5F1YA

Crystal structure of ba3275, the member of s66 family of serine peptidases
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
343
structure length
343
Chain Sequence
MLIKPKRLQAGDIVATVSPSWGGAGDSEIRWRYEQGVKRLEEVFGLTVVPMPNSLKGSEFIYNNPQARAEDLMTAFQDTRVKAIIANIGGQDSIRLLPYIDFNAIRENPKIFMGYADVTISHLFCHKAGLSSFYGPAILTDFAENVEMDPYTVEMVNRTLFSNEMIGEIQPAPEWTSERLEWIEINKDTRRTMQQNNGYELLQGSTTVQGRLIGGCIEVLEFAKGTELWPEKKHWEDSILFFETSEDHPEPSYIKYWLRNYAAQGILQKAKGIIFGKPKDEMYYEEYKHEILQVMKEHNLEDLPILYNLNFGHTEPKFILPYGSMAEIDCENGSFSILESGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MccC family protein
publication title Crystal structure of S116A mutant of Ba3275, the member of S66 family of serine peptidases
rcsb
source organism Bacillus cereus (strain atcc 10987 / nrs 248)
molecule tags Hydrolase
total genus 109
structure length 343
sequence length 343
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02016 Peptidase_S66 LD-carboxypeptidase N-terminal domain
A PF17676 Peptidase_S66C LD-carboxypeptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Class I glutamine amidotransferase-like 5f1yA01
3.50.30.60 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 LD-carboxypeptidase A C-terminal domain-like 5f1yA02
4EYSA 2AUNA 2AUMA 3G23A 5F1YA 4IIXA 3TLZA 3TYXA 1ZRSA 3TLAA 5K99A 5F9MA 4H1HA 4MI1A 3T5MA 1ZL0A 3GJZA 5FD8A 3U1BA 5JYBA 3TLEA 4MJXA 3TLCA 4JVOA 3TLBA 3SR3A 3TLYA 4INJA 5F5XA 4E5SA 3TLGA 3TLGB 4IIYA 4E94A
chains in the Genus database with same CATH superfamily
3C4VA 3G8BA 2QJFA 3VVBA 1AH2A 2CVFA 2DUNA 2QY6A 4W6QA 1YR7A 4H1UA 3TGLA 1BA3A 3RR2A 1FEZA 2ABWA 4YI3A 3VKVA 2PX8A 2JBKA 4A73A 2EYQA 3OE7D 2GNAA 1TEVA 3IKMB 4M8DA 1W49A 3CLRD 4P0QB 2AXEA 3KUUA 3QHPA 4AKHA 5EZQA 5HGJA 3HMQA 4EFLA 2GXUA 2PL1A 3WK6A 1T3LA 1CUFA 3P0JA 3WSTA 4C8UA 3VH4A 3ZLJA 1JHRA 2HYIC 3GLGE 1JPNA 1LVGA 1O8BA 4XASA 4P4IA 3EGOA 5E1DA 2YY5A 3TL2A 1N9ZA 3RT7A 1P0IA 3BIXA 3ZG6A 1MUUA 4BGIA 2TECE 4M1SA 3OFKA 3I9JA 1JEYB 1H8HD 5BR7A 4BLWA 2QL6A 4QU8A 5E2IA 4C1BA 2APJA 5GGYA 3ZWYA 4Z49A 3ZDBA 4O4HB 4BMVA 3QJYA 2I3ZA 2X5KO 4EI2A 1KERA 4FHCA 4RBNA 5H68A 3SQDA 1OBVA 3KG2A 4I4IA 1AK1A 1NZDA 4OP2A 2CJPA 5REQA 3PX7A 4KFUA 2HT1A 1IJFA 1FQWA 2H1RA 1V26A 1VMIA 3P9XA 5C1OA 3SJCA 1Q1ZA 1VMEA 4DLLA 2MWMA 4QU0A 5CX1A 4W5OA 2H7CA 1E4EA 1U2EA 2VPWA 3D31A 4Y1RA 2VI5A 4GKVA 1N2EA 2PGJA 1PSZA 4B8WA 1N1DA 5JPDA 1YXMA 4PTZA 1J6UA 1IZ9A 1RZRD 2PX4A 1C3OA 5LP6F 4RPHA 3ZJYA 4ID3A 1XT6A 1ENPA 2Q07A 2OHJA 3BSWA 3QEOA 5KSPA 1OV6A 4EA6A 3QGMA 3R9KA 1TUEA 2R48A 2IEZA 1H2WA 3L1KA 3F6BX 1VBKA 4O2AA 1UKEA 4KXLA 3UTCA 3IMEA 2AG5A 1Y3BE 1OQAA 1U8YA 2B2NA 2FP4B 4OQFA 3W1WA 2QX8A 4HNUA 4D97A 1SG6A 5EZYF 1O89A 3WYDA 5EJ4A 4BMSA 1E6MA 1SQ0A 4KWIA 4L4ZA 1C3LA 2XUKA 3OUZA 3OQHA 3EDQA 3PNKA 3NEJA 1EZAA 1P6UA 3KELA 1ZR2A 1TK9A 2XGMA 2ZJ3A 4AZSA 3EZFA 4E30A 4EA8A 3JZIA 4W8OA 4V3CA 1MQ8B 3MJDA 3OT1A 3G9ZA 2J8ZA 1R00A 2AMVA 1BS2A 2PKRA 4JLNA 5JZVA 5GOTA 4EUKA 1R0LA 3VPAA 2AUMA 2HTEA 1W34A 4IQ0A 2CWWA 4BO9A 1U0JA 1OFUA 3G2PA 5JSFA 5A5DA 1M8FA 3Q7IA 3P9RA 2QGFA 1JZQA 4IJVA 3GDFA 3WC4A 4U6QA 2VBGA 3JW8A 4YTEA 4JJ4A 5FA6A 1NKSA 7YASA 4V24A 2YDXA 1EGAA 5LBTA 4CZ2A 2H4ZA 1IUPA 4A8JA 3S8YA 3O8OB 1T8TA 2GJKA 2J3MA 2RHHA 3NTRA 4V0QA 3UMGA 3UJAA 4RACA 1E6WA 5A0TA 2P4UA 1Y6JA 3T7AA 2H65A 1E79A 1MG5A 3TEFA 3QX8A 4BHTA 4COKA 3ZIAA 2AGVA 3QTLA 4KQMA 4CMCA 3QY0A 1X77A 3DMPA 1PTJA 2GCPA 1EFVB 2I7TA 1VL0A 4PHFA 4OPMA 2NXJA 4CLDA 3I73A 2XODA 4FHFA 1J2RA 4GOJA 1UBKS 2KI5A 3UPDA 1YZTA 3V4FA 3IS3A 4QATA 4AJNA 5JZOA 2YJTA 2CD9A 4ARZB 1F8UA 2P4EA 4AF6A 4D82A 4FZVA 3KX2A 3RIYA 3EPLA 4C8TA 4PU0A 1YVRA 4MW6A 3T1NA 4MQ5A 2Y93A 2NUAB 3VR0A 1WQ3A 2GZRA 2Z8YM 4YAIA 1LW7A 3NCTA 5P8WA 1L8OA 3LU1A 1G5IA 2JZOA 5HUHA 2GT1A 2NTJA 3N05A 1PT7A 4WJZA 5HKOA 5J2TA 3F97A 1JGTA 2VUTA 5BW8A 5K3AA 3UJ6A 4OO3A 4LF7B 3S2IA 1GZ3A 4L4XA 3GUHA 4G09A 3CVUA 3DMTC 2K7FA 1ZSVA 4TRRA 2AEMA 4MJLA 3AFHA 5BSGA 4X5OA 4ZZ3A 4YECA 1UDAA 2DB3A 1K75A 3RSZA 1AG9A 1DDIA 2GN0A 2C3OA 3CRMA 2HK7A 1N2OA 2UVPB 3E8MA 3N6RA 1NJ8A 3D8HA 1QC5B 4Y7DA 3HGTA 4M8NE 1ISFA 1KP3A 3TDKA 3Q2IA 4OQLA 4CKEA 5C3UA 2GSWA 1SQGA 4ZVMA 3U9TA 3CV3A 5DNCA 1EINA 1MEEA 3NBXX 3DLHA 1XU7A 4JC8A 4DMUB 1ORTA 2FPSA 2WJIA 2RJOA 5C53B 4HGZA 3UICA 4LF5B 3WA7A 3OPYB 4BJHB 1V9LA 3AZQA 4XLZA 4FE3A 3CN7A 4ENVA 2LDBA 3R77A 3NX4A 4MRVA 3WIVA 1XPOA 1UL1X 1MU0A 1W0JA 2WF8A 1T2UA 1CUJA 5EE5B 4YR7A 1NL3A 2O6HA 4B8ZA 2W5UA 3CA8A 3L05A 4M88A 1JDJA 1I33A 2QVYX 2OILA 3I28A 3IIJA 4BO4A 2P9QA 1MH9A 3AUTA 5CPFA 1Q15A 4YEDA 1I2ZA 5HPYB 2I2CA 1FXUA 1GYPA 3HCWA 4TYPA 5MN4A 4P98A 2ZYDA 1SMKA 2H2FA 3ONEA 5H3CA 2IBSA 4LDRA 2AN4A 5LZ9A 3K0CA 1P9RA 1PFQA 1NYRA 3I04M 2XMPA 3ZHOA 1UOPA 1DCMA 2C77A 3NJ8A 4NFHA 3SSMA 3R5JA 4HT3B 1OOEA 1U9YA 4HCJA 1QG0A 3HVKA 3PE4A 3MRXA 2JIMA 1BE8A 1QGYA 1XLUA 2NZUG 4UAGA 1E2FA 1T0IA 5CXSA 1A8PA 5CBPA 1TUGA 1U28A 3FLMA 3JZMA 4LTNA 1CW2B 1EESA 4KWHA 1JBKA 2D3TA 3R9IA 2GPAA 2DF8A 2GA8A 4Z1OA 3AQ4A 2UXDB 1RPNA 5TY0A 2FF5A 1XMJA 2FZ5A 5MHTA 1UZNA 4LOJA 3D4LA 2EHJA 2QIPA 5JI2E 1T13A 2H2GA 2IC5A 5ALOA 5AVWA 2AKAB 3U17A 1JPVA 3R7NA 4EG1A 1H4VB 3OPQA 4DDMA 1KI7A 3C6MA 3NHLA 2P67A 4HB2A 4KOEC 3HZZA 