5IB9A

Crystal structure of aminopeptidase equipped with pad from aneurinibacillus sp. am-1
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
412
structure length
412
Chain Sequence
ADHQITKRTDAENMYNTIQFLSQAPRVAGSPEELKAVRYIEQQFKSYGYHVEVQPFQFEGYTAPSEVTLKIGTEKKEGEAFTYSPNSDVTAELVYVGLGTTADVAGKDLNGKIALIQRGNISFADKVRNAAKQGAKAVIIYNNTDGKLNGTLGGSDASFVAAVGITKQEGDALAANLRAGEKITATVKVAGAEVKTLTSHNVIATKKPDANKKNTNDIIIIGSHHDSVEKAPGANDDASGVAVTLELARVMSKLKTDTELRFITFGAEENGLIGSKKYAASLSEDEIKRTIGMFQLDMVGSKDAGDLIMYTIDGKKNRVTDLGAAASSRLSGVLPYGQEGRSDHESFHALGIPAALFIHAPVEPWYHTPNDTLDKISKEKLDNVADIVGSAVYQAARPGELVIEPIDYPRRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Aminopeptidase
publication title Crystal structure of aminopeptidase
rcsb
source organism Aneurinibacillus sp. am-1
total genus 147
structure length 412
sequence length 412
ec nomenclature
pdb deposition date 2016-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 5ib9A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 5ib9A02
2PVVA 1OBRA 1ZG8A 4OP4A 4NGPA 3VATA 1ELMP 4NGNA 4CPAA 4IAVA 3KQZA 4C9UA 3K2KA 3SJXA 1DTDA 3ICUA 4GM5A 2GLFA 2JBKA 5IB9A 3S9MA 1XRYA 3I1UA 5J1QA 2QYVA 3PB7X 4ZYQA 5F09A 4DYOA 2ZEDA 4EMEA 3KI9A 4ZI6A 2ZEHA 1HDQA 3H8EA 3S9LA 2ZEFA 4PPZA 4MHNA 1CPSA 4NGQA 3FH4A 1F57A 4A39A 7CPAA 4MCQA 2XEGA 4F9VA 2ZEMA 3MN8A 3PB4X 5HVFA 2F8HA 4X2TA 4Z65A 3PBEA 1VGYA 1DE4C 2C6GA 3NA6A 5HXDA 2JEWA 4BD9A 3NH8A 3S9NA 1TKHA 2CIJA 4EWTA 3MRUA 3WC7A 3ISZA 2GREA 4R76A 1LCPA 2C1CA 2PIYA 2PJ7A 2ZENA 5D29A 4IK2A 4B6ZA 4LQGA 2WYRA 3IEHA 3DGVA 1VHOA 3B3TA 4OC0A 2XEIA 2PJ2A 2PJ0A 1RTQA 5ELYA 3LWUA 4P4BA 2ZEEA 4W9YA 4YN3A 1VIXA 1JQGA 4AXVA 2F7VA 2AFWA 4F9UA 4WJBA 3PB6X 3SI2A 3FX6A 5JGFA 2Q43A 3H8GA 2PIZA 4P6YA 3B3SA 3HLPA 3GB0A 4OC4A 2EK9A 4DUKA 4NGSA 3NH4A 3FECA 4H2KA 4O23A 3ISXA 3BI1A 4ZY2A 2CF4A 3SJGA 1CX8A 1YW4A 4FAIA 3CPXA 2PJ4A 1XMBA 1VHEA 2PJ6A 2PJ5A 2PJAA 2G9DA 5LYIA 2AFOA 3LMSA 3B2YA 1EE3P 4C8TA 5K8PA 3FEEA 4KSIA 4C84A 2JBJA 4A37A 1CPXA 1LAPA 4A38A 3I74A 3RAMA 1YMEA 2ZOGA 4C8UA 3BI0A 4NJQA 1HEEA 3TX8A 5LRGA 3D7GA 3KR4A 2BCOA 1TXRA 2HC9A 3PB8X 1R43A 4Q7AA 2ZOFA 3CT9A 4OKOA 4JZ0A 3B3CA 1LFWA 2FVGA 2OR4A 4OC3A 1FT7A 1LOKA 2WZNA 4PXEA 5LYDA 3D4UA 3IJ3A 5LYLA 4C9VA 2V8GA 3JRUA 4FUUA 1Y9ZA 4R7MA 3PB9X 4PXBA 2PJ1A 2HB6A 1AMPA 4YU9A 1CP6A 4NGMA 1TKFA 5HVHA 3KL9A 4C8CA 2V77A 3B35A 4IHMA 3EIFA 1NSAA 2EWBA 3V7ZA 3D66A 3L2NA 4TJVA 1Y0RA 4KNGE 1Z2LA 4MHZA 1LAMA 3NFZA 4F8ZA 3N5FA 2AFMA 4MHPA 3FVLA 4P4IA 2ZEOA 2PJCA 3KASA 4WWVA 2BOAA 3WC6A 4C86A 1ZG7A 5K8NA 3FMCA 3KHZA 4X8IA 3HUVA 2O4HA 5THWA 4C8FA 3PRTA 4P45A 4C85A 3WABA 4C9EA 1XF1A 2PJBA 1CP7A 5LYFA 4OIDA 2DEAA 1GYTA 3IFEA 4YWYA 4ZY1A 4MXUA 4EFDA 1Y7EA 4UEEA 1UWYA 4UIBA 4P4JA 3TC8A 2OOTA 3KZWA 3D7HA 1AYEA 4UIAA 1H8LA 4OC5A 3IO1A 2AFUA 3BXMA 4FWUA 1Z8LA 1PYTB 1ZLIA 4P44A 1IGBA 2IQ6A 3SJFA 3I6SA 2PJ8A 1ZG9A 2CTCA 2NSMA 3RBUA 5K8MA 3T8WA 3K9TA 4MRIA 1V6CA 1IY7A 4X3RA 4R6TA 3VARA 4NJRA 3D7FA 2ZELA 4NFRA 4P4EA 3RZAA 3SJEA 2PJ9A 3IIBA 4OMEA 4PXCA 4ZX9A 5I4MA 2PRQA 5CPAA 5LRKA 1F2OA 4MCRA 1ELLP 3H8FA 1TKJA 3FF3A 4TNUA 4ONWA 3VH9A 1FNOA 1Y0YA 1TF8A 4ZY0A 4MMOA 5JH9A 1KWMA 2Q4ZA 4MCPA 2V8DA 1YSJA 3CDXA 1XBUA 1HDUA 3KGQA 5CBMA 4G1PA 4C8PA 4PXDA 3FEDA 4NGTA 4R8FA 4TJXA 3PBBA 3PEIA 2C6CA 2QVPA 3DLJA 3WC5A 1LANA 2PE3A 2PJ3A 4NGRA 3IC1A 2AFXA 5K8OA 1YW6A 2XEFA 3PFOA 4CDKA 2ABZA 4UEFA 3IWWA 4OC1A 1BPMA 4A94A 1XJOA 3BHXA 2PCUA 2V8HA 1ZLHA 1WVMA 1QQ9A 3SI1A 1BPNA 2IJZA 4C8AA 1XFOA 2XEJA 3CPAA 3KQXA 2BO9A 2C6PA 2ANPA 4FBEA 4JYWA 1BLLE 1ARMA 3PFEA 4K3NA 4P10A 3NH5A 5HVGA 4OC2A 4PQAA 3V38A 3KR5A 3GLJA 4RUHA 4MHYA 2IMOA 2GLJA 3KHXA 2J9AA 2VL1A 4UF4A 2AFSA 4P4DA 8CPAA 3SI0A 2PVWA 4P4FA 2QJ8A 2I3CA 3FJUA 3B3VA 2POKA 4ZX8A 2AFZA 3WT4A 3D67A 1ARLA 6CPAA 1Q7LA 1YLOA 3QNVA 2RFHA 2NYQA 4C9AA 4CDJA 3D7DA 3VTAA 5LRJA 4DJLA 3D68A 1TF9A 1CG2A 4MCSA 2CTBA 2GU2A 3B7IA 2V8VA 1PCAA 2ZEPA 2O53A 5DS0A 4UEZA 1CBXA 1F2PA 5JM6A 3B3WA 4C99A 1Z5RA 2EK8A 1BAVA 1R3NA 2ZEGA 1QMUA 4OIWA 3GUXA 2Q51A 5D8NA 2RB7A 4C9RA 1M4LA 4TWEA
chains in the Genus database with same CATH superfamily
