5IB9A

Crystal structure of aminopeptidase equipped with pad from aneurinibacillus sp. am-1
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
412
structure length
412
Chain Sequence
ADHQITKRTDAENMYNTIQFLSQAPRVAGSPEELKAVRYIEQQFKSYGYHVEVQPFQFEGYTAPSEVTLKIGTEKKEGEAFTYSPNSDVTAELVYVGLGTTADVAGKDLNGKIALIQRGNISFADKVRNAAKQGAKAVIIYNNTDGKLNGTLGGSDASFVAAVGITKQEGDALAANLRAGEKITATVKVAGAEVKTLTSHNVIATKKPDANKKNTNDIIIIGSHHDSVEKAPGANDDASGVAVTLELARVMSKLKTDTELRFITFGAEENGLIGSKKYAASLSEDEIKRTIGMFQLDMVGSKDAGDLIMYTIDGKKNRVTDLGAAASSRLSGVLPYGQEGRSDHESFHALGIPAALFIHAPVEPWYHTPNDTLDKISKEKLDNVADIVGSAVYQAARPGELVIEPIDYPRRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminopeptidase
publication title Crystal structure of aminopeptidase
rcsb
source organism Aneurinibacillus sp. am-1
molecule tags Hydrolase/hydrolase inhibitor
total genus 147
structure length 412
sequence length 412
ec nomenclature
pdb deposition date 2016-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 5ib9A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 5ib9A02
4IK2A 3IIBA 3H8FA 4EFDA 2Q43A 2PJ3A 3SI2A 1XJOA 3B3SA 1TKHA 2PVVA 4P10A 4FAIA 3PB4X 3CDXA 3T8WA 4A94A 4PQAA 4UIAA 4NGSA 3FECA 2JBKA 5LRKA 2HC9A 3S9LA 4R6TA 3D7GA 1QQ9A 1LFWA 3VARA 2PJ0A 2PJ8A 2AFZA 3FH4A 3IO1A 2AFOA 2EWBA 4C84A 4LQGA 3D4UA 3KR4A 4H2KA 4Z65A 4OIDA 2Q51A 2AFWA 4OKOA 5JM6A 1UWYA 1TXRA 3WABA 2J9AA 3CT9A 1KWMA 4NGPA 4NGMA 3VH9A 4R7MA 4OC1A 2EK9A 3RBUA 4MXUA 2PJ9A 3B3VA 2F8HA 4ZY1A 5DS0A 1YW6A 1XBUA 4C8CA 2C6PA 3V7ZA 4P4IA 3WC6A 4P45A 4MHNA 5LYIA 2I3CA 2F7VA 2CF4A 3NFZA 2HB6A 4WWVA 1ZLIA 1ELMP 3KL9A 5LYFA 5K8OA 2PJ2A 4BD9A 2GREA 4A38A 2QJ8A 5CBMA 4OIWA 2ZEGA 4PXCA 2O4HA 4TNUA 4OMEA 3PEIA 5D29A 4ZX9A 3D66A 4DJLA 4A39A 3K2KA 2V77A 3HLPA 2PIYA 1XF1A 4FBEA 2BO9A 4PXBA 3NH8A 1CPSA 4AXVA 2PJAA 1R43A 3QNVA 3D7FA 3MN8A 4OC5A 3I74A 1ELLP 3IFEA 1LCPA 4YN3A 5LRGA 1YSJA 4YU9A 4OP4A 2XEJA 1BPMA 2NYQA 4W9YA 3ISZA 3D68A 4NGNA 4EMEA 8CPAA 1ZG7A 2PE3A 4MHZA 5D8NA 2GLJA 1M4LA 3DLJA 4GM5A 1ARMA 3K9TA 2ZOFA 1XRYA 2FVGA 2Q4ZA 2AFUA 4F9VA 2G9DA 4PXEA 1TKFA 2ZEHA 4OC2A 5K8MA 4JZ0A 1XMBA 3V38A 3EIFA 1JQGA 4G1PA 3IJ3A 4UF4A 2QVPA 1VIXA 4X2TA 1ZLHA 5HVFA 1LOKA 3WT4A 2CIJA 4C8PA 1BLLE 2WYRA 2ZELA 4EWTA 3B3CA 1HDQA 4NGQA 3GUXA 3SI1A 4P4BA 2C6GA 1DE4C 4ZY0A 1OBRA 4MHPA 3FMCA 4UEFA 1BAVA 2DEAA 4C85A 4ZYQA 1CBXA 3WC5A 1LAMA 3D7HA 5JH9A 2C1CA 5HXDA 4C86A 4CDJA 3MRUA 4ONWA 1CX8A 3L2NA 3SJGA 1TF9A 2IMOA 3B2YA 3HUVA 3KQZA 5LRJA 3KASA 2PJ7A 5ELYA 2OR4A 3FEEA 4MMOA 4PPZA 4P4FA 3IC1A 3KHXA 1CP6A 4F8ZA 3FVLA 3PRTA 4KSIA 2CTCA 4ZI6A 4A37A 2AFXA 1Z8LA 4TJXA 2RB7A 4K3NA 4MCQA 2PJCA 1VHOA 2EK8A 1BPNA 3PB9X 3NA6A 1CP7A 3NH4A 3KGQA 3GB0A 5CPAA 4CPAA 2VL1A 4DYOA 5HVGA 3B7IA 2WZNA 4C8AA 4C8FA 2PJ6A 3KZWA 2RFHA 4NGTA 3PB6X 2PJ1A 5J1QA 2ZEEA 1Q7LA 2OOTA 3ICUA 2ZOGA 3RZAA 1YMEA 2ZEMA 3LMSA 3PB7X 3B3WA 1FT7A 1ZG8A 3BI1A 3CPAA 2GU2A 4UIBA 1F2OA 2CTBA 4O23A 4KNGE 6CPAA 4RUHA 2IJZA 4UEZA 4C8UA 1ZG9A 4X8IA 4MCSA 1CPXA 4OC3A 3VTAA 2ZEPA 4ZY2A 4ZX8A 2QYVA 3FX6A 4Q7AA 3TX8A 5K8NA 1Y0RA 1F2PA 2XEIA 1LANA 4B6ZA 2PRQA 4C9VA 2XEFA 1AYEA 2GLFA 3D7DA 3H8EA 2V8HA 4NJRA 5LYLA 1HEEA 4C8TA 5THWA 2ABZA 3S9NA 1YLOA 4MRIA 1XFOA 3GLJA 3NH5A 4X3RA 5HVHA 4MCPA 4PXDA 2AFSA 3N5FA 4P6YA 3WC7A 3DGVA 3PBBA 3JRUA 2PVWA 1VHEA 1WVMA 3S9MA 1TF8A 3BI0A 4P4JA 1Y7EA 3TC8A 4P44A 4P4EA 3CPXA 5IB9A 5F09A 3H8GA 4NFRA 1Z2LA 4F9UA 4C9AA 1R3NA 2ZEOA 1V6CA 4NGRA 3B3TA 3I6SA 1AMPA 1PCAA 3PB8X 4FUUA 1RTQA 3B35A 3PFOA 3SJFA 1H8LA 3SI0A 2JEWA 3IWWA 3ISXA 2PCUA 4TWEA 1IGBA 4C9UA 7CPAA 4MCRA 4IAVA 2ANPA 1IY7A 1HDUA 2V8GA 1CG2A 3FJUA 2V8DA 1DTDA 3VATA 3LWUA 1YW4A 1F57A 3RAMA 3KHZA 4R8FA 3PBEA 4FWUA 1QMUA 4NJQA 4UEEA 2C6CA 3SJEA 4OC4A 3FEDA 2PJ4A 3PFEA 5LYDA 1Y9ZA 4C99A 3KI9A 2ZENA 3FF3A 2ZEDA 4IHMA 2AFMA 3D67A 1VGYA 1Z5RA 3BHXA 4OC0A 3BXMA 2V8VA 4WJBA 2BCOA 1PYTB 1LAPA 4JYWA 3I1UA 4MHYA 1ARLA 1GYTA 3KR5A 2PIZA 4TJVA 2O53A 2ZEFA 4C9RA 2POKA 3KQXA 5K8PA 1NSAA 2XEGA 1TKJA 4R76A 4P4DA 1FNOA 2PJBA 1EE3P 2PJ5A 4CDKA 4YWYA 2JBJA 5I4MA 2IQ6A 5JGFA 4C9EA 3IEHA 1Y0YA 2NSMA 3SJXA 4DUKA 2BOAA
chains in the Genus database with same CATH superfamily