1JMKC 2XE4A 3C8HA 1K6XA 1GITA 2R1TA 2KLBA 2OENG 2CJYA 1GUFA 4RMIA 1S01A 2BI8A 1XPUA 1OBHA 4N82A 4Q0MA 3TLZA 3GJTA 1D0IA 3LLVA 2C2WA 1WMBA 3BE5A 3PCXA 3SX2A 1JECA 1L1QA 3C41J 1A9PA 1NVTA 4U2EA 2GAIA 2PH5A 3G82C 3U7EB 1IXKA 4QNRA 2DR3A 3JWPA 1VC2A 3HJCA 4MV9A 3TZEA 3RVLA 1BFDA 1XCPA 3DM5A 1M8PA 1XYYA 3UUFA 2B1IA 2FRDC 3PS9A 2PS9A 3EUAA 4IHKA 1JLKA 5FNVF 1Z75A 5IDVA 2VRBA 3DUFA 2YJGA 5DGHA 1VB3A 4PLGA 4B2YA 2OL4A 3IEUA 1HE2A 1UCFA 3B1JA 1UUFA 3C3CA 1BHSA 4FBMA 4KVAA 2W2OA 1SVWA 3UFXB 1IBCA 3P9YA 4V1CA 4JOCA 4EB3A 1J0CA 1IAVA 2D1TA 5GM1A 1YC5A 4FLFA 1XMPA 2WB2A 3ZE1B 5JAZA 2FW9A 4GEKA 5D3QA 5JLJA 3AF6A 4NG4A 3V1UA 1WPXA 3BTOA 1NJSA 3EXEA 5M3BA 8OHMA 5BNZA 2WTUA 3U7IA 2IYWA 2O8CB 3NOQA 1X14A 1AS2A 2IE8A 4R54A 1GCIA 1H94A 4X92A 4Z3DA 1HYGA 5BT8A 1OLXB 3DHVA 1GFSA 2F17A 5KMGB 2O3QA 2G8LA 3PF8A 3CWZA 4MICA 4OVKA 1JE1A 1KS9A 1PZGA 3FBGA 1IRXA 1ZNQO 3BL5A 3GU3A 4ER6A 2FPPB 5CGZA 4YUWA 1MOQA 3WXMA 5BV7A 4J1NA 2FMHA 4Y2UA 1LDEA 3TM4A 1ZD2P 2GKOA 2VF4X 1S2DA 4NKRA 2NPOA 2WD8A 3W9BA 2FFHA 5BQ3A 2F43A 1U4SA 2G72A 4PCAA 1CY0A 2C31A 2O48X 3TW0A 3D7DA 3HP1A 1BAPA 2VSFA 3QVXA 2OVFA 3W5HA 3H2YA 1C0IA 4BO1A 2BGWA 2ZANA 2ZU0C 4H3HB 3HA2A 3KS9A 4KBGA 3BQ9A 1KOLA 1EK0A 3I58A 3K1YA 3RFTA 5MGBA 4MEBA 3HN7A 5C5CA 4QGBA 5ADWA 2AT1A 1Z45A 1WCXA 3PPVA 2FEPA 4HTFA 4Q1AA 5KWIA 4P4JA 1DWUA 1I4LD 2ZRPA 1V2HE 5FAXA 3T0TA 1B41A 2P9JA 5ICCA 1G0NA 1YH3A 2Q9BA 4NCBA 2PUHA 3BMXA 1N5IA 2YN4A 4B0PA 4GM0A 5LQUA 1NLYA 1W94A 2X86A 4RV9A 1N0WA 3B20A 4DR3B 2ZYGA 3D7FA 4V0LA 4U8HA 2BGIA 2WK1A 3GOHA 1ZJZA 1NW6A 2L19A 3JCZA 1O6FA 5HFNA 3SJBA 4BO5A 3DXZA 2QAJA 4WKGA 3T7IA 1M2EA 1VIMA 5JTTA 3NUZA 3MPOA 1P9NA 1X7YB 3TLYA 1MRSA 3FWNA 3ZXSA 2XUHA 2NP7A 2NZXA 5H0IA 3PE3A 3FUWA 5FL7A 2VDQB 3C4QA 3UAGA 4D9KA 1YV9A 5IJ9A 3GJ7A 2OR3A 1TNDA 3STTA 3SY8A 2BP7B 2C3PA 1SUAA 4R7GA 4W6ZA 3UT5B 2JI9A 2IXBA 2RC6A 2XRYA 2WD7B 5L3VA 4J0GA 4XFKA 4DA9A 3QU4A 5C1DA 1S5PA 1QZZA 2O3JA 3EMKA 3K9FC 3L6OO 2XB6A 3AILA 4CF4A 1OVMA 2OLKA 2REBA 2B6NA 4JLKA 4BZQA 5IDQA 2BR3A 2EF1A 2V4ZA 3V6MA 5M34A 1U3FA 3EOBI 2XQIA 4P33A 4OAPA 1N6OA 1Y7PA 3PA6A 4NCNA 4KHZA 4KSYA 1M6VA 2XKJE 3LDUA 1EWRA 1GLGA 3FKJA 4JKOA 4CHTA 3OE4A 1E64A 4EY8A 4M83A 4ZN6A 2WINI 2VBCA 3QMPA 2AK2A 5FPHA 2P6OA 5K4HA 1U94A 5AJWA 1Y9JA 1QPZA 4YX9A 3TTXA 3K70B 4AY2A 1PHRA 2XB9A 1V7PC 3RIEA 4C2TA 4NXMB 1KVRA 2IXEA 2WU1A 1FFCA 1W5BA 4PAWA 3LVBA 5ERXA 3I39X 1HV8A 5ARCA 4ETMA 1JYSA 2R66A 3EBPA 3GLHE 1ZW6A 2VH5R 3ANLA 3DVSX 2YW9A 2HF9A 3OP1A 5REQB 1PZXA 2EU8A 3Q9SA 4B9AA 4F97A 5JNLA 2D0PA 1NMSA 3A0RB 3CNHA 3HXOA 3EQ7A 5LPNA 4I8IA 1SKMA 2H0AA 2QRKA 2VT3A 1S9HA 1P5JA 2ZWMA 4PSCA 2CNNA 4Y1RB 3VZCA 3U4AA 5C34B 1MG0A 4N18A 4OLHA 1JU3A 2FR0A 4BFYA 2DWPA 3CU5A 3RADC 4CKBA 4DCSA 3O75A 3SS7X 2H1VA 5CFRA 2EJUA 2OGSA 2ISSD 5D7NA 2H54A 4TMTA 4CCSA 1VE5A 4BOYA 4Z99A 4ESOA 1RAFA 3N0WA 4IX1A 4E2FA 3H8VA 3RRFA 2YZMA 4O2AB 2VPTA 4PZUA 1L5NA 1LBTA 1K4YA 5ENDA 3L3BA 5F5LA 2ZITA 4GAEA 4POAA 5J2TF 5IDYA 4Z4QA 1XKLA 2GCEA 1KOGA 4ESVA 3I74A 2JLQA 2C2XA 2G9VA 1Q21A 1PR9A 1UJ4A 1BWRA 1EE1A 1S96A 2BBOA 5HR5A 1TYDE 2EFYA 1Z37A 3D8NA 3MTJA 3IUEA 3RUPA 1B6RA 2HJRA 4II7A 3WLNA 1US8B 2GI4A 3W7AA 3ZV6A 4PIPA 1WJGA 3M9XA 4MKHA 1YMVA 4JK3A 1DOZA 1YBAA 3EQ8A 1NT2A 1CRQA 3OQMA 2AW5A 3OIWA 3OT1B 3QE0A 3X1XA 4PQEA 4HXGA 1E66A 1U9JA 2ZE6A 3HYRA 4R9UC 3R5FA 3DULA 1ZHHA 1YVUA 2CHUA 4NRDA 3VNRA 4FN4A 1RYYA 4PXSA 2WV7A 1NR1A 1KZHA 1II9A 1BE6A 5KPDA 4DA8A 1U0HC 3REOA 4F4FA 4MCRA 3R7LA 2GYYA 3VYSB 3LUCA 1A8IA 4O2BB 2EQAA 3TECE 1H0HA 2CBGA 2R7LA 1A76A 1W29A 2EKQA 1RI5A 2HNBA 2WWIA 1YZVA 1M2NA 4FYPA 1UBNA 2OGWA 1X7XB 2W2TA 3DFZA 4J43A 4KFRA 4S24A 3WGHA 1N6IA 1POXA 4FX2A 4LMAA 1E0JA 3ZV7A 2PH7A 4J2OA 1H6DA 2CCKA 1ZK0A 3DDHA 1E7YA 5EQFA 3R0JA 4NJEB 1JLSA 2QL7A 2Y2UA 5EE3A 3PG5A 5IAOA 2BEWA 1U3GA 3R9WA 2O59A 2AWNA 1W0KA 3II6X 4OFXA 3QW4B 5BSUA 5HK8A 3DDOA 2DPLA 4RVSA 1V16A 2NV2B 3DEYX 4U7JA 3V46A 4B80A 3LLMA 5BV8A 1Q0TA 3KEQA 1E2UA 2C4WA 4ZZIA 3IBTA 5BWBA 2ZFUA 4E1BA 1WS6A 4GI3A 4ASUD 3LX8A 4E88A 1WSAA 3FYUB 2DPMA 4YMSA 1G38A 2IT1A 1CR1A 3O2SB 3OUUA 3Q85A 5KYXB 2EWVA 2FPMA 3L6CA 4GU5A 4XZ3A 1ZC4A 3OEHA 4EZEA 2VHJA 2X1LA 5FNZA 1GGOA 4PYOA 9LDBA 1DIAA 2P9CA 5C8XA 2OO3A 1DINA 1ONNA 2JLXA 3M4JA 4QDOA 5JWRA 2GF0A 5H7XA 4ND1A 1ST2A 1NA5A 4QD3A 4BNJA 2BKLA 3BE6A 2G4LA 3IKJA 5DMHA 5L3ZA 2NU8B 5IJ0A 1IQRA 1WA5A 4KIGA 4BO3A 2ZTSA 4RZQA 2X4DA 3OE1A 4P92A 1AQIA 2ZWOA 3A0UA 3ZDYB 3PL1A 2A57A 4CUJA 4HEQA 5L45A 1JAYA 5I7VA 3EF3A 4D74A 1Q0HA 2IYUA 4WXMA 1LK7A 3OZTA 4DARA 1SCUB 1OT5A 1P0CA 1XTQA 4GXRA 3IL2A 4QECA 3UW1A 3LD9A 2E3JA 4RADA 3D6JA 4OJNA 3C4JA 5D3MA 5EKTA 1YWGO 5HG0A 4WK0B 2V58A 3QBVA 4A1FA 1U4NA 4LFBB 1W93A 1XXHB 2ORIA 3E9DA 4ARCA 4WA8A 5ICSA 2BUAA 2HCRA 621PA 3ZNPA 2VDNB 5IZ4A 4FFSA 1E7MA 1MTZA 3TR0A 1DG1G 2C7OA 5F3RA 1IWBB 3GRFA 2HNAA 3QEMB 1NXWA 3INTA 3W2TA 4DLVA 3U3DA 2Q4EA 5KVVA 5AKIA 3FWHA 4W9NC 3M6VA 1Y4SA 1FVHA 4IXNA 1U7ZA 1MEOA 1FVOA 1DAHA 2KBFA 3OC6A 5BN5B 4U2CA 1Q92A 1JWLA 4YMHA 1I0LA 3C8DA 4GXQA 3DTVA 1RYNA 4BCDA 2IHKA 1G60A 2R00C 3KKNA 4TSKA 2A0WA 1ECGA 1MV8A 2FZVA 3VHRA 7MDHA 4G0UA 3UW3A 2GD6A 4NS4A 2ZAYA 5HKBA 3ERCA 3VYWA 4IHJA 4DT1A 2DT8A 2ERCA 4JVSB 3H4IA 4UUQA 2EX0A 5KOHB 