2PVVA 1OBRA 1QSTA 1XIXA 1ZG8A 4OP4A 1ELMP 4NGNA 4NGPA 3VATA 4A30A 3EC4A 4CGMA 4CPAA 4KSAA 2X0SA 3SXOA 4IAVA 4CGOA 4JXRA 3KQZA 3LODA 4OAEA 5IV0A 1Q2YA 1CJWA 2BUEA 2PSWA 4KVME 1C30B 2Q7SA 2Q04A 2QMLA 4C9UA 3K9UA 2ZW6A 4MFLA 3K2KA 3SJXA 1GGOA 1XF8A 4MFJA 2K5TA 4KOXA 1DTDA 3ICUA 4R9MA 4GM5A 4KLVA 5AG5A 2GLFA 2JBKA 1N71A 1GHEA 5IB9A 3S9MA 1XRYA 3I1UA 3T90A 5J1QA 2QYVA 3PB7X 1I1DA 5DWNA 1QSMA 4CAWA 4ZYQA 1NMTA 5F09A 2CXAA 4EVYA 4DYOA 4I49A 1EZAA 2ZEDA 4IF5A 4R3LA 4EMEA 3KI9A 2EVNA 4ZI6A 2ZEHA 1HDQA 2GP4A 3D8PA 3H8EA 3S9LA 1M6VB 4KOYA 5EBVA 2REFA 2ZEFA 4PPZA 4R3KA 4MHNA 1CPSA 4NGQA 2OB0A 2DIKA 4U9YA 3I3GA 5HMNA 3FH4A 4CYQA 1F57A 2EO8A 2GE3A 2REEA 3S6GA 4MCQA 4A39A 7CPAA 3FRMA 4HPSA 1YVOA 2XEGA 4F9VA 3TOAA 2ZEMA 3MN8A 2CY2A 3PB4X 1Z8XA 5JPHA 5IB0A 2YJVA 2OZHA 5F5XA 2FIWA 4KOUA 5HVFA 2F8HA 1YGHA 4X2TA 4Z65A 2JLMA 3KKWA 3G8WA 3PBEA 4INJA 2Z3MA 1VGYA 1DE4C 5J8FA 3SR3A 2C6GA 1ZO0A 3NA6A 3D3SA 5HXDA 2JEWA 4PK3A 3NH8A 4BD9A 3S9NA 3H5ZA 2C5QA 1TKHA 2CIJA 4EWTA 2IL4A 4CYOA 3MRUA 2FIAA 2PDOA 4MI4A 5KTCA 3WC7A 3ISZA 2GREA 4R76A 2EZBA 1LCPA 1M4IA 1QSNA 4UWJA 2C1CA 2PIYA 3PGPA 3DR8A 2VBQA 5KTAA 2PJ7A 3U1BA 2ZENA 1Z4EA 2I00A 4IK2A 5D29A 4B6ZA 4LQGA 4H1HA 2PC1A 2WYRA 3IEHA 4E0AA 4CO9A 3QAHA 3WR7A 1P4NA 2B5GA 2B58A 2ZPAA 3DGVA 3GY9A 1VHOA 3IU1A 3B3TA 4KS9A 5C88A 4OC0A 5I0CA 2XEIA 2PJ2A 2PJ0A 3G23A 3LD2A 4CGLA 1WWZA 4KORA 4NCZA 1RTQA 3OWCA 5ELYA 3V8IA 2Y0MA 4B5PA 1S7NA 3LWUA 4QC6A 4P4BA 3CXSA 2ZEEA 4W9YA 1X10A 4YN3A 1VIXA 3FXTA 3I9SA 1K4JA 3P2FA 5FVJA 1JQGA 3TE4A 2Q4YA 3H4QA 1UFHA 4AXVA 3VWEA 2F7VA 2AFWA 4F9UA 2I79A 1IU8A 4WJBA 3PB6X 3SI2A 3FX6A 4UA3A 2FS5A 5JGFA 4C2ZA 2Q43A 3QB8A 3H8GA 3TT2A 3VWDA 2FT0A 2PIZA 4P6YA 3B3SA 3HLPA 3JUWA 4KUBA 4M6IA 4UCPA 3GB0A 4COBA 4FD6A 4JJXA 4OC4A 4B14A 2EK9A 2HI6A 1LRZA 2WUUA 4DUKA 4NGSA 3NH4A 4M3SA 2C27A 3FECA 2R8VA 3GIUA 4H2KA 4O23A 3TLGA 2FM4A 3ISXA 1XOVA 4QUSA 3BI1A 4L8AA 2Z3OA 3P2HA 2CF4A 4ZY2A 3SJGA 1CX8A 1YW4A 3NE7A 2R1IA 2PRBA 4DNCA 3CPXA 2PJ4A 4E2AA 5GCNA 4FAIA 3EZEA 1XMBA 5C82A 1I21A 1VHEA 2G3TA 2PJ6A 2PJ5A 2QECA 2PJAA 2G9DA 5DWMA 2HWGA 1R57A 5EMIA 2AFOA 5LYIA 2D4PA 3LMSA 4B11A 3B2YA 1VBHA 1EE3P 4C8TA 3TO6A 3FEEA 4QBJA 5K8PA 3TFYA 2NMTA 4KSIA 5JVLA 1T36B 2EZAA 4C84A 2JBJA 3UY5A 1Y9WA 2G3AA 3FB3A 4A37A 4KSFA 1CPXA 4C2XA 1LAPA 2B0AA 1QSOA 4A38A 3I74A 4M8DA 2X7BA 1S7LA 2B3VA 3RAMA 1YMEA 4MFQA 3BLNA 4XPDB 2ZOGA 1MJAA 2AUMA 2Q4VA 3BI0A 4C8UA 2B4DA 4NJQA 1HEEA 3TX8A 2JDCA 4IIYA 2B5GB 3D7GA 5LRGA 3TLYA 3C26A 3KR4A 4FD7A 2BCOA 1TXRA 2VZYA 2HC9A 3PB8X 1R43A 4Q7AA 2ZOFA 3CT9A 4OKOA 2OLSA 2MP0A 2OZUA 4JZ0A 1KBLA 3B3CA 1LFWA 2FVGA 2OR4A 4B5PB 4OC3A 4FD4A 1FT7A 1LOKA 2WZNA 4F0XA 4PXEA 5AGEA 4Y49C 5LYDA 1Z9UA 2HQYA 3D4UA 3IJ3A 3S6HA 5LYLA 1KZFA 3EY5A 2VZZA 5EC4A 3CZXA 1RXTA 4K30A 1ZL0A 1S7KA 4C9VA 2VXKA 3KRVA 2CNTA 2WPWA 4B10A 2V8GA 4C7HA 3W6SA 3JRUA 4FUUA 1Y9ZA 4R7MA 3PB9X 4UFWA 4C7IA 2AE6A 1B6BA 4PXBA 2PJ1A 2HB6A 1AMPA 3IU2A 4LQ6A 4Y49B 4YU9A 3GJZA 1CP6A 2YNCA 4JD6A 1TKFA 2DXQA 4NGMA 1SQHA 2D0OA 5F48A 3TO7A 5HVHA 3KL9A 3F0AA 4C8CA 2V77A 4KVOE 3B35A 4A31A 1IYKA 1ZYMA 4AG9A 4IHMA 2OU2A 3TLGB 4PK2A 4PSXA 3EIFA 1NSAA 2EWBA 4OADA 4CAFA 3V7ZA 4CAXA 4CYPA 3D66A 3L2NA 4TJVA 1Y0RA 2DPSA 4KNGE 1M4GA 1Z2LA 3EZBA 1AUGA 4UWIA 4MHZA 1LAMA 3T5MA 3NFZA 5JYBA 4F8ZA 1J4JA 3N5FA 5BWAB 2AFMA 3CXPA 4M85A 4MHPA 3T05A 4C85A 3FVLA 2FXFA 1BOBA 2VEZA 4F6AA 4YFJA 3EXNA 4KOVA 2ZEOA 4P4IA 2PJCA 3KASA 4WWVA 3RO0A 4B13A 1CE8B 2BOAA 3WC6A 4IIXA 3ZZIA 1KC7A 5G21A 3W6XA 2YNEA 1S7FA 1FY7A 4C86A 1MK4A 5AG7A 1ZG7A 5K8NA 1NSLA 5ISVA 2EZCA 1YK3A 4NXYA 4C68A 3FMCA 4JLYA 2J8MA 3KHZA 3NOJA 4X8IA 3HUVA 4AVBA 2O4HA 5THWA 2Q0YA 3R9EA 2AUNA 3PRTA 4P45A 2JEVA 3C8OA 3WABA 4C8FA 2ZW4A 4CRYB 5A27A 4PV6A 3JTKA 5J8CA 3QAYA 1YQEA 4NF1A 4C9EA 2CNMA 1XF1A 2B4DB 2PJBA 1CP7A 5LYFA 4OIDA 3R95A 1Z4RA 2R7HA 4B5OA 2Z0ZA 4KZTA 5E96A 2DEAA 4B12A 1GYTA 3IFEA 4YWYA 1EZBA 3TTHA 3W91A 4ZY1A 1JDBC 4JXQA 4MXUA 3S6KA 1S5KA 4EFDA 5HH1A 1Y7EA 4UEEA 1UWYA 2YGWA 4UIBA 1IICA 4CZ1A 4H89A 2PR1A 4P4JA 4KLWA 4QB9A 3TC8A 3EZAA 2EUIA 2OOTA 3KZWA 3D7HA 1CS0B 1AYEA 4HNWB 2ARHA 3EO4A 4UIAA 1H8LA 4KVXA 4OC5A 4YGOA 4M6HA 2ODFA 2AFUA 3IO1A 4CGPA 2A4NA 1VI4A 2CNSA 4UBRA 3BXMA 3R1KA 4FWUA 4C2YA 3R96A 1Z8LA 2J8RA 3SHPA 1PYTB 4ONUA 1ZLIA 5H86A 4P44A 5G22A 3FIXA 5FD8A 1IGBA 1C3OB 1KUVA 1ON0A 4HNYB 2IQ6A 4KOSA 3SJFA 2PJ8A 3I6SA 2DPTA 5H84A 2YJTA 3K4IA 3IWEA 1ZG9A 2CTCA 2NSMA 3RBUA 5K8MA 1P0HA 4IUSA 4A33A 1IYLA 3T8WA 2HV2A 2ZW7A 3K9TA 2Q7BA 4XNHC 3R9GA 4A32A 3BJ7A 1YX0A 4MRIA 4XPDC 1PUAA 4FD5A 