3RYOA 4BINA 1YVOA 5KTCA 3TLZA 3T9YA 5KTAA 2VZZA 4IK2A 2YJVA 3IIBA 2VZYA 3H8FA 2EUIA 4EFDA 2Q43A 1K4JA 1I21A 1LRZA 4CAWA 2JEVA 2PJ3A 4NCZA 4R3LA 1CS0B 4UA3A 2Z0ZA 3SI2A 1XJOA 3B3SA 1TKHA 2PVVA 3D2PA 4I49A 4P10A 3VWDA 3PB4X 4FAIA 2EZBA 5FD8A 3CDXA 4XPDC 3T8WA 1IOFA 4A94A 5CNPA 5C82A 1J3LA 4MFLA 4Y49B 4PQAA 4KVME 4UBRA 4UIAA 4NGSA 4HPSA 3S6GA 3FECA 3EFAA 1GHEA 4NEXA 2CNMA 1S7NA 4L89A 2JBKA 5LRKA 1VHSA 2HC9A 3I3GA 3K9UA 5EBVA 3S9LA 4R6TA 3D7GA 1QQ9A 3H5ZA 2I79A 1LFWA 3VARA 3PZJA 2PJ0A 3DR6A 2PJ8A 3BJ7A 2P6FA 3ZZIA 2AFZA 4E0AA 1NXJA 3FH4A 2DF5A 2AFOA 3IO1A 2EWBA 4B12A 4C84A 2IL4A 2B5GB 4LQGA 3DNSA 3D4UA 3KR4A 4H89A 4GS4A 2Q44A 4H2KA 4Z65A 1V0CA 2Q51A 4OIDA 2FM4A 2AFWA 4OKOA 3G8WA 1I12A 3GKRA 5AG4A 5JM6A 4R57A 1UWYA 1MK4A 4YFJA 1TXRA 4R9MA 5AG6A 3WABA 2AUNA 2J9AA 4B13A 3CT9A 1OZPA 4E8OA 2HQYA 3FRMA 2B3UA 3G3SA 5G22A 4A31A 1KWMA 4NGPA 4NF1A 4NGMA 3VH9A 2YNEA 4R7MA 4OC1A 2EK9A 2Q4VA 2YNDA 3RBUA 4AVAA 4MXUA 4XNHC 2PJ9A 3B3VA 2F8HA 4ZY1A 3EZAA 4H1HA 5DS0A 1YW6A 4E5SA 1XBUA 1AUGA 3IU1A 1YX0A 4J3GA 3R96A 4EVYA 4C8CA 3I9SA 2ZW6A 2G0BA 2C6PA 3V7ZA 4MBUA 4P4IA 5JVLA 5K99A 3WC6A 4P45A 4MHNA 2ZW4A 3TLGB 5LYIA 2I00A 1IYLA 2I3CA 2F7VA 4R87A 2CF4A 3RO0A 3NFZA 2HB6A 3C26A 4WWVA 1ZLIA 2HWGA 1XOVA 1ELMP 3KL9A 4CYPA 4F0YA 5LYFA 5K8OA 3D8PA 2PJ2A 4BD9A 2GREA 4A38A 2OZGA 4GXHA 2QJ8A 4JXQA 4U5YA 4AVCA 5CBMA 4OIWA 2ZEGA 2B4DA 4PXCA 3TE4A 2O4HA 4TNUA 3TT2A 4AG9A 4OMEA 3TO6A 3PEIA 5D29A 4ZX9A 3D66A 4DJLA 4A39A 3K2KA 2V77A 3HLPA 2PIYA 3LD2A 2FS5A 1XF1A 4OADA 4FBEA 4MI1A 2BO9A 4PXBA 4INJA 3C8OA 2JDDA 3NH8A 4YGOA 4FD5A 1Y9KA 1QSMA 3V8IA 1CPSA 4AXVA 2PJAA 4CAXA 2D4OA 1R43A 3QNVA 3W6XA 4J0NA 3D7FA 5F9MA 3T05A 2RC4A 3MN8A 4OC5A 3I74A 1P4NA 1ELLP 3IFEA 1LCPA 1ON0A 1B6BA 2Z3OA 3P2FA 2D0PA 3ZJ0A 4YN3A 3IGRA 1YLEA 2VI7A 3EY5A 5F5XA 5LRGA 4QB9A 4UFVA 1QSRA 1YSJA 4YU9A 2QMLA 3S6FA 4OP4A 2PR1A 4M6GA 1BPMA 2XEJA 1PUAA 4PK2A 5EMIA 2FSRA 2NYQA 2HV2A 1X12A 2PRBA 3B8GA 4W9YA 2E28A 2J8RA 1VBHA 4A95A 2Y0MA 3ISZA 2FIAA 3D68A 4NGNA 4RI1A 4EMEA 8CPAA 1ZG7A 2PE3A 4QVTA 1EZBA 2Z10A 4MHZA 5D8NA 2GLJA 1M4LA 3CXSA 3DLJA 4GM5A 1ARMA 1B87A 1S7LA 5A28A 2B4BA 3K9TA 2ZOFA 1XRYA 2FVGA 2Q4ZA 2AFUA 4F9VA 1TIQA 1Y7RA 2G9DA 4IUSA 4PXEA 1QSTA 2Z3PA 4CYOA 1XMTA 1SQHA 1TKFA 2ZEHA 4OC2A 5K8MA 4JZ0A 1XMBA 3V38A 4HNWB 3EIFA 1JQGA 2CXAA 4G1PA 1MJBA 3P2HA 3TLYA 2KCWA 5DWNA 3IJ3A 4UF4A 2QVPA 3N7ZA 1JDBC 1VIXA 4X2TA 5C88A 2HROA 4HNYB 5F48A 2B0AA 3QB8A 1ZLHA 5HVFA 4CGMA 1LOKA 3WT4A 2CIJA 2FIWA 4C8PA 4MFQA 1BLLE 2REEA 4CAEA 2WYRA 2F5IA 2EO8A 2ZELA 4KSAA 3TOAA 4EWTA 3B3CA 3CXQA 1ZL0A 1HDQA 4NGQA 5FVJA 3R1KA 5DWMA 1S3ZA 3FNCA 3TCVA 3GUXA 3SI1A 4P4BA 5IX3A 2C5QA 2YJTA 2C6GA 4F6AA 1DE4C 1PU9A 4ZY0A 1OBRA 4MHPA 4JLYA 3BLNA 3IWGA 4COGA 3FMCA 4UEFA 1NE9A 1M4GA 1BAVA 2DEAA 3QAHA 3U1BA 4MFPA 3TLCA 2YNCC 4C85A 4ZYQA 4RS2A 1CBXA 3WC5A 1IIDA 1LAMA 3D7HA 2QIRA 2GIVA 1DIKA 5JH9A 4UCMA 4ORFA 2G3TA 4IIYA 4C7IA 2C1CA 5HXDA 2MP0A 4C86A 4CDJA 1XIXA 3MRUA 4ONWA 5AGEA 1CX8A 2G3AA 3KRVA 3L2NA 4M8DA 3W6SA 1QSNA 4KOXA 4CGNA 2FL4A 3FBUA 4JD6A 3SJGA 1TF9A 4UWJA 1Q5XA 1CJWA 1NMTA 2VXKA 4KVOE 4CGLA 4KLVA 1IOIA 4CYNA 3T5MA 4MFZA 4M85A 2IMOA 3B2YA 3HUVA 3KQZA 5LRJA 4A30A 4DNCA 1Z4EA 3KASA 2PJ7A 4KOSA 1ZRSA 4C2YA 5ELYA 2P6GA 1Y9WA 2OR4A 1KUXA 2Z3LA 1YVKA 1Z8WA 3TTHA 4LUAA 3S6KA 3FEEA 4MMOA 4PPZA 2Z3NA 4U9ZA 4P4FA 4NSQA 3IC1A 4MHDA 4MY3A 3KHXA 3JUWA 2AUMA 2YGWA 1CP6A 4F8ZA 3FVLA 4KUBA 3PRTA 2JDCA 4KSIA 2CTCA 3IU2A 4ZI6A 4CYQA 4A37A 2AFXA 2FXFA 1Z8LA 4TJXA 2RB7A 1VKCA 4CRZB 4K3NA 3W91A 4MCQA 4COBA 3NOJA 2PJCA 1VHOA 2EK8A 4F0XA 1BPNA 2O28A 3PB9X 4CZ1A 1YQEA 1Q2CA 3A9LA 1CP7A 3NA6A 2PQ8A 1WK4A 3NH4A 1JDEA 1KUVA 3GB0A 3KGQA 5CPAA 4CPAA 3KKWA 2AJ6A 2VL1A 2DXQA 4DYOA 2DPTA 5AG7A 5HVGA 1Z9UA 2ZXVA 3B7IA 5J8CA 4ZGYB 1CE8B 4CO9A 1Q2YA 2WZNA 1YGHA 4C8AA 4Y49C 4C8FA 3FB3A 2PJ6A 3KZWA 1Z8TA 4L8AA 3EZEA 5F46A 1C3OB 2RFHA 4NGTA 3PB6X 2REFA 1NSLA 2P6EA 4EYSA 2PJ1A 1Q2DA 5J1QA 2J8NA 2ZEEA 4IF5A 1Q7LA 3GY9A 4FD4A 4NXYA 3D3SA 2QECA 2OOTA 2B58A 5HMNA 1BO4A 4R3KA 2ZOGA 1KZFA 3RZAA 3ICUA 3TO7A 1YMEA 2ZEMA 3LMSA 3PB7X 2FCKA 3SXNA 5IV0A 4E2AA 3T0TA 5A27A 3B3WA 1FT7A 1ZG8A 4QC6A 2X7BA 3TO9A 2R98A 4M6HA 4QUSA 3BI1A 1I1DA 2Q04A 4XPDB 4B5OA 3CPAA 2GU2A 4UIBA 3QAYA 3G23A 4C2XA 1F2OA 2CTBA 3LODA 5H86A 2HI6A 4O23A 4KNGE 2NMTA 1Z4RA 6CPAA 2CNTA 4RUHA 3OWCA 2IJZA 1U6MA 2PR8A 2Q4YA 2Z3KA 1ZG9A 2ZW7A 4Q38A 4KZTA 4UEZA 4YRHA 1XEBA 5GCNA 2OH1A 1J4JA 4X8IA 3PGPA 4MCSA 2OU2A 2WSAA 1IYKA 1M6VB 2OB0A 3TLBA 3GJZA 1CPXA 4PSXA 4OC3A 