1O58A 2PN1A 2VLBA 3DR5A 3QV1A 4MROA 3ZCQA 1OYVA 3E81A 1B23P 5ADUS 1GTG1 4WFQA 3WA6A 2MIIA 1SU7A 2FQXA 4F9EA 4ZGGA 3PQ8A 4W9RA 2XRZA 1JQ5A 1TUIA 1TJ4A 4PNZA 1A97A 3E61A 3SYTA 1AF4A 2DUUA 1F0YA 2Q3LA 2XOXA 4DGQA 5IWCA 5E95A 5EA2A 4I1SA 4A4DA 2A9VA 4J0IA 2W2XA 3GXOA 4AG5A 4J7AA 3HMKA 4MUNA 3ZXXA 4DLXA 2ZUCA 2QTWB 3TZHA 1AGXA 1XZBA 1OXSC 2O7SA 1X7ZA 1QKIA 5JD3A 2GYUA 5CP8A 1R8YA 4ZQEA 1KPGA 5I3ZA 3SC3A 2ZBEA 1DKUA 2QD2A 2BFMA 3QEJA 4G9BA 1CUDA 3JY6A 2YXLA 3BD8A 1EA7A 1KMIY 1R5NA 1VPTA 2ADFA 2MYNA 3NTQA 1QK3A 2R1TB 1UJCA 1LC0A 1PS8A 2ZSFA 3GC6A 4LZPA 5DBHX 4CTOA 4C9EA 5LQCA 4JGGA 1RHKA 5HJ7A 1X3SA 3R6DA 2JZCA 3VBCA 2L69A 1Y89A 4C7BA 2PWPA 2VTDA 2O06A 1P31A 1TAHA 5LNK1 3D4BA 4N0MA 5LA6F 4KQ6A 4M1EA 2RB4A 1MCZA 2BZSA 4ZV7A 1P9OA 4V0OA 1P18A 2P1ZA 1UAGA 3BH0A 2MOKA 5ALYA 4ZFNA 1Z2DA 2VAWA 2O1SA 3GIDA 3KUDA 4GR4A 3KTFA 4G37A 1MXFA 4W1RA 4FU0A 5DHFA 2F62A 2GERA 3LX5A 2QJTA 3SBEA 2Y0EA 2I1WA 3JR7A 3SC4A 4AQDA 1XZJA 1XRRA 5A4KA 5B1HA 2J41A 5JC1A 1Z16A 2QVGA 3HS3A 3AP1A 1MC4A 1ZEMA 4LGMA 4V1CB 2VCHA 2JRCA 3BBLA 4HWRA 5JSQA 5HJ5A 3OTOB 4OXQA 4BV8A 2WDZA 3K8ZA 3G2QA 4QO8A 3EZNA 1QB7A 2D13A 4G0OA 1HLPA 3ZHRA 1XMSA 5AUNB 2N1MA 4YA6A 1XDSA 3EQZA 4YJGA 4EIWA 3DBLB 4WUTA 1EFLA 2Y6UA 2PD4A 2Y0CA 1BQEA 2A1UA 2C42A 4INJA 1D6SA 3COYA 4L9RA 3CNBA 3TMYA 1EZZA 1ZINA 2YNMD 4YO7A 2XB2A 4B3RB 4JI8B 2JLVA 1E1KA 5EY5B 2CLHB 3UB4A 1PJRA 2F48A 3CO0S 2DXIA 4HL6A 4HMOA 3DMNA 4TS3A 1QR6A 1J0XO 4U6SA 4JJGA 3IERA 4F3KA 3T4UA 1UBCA 1SKAA 3PGVA 1CFJA 4OMUA 5SY9A 4F4IA 3HU3A 5C1IA 4JI1B 2XVZA 4P3YA 2JEOA 2HF8A 4ZI7A 4C8FA 4UHHA 1FBNA 5EIBD 1TZJA 4UQLA 2PUEA 3A1SA 1HYEA 4E7OA 1A4UA 3RC8A 1FNSA 3C3BA 2OCPA 1Y5NA 3QVMA 4IJWA 3TPZA 4PQRA 1K7SN 4HTFB 1KI4A 1WBDA 1AQLA 1DX6A 1LQUA 3HJUA 2FN4A 4AJOA 1EEHA 2Q9CA 3A4MA 1RKUA 4HMPA 2PO7A 3H3FA 1ISIA 3H7AA 4MEJA 1R8QA 4YRJA 1HLGA 4GLLA 1I6WA 1K6EA 1XQYA 2VC2B 3CRRA 5A02A 3GB9A 2AEFA 3QSYA 1ZO8A 5B53A 2F3UA 2GEUA 5LWQA 3AZPA 4MUGA 3C0KA 2VQSA 3PZBA 5EWMB 4E08A 5P21A 3KWMA 1VKOA 4LW8A 1MAUA 4ZVVA 5C8DA 2CKDA 2CIJA 3DTYA 4OQDA 2ZRAA 2WYWA 4L0CA 4OBEA 4TLBA 5ITZA 3R0ZA 3OQNA 1YS9A 1F17A 3X43A 2WOOA 5H9VA 3BRQA 4KPEC 2A9KA 1TIPA 4S05A 2F4NA 3KVYA 4QBIA 1A5TA 2NSLA 3RBXA 4FOPA 4MLDA 4G5XA 5DTIA 3MCZA 4QUJA 5K8VA 3UA3A 5IJ9B 3CXUA 2CLLB 2ZJAA 1Q57A 2JLZA 3I5UA 1AT1A 2AHOA 3ZHXA 5JMWA 1E3TA 4RA9B 3ROGA 5DM0A 1DZIA 4Z9AA 3S5UA 2BBTA 4E14A 4DJJA 1OX6A 3C5CA 2IU6A 3K20A 1HX7A 4HUTA 3G89A 4I2VA 5ELYA 1ZMRA 3ZBUA 2O52A 3L7BA 2IHBA 3PR3A 3KQVA 1KL7A 1M1YE 2HXGA 5DE3A 5FTKA 1I9CA 3SMQA 3D0KA 3GNQA 4HI0E 5C0OE 4RTPA 1T9KA 2AHRA 3DAFA 1M6VB 4RF3A 4RH1A 5HKAA 2C0CA 1NVWQ 1KDVA 3ONVA 3ZWWA 4MW5A 3ESYA 1Q0PA 2YUTA 5FBZA 3J81k 1YDEA 1QHNA 3OFJA 3Q1LA 4GVLA 4IQGA 3QIAA 4XLLA 1ODJA 4B0OA 1V37A 2R8OA 3FLAA 3SSOA 4EHJA 1JJ7A 2JJ1A 4CDGA 1AKWA 4OHBA 3C24A 1TGYA 2P9YA 3IB3A 1IC6A 3HZHA 3LBFA 2AG0A 3I2YX 1KBOA 1JHDA 2V5VA 3ILXA 4FS3A 4JEIA 5AWFC 3RYFA 3TW6A 1QYCA 1SUIA 3NBQA 2VDLB 4HDMA 2D0PB 4E5KA 1FRQA 3LOQA 3Q9UA 3WGQA 2FWBA 2J0SA 4HQ6A 2ZPTX 3RLFA 4ED9A 3UOWA 2YBEA 1Y8AA 1QRAA 1EZBA 2IYXA 1P6XA 1NU6A 4BBPA 4HV4A 2R2AA 2QTAA 1KJWA 1TU0A 3LQYA 4FI3C 10MHA 5TPZA 3MTEA 4CKBB 3VPGA 4NZYA 5BUSA 2QMUA 3HEBA 2OZVA 2R1VA 3X2EA 1IL0A 2AKYA 5KNBH 1WG8A 1W6UA 3EIQA 5A5FA 3T06B 4B3SB 1U2SA 4F3TA 2DQYA 3LP8A 5KTMA 5LVAA 3G5TA 1L1EA 4GR9A 1A9XB 1IEXA 3WDMA 1ULUA 1N78A 1EHYA 2KX7A 4AUNA 2DCUA 1ZGZA 4LMRA 3W6PA 3LA6A 4E6EA 1ISMA 1NP3A 1QG2A 1LJUA 3DXXA 2W70A 1FVFA 2XUFA 3AHFA 5JXWA 5A3SA 4PINA 2C04A 2V7BA 4IDFA 2SKCA 5KTTA 5AI8A 2A0KA 4ZAYA 3I8SA 5HYVA 5FPPA 4YDSA 4YAEA 2FWRA 1MKYA 8ADHA 2XMBA 5IT0A 1UQUA 1S8FA 2AOTB 2XNDA 3JQCA 3ON5A 5FRDA 5IDXA 1L1RA 4UU8A 4QPJC 4NU6A 4EZIA 2XPCA 2O5CA 4JIGA 4WMLA 3A3YA 5GINE 4RZIA 2A33A 3T0FA 4NGQA 2NU7A 1HMYA 2BELA 5FF9A 3G9TA 3VJKA 5AUPB 1U5CA 4PPYA 3RQSA 1R8JA 1I10A 1ZM9A 4A2CA 3W8NA 1UBHS 4NESA 3WLKX 3AERB 4HB0A 1GZ4A 3KVRA 3P7MA 4L3VA 3BI1A 4IRXA 4ZYWA 5IBCA 3SXUA 2WR8A 4A16A 4B84A 4Q47A 2C99A 2PWYA 4QQ8A 3TIGA 4CUZA 2Y76A 1Q0RA 2DHRA 3BFKA 3KBBA 3OQ6A 2X9LA 4U5QA 3T9BA 1FP7A 3EVTA 1JPJA 4UARA 3SICE 4FFPA 2OV6A 5K45A 2VP4A 1DHTA 3AJEA 3HDYA 4XH9B 5KTOA 2C7PA 5CW2A 1LGYA 2Y66A 5ALJA 2QZJA 3T5CA 2HKIA 1QTNA 3GG2A 4WKCA 3TI9A 1XJ5A 4CWAA 2Q1XA 3OO0A 4REQA 1A4XA 1ILWA 3K5WA 4W9MC 2JVKA 2J0UB 2CUZA 2XJ4A 2HCJB 5KYVA 1V16B 2PZEA 3NM6B 4XIIA 1HR0B 4ECEA 3KT0A 4G0XA 1RPTA 3NVMB 4P5EA 1QBGA 1XTSA 3HB4X 4GOOD 3RVMA 4IW3B 4PIVA 3UV6A 3ZWOA 4BQPA 3WJ1A 2A9PA 2QJWA 1U1GA 2V97A 4ER7A 5JWOA 1OI2A 3AEXA 3U7FB 1VPEA 3ZK8A 1FUEA 3GLTA 4NGTA 1C8BA 1SB8A 1E9SA 2NGRA 3GFBA 4PGAA 2VDVE 1RHJA 2XEJA 1E1QA 5T4HA 3M3DA 1AKTA 4N49A 3G13A 3LFTA 3SS8A 3BT7A 4ZVSA 2OESA 2X4LA 3EZXA 4GGOA 5EWLA 1YULA 1Z68A 4QXRA 4NV1A 4MVJI 3Q8XB 3MFYA 1PT5A 4OATA 1S2MA 4RPKA 5IJ0B 4F1WA 5EE9A 4LAFA 4OJTA 5KU1A 1NKVA 1O7JA 3ROFA 4BIIA 3UOGA 1E2JA 3H1AA 1RWKA 2NT4A 5TX7A 3WIBA 1YU6A 4CR6A 3E9NA 4EQ6B 1OLSA 2Z09A 2CHFA 3CZCA 4RM2A 2C2ZA 1Y5IA 5C7IO 3FOZA 1JEDA 4AM8A 2FCRA 3ZIUA 3B1YA 1EXMA 3M6XA 3RQIA 1LNQA 2X77A 3JVVA 4C6TB 2AXNA 5BN3A 3TRJA 4Y2GA 3R74A 3F6YA 3PPWA 5KAPA 4BTVA 4XGQA 4CCYB 1Q6YA 1C4KA 1TLLA 3MB8A 4K9QA 3MCTA 3QKIA 2EQBA 4YUVA 2G1KA 3JD2A 