1IY7A 2Z3PA 4X3RA 1V6CA 3RNZA 2DF5A 3GKRA 4R6TA 2FCKA 3D2MA 4E8OA 1Y7RA 3VARA 4UFVA 3B8GA 2P6FA 4MHDA 4MJ8A 2Z3LA 4XNHB 2HROA 1BXRB 4NJRA 4YRHA 3IGRA 1L0CA 1S60A 4LUAA 3IWGA 2RC4A 4A95A 1Q2DA 2OH1A 3D7FA 4COGA 2ZELA 4NFRA 8CPAA 1IIDA 1V0CA 2EBJA 4P4EA 3BJ8A 3RZAA 3SJEA 2PJ9A 4KOWA 5F49A 3TO9A 4AVCA 4RN7A 3IIBA 4OMEA 3TLCA 1KUYA 4PXCA 4H6UA 4ZX9A 5I4MA 1Q2CA 3DSBA 2FSRA 3DR6A 3GYAA 1YVKA 2PRQA 1KEEB 1JDEA 5CPAA 5F47A 2Z10A 5LRKA 2GANA 3CXQA 1F2OA 5AG4A 4E5SA 2P0WA 1M44A 1PU9A 1XEBA 4MCRA 4UFXA 4X5KA 4J3GA 4AVAA 1VBGA 4HKFA 1ZRSA 3A9LA 3TLEA 3TOBA 1ELLP 1MJBA 3H8FA 1TKJA 4RS2A 3FF3A 4TNUA 2WSAA 4ONWA 3VH9A 1FNOA 5G20A 4L89A 2B4BA 4ZBGA 1Y0YA 1TF8A 2YNDA 2Z11A 3R9FA 2OZGA 2HUZA 4ZY0A 2D0PA 3G3SA 4MMOA 2ATRA 5JH9A 1A9XB 1KWMA 4OLLA 4F0YA 2P6GA 2Q4ZA 4MCPA 2V8DA 1TIQA 1YSJA 5CNPA 2J8NA 4U9ZA 3CDXA 1XBUA 1M1DA 2F5IA 2BSWA 4CS0B 1HDUA 5G1ZA 2FE7A 3KGQA 5CBMA 4G1PA 4BINA 4R87A 4NSQA 4II9A 4C8PA 4PXDA 2R82A 3FEDA 3F8KA 1Q5XA 1Z8TA 4JWPA 4NGTA 4KUAA 4R8FA 4ZGYB 1QSRA 4TJXA 1M4DA 3PBBA 3PEIA 2C6CA 3PZJA 2QVPA 3EFAA 3DLJA 1CM0A 1LANA 2PE3A 3FNCA 2PJ3A 4NGRA 3WC5A 3IC1A 1YLEA 2AFXA 4CRZB 1VKCA 1YW6A 5K8OA 1J3LA 2XEFA 3PFOA 4CDKA 1BO4A 2GIVA 2ABZA 3PP9A 2PR8A 2PCNA 4QVTA 1XMTA 1R61A 2FL4A 2GFQA 4UEFA 5F9MA 4CAEA 1WK4A 3S6FA 3IWWA 4OC1A 5IX3A 4JVOA 1BPMA 3D2PA 2D4OA 3TLAA 4AB7A 5AG6A 5KTDA 4CGNA 3SXNA 4A94A 1XJOA 2G0BA 2PCUA 1IOIA 2V8HA 2Z3NA 3BHXA 1ZLHA 1YREA 1X12A 2AJ6A 1QQ9A 3SI1A 1BPNA 2IJZA 1WVMA 1YR0A 3JVNA 2ZXVA 3DNSA 3DDDA 4C8AA 1MJ9A 1XFOA 2XEJA 4M6GA 3CPAA 4MFKA 4MFZA 4UCMA 5A28A 3KQXA 2BO9A 2C6PA 2ANPA 2Q44A 3FYNA 4MBUA 4FBEA 1OZPA 1XE4A 4JYWA 4CAVA 1BLLE 1ARMA 3PFEA 4H6ZA 4K3NA 3NH5A 4LX9A 4P10A 4RI1A 5HVGA 1S3ZA 1IOFA 2JDDA 4OC2A 4PQAA 3V38A 3KR5A 3T9YA 1RO5A 2WPXA 3GLJA 4AG7A 4RUHA 4MHYA 5F46A 2IMOA 1IB1E 2Z3KA 2GLJA 3F5BA 2J9AA 3KHXA 4GS4A 3ZJ0A 3E0KA 2VL1A 4UF4A 3T0TA 2AFSA 2KCWA 2VI7A 4P4DA 2BL1A 2R98A 4Q36A 4XPLA 3SI0A 2PVWA 4MJXA 2YNCC 2QJ8A 4P4FA 4BBHA 1NBWA 4E94A 4MY0A 2I3CA 2VQYA 2E28A 3FJUA 2H5MA 3B3VA 4A2ZA 2POKA 4ZX8A 1Z8WA 2AFZA 3WT4A 3N7ZA 1JWQA 3D67A 3FBUA 1DIKA 3TCVA 1ARLA 6CPAA 1Q7LA 1YLOA 3QNVA 4J0NA 5JQ4A 4U5YA 2RFHA 3NE8A 4UCNA 2NYQA 2QIRA 4C9AA 4CDJA 3D7DA 1NXJA 3VTAA 2B3UA 3TLZA 4XPKA 5LRJA 4DJLA 1Y9KA 1NE9A 1TF9A 2BEIA 3D68A 1CG2A 4MI1A 2ZW5A 4CYNA 4EYSA 4MCSA 2CTBA 2GU2A 3B7IA 5K99A 4HNXB 4MFPA 4Q38A 2V8VA 4R57A 3TLBA 1PCAA 2ZEPA 2O53A 5DS0A 4UEZA 1B87A 1CBXA 1U6MA 1F2PA 4BMHA 1I12A 4ORFA 5JM6A 3RYOA 3B3WA 3MGDA 4C99A 1Z5RA 2EK8A 1BAVA 1KUXA 1R3NA 3T07A 4PSWA 5F1YA 2O28A 2ZEGA 1QMUA 2PQ8A 4OIWA 3GUXA 1VHSA 2P6EA 2Q51A 4GXHA 4MY3A 5D8NA 3TYXA 2RB7A 3LACA 4NEXA 1A2ZA 4KOTA 4C9RA 1M4LA 4TWEA 5IR2A
chains in the Genus database with same CATH topology
2PVVA 1OBRA 1ZG8A 4OP4A 4NGPA 3VATA 1ELMP 4NGNA 4CPAA 4IAVA 3KQZA 4C9UA 3K2KA 3SJXA 1DTDA 3ICUA 4GM5A 2GLFA 2JBKA 5IB9A 3S9MA 1XRYA 3I1UA 5J1QA 2QYVA 3PB7X 4ZYQA 5F09A 4DYOA 2ZEDA 4EMEA 3KI9A 4ZI6A 2ZEHA 1HDQA 2GP4A 3H8EA 3S9LA 2ZEFA 4PPZA 4MHNA 1CPSA 4NGQA 3FH4A 1F57A 4A39A 7CPAA 4MCQA 2XEGA 4F9VA 2ZEMA 3MN8A 3PB4X 5HVFA 2F8HA 4X2TA 4Z65A 3PBEA 1VGYA 1DE4C 2C6GA 3NA6A 5HXDA 2JEWA 4BD9A 3NH8A 3S9NA 2C5QA 1TKHA 2CIJA 4EWTA 3MRUA 3WC7A 3ISZA 2GREA 4R76A 1LCPA 2C1CA 2PIYA 2PJ7A 2ZENA 5D29A 4IK2A 4B6ZA 4LQGA 2WYRA 3IEHA 3DGVA 1VHOA 3B3TA 4OC0A 2XEIA 2PJ2A 2PJ0A 1RTQA 5ELYA 3LWUA 4P4BA 2ZEEA 4W9YA 4YN3A 1VIXA 1JQGA 4AXVA 2F7VA 2AFWA 4F9UA 4WJBA 3PB6X 3SI2A 3FX6A 5JGFA 2Q43A 3H8GA 2PIZA 4P6YA 3B3SA 3HLPA 3GB0A 4OC4A 2EK9A 4DUKA 4NGSA 3NH4A 3FECA 4H2KA 4O23A 3ISXA 3BI1A 4ZY2A 2CF4A 3SJGA 1CX8A 1YW4A 4FAIA 3CPXA 2PJ4A 1XMBA 1VHEA 2PJ6A 2PJ5A 2PJAA 2G9DA 5LYIA 2AFOA 3LMSA 3B2YA 1EE3P 4C8TA 5K8PA 3FEEA 4KSIA 4C84A 2JBJA 4A37A 1CPXA 1LAPA 4A38A 3I74A 3RAMA 1YMEA 2ZOGA 4C8UA 3BI0A 4NJQA 1HEEA 3TX8A 5LRGA 3D7GA 3KR4A 2BCOA 1TXRA 2HC9A 3PB8X 1R43A 4Q7AA 2ZOFA 3CT9A 4OKOA 4JZ0A 3B3CA 1LFWA 2FVGA 2OR4A 4OC3A 1FT7A 1LOKA 2WZNA 4PXEA 5LYDA 3D4UA 3IJ3A 5LYLA 4C9VA 2V8GA 3JRUA 4FUUA 1Y9ZA 4R7MA 3PB9X 4PXBA 2PJ1A 2HB6A 1AMPA 4YU9A 1CP6A 4NGMA 1TKFA 5HVHA 3KL9A 4C8CA 2V77A 3B35A 4IHMA 3EIFA 1NSAA 2EWBA 3V7ZA 3D66A 3L2NA 4TJVA 1Y0RA 4KNGE 1Z2LA 4MHZA 1LAMA 3NFZA 4F8ZA 3N5FA 2AFMA 4MHPA 3FVLA 4P4IA 2ZEOA 2PJCA 3KASA 4WWVA 2BOAA 3WC6A 4C86A 1ZG7A 5K8NA 3FMCA 3KHZA 4X8IA 