2AE6A 2GP4A 1M4DA 2ZEPA 3VTAA 4ZY2A 4MI4A 3NE7A 4ZX8A 3R95A 3R9GA 4KORA 2QYVA 3BJ8A 3FX6A 4Q7AA 4UCNA 3TX8A 4KVXA 5K8NA 2FE7A 4C2ZA 1Y0RA 1F2PA 2XEIA 4CS0B 2FT0A 4UFXA 1LANA 4B6ZA 2PRQA 4C9VA 2XEFA 1AYEA 2GLFA 4CGOA 3D7DA 3H8EA 2V8HA 5EC4A 4AG7A 2OLSA 3UY5A 5J8FA 2WPWA 1RXTA 4JWPA 4NJRA 3SHPA 1HEEA 2GE3A 5E96A 2PDOA 2EBJA 5LYLA 1XE4A 2CNSA 4JXRA 3EO4A 4U9YA 3EXNA 1S60A 4BBHA 4C8TA 4XNHB 1A2ZA 5THWA 3VATA 1P0HA 1A9XB 2ABZA 5JPHA 2D4PA 3S9NA 5F47A 1YLOA 3VWEA 4HKFA 3K4IA 2B4DB 1R61A 4MRIA 2R82A 1XFOA 2C27A 3GLJA 3NH5A 4PSWA 4X3RA 1S7KA 5IR2A 5HVHA 4ONUA 5AG5A 1EZAA 1ZYMA 1S5KA 3DDDA 4M6IA 4MCPA 4PXDA 2AFSA 3N5FA 3TLEA 4P6YA 5HH1A 3WC7A 1JWQA 3DGVA 3R9FA 3PBBA 5F49A 4MJ8A 1RO5A 2PVWA 1VHEA 3JRUA 4LX9A 3TOBA 4CAVA 1BXRB 1WVMA 3TYXA 4KSFA 2A4NA 4H6UA 3EC4A 4OLLA 5JQ4A 3S9MA 1TF8A 3BI0A 4HNXB 4P4JA 1Y7EA 2VEZA 2H5MA 2YNCA 4P44A 1WWZA 2OZHA 3TC8A 4B14A 1KBLA 4UFWA 2ATRA 1UFHA 4B5PA 1KUYA 1GGOA 2PSWA 3IWEA 4P4EA 3CPXA 2X0SA 2B3VA 4RN7A 5IB9A 5F09A 1FY7A 1Z2LA 3H8GA 4NFRA 4F9UA 4C8UA 4C9AA 1R3NA 3SR3A 2ZEOA 1MJ9A 1V6CA 4NGRA 3B3TA 3I6SA 2HUZA 5G1ZA 5ISVA 1NBWA 4KOYA 1AMPA 3S6HA 1PCAA 2R1IA 2GFQA 3PB8X 4FUUA 2JLMA 1RTQA 2ODFA 2Q0YA 3B35A 4A2ZA 2BSWA 1YR0A 2OZUA 3PFOA 3WR7A 3SJFA 2R8VA 1H8LA 4OAEA 3SI0A 2JEWA 3IWWA 4C7HA 4E94A 2R7HA 4H6ZA 3ISXA 2PCUA 4FD7A 4X5KA 1ZO0A 2GANA 4TWEA 3EZBA 4BMHA 1IGBA 4C9UA 7CPAA 5JYBA 4MCRA 3RNZA 3TFYA 4IAVA 1KC7A 2ANPA 1IY7A 2BEIA 5H84A 1HDUA 2V8GA 4CGPA 1CG2A 2ARHA 3FJUA 3D2MA 3GIUA 2V8DA 5G20A 4B11A 2Q7SA 1DTDA 4KS9A 1M1DA 2DPSA 3LWUA 3DSBA 3F5BA 1YW4A 4Q36A 1F57A 3JVNA 4KUAA 3RAMA 3KHZA 4R8FA 5BWAB 3F8KA 4A32A 3PBEA 4FWUA 1QMUA 4NJQA 3JTKA 4UEEA 2C6CA 5G21A 1N71A 4UCPA 1S7FA 4ZBGA 3NE8A 2ZPAA 3SJEA 4CRYB 4LQ6A 4OC4A 3MGDA 2EZCA 1YREA 2J8MA 3FEDA 4IIXA 3TLAA 2PJ4A 5IB0A 4M3SA 3H4QA 1YK3A 4MJXA 1M4IA 3FIXA 4XPLA 4II9A 3PFEA 2ZW5A 4KOWA 1CM0A 4XPKA 3LACA 5LYDA 1Y9ZA 4C99A 1T36B 2PCNA 4PK3A 3KI9A 2ZENA 2DIKA 5I0CA 3SXOA 4A33A 2D0OA 3FF3A 2ZEDA 2WPXA 3GYAA 4KOUA 4IHMA 3T90A 2AFMA 2CY2A 3D67A 4MY0A 4MFKA 1VBGA 2EVNA 1IU8A 1VGYA 1Z8XA 4CAFA 2EZAA 1MJAA 4PV6A 4KOTA 1Z5RA 2BL1A 4AVBA 1C30B 2Z3MA 3BHXA 5F1YA 4OC0A 3BXMA 2B5GA 2V8VA 4WJBA 2BCOA 4B5PB 1IB1E 3T07A 1PYTB 4FD6A 3FXTA 1M44A 1LAPA 4MFJA 4JVOA 2K5TA 3CZXA 4JYWA 3I1UA 4KOVA 4MHYA 1X10A 4B10A 4AB7A 1ARLA 1GYTA 3KR5A 2PIZA 4JJXA 4TJVA 2O53A 2ZEFA 3PP9A 2Q7BA 4C9RA 2POKA 4UWIA 1QSOA 1KEEB 3KQXA 2P0WA 2VQYA 4K30A 1R57A 3E0KA 3CXPA 1XF8A 1IICA 1NSAA 5K8PA 2XEGA 1TKJA 2PC1A 3F0AA 1BOBA 4KLWA 2VBQA 4R76A 4P4DA 1FNOA 2PJBA 3DR8A 3FYNA 1EE3P 3R9EA 2PJ5A 2Z11A 3TLGA 1VI4A 4CDKA 4YWYA 2JBJA 5I4MA 2IQ6A 5JGFA 4C9EA 1L0CA 2BUEA 3IEHA 1Y0YA 2NSMA 4C68A 3SJXA 4DUKA 4QBJA 2BOAA 2WUUA 5KTDA
chains in the Genus database with same CATH topology
4IK2A 3IIBA 3H8FA 4EFDA 2Q43A 2PJ3A 3SI2A 1XJOA 3B3SA 1TKHA 2PVVA 4P10A 4FAIA 3PB4X 3CDXA 3T8WA 4A94A 4PQAA 4UIAA 4NGSA 3FECA 2JBKA 5LRKA 2HC9A 3S9LA 4R6TA 3D7GA 1QQ9A 1LFWA 3VARA 2PJ0A 2PJ8A 2AFZA 3FH4A 3IO1A 2AFOA 2EWBA 4C84A 4LQGA 3D4UA 3KR4A 4H2KA 4Z65A 4OIDA 2Q51A 2AFWA 4OKOA 5JM6A 1UWYA 1TXRA 3WABA 2J9AA 3CT9A 1KWMA 4NGPA 4NGMA 3VH9A 4R7MA 4OC1A 2EK9A 3RBUA 4MXUA 2PJ9A 3B3VA 2F8HA 4ZY1A 5DS0A 1YW6A 1XBUA 4C8CA 2C6PA 3V7ZA 4P4IA 3WC6A 4P45A 4MHNA 5LYIA 2I3CA 2F7VA 2CF4A 3NFZA 2HB6A 4WWVA 1ZLIA 1ELMP 3KL9A 5LYFA 5K8OA 2PJ2A 4BD9A 2GREA 4A38A 2QJ8A 5CBMA 4OIWA 2ZEGA 4PXCA 2O4HA 4TNUA 4OMEA 3PEIA 5D29A 4ZX9A 3D66A 4DJLA 4A39A 3K2KA 2V77A 3HLPA 2PIYA 1XF1A 4FBEA 2BO9A 4PXBA 3NH8A 1CPSA 4AXVA 2PJAA 1R43A 3QNVA 3D7FA 3MN8A 4OC5A 3I74A 1ELLP 3IFEA 1LCPA 4YN3A 5LRGA 1YSJA 4YU9A 4OP4A 2XEJA 1BPMA 2NYQA 4W9YA 3ISZA 3D68A 4NGNA 4EMEA 8CPAA 1ZG7A 2PE3A 4MHZA 5D8NA 2GLJA 1M4LA 3DLJA 4GM5A 1ARMA 3K9TA 2ZOFA 1XRYA 2FVGA 2Q4ZA 2AFUA 4F9VA 2G9DA 4PXEA 1TKFA 2ZEHA 4OC2A 5K8MA 4JZ0A 1XMBA 3V38A 3EIFA 1JQGA 4G1PA 3IJ3A 4UF4A 2QVPA 1VIXA 4X2TA 1ZLHA 5HVFA 1LOKA 3WT4A 2CIJA 4C8PA 1BLLE 2WYRA 2ZELA 4EWTA 3B3CA 1HDQA 4NGQA 3GUXA 3SI1A 4P4BA 2C5QA 2C6GA 1DE4C 4ZY0A 1OBRA 4MHPA 3FMCA 4UEFA 1BAVA 2DEAA 4C85A 4ZYQA 1CBXA 3WC5A 1LAMA 3D7HA 5JH9A 2C1CA 5HXDA 4C86A 4CDJA 3MRUA 4ONWA 1CX8A 3L2NA 3SJGA 1TF9A 2IMOA 3B2YA 3HUVA 3KQZA 5LRJA 3KASA 2PJ7A 5ELYA 2OR4A 3FEEA 4MMOA 4PPZA 4P4FA 3IC1A 3KHXA 1CP6A 4F8ZA 3FVLA 3PRTA 4KSIA 2CTCA 4ZI6A 4A37A 2AFXA 