5EKUA 3FTPA 4J8PA 1Z88A 1VA5A 1X80A 5ALMA 1RXIA 2IEAA 3B52X 3FPAA 3AUSA 1Z36A 3NH6A 1EM8A 2OQRA 3EXG2 1IQ0A 1KVQA 4UTZA 3UTDA 5INTA 3ANMA 4PLWA 3ROMA 3WB1A 1NAHA 3NVKI 2OLJA 1T9CA 3WDKA 4AKGA 4DAEA 4IHJB 4V02A 3LIPA 1MQAA 2LTAA 3SHTA 3TQCA 4U7TB 1ULBA 5LDHA 1U8XX 2Q1TA 2Q0XA 3STUA 1XVIA 1B43A 1KJYA 2PS3A 1K66A 1UPCA 2KPOA 1K9VF 2DFDA 2BMJA 2YS6A 3KQSA 3EFOA 1GPJA 1XEFA 2IK8A 2YYYA 3RDPA 3F4KA 2X2PA 1NP6A 3R5KA 4TYYA 3OCVA 1DG9A 1H65A 3T3MB 1Q7TA 3HFGA 1II8A 3H13A 4UPEA 3I64A 1ES9A 1GNSA 1H0SA 4DQ0A 4BX9A 1SVOA 4F6CA 1XZ8A 3DLBA 2J3EA 3R0IA 1SO8A 3ES9A 3UWSA 4BB9A 4R0MA 4U4AA 4DJFC 2ONZA 3QOWA 1JIQA 3GCDA 1UK8A 2Z1DA 3TKLA 1XFDA 1X7ZB 4RESA 4TJXA 3O92A 3BSSA 5DVZA 1RWOA 3E22A 1RBZA 3M1AA 1BVYF 5E9WA 4JVNA 2WIKA 2PCNA 3FOEC 2CMFA 4MYCA 1W5TA 4BNUA 4EYSA 4WZAE 4OGGA 1K6MA 1ZJWA 3IQGX 3T5GA 4LYJA 5F1YA 1ISHA 2JCVA 2NSJA 2QUJA 3OA2A 1KIFA 1I7NA 4OL0A 2DQKA 2O7RA 2ZJ1A 3F71A 4PR3A 3LCUA 3W04A 3FCXA 4AF8A 4DLPA 4ZJZA 1P2BA 3NOXA 4AUMA 1UBLS 5EJEA 5IVIA 3R0VA 4YRGA 1AV6A 4ZQIA 2VK2A 4BPRA 2A5LA 3U1BA 4MV5A 4DWWA 5AM0A 2TS1A 2PGDA 5DF1A 3TG8A 4E2WA 3P0EA 4XYEA 1WP9A 4NGPA 2XGGA 1OBCA 3Q1KA 4C0BA 3QEAZ 4NAUA 1FFSA 1ULAA 1T9AA 1D3AA 1GZ7A 1RJFA 3D0QA 1XCLA 4KLZA 3UMVA 3DV0B 4JGIA 1BU5A 1O0CA 2VWQA 3VR6D 1P4RA 3IPAA 3IQEA 1RLUA 2FN3A 4EF5A 2YWEA 3ENQA 1PGQA 3MZ0A 1RT9A 3FZQA 1CLUA 1GSAA 1IZ8A 2D7CA 3BD7A 4LSZA 4YP7A 1BN6A 4FFNA 2WHPB 5I01A 3FBWA 4K9OA 3ZK9A 4XD2A 4HP8A 1DO0A 3IELA 1XRMA 3IVXA 5BSVA 4XJSA 2R8EA 1OH8A 3AR6A 4WZZA 1CEXA 4K6FA 4B4KA 2O2SA 4S1PA 1PV4A 2D7DA 1P5HA 3QI7A 4EF6A 1P2FA 1V47A 2FQYA 3HYTA 4OB6A 4PGMA 1LLFA 3O3CA 1TK2A 3Q10A 3FHLA 1PEKE 3FF4A 4J0NA 4CI9A 5DZSA 5LLSA 3UB3A 9ABPA 3R5XA 4RJKA 4KPUA 4CM4A 2WAYA 1FUIA 2Q6IA 3GH1A 5K3CA 5DSXA 1C7RA 3RREA 3JAMA 1K6IA 3W7VA 2QNIA 2PQ2A 2V7QA 3ZE6A 5DNYB 2GEDA 4DE5A 2HPHA 1NG9A 2R6DA 2ZS9A 3FBTA 5PGMA 3A31A 1UQTA 3PKIA 1MIHA 3ROKA 3TQIA 1VDMA 4X85A 3X1KA 4DJEC 4ZI7B 1NVKA 2NM0A 2I33A 3RHTA 4KGDA 1Y4UA 5I7FA 1NNUA 1XF9A 1Z4IA 1TQ2A 1Y1TA 3OEWA 2EKBA 2XEDA 4V0ME 2FDRA 3ZW9A 4B46A 1CUAA 2ENWA 2WPDD 3PZRA 1EG7A 2H16A 3ZWVA 3ZCTA 1KSHA 3V3KA 4DR6B 1E3LA 1JJBA 3AI1A 1T3SA 1L9KA 3PUKA 3WV5A 5AHRA 4EOGA 3HXMA 1QIJA 1WV1A 2BSAA 3HYNA 1L5FA 3K6KA 3WGTA 3AEYA 2KBEA 3QEBZ 3RHSA 2VJCA 5JMTA 2JH8A 2QNBA 3ZWXA 1JU4A 4NR0A 3VC2A 2X8BA 3A1VA 3GRZA 5HXAA 2D1RA 1AUXA 3NS7A 4CMIB 3GRVA 5ITZB 2F8MA 3NHSA 1WB4A 4DLTA 1XTJA 4BMXA 3KXDA 1G3MA 4RGQA 3Q5EA 4OSEA 1JQJC 2PVCA 3UB2A 3DOEA 3VYTB 3ZOZA 1TQDA 1XVUA 4BYMA 3SJXA 5DISB 2BGUA 2JKYA 2A9QA 2BI7A 1QH8A 1DB3A 5JH7B 1OZ0A 2EZCA 1JBEA 2QQFA 3R0XA 3L7YA 1IQUA 2HPAA 2X3UA 5HA5A 1GV0A 1DBQA 1WDWB 3JWJA 3LXUX 4RYDA 1C29B 2GZDA 4DMRA 2CCJA 4X7BA 1FFEA 2CKMA 3H2GA 5F9HA 2WEKA 1SHLA 1U8ZA 3JPWA 3PUVA 2WF7A 3DT9A 5A5GA 4ZQBA 3IB6A 3PWZA 1ADCA 3NBKA 2Y1FA 2VOEA 4PHCA 4R68A 1EG2A 3HNPA 1ULSA 3FA2A 5FCDA 4TVSA 2XCOA 3JZFA 3WLPA 4ZTUB 2D5BA 1Z0ZA 4WOJA 4GW3A 1F6WA 3WS7A 4DV1B 1E69A 2HQBA 3CX3A 4US1R 2Y1LA 1Q83A 2E1RA 1H1TA 3B6KA 3HJAA 4A2PA 2H85A 5LYJB 2BHTA 3E5MA 3QVGB 3RYFB 4BVEA 1EXVA 2JJ8A 3PUIA 1UMCA 5JJ5A 1QYIA 2SKDA 4LV5B 2JASA 3FETA 4WZAB 3SAJA 4D99A 2YMMA 5D87A 1HZJA 4HDMB 1AA9A 4D44A 2C1ZA 3IAAA 3OFND 3A28A 2QQ0A 3C3YA 4BMYA 4O25A 3JD4A 1YBFA 2W6ZA 4Q00A 3TR5A 2K87A 4I50A 1ZISA 2GBFA 2GN9A 4DBVO 3EDYA 2IYQA 4KNWA 3GN2A 4MV0A 2WRZA 3OP4A 1P62B 1RQLA 2EGHA 2Y3IA 3I83A 3LH5A 3F74A 4CEIA 4WXEA 1MB4A 2XYPA 3I1JA 5K0BA 2R1VB 4C2AA 1LX7A 5BPHA 2MU1A 5EI5A 4LDPA 1DBWA 1QIIA 4NS1A 2B8NA 2BFEA 2VPYA 3HM2A 4FYJA 4DCPA 1CB0A 4WUVA 4DXAA 5DHPA 4AX8A 1RZVA 3N3BC 3L7JA 3Q7TA 4NVRA 4XAQA 1E89A 4D4GA 4OC3A 4EHDA 2C61A 4FILA 1S2OA 1EJBA 4IIJF 3T9EA 5AW0A 1ZGGA 2PLWA 4DV2B 4HFRA 2HYDA 3OZBA 2AFIE 4E4RA 1SC9A 1CUEA 3NT4A 3J7TA 3EEOA 3V8NA 1YC2A 3BORA 4OQPA 5CR9A 1TXGA 2DBRA 4LVCA 4OKSA 3U4CA 1I2AA 1MIOA 3QVJA 1L7EA 2D1QA 3M9LA 1Z38A 2XZPA 2JF0A 1TU3A 3MSCA 3NAQA 1P0FA 2FQ1A 4BLUA 4D3FA 4DIBA 2D6FA 5BXQC 2XB8A 3I9MA 4OI4A 1XTKA 2NU7B 3PYXA 4ZPJA 2X0NA 4QG3A 2PGNA 2PUVA 3WGLA 5DXAA 4MW2A 3GEGA 4IS2A 2FUG6 4IYJA 4JCCA 2ZTUA 3EVZA 1GL7A 3ISTA 4UBKA 4XDGA 3O1IC 4P5DA 2W71A 2H4WA 2XMZA 1D8TA 2NPIA 3KAJA 5IK2A 3UXMA 4XOUA 5DWDA 5J4YA 3ND8A 4AJJA 2QSYA 2G88A 5H83A 1EWTA 2GTIA 1U2GA 3F9IA 4PFKA 1B7GO 1IYZA 5GM2A 3KOYA 3MW8A 4N48A 4ZV9A 1QQTA 3OZVA 3PKZA 4MB6A 4N65A 1WXHA 4R3WA 5GJVC 3T7KA 4EPRA 4KXFB 4B9EA 1GILA 2WKQA 2OFPA 1VXOA 4I5FA 3FWKA 4YCLA 3PWSA 1Z17A 3PC6A 2LKDA 4RIHA 2QN9A 4N7MA 3I2IA 3KJEA 3KYJB 3RIMA 1R0CA 4WZBE 3SSAA 5KOYA 1E3WA 1OXKB 2HA4A 2JCXA 2Z1MA 3QVWA 2XDAA 1QDUA 3V4SA 1B3RA 1FFWA 2HWGA 5G1OA 3R20A 1JF8A 2BM0A 1BFKA 1D2GA 1KEWA 2D2EA 2JFVA 4C7XA 1F2UB 1JHQA 5JI3E 3VU3A 4F8JA 1L4KA 1KE2A 3FVRA 3RHFA 4LZZA 3VNVA 2OXFA 2P9TA 1ZI9A 2I6FA 3OCWA 4ARBA 4EFNA 4UMEA 1R10A 3BHXA 1X8XA 3CVOA 3NH9A 2HJSA 2FCAA 2QRLA 4L5JA 4B7UA 4FGJA 2N47A 5JNWA 4X93A 721PA 5JAUA 1YNSA 2OV8A 2DULA 1RJWA 1EQAA 3PRYA 4EJ2A 1KAGA 1BH2A 3CZPA 3MBKA 5C8YF 4OX9Y 4BO6A 5DDIP 4BN0A 1TZKA 1RYEA 3MJ4A 3E03A 2YWDA 1RQNA 521PA 4ML3A 1UT5A 1P4JA 2DFKB 1K2WA 2ASVA 1HDCA 3PJEA 3IPXA 1AZLA 1OLSB 2VYVA 1XUOA 4F2WA 5KYTA 3L46A 2VHWA 4YJ3F 2QAGB 1WHSB 1G21E 3LTNC 3KOOA 2NLOA 1WDMA 4NQRA 3R7DA 