3HUVA 2O4HA 5THWA 4C8FA 3PRTA 4P45A 4C85A 3WABA 4C9EA 1XF1A 2PJBA 1CP7A 5LYFA 4OIDA 2DEAA 1GYTA 3IFEA 4YWYA 4ZY1A 4MXUA 4EFDA 1Y7EA 4UEEA 1UWYA 4UIBA 4P4JA 3TC8A 2OOTA 3KZWA 3D7HA 1AYEA 4UIAA 1H8LA 4OC5A 3IO1A 2AFUA 3BXMA 4FWUA 1Z8LA 1PYTB 1ZLIA 4P44A 1IGBA 2IQ6A 3SJFA 3I6SA 2PJ8A 1ZG9A 2CTCA 2NSMA 3RBUA 5K8MA 3T8WA 3K9TA 4MRIA 1V6CA 1IY7A 4X3RA 4R6TA 3VARA 4NJRA 3D7FA 2ZELA 4NFRA 4P4EA 3RZAA 3SJEA 2PJ9A 3IIBA 4OMEA 4PXCA 4ZX9A 5I4MA 2PRQA 5CPAA 5LRKA 1F2OA 4MCRA 1ELLP 3H8FA 1TKJA 3FF3A 4TNUA 4ONWA 3VH9A 1FNOA 1Y0YA 1TF8A 4ZY0A 4MMOA 5JH9A 1KWMA 2Q4ZA 4MCPA 2V8DA 1YSJA 3CDXA 1XBUA 1HDUA 3KGQA 5CBMA 4G1PA 4C8PA 4PXDA 3FEDA 4NGTA 4R8FA 4TJXA 3PBBA 3PEIA 2C6CA 2QVPA 3DLJA 3WC5A 1LANA 2PE3A 2PJ3A 4NGRA 3IC1A 2AFXA 5K8OA 1YW6A 2XEFA 3PFOA 4CDKA 2ABZA 4UEFA 3IWWA 4OC1A 1BPMA 4A94A 1XJOA 3BHXA 2PCUA 2V8HA 1ZLHA 1WVMA 1QQ9A 3SI1A 1BPNA 2IJZA 4C8AA 1XFOA 2XEJA 3CPAA 3KQXA 2BO9A 2C6PA 2ANPA 4FBEA 4JYWA 1BLLE 1ARMA 3PFEA 4K3NA 4P10A 3NH5A 5HVGA 4OC2A 4PQAA 3V38A 3KR5A 3GLJA 4RUHA 4MHYA 2IMOA 2GLJA 3KHXA 2J9AA 2VL1A 4UF4A 2AFSA 4P4DA 8CPAA 3SI0A 2PVWA 4P4FA 2QJ8A 2I3CA 3FJUA 3B3VA 2POKA 4ZX8A 2AFZA 3WT4A 3D67A 1ARLA 6CPAA 1Q7LA 1YLOA 3QNVA 2RFHA 2NYQA 4C9AA 4CDJA 3D7DA 3VTAA 5LRJA 4DJLA 3D68A 1TF9A 1CG2A 4MCSA 2CTBA 2GU2A 3B7IA 2V8VA 1PCAA 2ZEPA 2O53A 5DS0A 4UEZA 1CBXA 1F2PA 5JM6A 3B3WA 4C99A 1Z5RA 2EK8A 1BAVA 1R3NA 2ZEGA 1QMUA 4OIWA 3GUXA 2Q51A 5D8NA 2RB7A 4C9RA 1M4LA 4TWEA 5IR2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PVV A;  1OBR A;  1ZG8 A;  4OP4 A;  4NGP A;  3VAT A;  1ELM P;  4NGN A;  4CPA A;  4IAV A;  3KQZ A;  4C9U A;  3K2K A;  3SJX A;  1DTD A;  3ICU A;  4GM5 A;  2GLF A;  2JBK A;  5IB9 A;  3S9M A;  1XRY A;  3I1U A;  5J1Q A;  2QYV A;  3PB7 X;  4ZYQ A;  5F09 A;  4DYO A;  2ZED A;  4EME A;  3KI9 A;  4ZI6 A;  2ZEH A;  1HDQ A;  3H8E A;  3S9L A;  2ZEF A;  4PPZ A;  4MHN A;  1CPS A;  4NGQ A;  3FH4 A;  1F57 A;  4A39 A;  7CPA A;  4MCQ A;  2XEG A;  4F9V A;  2ZEM A;  3MN8 A;  3PB4 X;  5HVF A;  2F8H A;  4X2T A;  4Z65 A;  3PBE A;  1VGY A;  1DE4 C;  2C6G A;  3NA6 A;  5HXD A;  2JEW A;  4BD9 A;  3NH8 A;  3S9N A;  1TKH A;  2CIJ A;  4EWT A;  3MRU A;  3WC7 A;  3ISZ A;  2GRE A;  4R76 A;  1LCP A;  2C1C A;  2PIY A;  2PJ7 A;  2ZEN A;  5D29 A;  4IK2 A;  4B6Z A;  4LQG A;  2WYR A;  3IEH A;  3DGV A;  1VHO A;  3B3T A;  4OC0 A;  2XEI A;  2PJ2 A;  2PJ0 A;  1RTQ A;  5ELY A;  3LWU A;  4P4B A;  2ZEE A;  4W9Y A;  4YN3 A;  1VIX A;  1JQG A;  4AXV A;  2F7V A;  2AFW A;  4F9U A;  4WJB A;  3PB6 X;  3SI2 A;  3FX6 A;  5JGF A;  2Q43 A;  3H8G A;  2PIZ A;  4P6Y A;  3B3S A;  3HLP A;  3GB0 A;  4OC4 A;  2EK9 A;  4DUK A;  4NGS A;  3NH4 A;  3FEC A;  4H2K A;  4O23 A;  3ISX A;  3BI1 A;  4ZY2 A;  2CF4 A;  3SJG A;  1CX8 A;  1YW4 A;  4FAI A;  3CPX A;  2PJ4 A;  1XMB A;  1VHE A;  2PJ6 A;  2PJ5 A;  2PJA A;  2G9D A;  5LYI A;  2AFO A;  3LMS A;  3B2Y A;  1EE3 P;  4C8T A;  5K8P A;  3FEE A;  4KSI A;  4C84 A;  2JBJ A;  4A37 A;  1CPX A;  1LAP A;  4A38 A;  3I74 A;  3RAM A;  1YME A;  2ZOG A;  4C8U A;  3BI0 A;  4NJQ A;  1HEE A;  3TX8 A;  5LRG A;  3D7G A;  3KR4 A;  2BCO A;  1TXR A;  2HC9 A;  3PB8 X;  1R43 A;  4Q7A A;  2ZOF A;  3CT9 A;  4OKO A;  4JZ0 A;  3B3C A;  1LFW A;  2FVG A;  2OR4 A;  4OC3 A;  1FT7 A;  1LOK A;  2WZN A;  4PXE A;  5LYD A;  3D4U A;  3IJ3 A;  5LYL A;  4C9V A;  2V8G A;  3JRU A;  4FUU A;  1Y9Z A;  4R7M A;  3PB9 X;  4PXB A;  2PJ1 A;  2HB6 A;  1AMP A;  4YU9 A;  1CP6 A;  4NGM A;  1TKF A;  5HVH A;  3KL9 A;  4C8C A;  2V77 A;  3B35 A;  4IHM A;  3EIF A;  1NSA A;  2EWB A;  3V7Z A;  3D66 A;  3L2N A;  4TJV A;  1Y0R A;  4KNG E;  1Z2L A;  4MHZ A;  1LAM A;  3NFZ A;  4F8Z A;  3N5F A;  2AFM A;  4MHP A;  3FVL A;  4P4I A;  2ZEO A;  2PJC A;  3KAS A;  4WWV A;  2BOA A;  3WC6 A;  4C86 A;  1ZG7 A;  5K8N A;  3FMC A;  3KHZ A;  4X8I A;  3HUV A;  2O4H A;  5THW A;  4C8F A;  3PRT A;  4P45 A;  4C85 A;  3WAB A;  4C9E A;  1XF1 A;  2PJB A;  1CP7 A;  5LYF A;  4OID A;  2DEA A;  1GYT A;  3IFE A;  4YWY A;  4ZY1 A;  4MXU A;  4EFD A;  1Y7E A;  4UEE A;  1UWY A;  4UIB A;  4P4J A;  3TC8 A;  2OOT A;  3KZW A;  3D7H A;  1AYE A;  4UIA A;  1H8L A;  4OC5 A;  3IO1 A;  2AFU A;  3BXM A;  4FWU A;  1Z8L A;  1PYT B;  1ZLI A;  4P44 A;  1IGB A;  2IQ6 A;  3SJF A;  3I6S A;  2PJ8 A;  1ZG9 A;  2CTC A;  2NSM A;  3RBU A;  