1Z8LA 4TJXA 2RB7A 4K3NA 4MCQA 2PJCA 1VHOA 2EK8A 1BPNA 3PB9X 3NA6A 1CP7A 3NH4A 3KGQA 3GB0A 5CPAA 4CPAA 2VL1A 4DYOA 5HVGA 3B7IA 2WZNA 4C8AA 4C8FA 2PJ6A 3KZWA 2RFHA 4NGTA 3PB6X 2PJ1A 5J1QA 2ZEEA 1Q7LA 2OOTA 3ICUA 2ZOGA 3RZAA 1YMEA 2ZEMA 3LMSA 3PB7X 3B3WA 1FT7A 1ZG8A 3BI1A 3CPAA 2GU2A 4UIBA 1F2OA 2CTBA 4O23A 4KNGE 6CPAA 4RUHA 2IJZA 4UEZA 4C8UA 1ZG9A 4X8IA 4MCSA 1CPXA 4OC3A 2GP4A 3VTAA 2ZEPA 4ZY2A 4ZX8A 2QYVA 3FX6A 4Q7AA 3TX8A 5K8NA 1Y0RA 1F2PA 2XEIA 1LANA 4B6ZA 2PRQA 4C9VA 2XEFA 1AYEA 2GLFA 3D7DA 3H8EA 2V8HA 4NJRA 5LYLA 1HEEA 4C8TA 5THWA 2ABZA 3S9NA 1YLOA 4MRIA 1XFOA 3GLJA 3NH5A 4X3RA 5IR2A 5HVHA 4MCPA 4PXDA 2AFSA 3N5FA 4P6YA 3WC7A 3DGVA 3PBBA 3JRUA 2PVWA 1VHEA 1WVMA 3S9MA 1TF8A 3BI0A 4P4JA 1Y7EA 3TC8A 4P44A 4P4EA 3CPXA 5IB9A 5F09A 3H8GA 4NFRA 1Z2LA 4F9UA 4C9AA 1R3NA 2ZEOA 1V6CA 4NGRA 3B3TA 3I6SA 1AMPA 1PCAA 3PB8X 4FUUA 1RTQA 3B35A 3PFOA 3SJFA 1H8LA 3SI0A 2JEWA 3IWWA 3ISXA 2PCUA 4TWEA 1IGBA 4C9UA 7CPAA 4MCRA 4IAVA 2ANPA 1IY7A 1HDUA 2V8GA 1CG2A 3FJUA 2V8DA 1DTDA 3VATA 3LWUA 1YW4A 1F57A 3RAMA 3KHZA 4R8FA 3PBEA 4FWUA 1QMUA 4NJQA 4UEEA 2C6CA 3SJEA 4OC4A 3FEDA 2PJ4A 3PFEA 5LYDA 1Y9ZA 4C99A 3KI9A 2ZENA 3FF3A 2ZEDA 4IHMA 2AFMA 3D67A 1VGYA 1Z5RA 3BHXA 4OC0A 3BXMA 2V8VA 4WJBA 2BCOA 1PYTB 1LAPA 4JYWA 3I1UA 4MHYA 1ARLA 1GYTA 3KR5A 2PIZA 4TJVA 2O53A 2ZEFA 4C9RA 2POKA 3KQXA 5K8PA 1NSAA 2XEGA 1TKJA 4R76A 4P4DA 1FNOA 2PJBA 1EE3P 2PJ5A 4CDKA 4YWYA 2JBJA 5I4MA 2IQ6A 5JGFA 4C9EA 3IEHA 1Y0YA 2NSMA 3SJXA 4DUKA 2BOAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IK2 A;  3IIB A;  3H8F A;  4EFD A;  2Q43 A;  2PJ3 A;  3SI2 A;  1XJO A;  3B3S A;  1TKH A;  2PVV A;  4P10 A;  4FAI A;  3PB4 X;  3CDX A;  3T8W A;  4A94 A;  4PQA A;  4UIA A;  4NGS A;  3FEC A;  2JBK A;  5LRK A;  2HC9 A;  3S9L A;  4R6T A;  3D7G A;  1QQ9 A;  1LFW A;  3VAR A;  2PJ0 A;  2PJ8 A;  2AFZ A;  3FH4 A;  3IO1 A;  2AFO A;  2EWB A;  4C84 A;  4LQG A;  3D4U A;  3KR4 A;  4H2K A;  4Z65 A;  4OID A;  2Q51 A;  2AFW A;  4OKO A;  5JM6 A;  1UWY A;  1TXR A;  3WAB A;  2J9A A;  3CT9 A;  1KWM A;  4NGP A;  4NGM A;  3VH9 A;  4R7M A;  4OC1 A;  2EK9 A;  3RBU A;  4MXU A;  2PJ9 A;  3B3V A;  2F8H A;  4ZY1 A;  5DS0 A;  1YW6 A;  1XBU A;  4C8C A;  2C6P A;  3V7Z A;  4P4I A;  3WC6 A;  4P45 A;  4MHN A;  5LYI A;  2I3C A;  2F7V A;  2CF4 A;  3NFZ A;  2HB6 A;  4WWV A;  1ZLI A;  1ELM P;  3KL9 A;  5LYF A;  5K8O A;  2PJ2 A;  4BD9 A;  2GRE A;  4A38 A;  2QJ8 A;  5CBM A;  4OIW A;  2ZEG A;  4PXC A;  2O4H A;  4TNU A;  4OME A;  3PEI A;  5D29 A;  4ZX9 A;  3D66 A;  4DJL A;  4A39 A;  3K2K A;  2V77 A;  3HLP A;  2PIY A;  1XF1 A;  4FBE A;  2BO9 A;  4PXB A;  3NH8 A;  1CPS A;  4AXV A;  2PJA A;  1R43 A;  3QNV A;  3D7F A;  3MN8 A;  4OC5 A;  3I74 A;  1ELL P;  3IFE A;  1LCP A;  4YN3 A;  5LRG A;  1YSJ A;  4YU9 A;  4OP4 A;  2XEJ A;  1BPM A;  2NYQ A;  4W9Y A;  3ISZ A;  3D68 A;  4NGN A;  4EME A;  8CPA A;  1ZG7 A;  2PE3 A;  4MHZ A;  5D8N A;  2GLJ A;  1M4L A;  3DLJ A;  4GM5 A;  1ARM A;  3K9T A;  2ZOF A;  1XRY A;  2FVG A;  2Q4Z A;  2AFU A;  4F9V A;  2G9D A;  4PXE A;  1TKF A;  2ZEH A;  4OC2 A;  5K8M A;  4JZ0 A;  1XMB A;  3V38 A;  3EIF A;  1JQG A;  4G1P A;  3IJ3 A;  4UF4 A;  2QVP A;  1VIX A;  4X2T A;  1ZLH A;  5HVF A;  1LOK A;  3WT4 A;  2CIJ A;  4C8P A;  1BLL E;  2WYR A;  2ZEL A;  4EWT A;  3B3C A;  1HDQ A;  4NGQ A;  3GUX A;  3SI1 A;  4P4B A;  2C6G A;  1DE4 C;  4ZY0 A;  1OBR A;  4MHP A;  3FMC A;  4UEF A;  1BAV A;  2DEA A;  4C85 A;  4ZYQ A;  1CBX A;  3WC5 A;  1LAM A;  3D7H A;  5JH9 A;  2C1C A;  5HXD A;  4C86 A;  4CDJ A;  3MRU A;  4ONW A;  1CX8 A;  3L2N A;  3SJG A;  1TF9 A;  2IMO A;  3B2Y A;  3HUV A;  3KQZ A;  5LRJ A;  3KAS A;  2PJ7 A;  5ELY A;  2OR4 A;  3FEE A;  4MMO A;  4PPZ A;  4P4F A;  3IC1 A;  3KHX A;  1CP6 A;  4F8Z A;  3FVL A;  3PRT A;  4KSI A;  2CTC A;  4ZI6 A;  4A37 A;  2AFX A;  1Z8L A;  4TJX A;  2RB7 A;  4K3N A;  4MCQ A;  2PJC A;  1VHO A;  2EK8 A;  1BPN A;  3PB9 X;  3NA6 A;  1CP7 A;  3NH4 A;  3KGQ A;  3GB0 A;  5CPA A;  4CPA A;  2VL1 A;  4DYO A;  5HVG A;  3B7I A;  2WZN A;  4C8A A;  4C8F A;  2PJ6 A;  3KZW A;  2RFH A;  4NGT A;  3PB6 X;  2PJ1 A;  5J1Q A;  2ZEE A;  1Q7L A;  2OOT A;  3ICU A;  2ZOG A;  3RZA A;  1YME A;  2ZEM A;  3LMS A;  3PB7 X;  3B3W A;  1FT7 A;  1ZG8 A;  3BI1 A;  3CPA A;  2GU2 A;  4UIB A;  1F2O A;  2CTB A;  4O23 A;  4KNG E;  