5ISMA 3QUQA 4DUYB 1T3HA 3ASZA 4W5QA 1QO0A 3NEYA 4LDJA 2W8ZA 4KLRA 2Q2VA 2O9JA 5TNXA 5ALTA 3W7BA 2ZRBA 3A6JA 4Q93A 3QKTA 1NR7A 4RSHA 1OBFO 2COUA 2P78A 4CODB 5AIAA 1M2JA 1X80B 3CVVA 3ET4A 421PA 5DBFA 2Z2IA 1HPLA 5C5EA 4URXR 5CURA 1F48A 1A9RA 1AXRA 3KL4A 1ONOA 5FWXB 1YIDA 2ZROA 1QF7A 2C2BA 3HKDA 1PUXA 2ZYSA 3UKOA 3KB8A 3JAKA 5FPKA 5HCUA 4PXYA 1CRWG 4L0MA 4QOJA 3NXSA 3BJRA 5BSFA 1BQ4A 1KJ8A 1MO4A 4KBFA 1Z5ZA 1CDOA 1NW3A 3SGLA 5IKEA 1SXJA 1YF3A 1Q50A 1BQ3A 3H84A 1OI7A 3SC2B 3H6HA 4C3VA 2GCOA 1KDZA 1QOZA 4CEHA 3F90A 1V3QE 3U16A 2Z30A 1PYGA 1PVDA 2XYRA 3EFOB 1TA0A 1JG4A 2HMWA 2RGNA 1LW6E 2VXOA 2ZSHA 2I4LA 3JD0A 3IRVA 3BEOA 4P80A 5CPBA 4Z9XA 3FUXA 2BCJQ 3CH4B 1II8B 2MCFA 3S0JA 3S44A 1REQA 5DLEA 3VU8A 3IHKA 3L7DA 3KJNA 3FUVA 3AR2A 2HQ1A 2YJ6A 2WFLA 3NHJA 3SYNA 2XCTB 3SBXA 1PFGA 1D1SA 3VGJA 1H05A 2YJZA 3NONA 4IO0A 2FFAA 2XWSA 1RVV1 2PKWA 5FR1A 5JCXA 4HYTA 3PYMA 3PDIA 1N4DA 3N07A 2ZOSA 3E22B 4Y2TA 1DC5A 1EQUA 1FPMA 2HDHA 1MAVA 2GLXA 3MGGA 4JJZA 4Q4LA 5CXXA 4E5YA 1J8FA 1QHGA 1V8ZA 1N0UA 2ANBA 2EVWX 2O8NA 3AY7A 3E58A 2BD0A 2FB9A 2FP3A 4MYSA 1V48A 1QG4A 4RY0A 2JHPA 3S2SA 4IDBA 2YL2A 1DJPA 2F3SA 2IOQA 1UFOA 4ZYUA 4F93B 4HF7A 1WD7A 2C59A 2C8JA 2YCLA 1UKBA 1A9ZA 1WAMA 1BVRA 3LM8A 3ONDA 2FN9A 2ZWAA 3AP3A 4Q9AA 3EX7C 3O8BA 1XN4A 2Z6QA 2YW2A 3IDQA 3KKKA 4GDMA 4B7ZA 2Z3ZA 4G0QA 2PU7A 1BVHA 2OD9A 3DOJA 2HH9A 5B4TA 2GZ3A 3QITA 1UINA 4ARIA 5DK4A 1AKYA 4JC5A 2JK1A 3Q88A 1H4TA 3PHIA 4KFTA 2EATA 2F3PA 3P2KA 5L7TA 1WXDA 2IF2A 1SBQA 3DE1X 1E3MA 3PUZA 4GQBA 5G0UA 4TM8A 5LXTA 3BH7A 1LI7A 4IDAA 2IU3A 2J9RA 3DE5X 4XTRA 1AQ6A 2AZMA 3OQOA 2G07A 2D2IA 5BR1A 4U2GA 1JHMA 2DU8A 1WOYA 4P22A 3O3NB 3B9RA 2NXCA 2Y4NA 2V74B 5IANA 3WL8A 1TUBA 1U31A 2EV9A 1QU2A 1PV2A 4B34A 3IDAA 1XNJA 3PQ5A 1GNTA 1P45A 4XR9A 4MCQA 3N5CA 1XJWA 1UM8A 2JL1A 1PJ4A 4PYMA 4G5FA 1W7AA 2PMBA 5J9FA 2PUGA 2VDOB 3CUKA 3IDZA 4PYKA 3FVVA 5DW3A 4D6XA 5IUNC 5LFAA 1F7UA 1ZCFA 4DIEA 2P90A 2GILA 5JR3A 2D54A 2E4ZA 3UYKA 3AR4A 1TL7C 3DR3A 2CZQA 3W6ZA 4YCNA 2IUYA 3IQZA 4KPUB 2FNAA 1UKCA 4Q7QA 1K88A 4BLVA 1S7GA 1B74A 3O8DA 4EKNB 1N7IA 1JG6A 3C5WP 5BMVF 4US0R 3P9KA 3E9YA 3OEED 3PFGA 3BD6A 4FDLA 2XOKD 4Y30A 3BTUA 1RYDA 4PPNA 3BXXA 4G5RA 1Q44A 3IVMA 3OJOA 4Z3KA 1FDWA 2C5BA 3DFMA 3IA2A 2WQ7A 2FN8A 1Z4LA 3N2NA 1XMIA 4JJ6A 5KQMA 2MJLA 3A1TA 4UE3S 4WLUA 2Q5JA 5T8KC 3TZCA 4AP9A 1O94C 5CLHA 5EJ2A 4DRXA 1BX0A 2PJDA 5KREA 1T36A 4UTXA 2FLWA 2CGEA 1X6VA 1JFLA 3N8KA 4DANA 1VECA 1Y8RA 1UXHA 4K9LA 4BNXA 1QP0A 3QLJA 2VK1A 4AMVA 4HFJA 2NSHA 3FX2A 3JVUA 3U7QB 4KEAA 3USZA 2B8WA 2W2PA 3P94A 4I50F 3LBAA 1CC1S 1JJIA 2IXFA 3LX6A 1FB5A 4P3NA 2AC4A 5DCLA 5LZ2A 2WU3A 4HS9A 3R9XA 1ADJA 4UOZA 1JL3A 1GU7A 1PNQA 3IAM6 1SOAA 5JD6A 3M4NA 3JVDA 4FR5A 1AKUA 4GYWA 4GX5A 4UM5A 5LQKA 3OJEA 1ZGJA 3ACCA 1UJ6A 1ZJJA 3Q72A 2MYUA 2NADA 5B1DA 3UHFA 5HGXA 4JBHA 5DN6D 5IYZA 5K05A 1NXPA 3CLUC 5EHIA 2P35A 2PLFA 1UP7A 4E5UA 1N6PA 1Z06A 2DJ5A 2O3TA 2OFOA 3OH8A 4G36A 4IG4A 5CVUA 2CHEA 5TMBA 3ZQ4A 3CEMA 3AVVA 3VPBA 2F3TA 3Q40A 4BAGA 4IVQA 3F6CA 3E8SA 3O91A 3IQXA 1RWXA 1CRPA 2QD4A 3KYCB 5FI3A 4CGZA 1M54A 2V7TA 2D2FA 2ZQYA 3RCBA 4ZXFA 3QMMA 3WHPA 3AT1A 4H1TA 5KKCA 3M6UA 3D2CA 1KF0A 2H1WA 4WBXC 2ZZNA 2ZUWA 5HIMA 4OFBA 1H8ED 3TRIA 4F45A 1V35A 3QEKA 2OUKA 4M7WA 3C85A 1FQJA 1E1CA 2ENUA 1SVUA 3K0FB 3OZFA 2YIMA 4JASB 4O4LA 3ZDAA 3P45A 2DHCA 4URZR 4HLUC 3I23A 2IOYA 1ZGBA 1YA8A 3NCHA 1VPWA 1SOUA 3G0HA 1N2CA 3FYHA 1WZUA 3HCAA 3K71B 2CNBA 3K09C 4EVRA 3KCQA 4QHSA 2WSYB 2C2GA 3EIFA 5KTNA 1GGMA 1R18A 4FZRA 1UR5A 1RHUA 3A6HA 1E1MA 2H8GA 4POOA 5AICA 3BKXA 3FY4A 1BOFA 1OFTA 4MV3A 5LSAA 1PWEA 3NC0C 4R2XA 4MGZR 3U1VA 3R3HA 1ZMOA 4BY9E 3LP5A 2PMEA 3KVNA 2WVAA 1OZHA 1RBMA 3LNTA 1Z13A 5DGTA 1QZUA 1XCOA 3UHPA 1VCHA 1ZMTA 1W2GA 2A92A 4MNTA 4EBBA 2PMWB 3AXSA 3FNIA 1KMHA 4MJ7A 5CYGA 2F8TA 3L7AA 1U0TA 4YJ2F 4BS9A 1FSSA 1AHHA 3WGOA 3HHPA 1CZKA 1KK2A 3L1VA 5BVGB 1C1HA 1MDBA 1U80A 4CDMA 4EGSA 5KOJB 4UNIA 1GAXA 3JQFA 2FI1A 2DTXA 3BCSA 4CG2A 3HYSA 4P0TA 1KVSA 1XAGA 4OQYA 2ZVQX 3GEBA 3WISA 3FYTA 4YRZA 2BFEB 4KI7A 5EIOA 3KPYA 2NZ2A 3JD3A 3LMKA 4IX9A 3VV3A 3ZGOA 5B3KA 5C18A 1QNFA 2QMOA 3CUYA 3ZGXA 2R6FA 5HQTA 4E2ZA 3GP8A 1KYTA 2HZBA 1JHAA 4AYXA 4ZOBA 4LJ8A 4GE0A 4XE5A 5JXHA 1IN7A 1CE8B 3LK6A 1I5EA 2YHBA 1QZXA 4ND7A 2BMVA 4NBVA 4LXYA 4AVYA 1ESDA 3L8DA 1C8LA 2QXYA 5IKPA 1Q1AA 1VGRA 1CQWA 3Q0IA 3QX3A 1EFUA 2J5QA 1CV2A 1R9NA 4LDNA 1MIOB 3OTWA 4ND6A 3RYCA 3AI3A 3DMTA 2QZSA 1J4AA 1V8OA 2OBMA 4XKJA 4ZVUA 4FGSA 4LSGA 4PVDA 2BCGY 2W58A 3LGSA 4CN9A 1NI4B 4F8EA 3H1TA 4RVGA 3IODA 1WUHS 3QTBA 1RIIA 2SNIE 3ITEA 4M3NA 2GLTA 4G3XA 3RS3A 1KZYC 2EHDA 3CGWA 3BK1A 2QSJA 3PPIA 3O90A 2IXAA 1SPBS 4X84A 3N6XA 3PRJA 4BBJA 3FVWA 3S2EA 4YMTA 4BX3A 4REOA 3AJ9A 1X42A 4DCNA 2H06A 4QXMA 1OJLA 3IHTA 2B20A 2J6HA 3DHEA 2CVPA 1FU4A 1CS4C 3HKEB 1P7ZA 4L6AA 3D8UA 1OKKD 3DKPA 4NV3A 1IEQA 4QOSA 4ZEOA 3OIDA 1KBLA 1N5DA 4I5IA 4UDYX 4HAZA 3ZLBA 4YCBA 3MA0A 4JT9A 3ZGLA 3B89A 3ORSA 4GVPA 4YJDA 3PF9A 1M10A 4HDNB 4UCQA 5LLDA 1Y33E 1Z4JA 5JAMA 2QA5A 3P2MA 1KK0A 4EH1A 3D6MA 4YRLA 3MM4A 3CBGA 3E70C 3VU0A 1B0UA 1N3BA 1YQEA 2Q99A 2P2YA 4GOMD 2BW0A 1U7UA 4RF2A 3F49S 1MA0A 4IF6A 4HVTA 2O0KA 1E3WB 4UMVA 4C99A 2ZIVB 2GEKA 4F5ZA 