5K8M A;  3T8W A;  3K9T A;  4MRI A;  1V6C A;  1IY7 A;  4X3R A;  4R6T A;  3VAR A;  4NJR A;  3D7F A;  2ZEL A;  4NFR A;  4P4E A;  3RZA A;  3SJE A;  2PJ9 A;  3IIB A;  4OME A;  4PXC A;  4ZX9 A;  5I4M A;  2PRQ A;  5CPA A;  5LRK A;  1F2O A;  4MCR A;  1ELL P;  3H8F A;  1TKJ A;  3FF3 A;  4TNU A;  4ONW A;  3VH9 A;  1FNO A;  1Y0Y A;  1TF8 A;  4ZY0 A;  4MMO A;  5JH9 A;  1KWM A;  2Q4Z A;  4MCP A;  2V8D A;  1YSJ A;  3CDX A;  1XBU A;  1HDU A;  3KGQ A;  5CBM A;  4G1P A;  4C8P A;  4PXD A;  3FED A;  4NGT A;  4R8F A;  4TJX A;  3PBB A;  3PEI A;  2C6C A;  2QVP A;  3DLJ A;  3WC5 A;  1LAN A;  2PE3 A;  2PJ3 A;  4NGR A;  3IC1 A;  2AFX A;  5K8O A;  1YW6 A;  2XEF A;  3PFO A;  4CDK A;  2ABZ A;  4UEF A;  3IWW A;  4OC1 A;  1BPM A;  4A94 A;  1XJO A;  3BHX A;  2PCU A;  2V8H A;  1ZLH A;  1WVM A;  1QQ9 A;  3SI1 A;  1BPN A;  2IJZ A;  4C8A A;  1XFO A;  2XEJ A;  3CPA A;  3KQX A;  2BO9 A;  2C6P A;  2ANP A;  4FBE A;  4JYW A;  1BLL E;  1ARM A;  3PFE A;  4K3N A;  4P10 A;  3NH5 A;  5HVG A;  4OC2 A;  4PQA A;  3V38 A;  3KR5 A;  3GLJ A;  4RUH A;  4MHY A;  2IMO A;  2GLJ A;  3KHX A;  2J9A A;  2VL1 A;  4UF4 A;  2AFS A;  4P4D A;  8CPA A;  3SI0 A;  2PVW A;  4P4F A;  2QJ8 A;  2I3C A;  3FJU A;  3B3V A;  2POK A;  4ZX8 A;  2AFZ A;  3WT4 A;  3D67 A;  1ARL A;  6CPA A;  1Q7L A;  1YLO A;  3QNV A;  2RFH A;  2NYQ A;  4C9A A;  4CDJ A;  3D7D A;  3VTA A;  5LRJ A;  4DJL A;  3D68 A;  1TF9 A;  1CG2 A;  4MCS A;  2CTB A;  2GU2 A;  3B7I A;  2V8V A;  1PCA A;  2ZEP A;  2O53 A;  5DS0 A;  4UEZ A;  1CBX A;  1F2P A;  5JM6 A;  3B3W A;  4C99 A;  1Z5R A;  2EK8 A;  1BAV A;  1R3N A;  2ZEG A;  1QMU A;  4OIW A;  3GUX A;  2Q51 A;  5D8N A;  2RB7 A;  4C9R A;  1M4L A;  4TWE A; 
#chains in the Genus database with same CATH topology
 2PVV A;  1OBR A;  1QST A;  1XIX A;  1ZG8 A;  4OP4 A;  1ELM P;  4NGN A;  4NGP A;  3VAT A;  4A30 A;  3EC4 A;  4CGM A;  4CPA A;  4KSA A;  2X0S A;  3SXO A;  4IAV A;  4CGO A;  4JXR A;  3KQZ A;  3LOD A;  4OAE A;  5IV0 A;  1Q2Y A;  1CJW A;  2BUE A;  2PSW A;  4KVM E;  1C30 B;  2Q7S A;  2Q04 A;  2QML A;  4C9U A;  3K9U A;  2ZW6 A;  4MFL A;  3K2K A;  3SJX A;  1GGO A;  1XF8 A;  4MFJ A;  2K5T A;  4KOX A;  1DTD A;  3ICU A;  4R9M A;  4GM5 A;  4KLV A;  5AG5 A;  2GLF A;  2JBK A;  1N71 A;  1GHE A;  5IB9 A;  3S9M A;  1XRY A;  3I1U A;  3T90 A;  5J1Q A;  2QYV A;  3PB7 X;  1I1D A;  5DWN A;  1QSM A;  4CAW A;  4ZYQ A;  1NMT A;  5F09 A;  2CXA A;  4EVY A;  4DYO A;  4I49 A;  1EZA A;  2ZED A;  4IF5 A;  4R3L A;  4EME A;  3KI9 A;  2EVN A;  4ZI6 A;  2ZEH A;  1HDQ A;  2GP4 A;  3D8P A;  3H8E A;  3S9L A;  1M6V B;  4KOY A;  5EBV A;  2REF A;  2ZEF A;  4PPZ A;  4R3K A;  4MHN A;  1CPS A;  4NGQ A;  2OB0 A;  2DIK A;  4U9Y A;  3I3G A;  5HMN A;  3FH4 A;  4CYQ A;  1F57 A;  2EO8 A;  2GE3 A;  2REE A;  3S6G A;  4MCQ A;  4A39 A;  7CPA A;  3FRM A;  4HPS A;  1YVO A;  2XEG A;  4F9V A;  3TOA A;  2ZEM A;  3MN8 A;  2CY2 A;  3PB4 X;  1Z8X A;  5JPH A;  5IB0 A;  2YJV A;  2OZH A;  5F5X A;  2FIW A;  4KOU A;  5HVF A;  2F8H A;  1YGH A;  4X2T A;  4Z65 A;  2JLM A;  3KKW A;  3G8W A;  3PBE A;  4INJ A;  2Z3M A;  1VGY A;  1DE4 C;  5J8F A;  3SR3 A;  2C6G A;  1ZO0 A;  3NA6 A;  3D3S A;  5HXD A;  2JEW A;  4PK3 A;  3NH8 A;  4BD9 A;  3S9N A;  3H5Z A;  2C5Q A;  1TKH A;  2CIJ A;  4EWT A;  2IL4 A;  4CYO A;  3MRU A;  2FIA A;  2PDO A;  4MI4 A;  5KTC A;  3WC7 A;  3ISZ A;  2GRE A;  4R76 A;  2EZB A;  1LCP A;  1M4I A;  1QSN A;  4UWJ A;  2C1C A;  2PIY A;  3PGP A;  3DR8 A;  2VBQ A;  5KTA A;  2PJ7 A;  3U1B A;  2ZEN A;  1Z4E A;  2I00 A;  4IK2 A;  5D29 A;  4B6Z A;  4LQG A;  4H1H A;  2PC1 A;  2WYR A;  3IEH A;  4E0A A;  4CO9 A;  3QAH A;  3WR7 A;  1P4N A;  2B5G A;  2B58 A;  2ZPA A;  3DGV A;  3GY9 A;  1VHO A;  3IU1 A;  3B3T A;  4KS9 A;  5C88 A;  4OC0 A;  5I0C A;  2XEI A;  2PJ2 A;  2PJ0 A;  3G23 A;  3LD2 A;  4CGL A;  1WWZ A;  4KOR A;  4NCZ A;  1RTQ A;  3OWC A;  5ELY A;  3V8I A;  2Y0M A;  4B5P A;  1S7N A;  3LWU A;  4QC6 A;  4P4B A;  3CXS A;  2ZEE A;  4W9Y A;  1X10 A;  4YN3 A;  1VIX A;  3FXT A;  3I9S A;  1K4J A;  3P2F A;  5FVJ A;  1JQG A;  3TE4 A;  2Q4Y A;  3H4Q A;  1UFH A;  4AXV A;  3VWE A;  2F7V A;  2AFW A;  4F9U A;  2I79 A;  1IU8 A;  4WJB A;  3PB6 X;  3SI2 A;  3FX6 A;  4UA3 A;  2FS5 A;  5JGF A;  4C2Z A;  2Q43 A;  3QB8 A;  3H8G A;  3TT2 A;  3VWD A;  2FT0 A;  