 2AE1A 2EP5A 2C4TA 1CLEA 3H5IA 3I05A 4N9QA 3FYUC 3LK7A 4CQMB 2N3ZA 2OSVA 3RC7A 1XIVA 3VC2A 5EPEA 3ZE0B 4DSTA 1V37A 3G7NA 1R0XA 1BCRA 2BFBA 2G1AA 4ND8A 3UJ3X 3CRQA 2QI9C 4FHCA 3LW7A 3FROA 5J4KA 3A3OA 2HBZA 3KDPA 5BQPA 1PNOA 1VIVA 1R00A 2B2NA 2D5LA 2AUMA 2OD9A 3VR4A 4TWRA 3ZY4A 3O38A 1INLA 1XK6A 1B00A 2RFLA 1FUEA 1RC0A 3REQA 1GOTA 5I4BA 1IHDA 2EQAA 2YNMD 3TR6A 5EE3A 2D3WA 3WC4A 2C95A 3FETA 2JRLA 1MQ8B 3BZWA 3ET5A 1S1CA 3HGTA 3PGJA 3K9WA 3IA7A 4XYMA 2RBKA 3S2IA 4BCCA 4C78A 1UFVA 4DADA 1RNLA 2BCGY 4M49A 4CL0A 2P2YA 3DWIA 2RMKA 3KKEA 5J47A 1JEYB 3CO0S 1Y1LA 3UBTA 4RD3A 2I76A 1DFIA 4MGHA 3WKCA 1UK7A 4LZNA 2EX1A 1C4KA 3KSRA 4HVLA 4YQEA 1CR2A 3EFOB 5LZ8A 1N2ZA 1B3RA 3C3PA 1OBOA 4GGPA 3GJYA 4YMUA 2V6GA 4DBLE 2ZYHA 4G8JA 4RVSA 1A9RA 4H6XA 3RFTA 3VH1A 3EDOA 2R6GA 4I9HA 4PZYA 3KUXA 3H2GA 4GOND 4UUBA 4CMAA 2VPWA 2OR3A 2Z56A 2O5EA 2QP3A 2PCJA 2BMWA 3QUBA 1ZM9A 2J3HA 3CQ9A 3B1XA 5JCJA 1QRDA 5JNRA 1P4GA 1ZCJA 3O1HB 2QE6A 4YALA 3U16A 2NACA 2Q4EA 2VDVE 4QDZA 1R7RA 1TI7A 1Q50A 3KEGA 1Y3FE 2DUUA 5GOTA 3RBZA 4J90A 4M0LA 3SD7A 1WJGA 1Z13A 4R0NA 1MVOA 3B5EA 1ESNA 1PJAA 1I2BA 4U7DA 2YQ4A 2H1SA 5HJ7A 3N6VA 2YY7A 4L2IB 4OLAA 2XWQA 3DYIA 4TKUA 4WCFA 3WL3A 4PYRA 1W36B 3RS0A 5K3FA 1I0ZA 2HU7A 2SKEA 3IKTA 1RYMA 3WOHA 2HB6A 1IN1A 1B4DA 2YWJA 1ZBDA 4XH9B 1LLQA 3T9EA 1R66A 4EGAA 1NUQA 3TDNA 4WVFA 3A1TA 4R1LA 3SXPA 1PVOA 4CKZA 4GX2A 5BWNA 4UOZA 1DBSA 1U0RA 1W4BA 3I9OA 2GM9A 3TOZA 1LBH