4QBHA 3HBNA 4RIIA 1P0QA 1LI5A 4UVIA 3AR7A 4ZCRA 2XE6A 4G5OA 4CCYA 5K0JA 1IM2A 1HURA 4PN3A 3IOEA 4YCCA 3TNJA 3TVTA 4HRAA 5FYDA 3RROA 3O93A 3OOJA 4EMSA 3DV2A 4COOA 4JB0A 2X23A 3A1FA 4QJ5A 1QQ5A 1GZSA 2JGRA 5F1OA 4D46A 1ULZA 3VHXB 4JENA 2ZUBA 3WKCA 1NHWA 2AWOA 1W5SA 3BBPA 2AYYA 3I5MA 1NVFA 1ZA1A 1JW9B 2JIZD 2X9QA 3OJLA 4MQEA 5AQ1A 1R9GA 2GZHA 2BHSA 1KP9A 3M0EA 5F4ZA 3KE8A 4PRKA 4KYUA 2XI4A 5F35A 5TF4A 3O8CA 4JI4B 2HTFA 3RJ5A 1EHIA 5GIPE 3D7GA 2EFEB 1IZ0A 1NU8A 4K9KA 5CFLA 1XR3A 3HRIA 4IGIA 4O8ZA 1WXWA 2RHGB 3ZDDA 1H2EA 4YXWA 4BVHA 4JEMA 4EG5A 3D3WB 3R40A 1WMDA 1UPBA 4GNKA 3BGSA 4BGVA 5KWVA 1SGWA 1MO5A 1YL7A 3AF1A 3O1LA 2P2LA 4HYYA 3DKRA 3FFXA 1Z22A 3VO2A 1PR5A 4JUIA 4LYEA 1R4AA 1Z5OA 3R0QA 5HS6A 4TXNA 3X2FA 5I9MA 2CNLA 5EOVA 3AR5A 2FSGA 3PEWA 4Y67A 2Q3BA 4ZDKA 3SF0A 3WFIA 5LQDA 1GP2A 1V5WA 3GI1A 4GH5A 3OMWA 3ZBPA 1T1GA 1Q0UA 1T8UA 1W30A 4C08A 1XTBA 3I8XA 4GD3Q 4CO9A 3NHBA 3URKA 3PNSA 4G1FA 4MGYR 4YFVA 2HDOA 2XIQA 1KO8A 2IHVA 2IYYA 3HKDB 5KJFA 4H4EA 3K72B 2H1OA 2IHYA 2A0FA 4XUEA 2IQ5A 3QOFA 4J0QA 2P6NA 4NG5A 1VYVA 3S99A 5HZKA 2C6GA 1UFQA 1LDGA 2QLMA 5J59A 1LLDA 2YZGA 3FTFA 1NMXA 1Q7BA 1CEEA 1SXJB 2PKCA 4NGNA 2K6GA 1LFDB 1RDFA 5C1BA 2GCOB 3ZK7A 1XVTA 2DBQA 1OWLA 4M86A 2OXEA 1XTTA 2ZYIA 2BWJA 4YS6A 1IXRC 1XXLA 3OFVA 2H9IA 4IBOA 5IJWA 4JI3B 5CDGA 2XZTA 2Z2XA 4LCBA 4BWVA 2H6EA 4NOMA 1MOZA 1E2EA 5KX5A 3JALA 5BQ5A 4M1KA 2DGDA 4JR2A 5FPQA 2QTCA 5F12A 1T9GS 2WT4A 4M9UA 2POQX 4ZHSA 5IJZA 2MR5A 5IHPA 1HSOA 1PL8A 4L2IA 2WAXA 4Q66C 2WFLB 2R60A 3SN6A 5D86A 3ZBTA 4YUZA 2YQ4A 3ZU2A 1QP8A 1Z4PX 3KXIA 3L7CA 3PCTA 3FRIA 3K5PA 3T9DA 4H0NA 1V11A 3K0SA 3M4ZA 2PSDA 4U0JA 3O9MA 3PDIB 5KYGA 3LFHA 3LUDA 1FMTA 3V4RA 2J09A 3N53A 2VK8A 4HH3C 2EBFX 3GQBA 5KYWA 2NZ8A 3AI2A 4AECA 4A0RA 1GKYA 1WCWA 1LTQA 3DW3X 3QBDA 5DHRA 4HX2A 2GETA 2C9CA 4LYDA 2Y1WA 3WWYA 1GARA 1A04A 2EJTA 3SJUA 2PMCA 3F6EX 4GS5A 3ROEA 4L51A 3C3WA 3K0AA 1KU0A 5JAQA 1PD1A 4B73A 4D6PA 2BGRA 5K3FB 1UZLA 1QB8A 1ZUD1 1U04A 4CTKA 1LFAA 1MTOA 4MVJA 3MGKA 1G1AA 4JT8A 4WK4B 5HE9A 3QK7A 1PG5A 4OHMA 3GLIA 2RJ3A 4BE9A 3QOYA 9GPBA 3AH8A 1NBAA 1BVUA 1G5HA 3ZDEA 1KY5A 1CP3A 3OBBA 4J0EA 4EUNA 5CA1A 4TQAA 1OROA 3A9WA 2ZAMA 1YUBA 3RHZA 5T4EA 1M1ZA 3S27A 5LXTB 4M9CA 2QB5A 3DAPA 4CKWA 5HQ3A 5LQAA 1JXOA 5GJCA 5DEOA 1XD2A 1E1DA 1V43A 5JZBA 1JG3A 5FWYB 3KPUA 1K4KA 1P1IA 3EUEA 3OC0A 5K0SA 5IYZF 3DJFA 5JJLA 2IZ0A 5LL6P 5KQSA 3TX6A 1TUBB 1Z2AA 4OXXA 1TVMA 4RHFA 4Y18A 1MJGM 3S5JA 3HHEA 1EFAA 4J2HA 1YB5A 1ISJA 3QXXA 1Y4DE 4R1UA 3ADPA 4BVKA 1TPZA 5DHAA 1ZZEA 1VPLA 2REXB 3NYIA 4RMHA 1PLJA 4DOMA 5IAAA 3IE2A 4P58A 3S81A 2AF4C 1J9GA 1VJGA 3BYZA 4RD3A 1T2DA 4YAGA 3QOXA 1Z18A 4ID9A 2VR1A 1GPWB 2WM3A 3E9RA 1QH0A 4PG4A 2P3QA 2ODPA 2W6JD 4GMXA 3LOPA 3AKEA 4GPZA 3RVOA 4E94A 4EPYA 3IDSA 2GVZC 2B8EA 3BMNA 4O4LF 1F7VA 1VSBA 1Z8FA 2IS1A 1JLLA 2WYVA 3JYNA 3AUKA 3DMRA 1F9EA 1SY7A 2ZXFA 3GR6A 4HDRB 4Y9SA 2PL3A 2V59A 3OD5A 2PIDA 4FINA 5SZJA 1ESEA 1Z35A 4BLTA 1G66A 4I9FA 4H16A 5AR1A 2FR8C 2W6NA 2P2NA 3PR1A 3ZS8A 4ZWNA 1QR2A 2JAXA 4FDUA 3M5WA 4Z0PA 1JR3A 1X74A 1T36B 5FJJA 3EWIA 3KQMA 5IG2A 4P45A 3K9NA 4PZCA 1R3DA 4G0ZA 1CJVC 1Y8RB 4BFCA 4TZTA 1PS9A 4EG8A 1SXQA 5JO9A 3CX7A 4BBAA 3B1VA 2VWHA 5KUTA 3D8BA 5JUWA 2PYIA 4RVNA 4HBZA 3SEZA 1VDZA 3I0MA 3VHLB 4W99A 4ZD6A 3GGOA 4Y9RA 3R9XB 5KYKA 1B4DA 1YZHA 3C6YA 1GTZA 3AOEC 2ZW9A 3HA7A 2FSPA 2NXNA 4H1HA 4MI6A 2WKPA 4MI1A 2YFKA 4KGZA 3OSZA 3VR5A 5JFGA 3T8YA 2JJMA 2ODWA 1CJBA 1IMOA 2IQIA 2XADA 4JOSA 3E7FA 1UKVY 4AT1A 1RPZA 1U9IA 3I4CA 4G24A 4OGFA 4KAJA 3DQZA 5JZSA 1UT6A 2ZUDA 4PRLA 2H1SA 2BMAA 2QT1A 1S4QA 1FYDA 3MCUA 1JHUA 2ZE8A 2C3MA 4JFRA 5FUVA 3WAKA 3ZXYA 5A9SB 1QO7A 5IARA 5AW2A 4RIGA 3VPHA 3NHUA 4NC9A 4J6FA 1Z4NA 3PHLA 4DG9A 5KDOA 1H6CA 3QVLA 4MUJA 1PJ2A 4WJKB 1PX2A 3MRVA 3VR6H 1R6XA 4YAWA 3ETEA 5FAKA 3L49A 5JRJA 1XV5A 3A7DA 3FPCA 4ZCLA 3DBHB 1OAOC 4RFVA 5JMPA 2R5WA 1EP1B 2QQEA 4BLSA 1E1CB 4YQEA 2GD1O 2BFFA 1L5KA 4YJHB 3V8RA 4W5JA 3TMAA 2UUBB 3LQRA 2V6GA 3KJZA 1GN9A 2EW1A 4BFXA 7REQA 1PG2A 2ZE5A 3IQHX 3QNMA 2V55B 3GDWA 4S3MA 4BNNA 5CA0B 3HU5A 4P4NA 5AJTA 5HEKA 1E18A 5FOQA 5M04A 2WC1A 3RTGA 3M33A 2AR0A 2NTYC 2Q3HA 4FJ0A 3TRDA 4EUEA 3KETA 2PCLA 4ALNA 2OPHA 2XVAA 3STHA 1XQ1A 1XCBA 3I6ZA 3SLRA 4DXHA 1GL3A 3FXAA 4RORA 5BWNA 5KPJA 1C7IA 3OTGA 2ZPAA 1P60A 1BMFA 4DJAA 1ACMA 4Z2YA 5LZ7A 4N41A 4DCVA 3WYCA 2JA2A 3O8RA 3T05A 1BKSB 2OBNA 1WIWA 2HGSA 3QYPA 4MIYA 2NACA 5LNK6 4OBBA 2P9BA 2EBWA 2K2WA 2XNHA 4Y6RA 1AURA 1P3Y1 1T1RA 3LPCA 5AKKA 1Z7GA 4QHTA 3KQWA 2JFXA 5D7BA 3MRTA 2GTPA 2IYSA 4I55B 4IDHA 3HBLA 4UEQA 3HM9A 2P4HX 3EAGA 4O2RA 1JVNA 3IAS1 1AQNA 3LL7A 4QPDA 1WXFA 1YA4A 3QF4A 1Z74A 1XLTA 2I76A 4QFCA 3AU9A 2PRZA 4JX8A 3JQ6A 2UKDA 4OY3A 2FOLA 1Q84A 2K4MA 3EFEA 4FHEA 3Q9NA 3ED1A 1T9BA 4MS3A 2P79A 1KI8A 4MI3A 3SJAA 2ZJYA 3JVEA 1JHZA 3RYCB 1Z7YA 4R2MA 3MIZA 4A0HA 5IHXA 4H7KA 4C7KA 1YMUA 2ZDGA 3TE7A 3WWZA 1ENOA 1ZMBA 3V2UA 2A9FA 3AB7A 1KZ6A 3ESRA 3A9VA 5ENVA 1PJAA 2O0MA 2OV1A 4MCSA 4N01A 4X3PA 4G0NA 5EWJA 1TKAA 1YZQA 2Q27A 3VI4B 1ISGA 4TLDA 1X1QA 2YV2A 2GRAA 4OI1A 1A5ZA 2BEVB 1OXUA 2I6SA 4GX2A 4K40A 3GEHA 2VDWA 4EMUA 4NGMA 1RAEA 1NURA 3SF8A 2NVUA 3AEUA 2OO5C 2CCGA 4BP9A 1P2GA 5T4BA 1VLQA 3D3QA 3PSHA 