6CPA A;  4RUH A;  2IJZ A;  4UEZ A;  4C8U A;  1ZG9 A;  4X8I A;  4MCS A;  1CPX A;  4OC3 A;  3VTA A;  2ZEP A;  4ZY2 A;  4ZX8 A;  2QYV A;  3FX6 A;  4Q7A A;  3TX8 A;  5K8N A;  1Y0R A;  1F2P A;  2XEI A;  1LAN A;  4B6Z A;  2PRQ A;  4C9V A;  2XEF A;  1AYE A;  2GLF A;  3D7D A;  3H8E A;  2V8H A;  4NJR A;  5LYL A;  1HEE A;  4C8T A;  5THW A;  2ABZ A;  3S9N A;  1YLO A;  4MRI A;  1XFO A;  3GLJ A;  3NH5 A;  4X3R A;  5HVH A;  4MCP A;  4PXD A;  2AFS A;  3N5F A;  4P6Y A;  3WC7 A;  3DGV A;  3PBB A;  3JRU A;  2PVW A;  1VHE A;  1WVM A;  3S9M A;  1TF8 A;  3BI0 A;  4P4J A;  1Y7E A;  3TC8 A;  4P44 A;  4P4E A;  3CPX A;  5IB9 A;  5F09 A;  3H8G A;  4NFR A;  1Z2L A;  4F9U A;  4C9A A;  1R3N A;  2ZEO A;  1V6C A;  4NGR A;  3B3T A;  3I6S A;  1AMP A;  1PCA A;  3PB8 X;  4FUU A;  1RTQ A;  3B35 A;  3PFO A;  3SJF A;  1H8L A;  3SI0 A;  2JEW A;  3IWW A;  3ISX A;  2PCU A;  4TWE A;  1IGB A;  4C9U A;  7CPA A;  4MCR A;  4IAV A;  2ANP A;  1IY7 A;  1HDU A;  2V8G A;  1CG2 A;  3FJU A;  2V8D A;  1DTD A;  3VAT A;  3LWU A;  1YW4 A;  1F57 A;  3RAM A;  3KHZ A;  4R8F A;  3PBE A;  4FWU A;  1QMU A;  4NJQ A;  4UEE A;  2C6C A;  3SJE A;  4OC4 A;  3FED A;  2PJ4 A;  3PFE A;  5LYD A;  1Y9Z A;  4C99 A;  3KI9 A;  2ZEN A;  3FF3 A;  2ZED A;  4IHM A;  2AFM A;  3D67 A;  1VGY A;  1Z5R A;  3BHX A;  4OC0 A;  3BXM A;  2V8V A;  4WJB A;  2BCO A;  1PYT B;  1LAP A;  4JYW A;  3I1U A;  4MHY A;  1ARL A;  1GYT A;  3KR5 A;  2PIZ A;  4TJV A;  2O53 A;  2ZEF A;  4C9R A;  2POK A;  3KQX A;  5K8P A;  1NSA A;  2XEG A;  1TKJ A;  4R76 A;  4P4D A;  1FNO A;  2PJB A;  1EE3 P;  2PJ5 A;  4CDK A;  4YWY A;  2JBJ A;  5I4M A;  2IQ6 A;  5JGF A;  4C9E A;  3IEH A;  1Y0Y A;  2NSM A;  3SJX A;  4DUK A;  2BOA A; 
#chains in the Genus database with same CATH topology
 3RYO A;  4BIN A;  1YVO A;  5KTC A;  3TLZ A;  3T9Y A;  5KTA A;  2VZZ A;  4IK2 A;  2YJV A;  3IIB A;  2VZY A;  3H8F A;  2EUI A;  4EFD A;  2Q43 A;  1K4J A;  1I21 A;  1LRZ A;  4CAW A;  2JEV A;  2PJ3 A;  4NCZ A;  4R3L A;  1CS0 B;  4UA3 A;  2Z0Z A;  3SI2 A;  1XJO A;  3B3S A;  1TKH A;  2PVV A;  3D2P A;  4I49 A;  4P10 A;  3VWD A;  3PB4 X;  4FAI A;  2EZB A;  5FD8 A;  3CDX A;  4XPD C;  3T8W A;  1IOF A;  4A94 A;  5CNP A;  5C82 A;  1J3L A;  4MFL A;  4Y49 B;  4PQA A;  4KVM E;  4UBR A;  4UIA A;  4NGS A;  4HPS A;  3S6G A;  3FEC A;  3EFA A;  1GHE A;  4NEX A;  2CNM A;  1S7N A;  4L89 A;  2JBK A;  5LRK A;  1VHS A;  2HC9 A;  3I3G A;  3K9U A;  5EBV A;  3S9L A;  4R6T A;  3D7G A;  1QQ9 A;  3H5Z A;  2I79 A;  1LFW A;  3VAR A;  3PZJ A;  2PJ0 A;  3DR6 A;  2PJ8 A;  3BJ7 A;  2P6F A;  3ZZI A;  2AFZ A;  4E0A A;  1NXJ A;  3FH4 A;  2DF5 A;  2AFO A;  3IO1 A;  2EWB A;  4B12 A;  4C84 A;  2IL4 A;  2B5G B;  4LQG A;  3DNS A;  3D4U A;  3KR4 A;  4H89 A;  4GS4 A;  2Q44 A;  4H2K A;  4Z65 A;  1V0C A;  2Q51 A;  4OID A;  2FM4 A;  2AFW A;  4OKO A;  3G8W A;  1I12 A;  3GKR A;  5AG4 A;  5JM6 A;  4R57 A;  1UWY A;  1MK4 A;  4YFJ A;  1TXR A;  4R9M A;  5AG6 A;  3WAB A;  2AUN A;  2J9A A;  4B13 A;  3CT9 A;  1OZP A;  4E8O A;  2HQY A;  3FRM A;  2B3U A;  3G3S A;  5G22 A;  4A31 A;  1KWM A;  4NGP A;  4NF1 A;  4NGM A;  3VH9 A;  2YNE A;  4R7M A;  4OC1 A;  2EK9 A;  2Q4V A;  2YND A;  3RBU A;  4AVA A;  4MXU A;  4XNH C;  2PJ9 A;  3B3V A;  2F8H A;  4ZY1 A;  3EZA A;  4H1H A;  5DS0 A;  1YW6 A;  4E5S A;  1XBU A;  1AUG A;  3IU1 A;  1YX0 A;  4J3G A;  3R96 A;  4EVY A;  4C8C A;  3I9S A;  2ZW6 A;  2G0B A;  2C6P A;  3V7Z A;  4MBU A;  4P4I A;  5JVL A;  5K99 A;  3WC6 A;  4P45 A;  4MHN A;  2ZW4 A;  3TLG B;  5LYI A;  2I00 A;  1IYL A;  2I3C A;  2F7V A;  4R87 A;  2CF4 A;  3RO0 A;  3NFZ A;  2HB6 A;  3C26 A;  4WWV A;  1ZLI A;  2HWG A;  1XOV A;  1ELM P;  3KL9 A;  4CYP A;  4F0Y A;  5LYF A;  5K8O A;  3D8P A;  2PJ2 A;  4BD9 A;  2GRE A;  4A38 A;  2OZG A;  4GXH A;  2QJ8 A;  4JXQ A;  4U5Y A;  4AVC A;  5CBM A;  4OIW A;  2ZEG A;  2B4D A;  4PXC A;  3TE4 A;  2O4H A;  4TNU A;  3TT2 A;  4AG9 A;  4OME A;  3TO6 A;  3PEI A;  5D29 A;  4ZX9 A;  3D66 A;  4DJL A;  4A39 A;  3K2K A;  2V77 A;  3HLP A;  2PIY A;  3LD2 A;  2FS5 A;  1XF1 A;  4OAD A;  4FBE A;  4MI1 A;  2BO9 A;  4PXB A;  4INJ A;  3C8O A;  2JDD A;  3NH8 A;  4YGO A;  4FD5 A;  1Y9K A;  1QSM A;  3V8I A;  1CPS A;  4AXV A;  2PJA A;  4CAX A;  2D4O A;  1R43 A;  3QNV A;  3W6X A;  4J0N A;  3D7F A;  5F9M A;  3T05 