2PIZ A;  4P6Y A;  3B3S A;  3HLP A;  3JUW A;  4KUB A;  4M6I A;  4UCP A;  3GB0 A;  4COB A;  4FD6 A;  4JJX A;  4OC4 A;  4B14 A;  2EK9 A;  2HI6 A;  1LRZ A;  2WUU A;  4DUK A;  4NGS A;  3NH4 A;  4M3S A;  2C27 A;  3FEC A;  2R8V A;  3GIU A;  4H2K A;  4O23 A;  3TLG A;  2FM4 A;  3ISX A;  1XOV A;  4QUS A;  3BI1 A;  4L8A A;  2Z3O A;  3P2H A;  2CF4 A;  4ZY2 A;  3SJG A;  1CX8 A;  1YW4 A;  3NE7 A;  2R1I A;  2PRB A;  4DNC A;  3CPX A;  2PJ4 A;  4E2A A;  5GCN A;  4FAI A;  3EZE A;  1XMB A;  5C82 A;  1I21 A;  1VHE A;  2G3T A;  2PJ6 A;  2PJ5 A;  2QEC A;  2PJA A;  2G9D A;  5DWM A;  2HWG A;  1R57 A;  5EMI A;  2AFO A;  5LYI A;  2D4P A;  3LMS A;  4B11 A;  3B2Y A;  1VBH A;  1EE3 P;  4C8T A;  3TO6 A;  3FEE A;  4QBJ A;  5K8P A;  3TFY A;  2NMT A;  4KSI A;  5JVL A;  1T36 B;  2EZA A;  4C84 A;  2JBJ A;  3UY5 A;  1Y9W A;  2G3A A;  3FB3 A;  4A37 A;  4KSF A;  1CPX A;  4C2X A;  1LAP A;  2B0A A;  1QSO A;  4A38 A;  3I74 A;  4M8D A;  2X7B A;  1S7L A;  2B3V A;  3RAM A;  1YME A;  4MFQ A;  3BLN A;  4XPD B;  2ZOG A;  1MJA A;  2AUM A;  2Q4V A;  3BI0 A;  4C8U A;  2B4D A;  4NJQ A;  1HEE A;  3TX8 A;  2JDC A;  4IIY A;  2B5G B;  3D7G A;  5LRG A;  3TLY A;  3C26 A;  3KR4 A;  4FD7 A;  2BCO A;  1TXR A;  2VZY A;  2HC9 A;  3PB8 X;  1R43 A;  4Q7A A;  2ZOF A;  3CT9 A;  4OKO A;  2OLS A;  2MP0 A;  2OZU A;  4JZ0 A;  1KBL A;  3B3C A;  1LFW A;  2FVG A;  2OR4 A;  4B5P B;  4OC3 A;  4FD4 A;  1FT7 A;  1LOK A;  2WZN A;  4F0X A;  4PXE A;  5AGE A;  4Y49 C;  5LYD A;  1Z9U A;  2HQY A;  3D4U A;  3IJ3 A;  3S6H A;  5LYL A;  1KZF A;  3EY5 A;  2VZZ A;  5EC4 A;  3CZX A;  1RXT A;  4K30 A;  1ZL0 A;  1S7K A;  4C9V A;  2VXK A;  3KRV A;  2CNT A;  2WPW A;  4B10 A;  2V8G A;  4C7H A;  3W6S A;  3JRU A;  4FUU A;  1Y9Z A;  4R7M A;  3PB9 X;  4UFW A;  4C7I A;  2AE6 A;  1B6B A;  4PXB A;  2PJ1 A;  2HB6 A;  1AMP A;  3IU2 A;  4LQ6 A;  4Y49 B;  4YU9 A;  3GJZ A;  1CP6 A;  2YNC A;  4JD6 A;  1TKF A;  2DXQ A;  4NGM A;  1SQH A;  2D0O A;  5F48 A;  3TO7 A;  5HVH A;  3KL9 A;  3F0A A;  4C8C A;  2V77 A;  4KVO E;  3B35 A;  4A31 A;  1IYK A;  1ZYM A;  4AG9 A;  4IHM A;  2OU2 A;  3TLG B;  4PK2 A;  4PSX A;  3EIF A;  1NSA A;  2EWB A;  4OAD A;  4CAF A;  3V7Z A;  4CAX A;  4CYP A;  3D66 A;  3L2N A;  4TJV A;  1Y0R A;  2DPS A;  4KNG E;  1M4G A;  1Z2L A;  3EZB A;  1AUG A;  4UWI A;  4MHZ A;  1LAM A;  3T5M A;  3NFZ A;  5JYB A;  4F8Z A;  1J4J A;  3N5F A;  5BWA B;  2AFM A;  3CXP A;  4M85 A;  4MHP A;  3T05 A;  4C85 A;  3FVL A;  2FXF A;  1BOB A;  2VEZ A;  4F6A A;  4YFJ A;  3EXN A;  4KOV A;  2ZEO A;  4P4I A;  2PJC A;  3KAS A;  4WWV A;  3RO0 A;  4B13 A;  1CE8 B;  2BOA A;  3WC6 A;  4IIX A;  3ZZI A;  1KC7 A;  5G21 A;  3W6X A;  2YNE A;  1S7F A;  1FY7 A;  4C86 A;  1MK4 A;  5AG7 A;  1ZG7 A;  5K8N A;  1NSL A;  5ISV A;  2EZC A;  1YK3 A;  4NXY A;  4C68 A;  3FMC A;  4JLY A;  2J8M A;  3KHZ A;  3NOJ A;  4X8I A;  3HUV A;  4AVB A;  2O4H A;  5THW A;  2Q0Y A;  3R9E A;  2AUN A;  3PRT A;  4P45 A;  2JEV A;  3C8O A;  3WAB A;  4C8F A;  2ZW4 A;  4CRY B;  5A27 A;  4PV6 A;  3JTK A;  5J8C A;  3QAY A;  1YQE A;  4NF1 A;  4C9E A;  2CNM A;  1XF1 A;  2B4D B;  2PJB A;  1CP7 A;  5LYF A;  4OID A;  3R95 A;  1Z4R A;  2R7H A;  4B5O A;  2Z0Z A;  4KZT A;  5E96 A;  2DEA A;  4B12 A;  1GYT A;  3IFE A;  4YWY A;  1EZB A;  3TTH A;  3W91 A;  4ZY1 A;  1JDB C;  4JXQ A;  4MXU A;  3S6K A;  1S5K A;  4EFD A;  5HH1 A;  1Y7E A;  4UEE A;  1UWY A;  2YGW A;  4UIB A;  1IIC A;  4CZ1 A;  4H89 A;  2PR1 A;  4P4J A;  4KLW A;  4QB9 A;  3TC8 A;  3EZA A;  2EUI A;  2OOT A;  3KZW A;  3D7H A;  1CS0 B;  1AYE A;  4HNW B;  2ARH A;  3EO4 A;  4UIA A;  1H8L A;  4KVX A;  4OC5 A;  4YGO A;  4M6H A;  2ODF A;  2AFU A;  3IO1 A;  4CGP A;  2A4N A;  1VI4 A;  2CNS A;  4UBR A;  3BXM A;  3R1K A;  4FWU A;  4C2Y A;  3R96 A;  1Z8L A;  2J8R A;  3SHP A;  1PYT B;  4ONU A;  1ZLI A;  5H86 A;  4P44 A;  5G22 A;  3FIX A;  5FD8 A;  1IGB A;  1C3O B;  1KUV A;  1ON0 A;  4HNY B;  2IQ6 A;  4KOS A;  3SJF A;  2PJ8 A;  3I6S A;  2DPT A;  5H84 A;  2YJT A;  3K4I A;  3IWE A;  1ZG9 A;  2CTC A;  2NSM A;  3RBU A;  5K8M A;  1P0H A;  4IUS A;  4A33 A;  1IYL A;  3T8W A;  2HV2 A;  2ZW7 A;  3K9T A;  2Q7B A;  4XNH C;  3R9G A;  4A32 A;  3BJ7 A;  1YX0 A;  4MRI A;  4XPD C;  1PUA A;  4FD5 A;  1IY7 A;  2Z3P A;  4X3R A;  1V6C A;  3RNZ A;  2DF5 A;  3GKR A;  4R6T