4MQFA 4P3KA 5TPWA 4EW2A 1SNYA 4K81B 1PBNA 4LJ6A 1VJ5A 1SBTA 4LXQA 4RY2A 4WXPA 4P82A 1SHTX 1RMYA 1TF5A 4XYLA 4H77A 1TO1E 1W6RA 3ZDQA 4DYHA 1JSZA 2BFAA 4DNFA 3PXCX 3I62A 4UOEA 3L0IB 2RGYA 4HYQA 1FRNA 4TYMA 4GOXA 1E5XA 4DMMA 4ZMSA 1T8RA 2DT5A 3B7WA 5FWAA 1OA0A 1EGQA 4KYTA 2BRUA 2XXAA 4J75A 2C84A 4QJBA 4LBVA 3RUEA 3RIGA 1H66A 1Z5WA 3WQSB 1CEQA 4LGCA 4BP1A 2M1XA 2R00A 3GAZA 2HRRA 3O3MB 4W8GA 4X45A 5DNUA 1ZRMA 3SBOA 4EO9A 4HJXA 5FPTA 1T9ZA 4TV9A 4MRAA 2BYTA 1QTRA 3NHZA 3PGMA 3DMDA 2QYTA 1JG1A 4DMHA 5KX5F 1O4VA 3WYEA 1V5EA 4BKOA 4K5QA 2D8MA 1DEKA 4MQEB 2J0EA 3SEQA 3VNAA 4JLMA 4CIAA 1ZH0A 3MOIA 1UXGA 3ZVLA 2D5CA 2NN3C 5J4KA 1RJGA 1JIKA 2C4UA 2Y1EA 4EKGA 3NASA 3RW9A 2GJ9A 3D02A 3MYRA 3BB4A 4L6IA 1M3SA 1VFNA 1NW5A 2ZRCA 4WT7A 3WFZA 4O33A 2YQZA 4Y2VA 3AX6A 4EL5A 4QVKA 1UC4B 1ECLA 2ZB4A 4AG3A 4CQMA 1IBMB 4MZXA 4P6VF 3S2FA 4PBSA 1VE7A 4MV7A 1E6EA 1GRCA 1Q95A 3H9EO 5CDFA 1AMOA 4D45A 1SM4A 2D3WA 1W5AA 1TVKA 2NTVA 1UODA 3G0DA 4RWEA 4MQLA 1EH5A 1JWAB 2O3SA 1H3FA 2PD3A 5CXUA 5C8ZA 2QX7A 2O2DA 1NVUQ 2XGSA 1ZOOA 3S2YA 1WUIS 2EGUA 1D03A 2E5FA 1X1BA 2WLTA 3H1EA 4GBED 3TMKA 1XN1A 2Z4TA 2I6XA 3A32A 2R6GA 3IVAA 4LQ4A 2JIPA 3PRKE 4Q05A 3TZQA 4B8YA 1W48A 4CI0B 1XVAA 4P7JA 1PVOA 1I0ZA 1YCDA 1WW8A 5CH8A 1JA0A 1UBUS 2BKUA 4LRUA 3SEFA 3O4HA 4LHWA 5I9BA 1W35A 2VRWA 3EPJA 2YVQA 2KHZA 1C0EA 1N2XA 1AO3A 3GVHA 2EDAA 1SR8A 3EXHC 4XA8A 2HA7A 5K8UA 4YJFB 1DWOA 2GCIA 1CIPA 2NT3A 2YY6A 1MMFB 3WVNA 4TXLA 4X64B 5HK9A 1WKBA 2QJOA 1X7GA 2HJVA 2QVLA 3CMMA 1J7JA 4M76B 1O03A 3KAKA 3L0DA 2F7SA 4GC9A 4BNHA 4WBSA 2DMRA 3EZ6A 3AR9A 3CX6A 1TF2A 4GXTA 4RV5A 1EVLA 3LTEA 5AK0A 2FSVC 1EGVB 3LSYA 1LPSA 2SECE 3O4VA 4MAMA 4DMLA 3GDOA 2JGJA 2VQ3A 2HK9A 1LBIA 2NW6A 3PTZA 1ZJ4A 5EUMA 5K8TA 1MF7A 1ESCA 4RD4A 4E2YA 1VLMA 3TD2A 1CVRA 3GW8A 3ETCA 3NBMA 4GPD1 3ZCXA 4P4EA 3FM9A 4L76A 2GFQA 4YCAA 3PJFA 1YQWA 3PUXA 2X15A 3WKAA 3EY9A 4EX6A 4U7WA 1V11B 2X0KA 1Z6QA 3GMTA 2QD3A 3OWXA 4OBXA 2Q6VA 4O4JF 1QFYA 1Y3AA 3TB6A 1KH3A 3TCXB 2P3OA 1L7XA 4MWOA 5ELLA 3B1KA 3IJRA 3KXKA 1D0VA 3EW7A 2ZIXB 3H5RA 3KD3A 5U4XA 3VKHA 1Z5GA 1NQWA 3W5SA 3TDNA 1NR5A 2IWRA 2HBYA 2X41A 1I7LA 3DCJA 4YAJA 2OXCA 1XEWX 4FSDA 3KPJA 2VH2A 1WVIA 1AXGA 4Z1MD 5JQWA 5JZ9A 1LTKA 4J76A 1WCV1 1J1UA 4C2BA 1ABBA 2C4VA 3KOMA 1VGQA 3G7UA 1EVEA 1FE8A 3OVMA 2QZZA 2XVYA 4Y9TA 3BZUA 3KKQA 5F1PA 2ONJA 1HNZB 1VJCA 4GLJA 3H9QA 3QUCA 5LQRA 2FX3A 1RRGA 2XTNA 4N3BA 4URHA 3M9WA 1EPUA 3GLIB 1ZN7A 4JL6A 1UJ5A 4JLJA 3F1LA 1O95C 4BNWA 5AM3A 5JAOA 3DE7X 1UXIA 5I4CA 2I2XB 3K8OE 5CA1B 3NNNA 4TLLB 3VUEA 2H1HA 3A04A 4GC5A 1D4AA 4X60A 1U7DA 2Z0MA 4K03A 5E0OA 4TTJA 5ICFA 5U1PA 4DLWA 5M2QA 3FTCA 5HQ3B 4RE5A 3P2JA 3SQXA 3VOAA 2B4QA 5AMXA 1I8TA 3QV2A 2Z5VA 1FFGA 1FZQA 3KEMA 4FWIB 4KX5A 5ILGA 1FS4A 3R3ZA 3LQ4A 3V1KA 1RI4A 3W2GA 5HRUA 1HEIA 5J58A 2RSLA 2WG0A 4PLTA 3RBVA 1JXQA 3BJZA 4LRTB 4GYJA 1ZH8A 2YWRA 4OG2A 3VPFA 3RVBA 3LP6A 2X3FA 4MWCA 1PQUA 4WBNF 4FCVA 3LYAA 4N1AA 3N8HA 3VPDA 2AI1A 2C7BA 4H08A 5CD9A 2CVHA 1UBEA 1J9ZA 1E3DA 4D41A 5K3SA 3ZQ6A 1DXHA 4N54A 5CNKA 4KZKA 3WMFA 3RC3A 3HSYA 3K1TA 3T52A 4JXKA 1PJ3A 1NOIA 2GGSA 3HR7A 3EIXA 3Q3VA 4IIBA 3WHKA 4BB6A 4XD7A 2GYWA 1KH1A 5K0EA 1CUWA 1W4CA 1CR4A 4TVOA 5E1BA 2EBHX 4MW4A 2CN1A 1NY6A 2QOEA 1JLLB 4L0QA 5I9SA 3U3KA 4DUPA 2O8BB 5DTEA 4FR0A 4ZHQA 4X7PA 4NONA 1MRNA 2J9FB 2Q9AA 2NIPA 2XX3A 3C7AA 4IIXA 4LA4A 2Q5CA 4WLEA 3PV0A 4TTRA 2BLNA 5KZMB 3KSRA 4J0JA 3JWHA 4F5EA 4MPPA 2B83A 1N9GA 5GPBA 3FSJX 3KJIA 1F14A 2R7AA 4OSOA 1EHCA 3V2IA 4LF6B 4N8EA 3FI0A 2IPMA 4RZ2A 3ONFA 5K6TA 2XT9A 4TT3A 4JJFA 5C32A 1OC4A 4ZOLB 4MRPA 5D5PA 3RYHA 4CMJA 1M2VA 4G67A 1WHTA 3E3NA 1DELA 4RZ3A 3OICA 3HJNA 3E5HA 1YHYA 3OX2A 1T5LA 2WTBA 3OCYA 2QE7A 1LQTA 3LCMA 5BUQA 3R8FA 3PQ4A 5BOSA 2O19A 2BDEA 3F8WA 3H5OA 3RVQA 3C3AA 5JARA 3HUUA 2FPLA 1P1JA 3PC7A 4AW9A 5J4HA 3SVZA 4RTJA 1P39A 1UKAA 5CK5A 2BEUA 2Q2OA 1L7MA 2AE2A 2ZI6A 1JJFA 1Z6TA 4KP7A 4ACBA 2IPOA 5ESWA 2ISQA 4QRHA 3TIFA 1JIVA 1X1TA 3L1IA 4KIFA 4ND8A 5AVOA 2OT3B 4KWCA 2RHCA 1YR9A 1RXSA 2IEDA 3NU1A 4WKBA 4EITA 3ICQB 4JQZA 3RB8A 1UPTA 1VE9A 4LHYA 4CETA 2HI0A 1BDBA 1FUYB 4LNAA 3P9PA 4XGKA 1ZH4A 2GHQA 1JDVA 1JLHA 1XA3A 3D5QA 4P93A 4S12A 3RS8A 2D5IA 1ZKDA 1J42A 3TSCA 2VYND 2BF7A 4C84A 1SAYA 4LWQA 1RRKA 3HCOA 1SRRA 2MSWA 2BL4A 1LDMA 1KJ9A 1P19A 2HV8A 4PR0A 1Z29A 3D4IA 2ZWPA 4O3FA 2VSQA 5ES3A 1KQFA 4TLCA 1MD9A 3HBFA 4K2HA 3TLMA 3E3OA 5D1HA 3UFBA 1ZP6A 1LSUA 1CZOA 1SCDA 5I7AA 4OP3A 1QYDA 2CZCA 2V4UA 4D3XA 4TKLA 4IV0A 3MCAA 4TKMA 3ZTWA 5C9ZA 3GLFB 1JDBC 1XP8A 2HLNA 1RZUA 3WJAA 1SD2A 1HFKA 1Q14A 2DR0A 4OCZA 2BFFB 2C2KA 3Q6NA 5LOVF 2DLCX 1UXKA 3UAZA 1NVGA 3EVNA 5K01A 5CNJA 4OM8A 2QPTA 3VDXA 4UU0A 1VG9B 5KCMA 3FG9A 2E28A 4LZAA 1NTRA 4OK5A 3UAXA 3OTIA 1NJ6A 1C7FA 1NI3A 2OGZA 4W5RA 2ZR7A 3P52A 4MINA 1CUXA 2OCBA 3JQ9A 1LCIA 1QYVA 4JT2A 1K0FA 4QQFA 2AFHA 2YFHA 2M9MA 4I4TF 2EOAA 3ANNA 4LBYA 5IC6A 1C50A 1FMJA 2P7HA 1WXEA 1Y3DE 2DJIA 1H9AA 1EX6A 3DP9A 5JECA 1CJMA 2DPGA 2W2LD 3LRXA 1CFZA 2CDCA 3OPYI 3UJ3X 3P0HA 3N5KA 3I2FA 2PJZA 2C2HA 3CC8A 3IPLA 4Y2RA 3QYJA 1AGYA 2C7GA 3EZGA 3CRVA 4O63O 1I7QB 4K6GA 4XVRA 4PLCA 3R5SA 2I1LA 1LSJA 3RLIA 4I08A 2GQ0A 1HOXA 1P3JA 2BOVA 3IAXA 5CG1A 4Z8XA 1E63A 4B79A 3H2SA 