A;  2RC4 A;  3MN8 A;  4OC5 A;  3I74 A;  1P4N A;  1ELL P;  3IFE A;  1LCP A;  1ON0 A;  1B6B A;  2Z3O A;  3P2F A;  2D0P A;  3ZJ0 A;  4YN3 A;  3IGR A;  1YLE A;  2VI7 A;  3EY5 A;  5F5X A;  5LRG A;  4QB9 A;  4UFV A;  1QSR A;  1YSJ A;  4YU9 A;  2QML A;  3S6F A;  4OP4 A;  2PR1 A;  4M6G A;  1BPM A;  2XEJ A;  1PUA A;  4PK2 A;  5EMI A;  2FSR A;  2NYQ A;  2HV2 A;  1X12 A;  2PRB A;  3B8G A;  4W9Y A;  2E28 A;  2J8R A;  1VBH A;  4A95 A;  2Y0M A;  3ISZ A;  2FIA A;  3D68 A;  4NGN A;  4RI1 A;  4EME A;  8CPA A;  1ZG7 A;  2PE3 A;  4QVT A;  1EZB A;  2Z10 A;  4MHZ A;  5D8N A;  2GLJ A;  1M4L A;  3CXS A;  3DLJ A;  4GM5 A;  1ARM A;  1B87 A;  1S7L A;  5A28 A;  2B4B A;  3K9T A;  2ZOF A;  1XRY A;  2FVG A;  2Q4Z A;  2AFU A;  4F9V A;  1TIQ A;  1Y7R A;  2G9D A;  4IUS A;  4PXE A;  1QST A;  2Z3P A;  4CYO A;  1XMT A;  1SQH A;  1TKF A;  2ZEH A;  4OC2 A;  5K8M A;  4JZ0 A;  1XMB A;  3V38 A;  4HNW B;  3EIF A;  1JQG A;  2CXA A;  4G1P A;  1MJB A;  3P2H A;  3TLY A;  2KCW A;  5DWN A;  3IJ3 A;  4UF4 A;  2QVP A;  3N7Z A;  1JDB C;  1VIX A;  4X2T A;  5C88 A;  2HRO A;  4HNY B;  5F48 A;  2B0A A;  3QB8 A;  1ZLH A;  5HVF A;  4CGM A;  1LOK A;  3WT4 A;  2CIJ A;  2FIW A;  4C8P A;  4MFQ A;  1BLL E;  2REE A;  4CAE A;  2WYR A;  2F5I A;  2EO8 A;  2ZEL A;  4KSA A;  3TOA A;  4EWT A;  3B3C A;  3CXQ A;  1ZL0 A;  1HDQ A;  4NGQ A;  5FVJ A;  3R1K A;  5DWM A;  1S3Z A;  3FNC A;  3TCV A;  3GUX A;  3SI1 A;  4P4B A;  5IX3 A;  2C5Q A;  2YJT A;  2C6G A;  4F6A A;  1DE4 C;  1PU9 A;  4ZY0 A;  1OBR A;  4MHP A;  4JLY A;  3BLN A;  3IWG A;  4COG A;  3FMC A;  4UEF A;  1NE9 A;  1M4G A;  1BAV A;  2DEA A;  3QAH A;  3U1B A;  4MFP A;  3TLC A;  2YNC C;  4C85 A;  4ZYQ A;  4RS2 A;  1CBX A;  3WC5 A;  1IID A;  1LAM A;  3D7H A;  2QIR A;  2GIV A;  1DIK A;  5JH9 A;  4UCM A;  4ORF A;  2G3T A;  4IIY A;  4C7I A;  2C1C A;  5HXD A;  2MP0 A;  4C86 A;  4CDJ A;  1XIX A;  3MRU A;  4ONW A;  5AGE A;  1CX8 A;  2G3A A;  3KRV A;  3L2N A;  4M8D A;  3W6S A;  1QSN A;  4KOX A;  4CGN A;  2FL4 A;  3FBU A;  4JD6 A;  3SJG A;  1TF9 A;  4UWJ A;  1Q5X A;  1CJW A;  1NMT A;  2VXK A;  4KVO E;  4CGL A;  4KLV A;  1IOI A;  4CYN A;  3T5M A;  4MFZ A;  4M85 A;  2IMO A;  3B2Y A;  3HUV A;  3KQZ A;  5LRJ A;  4A30 A;  4DNC A;  1Z4E A;  3KAS A;  2PJ7 A;  4KOS A;  1ZRS A;  4C2Y A;  5ELY A;  2P6G A;  1Y9W A;  2OR4 A;  1KUX A;  2Z3L A;  1YVK A;  1Z8W A;  3TTH A;  4LUA A;  3S6K A;  3FEE A;  4MMO A;  4PPZ A;  2Z3N A;  4U9Z A;  4P4F A;  4NSQ A;  3IC1 A;  4MHD A;  4MY3 A;  3KHX A;  3JUW A;  2AUM A;  2YGW A;  1CP6 A;  4F8Z A;  3FVL A;  4KUB A;  3PRT A;  2JDC A;  4KSI A;  2CTC A;  3IU2 A;  4ZI6 A;  4CYQ A;  4A37 A;  2AFX A;  2FXF A;  1Z8L A;  4TJX A;  2RB7 A;  1VKC A;  4CRZ B;  4K3N A;  3W91 A;  4MCQ A;  4COB A;  3NOJ A;  2PJC A;  1VHO A;  2EK8 A;  4F0X A;  1BPN A;  2O28 A;  3PB9 X;  4CZ1 A;  1YQE A;  1Q2C A;  3A9L A;  1CP7 A;  3NA6 A;  2PQ8 A;  1WK4 A;  3NH4 A;  1JDE A;  1KUV A;  3GB0 A;  3KGQ A;  5CPA A;  4CPA A;  3KKW A;  2AJ6 A;  2VL1 A;  2DXQ A;  4DYO A;  2DPT A;  5AG7 A;  5HVG A;  1Z9U A;  2ZXV A;  3B7I A;  5J8C A;  4ZGY B;  1CE8 B;  4CO9 A;  1Q2Y A;  2WZN A;  1YGH A;  4C8A A;  4Y49 C;  4C8F A;  3FB3 A;  2PJ6 A;  3KZW A;  1Z8T A;  4L8A A;  3EZE A;  5F46 A;  1C3O B;  2RFH A;  4NGT A;  3PB6 X;  2REF A;  1NSL A;  2P6E A;  4EYS A;  2PJ1 A;  1Q2D A;  5J1Q A;  2J8N A;  2ZEE A;  4IF5 A;  1Q7L A;  3GY9 A;  4FD4 A;  4NXY A;  3D3S A;  2QEC A;  2OOT A;  2B58 A;  5HMN A;  1BO4 A;  4R3K A;  2ZOG A;  1KZF A;  3RZA A;  3ICU A;  3TO7 A;  1YME A;  2ZEM A;  3LMS A;  3PB7 X;  2FCK A;  3SXN A;  5IV0 A;  4E2A A;  3T0T A;  5A27 A;  3B3W A;  1FT7 A;  1ZG8 A;  4QC6 A;  2X7B A;  3TO9 A;  2R98 A;  4M6H A;  4QUS A;  3BI1 A;  1I1D A;  2Q04 A;  4XPD B;  4B5O A;  3CPA A;  2GU2 A;  4UIB A;  3QAY A;  3G23 A;  4C2X A;  1F2O A;  2CTB A;  3LOD A;  5H86 A;  2HI6 A;  4O23 A;  4KNG E;  2NMT A;  1Z4R A;  6CPA A;  2CNT A;  4RUH A;  3OWC A;  2IJZ A;  1U6M A;  2PR8 A;  2Q4Y A;  2Z3K A;  1ZG9 A;  2ZW7 A;  4Q38 A;  4KZT A;  4UEZ A;  4YRH A;  1XEB A;  5GCN A;  2OH1 A;  1J4J A;  4X8I A;  3PGP A;  4MCS A;  2OU2 A;  2WSA A;  1IYK A;  1M6V B;  2OB0 A;  3TLB A;  3GJZ A;  1CPX A;  4PSX A;  4OC3 A;  2AE6 A;  2GP4 A;  1M4D A;  2ZEP A;  3VTA A;  4ZY2 A;  4MI4 A;  3NE7 A;  4ZX8 A;  3R95 A;  3R9G A;  