A;  2FCK A;  3D2M A;  4E8O A;  1Y7R A;  3VAR A;  4UFV A;  3B8G A;  2P6F A;  4MHD A;  4MJ8 A;  2Z3L A;  4XNH B;  2HRO A;  1BXR B;  4NJR A;  4YRH A;  3IGR A;  1L0C A;  1S60 A;  4LUA A;  3IWG A;  2RC4 A;  4A95 A;  1Q2D A;  2OH1 A;  3D7F A;  4COG A;  2ZEL A;  4NFR A;  8CPA A;  1IID A;  1V0C A;  2EBJ A;  4P4E A;  3BJ8 A;  3RZA A;  3SJE A;  2PJ9 A;  4KOW A;  5F49 A;  3TO9 A;  4AVC A;  4RN7 A;  3IIB A;  4OME A;  3TLC A;  1KUY A;  4PXC A;  4H6U A;  4ZX9 A;  5I4M A;  1Q2C A;  3DSB A;  2FSR A;  3DR6 A;  3GYA A;  1YVK A;  2PRQ A;  1KEE B;  1JDE A;  5CPA A;  5F47 A;  2Z10 A;  5LRK A;  2GAN A;  3CXQ A;  1F2O A;  5AG4 A;  4E5S A;  2P0W A;  1M44 A;  1PU9 A;  1XEB A;  4MCR A;  4UFX A;  4X5K A;  4J3G A;  4AVA A;  1VBG A;  4HKF A;  1ZRS A;  3A9L A;  3TLE A;  3TOB A;  1ELL P;  1MJB A;  3H8F A;  1TKJ A;  4RS2 A;  3FF3 A;  4TNU A;  2WSA A;  4ONW A;  3VH9 A;  1FNO A;  5G20 A;  4L89 A;  2B4B A;  4ZBG A;  1Y0Y A;  1TF8 A;  2YND A;  2Z11 A;  3R9F A;  2OZG A;  2HUZ A;  4ZY0 A;  2D0P A;  3G3S A;  4MMO A;  2ATR A;  5JH9 A;  1A9X B;  1KWM A;  4OLL A;  4F0Y A;  2P6G A;  2Q4Z A;  4MCP A;  2V8D A;  1TIQ A;  1YSJ A;  5CNP A;  2J8N A;  4U9Z A;  3CDX A;  1XBU A;  1M1D A;  2F5I A;  2BSW A;  4CS0 B;  1HDU A;  5G1Z A;  2FE7 A;  3KGQ A;  5CBM A;  4G1P A;  4BIN A;  4R87 A;  4NSQ A;  4II9 A;  4C8P A;  4PXD A;  2R82 A;  3FED A;  3F8K A;  1Q5X A;  1Z8T A;  4JWP A;  4NGT A;  4KUA A;  4R8F A;  4ZGY B;  1QSR A;  4TJX A;  1M4D A;  3PBB A;  3PEI A;  2C6C A;  3PZJ A;  2QVP A;  3EFA A;  3DLJ A;  1CM0 A;  1LAN A;  2PE3 A;  3FNC A;  2PJ3 A;  4NGR A;  3WC5 A;  3IC1 A;  1YLE A;  2AFX A;  4CRZ B;  1VKC A;  1YW6 A;  5K8O A;  1J3L A;  2XEF A;  3PFO A;  4CDK A;  1BO4 A;  2GIV A;  2ABZ A;  3PP9 A;  2PR8 A;  2PCN A;  4QVT A;  1XMT A;  1R61 A;  2FL4 A;  2GFQ A;  4UEF A;  5F9M A;  4CAE A;  1WK4 A;  3S6F A;  3IWW A;  4OC1 A;  5IX3 A;  4JVO A;  1BPM A;  3D2P A;  2D4O A;  3TLA A;  4AB7 A;  5AG6 A;  5KTD A;  4CGN A;  3SXN A;  4A94 A;  1XJO A;  2G0B A;  2PCU A;  1IOI A;  2V8H A;  2Z3N A;  3BHX A;  1ZLH A;  1YRE A;  1X12 A;  2AJ6 A;  1QQ9 A;  3SI1 A;  1BPN A;  2IJZ A;  1WVM A;  1YR0 A;  3JVN A;  2ZXV A;  3DNS A;  3DDD A;  4C8A A;  1MJ9 A;  1XFO A;  2XEJ A;  4M6G A;  3CPA A;  4MFK A;  4MFZ A;  4UCM A;  5A28 A;  3KQX A;  2BO9 A;  2C6P A;  2ANP A;  2Q44 A;  3FYN A;  4MBU A;  4FBE A;  1OZP A;  1XE4 A;  4JYW A;  4CAV A;  1BLL E;  1ARM A;  3PFE A;  4H6Z A;  4K3N A;  3NH5 A;  4LX9 A;  4P10 A;  4RI1 A;  5HVG A;  1S3Z A;  1IOF A;  2JDD A;  4OC2 A;  4PQA A;  3V38 A;  3KR5 A;  3T9Y A;  1RO5 A;  2WPX A;  3GLJ A;  4AG7 A;  4RUH A;  4MHY A;  5F46 A;  2IMO A;  1IB1 E;  2Z3K A;  2GLJ A;  3F5B A;  2J9A A;  3KHX A;  4GS4 A;  3ZJ0 A;  3E0K A;  2VL1 A;  4UF4 A;  3T0T A;  2AFS A;  2KCW A;  2VI7 A;  4P4D A;  2BL1 A;  2R98 A;  4Q36 A;  4XPL A;  3SI0 A;  2PVW A;  4MJX A;  2YNC C;  2QJ8 A;  4P4F A;  4BBH A;  1NBW A;  4E94 A;  4MY0 A;  2I3C A;  2VQY A;  2E28 A;  3FJU A;  2H5M A;  3B3V A;  4A2Z A;  2POK A;  4ZX8 A;  1Z8W A;  2AFZ A;  3WT4 A;  3N7Z A;  1JWQ A;  3D67 A;  3FBU A;  1DIK A;  3TCV A;  1ARL A;  6CPA A;  1Q7L A;  1YLO A;  3QNV A;  4J0N A;  5JQ4 A;  4U5Y A;  2RFH A;  3NE8 A;  4UCN A;  2NYQ A;  2QIR A;  4C9A A;  4CDJ A;  3D7D A;  1NXJ A;  3VTA A;  2B3U A;  3TLZ A;  4XPK A;  5LRJ A;  4DJL A;  1Y9K A;  1NE9 A;  1TF9 A;  2BEI A;  3D68 A;  1CG2 A;  4MI1 A;  2ZW5 A;  4CYN A;  4EYS A;  4MCS A;  2CTB A;  2GU2 A;  3B7I A;  5K99 A;  4HNX B;  4MFP A;  4Q38 A;  2V8V A;  4R57 A;  3TLB A;  1PCA A;  2ZEP A;  2O53 A;  5DS0 A;  4UEZ A;  1B87 A;  1CBX A;  1U6M A;  1F2P A;  4BMH A;  1I12 A;  4ORF A;  5JM6 A;  3RYO A;  3B3W A;  3MGD A;  4C99 A;  1Z5R A;  2EK8 A;  1BAV A;  1KUX A;  1R3N A;  3T07 A;  4PSW A;  5F1Y A;  2O28 A;  2ZEG A;  1QMU A;  2PQ8 A;  4OIW A;  3GUX A;  1VHS A;  2P6E A;  2Q51 A;  4GXH A;  4MY3 A;  5D8N A;  3TYX A;  2RB7 A;  3LAC A;  4NEX A;  1A2Z A;  4KOT A;  4C9R A;  1M4L A;  4TWE A;  5IR2 A; 
#chains in the Genus database with same CATH homology