4AJ4A 2JCBA 5D01A 3OX4A 3WV4A 2X6QA 2ZRLA 2ZEJA 3AXTA 5T7BA 3K05A 3EMBA 4UHFA 5JCZA 1YUNA 3C8UA 3E9ZA 2HY7A 2IHTA 4NYJQ 1DTSA 1VHWA 4H18A 2H8KA 1E3IA 2O57A 3N2GB 3DWIA 3GFQA 3QF4B 4U2DA 4XUGB 5DGIA 1L2TA 4JP8A 2O1EA 2XV1A 3LDAA 3D7RA 5JCJA 3NDIA 1XLVA 3AB3A 3MXTA 3BSFA 2CFOA 5C37A 3TBKA 3I1FA 4MW1A 2Y1KA 1MC5A 2F8SA 3IDFA 4DBZA 3NP7A 4WSOA 1OH7A 4UZEA 5HDQA 3ZY3A 3QELB 4MS3B 1BKDR 1WSWA 3KQTA 4B74A 2QT0A 4GWKA 5IBRA 1NN1A 1X87A 1T2EA 4U3JA 4ZDIA 3M83A 1UF9A 1XKTA 2QD5A 3U4QA 2WWXA 4JZYA 1NVXQ 2YV3A 3CCFA 4DUGD 4E22A 2P5SA 1R37A 4K8OA 1BOOA 4Y9UA 4KN8A 3NDBB 3N7TA 1PT8A 2OXTA 4G2NA 4EJ0A 5M7EA 2A30A 4DLZA 4F6RA 5IS2A 1J39A 4YP5A 1G8YA 5AHXA 4S1OA 4Z1MA 5BXYA 1K2VN 2AD1A 2BFDB 3EH2A 4WNAA 4DVJA 4Y6PA 3Q7SA 1GADO 5CLQA 4GZLA 1MAWA 1U8EA 2ZIZA 3JR3A 4L73A 2XEGA 3SF8B 3AEUB 3VNQA 3DA8A 4FMDF 1SUDA 2VJYA 1HY3A 1VLZA 2JCYA 5ALGA 5TPWB 4F92B 4FWTA 2EZ4A 5DX8A 3WGMA 1YGYA 4FC7A 2JGLA 1J2EA 1JZSA 4RGBA 4B2PA 1TW3A 4L27A 1MB0A 3CTMA 4JZKA 1YDFA 3SDSA 3FPKA 1UK7A 2B4KA 2H18A 1PL0A 2C5SA 2ZU6A 3DKKA 3RANA 4AO7A 4HB3A 3R6LA 2XXAB 4EO7A 1BMQA 2KJQA 4BAZA 1Q12A 3AKDA 2PNFA 1EP3B 2OMKA 1TFUA 4BJ6A 4NATA 4H7HA 5F98A 4ALIA 3FLBA 5BV2P 2CXXA 1DEXA 1KORA 2ZRFA 3QP9A 1I4EB 2I66A 5BUZA 5KSZA 1XEXB 3ZV4A 1S1MA 3ACDA 4TV9B 3G7SA 2O8DA 3U1TA 1BYIA 4HC4A 2JLBA 1BDHA 4YPOA 1NMYA 2GRJA 2OD2A 4MR8A 2WWVD 1QHIA 4D3ZA 1E20A 1NULA 1SCQA 3D0OA 4GGMX 4CKCA 1HE5A 3QJ5A 4IFBA 1KR5A 1TD1A 5J47A 4QUDA 1BD4A 2B36A 5JCOC 2UZAA 5KJ6A 2Z4RA 2NVOA 1VCNA 2OZLB 3DZDA 3PHCA 1R8XA 3K0KA 4IEFB 1I2MA 4L1KA 1GQ2A 2FZLA 3RIXA 2J9YB 3E48A 1C9JA 1O96A 2WF5A 4I6EA 4CQMB 5ECWA 1ADBA 1FNCA 2Z5LA 2HMSA 4DLUA 1FX0A 1GV1A 1V95A 4HATA 3LAWA 4R2JA 3CH7A 1LEHA 4N0QA 4AMYA 1TVKB 4GX0A 4X6XA 2EL7A 4A15A 2B98A 2Q4RA 1U99A 1JQDA 4MR7B 3JAWA 1KAQA 3G2HA 3E9EA 2XKAA 1QAOA 1UJNA 1X8KA 1XP5A 2PPLA 4MK4A 4O59O 3V2GA 3AW9A 5J2UF 4N76A 2H5LA 3L1JA 4EY4A 4MITA 2C9ZA 1FDTA 3R2JA 1U7TA 1NBEA 1C1XB 1T0PA 4HAVA 3LUBA 2G1UA 1QTQA 3KQQA 3MJEA 1C2TA 1SXHA 2AG8A 2HLDD 2QTFA 4R41A 4NZNA 1YR3A 1H4SA 1U90A 1IY0A 2MMCA 3L8CA 1OI4A 3T3OA 2CHGA 5BQXA 3VR4A 2PUTA 1QYWA 3S9MA 1VL8A 4CMEC 3RO7A 3EVEA 4W4TA 1Q2XA 1KQNA 3THWB 4RHCA 4NXNB 4ICIA 2FHPA 2PGIA 5DGDA 2CXPA 2POCA 3QXHA 5IVDA 3WGNA 5KJCA 3SNKA 1PWYE 1QDLB 2NSYA 1P81A 3FOFC 3HNOA 1NE2A 1DX4A 4RY8A 5IAJA 4AF7A 2XRMA 3WLQA 2ZRHA 4A6DA 1X86B 3ZU6A 1VMKA 1X0VA 3QPVA 1L5LA 1KYZA 4TL7A 5JHHB 2I3GA 3I9FA 5IC4A 4PYQA 1C41A 4V2IA 1Y1PA 4S1WA 5KU7A 3W5CA 1KI6A 4CG3A 1N0HA 4PZ0A 1AKMA 2IV2X 4RPGA 3QXCA 1A8HA 1Y3HA 3F4BA 4A91A 2G1PA 2QAIA 3GELA 5FEMA 3ELYA 4J94A 3NHAA 3EYAA 4EFKA 4QBKA 1C9NA 2VAMA 3KEGA 4ENSA 1R88A 4Q39A 3FEDA 4F5YA 4B6PA 2QKYA 1K5PA 2V7VA 3OY2A 4TTAA 3O31A 1XELA 1NBMA 1EEXB 2I4RA 4EB6A 1IXYA 1DIHA 4MH0R 2G06A 1W4LA 1VL5A 3H11A 1T4CB 5ICEA 2VH1A 4MTCA 5IT5A 5JYBA 3U7GA 4Q7JB 2O7VA 5DGCA 1AUVA 3IIBA 4PQGA 3M81A 4Q48A 1A9QA 2CB9A 3BMQB 3ROPA 4LJAA 4IIUA 4LF8B 1NW8A 1L5VA 4JU8A 5HM8A 3WADA 2VHYA 2ZI4A 1GPDG 1S7CA 3IHLA 3ZCPA 2WJ4A 3TX2A 3NKLA 3LHFA 1HM5A 3RFXA 4UTNA 3GARA 1FA9A 2RGXA 2Z9BA 2G9ZA 3K4PA 3L7IA 4F85A 3Q3JB 2PE5A 1JFTA 2B8JA 3DEAA 3QXGA 3TH5A 4ENQA 4GG1A 4ZGWA 4BP8A 2IUSA 3ZNQA 1XQ6A 2Z8ZA 3EBOA 5AT1A 1E5VA 1UC8A 1QK5A 3MJVA 4U9HS 1LPNA 5TE9A 2QN6A 1K7EB 2ZKLA 2OFWA 1TB4A 4DPMA 1WM1A 3WL5A 5E4TA 1QQAA 3LIIA 5FX2A 4YRRA 2CL5A 2WG1A 2B1GA 2Z2KA 5JSYA 2A84A 1FMCA 2F9FA 4JX9A 3HI6A 5LQNA 5IEJA 1JIIA 5JBIA 1L6RA 1PKXA 4HGQA 1AX9A 3BPSA 3Q3CA 1YOVA 2GBGA 2P30A 4IS3A 3AW8A 5CDTA 5GONB 4IZHA 1H2FA 3X0DA 4P3PA 3W3AD 1KGDA 3KHUA 3BXZA 1MAAA 4B3JA 1MEJA 1QLJA 2VDMB 3IEIA 4NJMA 2WYOA 4UASA 1YAHA 1O5IA 1PW7A 2BGMA 1CULC 3DOOA 3HY6A 3K9BA 2HIHA 2RK3A 1DL5A 2PZKA 1AHPA 3HCEA 1A7AA 4ZK2A 3BC1A 3CEPB 3PGLA 4X95A 5C52B 4MP6A 1V6AA 1NRXA 2RCYA 4X8MA 3CVYA 1XQWA 4JXZA 4BFLA 1EA5A 4PC3A 3UYLA 2ONCA 1FLAA 3KZNA 1KQOA 2VJAA 4HKTA 3FWZA 1FP4B 1IJEA 5DHTA 3U26A 4DUGA 4ODIA 3VKUA 1FL9A 5AVQA 5EFZA 1YSCA 1OYYA 4ZHQB 3K1ZA 1TM5E 3T61A 2I4NA 2KS6A 1YR2A 3LQQA 4NFSA 3WRXC 3D3KA 1N5RA 4IVRA 2Q3EA 3B60A 4IQFA 2W6ID 4BMCA 3PIDA 5DBGA 4PYJA 3GLRA 3KLOA 3EGDA 1NI5A 5B55A 5MFPA 2QM8A 4LX0A 1QIDA 4DZRA 2GX6A 2WT9A 4L5IA 3IBCA 3G9UA 3S1AA 3DYVA 3ZCVA 3MWFA 3RYHB 4BNFA 2L18A 2QL9A 3F78A 4NBKA 3GCGA 1WHTB 4FZJA 3QA9A 3C6KA 1SCBA 2FW0A 4C6RA 4PV7A 1YGPA 5KYYB 5FQNA 2RGGA 4KN9S 1U3UA 3ELBA 4XW2A 1WX1A 5EIAA 5BOSB 1T10A 2CFRA 3SMVA 3CY6A 5COAA 2OWDA 4Z8YA 1ZD5A 1Z5NA 4WCFA 3P2OA 2BEUB 5AW3A 3WRYC 4XB1A 1V8DA 4M99A 5JE8A 3NBZC 3TYXA 3BQNB 1J49A 3WJ7A 1DJMA 5JAHA 4X6YA 4D4LA 4KXUA 4DJDC 3GBPA 5DI3B 1L7VC 3TJZA 1U11A 4XX0B 1PGNA 3LPMA 4CT4B 2Z6AA 3TOVA 1QONA 1XQXA 1KJIA 3B6MA 5E6UA 1UBSB 4V39A 4HN2A 4G8JA 2X5JO 4M4SA 5L51A 1VM6A 1JRLA 4GI2A 1ZM7A 4HNQA 4B5KA 5D00A 2BGGA 2NNWB 2OXRA 4DNQA 4FYXA 1Q0ZA 1M83A 2C94A 1D6JA 2DVMA 3IUQA 3NT5A 1MFZA 2B5OA 3ORYA 4YRFA 1FFYA 3K9LA 4TZKA 1QJCA 2BKAA 4JLUA 3IXMA 4D56A 3T3GA 1I7DA 3IBGA 1ECBA 5BW5A 1Q77A 2AMFA 3PQFA 2PM8A 3P9SA 2O2JA 2LE0A 4MWDA 4DZTA 4NEHB 1KYQA 1QVVA 3BFJA 4Z0HO 4AZ3A 4AS2A 3WLMA 4Q7LA 3FSRA 3NANA 3L8GA 3HK2A 4C43A 2H3EA 2IPNA 1M7BA 3TPFA 2HSDA 3WYGA 4FW8A 3WJ2A 5I7EA 5K0CA 4OIMA 2R751 2H4YA 3LZCA 1NUAA 1VHQA 2IHZA 4Q3DA