4KOR A;  2QYV A;  3BJ8 A;  3FX6 A;  4Q7A A;  4UCN A;  3TX8 A;  4KVX A;  5K8N A;  2FE7 A;  4C2Z A;  1Y0R A;  1F2P A;  2XEI A;  4CS0 B;  2FT0 A;  4UFX A;  1LAN A;  4B6Z A;  2PRQ A;  4C9V A;  2XEF A;  1AYE A;  2GLF A;  4CGO A;  3D7D A;  3H8E A;  2V8H A;  5EC4 A;  4AG7 A;  2OLS A;  3UY5 A;  5J8F A;  2WPW A;  1RXT A;  4JWP A;  4NJR A;  3SHP A;  1HEE A;  2GE3 A;  5E96 A;  2PDO A;  2EBJ A;  5LYL A;  1XE4 A;  2CNS A;  4JXR A;  3EO4 A;  4U9Y A;  3EXN A;  1S60 A;  4BBH A;  4C8T A;  4XNH B;  1A2Z A;  5THW A;  3VAT A;  1P0H A;  1A9X B;  2ABZ A;  5JPH A;  2D4P A;  3S9N A;  5F47 A;  1YLO A;  3VWE A;  4HKF A;  3K4I A;  2B4D B;  1R61 A;  4MRI A;  2R82 A;  1XFO A;  2C27 A;  3GLJ A;  3NH5 A;  4PSW A;  4X3R A;  1S7K A;  5IR2 A;  5HVH A;  4ONU A;  5AG5 A;  1EZA A;  1ZYM A;  1S5K A;  3DDD A;  4M6I A;  4MCP A;  4PXD A;  2AFS A;  3N5F A;  3TLE A;  4P6Y A;  5HH1 A;  3WC7 A;  1JWQ A;  3DGV A;  3R9F A;  3PBB A;  5F49 A;  4MJ8 A;  1RO5 A;  2PVW A;  1VHE A;  3JRU A;  4LX9 A;  3TOB A;  4CAV A;  1BXR B;  1WVM A;  3TYX A;  4KSF A;  2A4N A;  4H6U A;  3EC4 A;  4OLL A;  5JQ4 A;  3S9M A;  1TF8 A;  3BI0 A;  4HNX B;  4P4J A;  1Y7E A;  2VEZ A;  2H5M A;  2YNC A;  4P44 A;  1WWZ A;  2OZH A;  3TC8 A;  4B14 A;  1KBL A;  4UFW A;  2ATR A;  1UFH A;  4B5P A;  1KUY A;  1GGO A;  2PSW A;  3IWE A;  4P4E A;  3CPX A;  2X0S A;  2B3V A;  4RN7 A;  5IB9 A;  5F09 A;  1FY7 A;  1Z2L A;  3H8G A;  4NFR A;  4F9U A;  4C8U A;  4C9A A;  1R3N A;  3SR3 A;  2ZEO A;  1MJ9 A;  1V6C A;  4NGR A;  3B3T A;  3I6S A;  2HUZ A;  5G1Z A;  5ISV A;  1NBW A;  4KOY A;  1AMP A;  3S6H A;  1PCA A;  2R1I A;  2GFQ A;  3PB8 X;  4FUU A;  2JLM A;  1RTQ A;  2ODF A;  2Q0Y A;  3B35 A;  4A2Z A;  2BSW A;  1YR0 A;  2OZU A;  3PFO A;  3WR7 A;  3SJF A;  2R8V A;  1H8L A;  4OAE A;  3SI0 A;  2JEW A;  3IWW A;  4C7H A;  4E94 A;  2R7H A;  4H6Z A;  3ISX A;  2PCU A;  4FD7 A;  4X5K A;  1ZO0 A;  2GAN A;  4TWE A;  3EZB A;  4BMH A;  1IGB A;  4C9U A;  7CPA A;  5JYB A;  4MCR A;  3RNZ A;  3TFY A;  4IAV A;  1KC7 A;  2ANP A;  1IY7 A;  2BEI A;  5H84 A;  1HDU A;  2V8G A;  4CGP A;  1CG2 A;  2ARH A;  3FJU A;  3D2M A;  3GIU A;  2V8D A;  5G20 A;  4B11 A;  2Q7S A;  1DTD A;  4KS9 A;  1M1D A;  2DPS A;  3LWU A;  3DSB A;  3F5B A;  1YW4 A;  4Q36 A;  1F57 A;  3JVN A;  4KUA A;  3RAM A;  3KHZ A;  4R8F A;  5BWA B;  3F8K A;  4A32 A;  3PBE A;  4FWU A;  1QMU A;  4NJQ A;  3JTK A;  4UEE A;  2C6C A;  5G21 A;  1N71 A;  4UCP A;  1S7F A;  4ZBG A;  3NE8 A;  2ZPA A;  3SJE A;  4CRY B;  4LQ6 A;  4OC4 A;  3MGD A;  2EZC A;  1YRE A;  2J8M A;  3FED A;  4IIX A;  3TLA A;  2PJ4 A;  5IB0 A;  4M3S A;  3H4Q A;  1YK3 A;  4MJX A;  1M4I A;  3FIX A;  4XPL A;  4II9 A;  3PFE A;  2ZW5 A;  4KOW A;  1CM0 A;  4XPK A;  3LAC A;  5LYD A;  1Y9Z A;  4C99 A;  1T36 B;  2PCN A;  4PK3 A;  3KI9 A;  2ZEN A;  2DIK A;  5I0C A;  3SXO A;  4A33 A;  2D0O A;  3FF3 A;  2ZED A;  2WPX A;  3GYA A;  4KOU A;  4IHM A;  3T90 A;  2AFM A;  2CY2 A;  3D67 A;  4MY0 A;  4MFK A;  1VBG A;  2EVN A;  1IU8 A;  1VGY A;  1Z8X A;  4CAF A;  2EZA A;  1MJA A;  4PV6 A;  4KOT A;  1Z5R A;  2BL1 A;  4AVB A;  1C30 B;  2Z3M A;  3BHX A;  5F1Y A;  4OC0 A;  3BXM A;  2B5G A;  2V8V A;  4WJB A;  2BCO A;  4B5P B;  1IB1 E;  3T07 A;  1PYT B;  4FD6 A;  3FXT A;  1M44 A;  1LAP A;  4MFJ A;  4JVO A;  2K5T A;  3CZX A;  4JYW A;  3I1U A;  4KOV A;  4MHY A;  1X10 A;  4B10 A;  4AB7 A;  1ARL A;  1GYT A;  3KR5 A;  2PIZ A;  4JJX A;  4TJV A;  2O53 A;  2ZEF A;  3PP9 A;  2Q7B A;  4C9R A;  2POK A;  4UWI A;  1QSO A;  1KEE B;  3KQX A;  2P0W A;  2VQY A;  4K30 A;  1R57 A;  3E0K A;  3CXP A;  1XF8 A;  1IIC A;  1NSA A;  5K8P A;  2XEG A;  1TKJ A;  2PC1 A;  3F0A A;  1BOB A;  4KLW A;  2VBQ A;  4R76 A;  4P4D A;  1FNO A;  2PJB A;  3DR8 A;  3FYN A;  1EE3 P;  3R9E A;  2PJ5 A;  2Z11 A;  3TLG A;  1VI4 A;  4CDK A;  4YWY A;  2JBJ A;  5I4M A;  2IQ6 A;  5JGF A;  4C9E A;  1L0C A;  2BUE A;  3IEH A;  1Y0Y A;  2NSM A;  4C68 A;  3SJX A;  4DUK A;  4QBJ A;  2BOA A;  2WUU A;  5KTD A; 
#chains in the Genus database with same CATH homology