 2PVV A;  1OBR A;  1ZG8 A;  4OP4 A;  4NGP A;  3VAT A;  1ELM P;  4NGN A;  4CPA A;  4IAV A;  3KQZ A;  4C9U A;  3K2K A;  3SJX A;  1DTD A;  3ICU A;  4GM5 A;  2GLF A;  2JBK A;  5IB9 A;  3S9M A;  1XRY A;  3I1U A;  5J1Q A;  2QYV A;  3PB7 X;  4ZYQ A;  5F09 A;  4DYO A;  2ZED A;  4EME A;  3KI9 A;  4ZI6 A;  2ZEH A;  1HDQ A;  2GP4 A;  3H8E A;  3S9L A;  2ZEF A;  4PPZ A;  4MHN A;  1CPS A;  4NGQ A;  3FH4 A;  1F57 A;  4A39 A;  7CPA A;  4MCQ A;  2XEG A;  4F9V A;  2ZEM A;  3MN8 A;  3PB4 X;  5HVF A;  2F8H A;  4X2T A;  4Z65 A;  3PBE A;  1VGY A;  1DE4 C;  2C6G A;  3NA6 A;  5HXD A;  2JEW A;  4BD9 A;  3NH8 A;  3S9N A;  2C5Q A;  1TKH A;  2CIJ A;  4EWT A;  3MRU A;  3WC7 A;  3ISZ A;  2GRE A;  4R76 A;  1LCP A;  2C1C A;  2PIY A;  2PJ7 A;  2ZEN A;  5D29 A;  4IK2 A;  4B6Z A;  4LQG A;  2WYR A;  3IEH A;  3DGV A;  1VHO A;  3B3T A;  4OC0 A;  2XEI A;  2PJ2 A;  2PJ0 A;  1RTQ A;  5ELY A;  3LWU A;  4P4B A;  2ZEE A;  4W9Y A;  4YN3 A;  1VIX A;  1JQG A;  4AXV A;  2F7V A;  2AFW A;  4F9U A;  4WJB A;  3PB6 X;  3SI2 A;  3FX6 A;  5JGF A;  2Q43 A;  3H8G A;  2PIZ A;  4P6Y A;  3B3S A;  3HLP A;  3GB0 A;  4OC4 A;  2EK9 A;  4DUK A;  4NGS A;  3NH4 A;  3FEC A;  4H2K A;  4O23 A;  3ISX A;  3BI1 A;  4ZY2 A;  2CF4 A;  3SJG A;  1CX8 A;  1YW4 A;  4FAI A;  3CPX A;  2PJ4 A;  1XMB A;  1VHE A;  2PJ6 A;  2PJ5 A;  2PJA A;  2G9D A;  5LYI A;  2AFO A;  3LMS A;  3B2Y A;  1EE3 P;  4C8T A;  5K8P A;  3FEE A;  4KSI A;  4C84 A;  2JBJ A;  4A37 A;  1CPX A;  1LAP A;  4A38 A;  3I74 A;  3RAM A;  1YME A;  2ZOG A;  4C8U A;  3BI0 A;  4NJQ A;  1HEE A;  3TX8 A;  5LRG A;  3D7G A;  3KR4 A;  2BCO A;  1TXR A;  2HC9 A;  3PB8 X;  1R43 A;  4Q7A A;  2ZOF A;  3CT9 A;  4OKO A;  4JZ0 A;  3B3C A;  1LFW A;  2FVG A;  2OR4 A;  4OC3 A;  1FT7 A;  1LOK A;  2WZN A;  4PXE A;  5LYD A;  3D4U A;  3IJ3 A;  5LYL A;  4C9V A;  2V8G A;  3JRU A;  4FUU A;  1Y9Z A;  4R7M A;  3PB9 X;  4PXB A;  2PJ1 A;  2HB6 A;  1AMP A;  4YU9 A;  1CP6 A;  4NGM A;  1TKF A;  5HVH A;  3KL9 A;  4C8C A;  2V77 A;  3B35 A;  4IHM A;  3EIF A;  1NSA A;  2EWB A;  3V7Z A;  3D66 A;  3L2N A;  4TJV A;  1Y0R A;  4KNG E;  1Z2L A;  4MHZ A;  1LAM A;  3NFZ A;  4F8Z A;  3N5F A;  2AFM A;  4MHP A;  3FVL A;  4P4I A;  2ZEO A;  2PJC A;  3KAS A;  4WWV A;  2BOA A;  3WC6 A;  4C86 A;  1ZG7 A;  5K8N A;  3FMC A;  3KHZ A;  4X8I A;  3HUV A;  2O4H A;  5THW A;  4C8F A;  3PRT A;  4P45 A;  4C85 A;  3WAB A;  4C9E A;  1XF1 A;  2PJB A;  1CP7 A;  5LYF A;  4OID A;  2DEA A;  1GYT A;  3IFE A;  4YWY A;  4ZY1 A;  4MXU A;  4EFD A;  1Y7E A;  4UEE A;  1UWY A;  4UIB A;  4P4J A;  3TC8 A;  2OOT A;  3KZW A;  3D7H A;  1AYE A;  4UIA A;  1H8L A;  4OC5 A;  3IO1 A;  2AFU A;  3BXM A;  4FWU A;  1Z8L A;  1PYT B;  1ZLI A;  4P44 A;  1IGB A;  2IQ6 A;  3SJF A;  3I6S A;  2PJ8 A;  1ZG9 A;  2CTC A;  2NSM A;  3RBU A;  5K8M A;  3T8W A;  3K9T A;  4MRI A;  1V6C A;  1IY7 A;  4X3R A;  4R6T A;  3VAR A;  4NJR A;  3D7F A;  2ZEL A;  4NFR A;  4P4E A;  3RZA A;  3SJE A;  2PJ9 A;  3IIB A;  4OME A;  4PXC A;  4ZX9 A;  5I4M A;  2PRQ A;  5CPA A;  5LRK A;  1F2O A;  4MCR A;  1ELL P;  3H8F A;  1TKJ A;  3FF3 A;  4TNU A;  4ONW A;  3VH9 A;  1FNO A;  1Y0Y A;  1TF8 A;  4ZY0 A;  4MMO A;  5JH9 A;  1KWM A;  2Q4Z A;  4MCP A;  2V8D A;  1YSJ A;  3CDX A;  1XBU A;  1HDU A;  3KGQ A;  5CBM A;  4G1P A;  4C8P A;  4PXD A;  3FED A;  4NGT A;  4R8F A;  4TJX A;  3PBB A;  3PEI A;  2C6C A;  2QVP A;  3DLJ A;  3WC5 A;  1LAN A;  2PE3 A;  2PJ3 A;  4NGR A;  3IC1 A;  2AFX A;  5K8O A;  1YW6 A;  2XEF A;  3PFO A;  4CDK A;  2ABZ A;  4UEF A;  3IWW A;  4OC1 A;  1BPM A;  4A94 A;  1XJO A;  3BHX A;  2PCU A;  2V8H A;  1ZLH A;  1WVM A;  1QQ9 A;  3SI1 A;  1BPN A;  2IJZ A;  4C8A A;  1XFO A;  2XEJ A;  3CPA A;  3KQX A;  2BO9 A;  2C6P A;  2ANP A;  4FBE A;  4JYW A;  1BLL E;  1ARM A;  3PFE A;  4K3N A;  4P10 A;  3NH5 A;  5HVG A;  4OC2 A;  4PQA A;  3V38 A;  3KR5 A;  3GLJ A;  4RUH A;  4MHY A;  2IMO A;  2GLJ A;  3KHX A;  2J9A A;  2VL1 A;  4UF4 A;  2AFS A;  4P4D A;  8CPA A;  3SI0 A;  2PVW A;  4P4F A;  2QJ8 A;  2I3C A;  3FJU A;  3B3V A;  2POK A;  4ZX8 A;  2AFZ A;  3WT4 A;  3D67 A;  1ARL A;  6CPA A;  1Q7L A;  1YLO A;  3QNV A;  2RFH A;  2NYQ A;  4C9A A;  4CDJ A;  3D7D A;  3VTA A;  5LRJ A;  4DJL A;  3D68 A;  1TF9 A;  1CG2 A;  4MCS A;  2CTB A;  2GU2 A;  3B7I A;  2V8V A;  1PCA A;  2ZEP A;  2O53 A;  5DS0 A;  4UEZ A;  1CBX A;  1F2P A;  5JM6 A;  3B3W A;  4C99 A;  1Z5R A;  2EK8 A;  1BAV A;  1R3N A;  2ZEG A;  1QMU A;  4OIW A;  3GUX A;  2Q51 A;  5D8N A;  2RB7 A;  4C9R A;  1M4L A;  4TWE A;  5IR2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...