 4IK2 A;  3IIB A;  3H8F A;  4EFD A;  2Q43 A;  2PJ3 A;  3SI2 A;  1XJO A;  3B3S A;  1TKH A;  2PVV A;  4P10 A;  4FAI A;  3PB4 X;  3CDX A;  3T8W A;  4A94 A;  4PQA A;  4UIA A;  4NGS A;  3FEC A;  2JBK A;  5LRK A;  2HC9 A;  3S9L A;  4R6T A;  3D7G A;  1QQ9 A;  1LFW A;  3VAR A;  2PJ0 A;  2PJ8 A;  2AFZ A;  3FH4 A;  3IO1 A;  2AFO A;  2EWB A;  4C84 A;  4LQG A;  3D4U A;  3KR4 A;  4H2K A;  4Z65 A;  4OID A;  2Q51 A;  2AFW A;  4OKO A;  5JM6 A;  1UWY A;  1TXR A;  3WAB A;  2J9A A;  3CT9 A;  1KWM A;  4NGP A;  4NGM A;  3VH9 A;  4R7M A;  4OC1 A;  2EK9 A;  3RBU A;  4MXU A;  2PJ9 A;  3B3V A;  2F8H A;  4ZY1 A;  5DS0 A;  1YW6 A;  1XBU A;  4C8C A;  2C6P A;  3V7Z A;  4P4I A;  3WC6 A;  4P45 A;  4MHN A;  5LYI A;  2I3C A;  2F7V A;  2CF4 A;  3NFZ A;  2HB6 A;  4WWV A;  1ZLI A;  1ELM P;  3KL9 A;  5LYF A;  5K8O A;  2PJ2 A;  4BD9 A;  2GRE A;  4A38 A;  2QJ8 A;  5CBM A;  4OIW A;  2ZEG A;  4PXC A;  2O4H A;  4TNU A;  4OME A;  3PEI A;  5D29 A;  4ZX9 A;  3D66 A;  4DJL A;  4A39 A;  3K2K A;  2V77 A;  3HLP A;  2PIY A;  1XF1 A;  4FBE A;  2BO9 A;  4PXB A;  3NH8 A;  1CPS A;  4AXV A;  2PJA A;  1R43 A;  3QNV A;  3D7F A;  3MN8 A;  4OC5 A;  3I74 A;  1ELL P;  3IFE A;  1LCP A;  4YN3 A;  5LRG A;  1YSJ A;  4YU9 A;  4OP4 A;  2XEJ A;  1BPM A;  2NYQ A;  4W9Y A;  3ISZ A;  3D68 A;  4NGN A;  4EME A;  8CPA A;  1ZG7 A;  2PE3 A;  4MHZ A;  5D8N A;  2GLJ A;  1M4L A;  3DLJ A;  4GM5 A;  1ARM A;  3K9T A;  2ZOF A;  1XRY A;  2FVG A;  2Q4Z A;  2AFU A;  4F9V A;  2G9D A;  4PXE A;  1TKF A;  2ZEH A;  4OC2 A;  5K8M A;  4JZ0 A;  1XMB A;  3V38 A;  3EIF A;  1JQG A;  4G1P A;  3IJ3 A;  4UF4 A;  2QVP A;  1VIX A;  4X2T A;  1ZLH A;  5HVF A;  1LOK A;  3WT4 A;  2CIJ A;  4C8P A;  1BLL E;  2WYR A;  2ZEL A;  4EWT A;  3B3C A;  1HDQ A;  4NGQ A;  3GUX A;  3SI1 A;  4P4B A;  2C5Q A;  2C6G A;  1DE4 C;  4ZY0 A;  1OBR A;  4MHP A;  3FMC A;  4UEF A;  1BAV A;  2DEA A;  4C85 A;  4ZYQ A;  1CBX A;  3WC5 A;  1LAM A;  3D7H A;  5JH9 A;  2C1C A;  5HXD A;  4C86 A;  4CDJ A;  3MRU A;  4ONW A;  1CX8 A;  3L2N A;  3SJG A;  1TF9 A;  2IMO A;  3B2Y A;  3HUV A;  3KQZ A;  5LRJ A;  3KAS A;  2PJ7 A;  5ELY A;  2OR4 A;  3FEE A;  4MMO A;  4PPZ A;  4P4F A;  3IC1 A;  3KHX A;  1CP6 A;  4F8Z A;  3FVL A;  3PRT A;  4KSI A;  2CTC A;  4ZI6 A;  4A37 A;  2AFX A;  1Z8L A;  4TJX A;  2RB7 A;  4K3N A;  4MCQ A;  2PJC A;  1VHO A;  2EK8 A;  1BPN A;  3PB9 X;  3NA6 A;  1CP7 A;  3NH4 A;  3KGQ A;  3GB0 A;  5CPA A;  4CPA A;  2VL1 A;  4DYO A;  5HVG A;  3B7I A;  2WZN A;  4C8A A;  4C8F A;  2PJ6 A;  3KZW A;  2RFH A;  4NGT A;  3PB6 X;  2PJ1 A;  5J1Q A;  2ZEE A;  1Q7L A;  2OOT A;  3ICU A;  2ZOG A;  3RZA A;  1YME A;  2ZEM A;  3LMS A;  3PB7 X;  3B3W A;  1FT7 A;  1ZG8 A;  3BI1 A;  3CPA A;  2GU2 A;  4UIB A;  1F2O A;  2CTB A;  4O23 A;  4KNG E;  6CPA A;  4RUH A;  2IJZ A;  4UEZ A;  4C8U A;  1ZG9 A;  4X8I A;  4MCS A;  1CPX A;  4OC3 A;  2GP4 A;  3VTA A;  2ZEP A;  4ZY2 A;  4ZX8 A;  2QYV A;  3FX6 A;  4Q7A A;  3TX8 A;  5K8N A;  1Y0R A;  1F2P A;  2XEI A;  1LAN A;  4B6Z A;  2PRQ A;  4C9V A;  2XEF A;  1AYE A;  2GLF A;  3D7D A;  3H8E A;  2V8H A;  4NJR A;  5LYL A;  1HEE A;  4C8T A;  5THW A;  2ABZ A;  3S9N A;  1YLO A;  4MRI A;  1XFO A;  3GLJ A;  3NH5 A;  4X3R A;  5IR2 A;  5HVH A;  4MCP A;  4PXD A;  2AFS A;  3N5F A;  4P6Y A;  3WC7 A;  3DGV A;  3PBB A;  3JRU A;  2PVW A;  1VHE A;  1WVM A;  3S9M A;  1TF8 A;  3BI0 A;  4P4J A;  1Y7E A;  3TC8 A;  4P44 A;  4P4E A;  3CPX A;  5IB9 A;  5F09 A;  3H8G A;  4NFR A;  1Z2L A;  4F9U A;  4C9A A;  1R3N A;  2ZEO A;  1V6C A;  4NGR A;  3B3T A;  3I6S A;  1AMP A;  1PCA A;  3PB8 X;  4FUU A;  1RTQ A;  3B35 A;  3PFO A;  3SJF A;  1H8L A;  3SI0 A;  2JEW A;  3IWW A;  3ISX A;  2PCU A;  4TWE A;  1IGB A;  4C9U A;  7CPA A;  4MCR A;  4IAV A;  2ANP A;  1IY7 A;  1HDU A;  2V8G A;  1CG2 A;  3FJU A;  2V8D A;  1DTD A;  3VAT A;  3LWU A;  1YW4 A;  1F57 A;  3RAM A;  3KHZ A;  4R8F A;  3PBE A;  4FWU A;  1QMU A;  4NJQ A;  4UEE A;  2C6C A;  3SJE A;  4OC4 A;  3FED A;  2PJ4 A;  3PFE A;  5LYD A;  1Y9Z A;  4C99 A;  3KI9 A;  2ZEN A;  3FF3 A;  2ZED A;  4IHM A;  2AFM A;  3D67 A;  1VGY A;  1Z5R A;  3BHX A;  4OC0 A;  3BXM A;  2V8V A;  4WJB A;  2BCO A;  1PYT B;  1LAP A;  4JYW A;  3I1U A;  4MHY A;  1ARL A;  1GYT A;  3KR5 A;  2PIZ A;  4TJV A;  2O53 A;  2ZEF A;  4C9R A;  2POK A;  3KQX A;  5K8P A;  1NSA A;  2XEG A;  1TKJ A;  4R76 A;  4P4D A;  1FNO A;  2PJB A;  1EE3 P;  2PJ5 A;  4CDK A;  4YWY A;  2JBJ A;  5I4M A;  2IQ6 A;  5JGF A;  4C9E A;  3IEH A;  1Y0Y A;  2NSM A;  3SJX A;  4DUK A;  2BOA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...