5IB9A

Crystal structure of aminopeptidase equipped with pad from aneurinibacillus sp. am-1
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
412
structure length
412
Chain Sequence
ADHQITKRTDAENMYNTIQFLSQAPRVAGSPEELKAVRYIEQQFKSYGYHVEVQPFQFEGYTAPSEVTLKIGTEKKEGEAFTYSPNSDVTAELVYVGLGTTADVAGKDLNGKIALIQRGNISFADKVRNAAKQGAKAVIIYNNTDGKLNGTLGGSDASFVAAVGITKQEGDALAANLRAGEKITATVKVAGAEVKTLTSHNVIATKKPDANKKNTNDIIIIGSHHDSVEKAPGANDDASGVAVTLELARVMSKLKTDTELRFITFGAEENGLIGSKKYAASLSEDEIKRTIGMFQLDMVGSKDAGDLIMYTIDGKKNRVTDLGAAASSRLSGVLPYGQEGRSDHESFHALGIPAALFIHAPVEPWYHTPNDTLDKISKEKLDNVADIVGSAVYQAARPGELVIEPIDYPRRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminopeptidase
publication title Crystal structure of aminopeptidase
rcsb
source organism Aneurinibacillus sp. am-1
molecule tags Hydrolase/hydrolase inhibitor
total genus 147
structure length 412
sequence length 412
ec nomenclature
pdb deposition date 2016-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 5ib9A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 5ib9A02
4OKOA 4C9RA 1LCPA 3K2KA 2PJ5A 3BHXA 4ZI6A 3RZAA 4F8ZA 1ELLP 1TF8A 3S9NA 3WT4A 4PXBA 3D7HA 4OC5A 3VATA 2F7VA 3SJGA 3B2YA 5CPAA 4C8FA 5LYDA 3T8WA 5LYIA 4RUHA 1EE3P 3LWUA 4MCQA 3H8FA 3GB0A 4MCSA 4C8TA 4UF4A 3D68A 1NSAA 4A94A 3FX6A 5I4MA 4ZYQA 4GM5A 4MHPA 4UIBA 3KHXA 3FH4A 4IAVA 1LOKA 1HEEA 3FJUA 4OIWA 1PYTB 4X8IA 4IK2A 4MCRA 3B3VA 2PJ9A 2IQ6A 3B3SA 1Z8LA 3PRTA 2BCOA 4MMOA 5D8NA 4R8FA 4NGNA 2IMOA 1TKHA 3D7GA 3GLJA 2ZEDA 2J9AA 5D29A 2NSMA 1ARLA 3PFOA 2QVPA 4X3RA 4WWVA 2XEGA 2PJ1A 1TF9A 1IY7A 2V8GA 2PE3A 3KR5A 2F8HA 1CPXA 1F2PA 4A37A 5K8MA 2Q43A 4C86A 3FEEA 3CT9A 1CP7A 2C6PA 1BAVA 2AFSA 1GYTA 4P10A 2QYVA 3S9MA 4NJQA 1ZLIA 4JZ0A 1IGBA 3N5FA 3VTAA 4C8PA 1ELMP 4ONWA 2AFUA 3NH8A 3L2NA 3PFEA 5LYFA 2GREA 4KSIA 3PB7X 4H2KA 3SI1A 3MRUA 2C6CA 3CDXA 1ZLHA 5ELYA 4KNGE 2RFHA 4DUKA 3PB9X 1FNOA 2OOTA 1DE4C 4NGSA 3NA6A 1XRYA 1CPSA 3IEHA 3FECA 2XEFA 4YN3A 3WC6A 4O23A 1DTDA 1Y7EA 3DGVA 1R43A 1YMEA 4OP4A 1XF1A 4EFDA 2QJ8A 2G9DA 2I3CA 4IHMA 5DS0A 1XFOA 4ZY2A 4C85A 2ZEHA 3B3CA 3KGQA 4MRIA 4TJVA 3FMCA 3FVLA 5K8OA 1VGYA 4TNUA 4OC0A 1XJOA 2PIYA 1LAMA 2VL1A 4OC4A 2ZOFA 3KL9A 2XEJA 4ZX8A 3BI1A 1CX8A 4LQGA 2HC9A 4UEZA 2WYRA 4P4BA 4A38A 4F9VA 7CPAA 2PJ2A 3ISZA 5K8NA 3B3WA 1Z5RA 4FBEA 3D7DA 2ABZA 3B7IA 3KHZA 4OC2A 1F2OA 2PVVA 4PQAA 3KI9A 3D66A 4MHYA 4G1PA 5CBMA 2NYQA 4CDJA 2JBKA 3I6SA 3WC7A 6CPAA 5HXDA 4FWUA 3BI0A 4NJRA 1AYEA 2PJ7A 4C9UA 1TXRA 3FF3A 4C84A 1YSJA 2ZEPA 4FUUA 4K3NA 2PJ6A 5LRKA 2AFZA 3K9TA 2V77A 4C8CA 2XEIA 5K8PA 3PB6X 2PJ3A 4NGMA 2PJ0A 4P4DA 1BLLE 3PB4X 4F9UA 3PEIA 2ZEFA 3ISXA 4P4IA 1FT7A 3I74A 2CIJA 2JBJA 2AFMA 2PJAA 4CDKA 5F09A 2ZEGA 4DYOA 3SJFA 3VH9A 2ZELA 4R7MA 2Q51A 1LANA 1Z2LA 1ZG8A 4UEEA 1RTQA 1ARMA 3LMSA 4UEFA 2GU2A 2PJBA 3H8EA 3VARA 1R3NA 3KQXA 3PB8X 4BD9A 3SI2A 1ZG7A 1CBXA 1UWYA 4NGPA 4W9YA 4ZY0A 4X2TA 1LAPA 1YLOA 2HB6A 3NH5A 3CPAA 4EMEA 4B6ZA 1QMUA 2PJCA 4Z65A 5JM6A 1VIXA 2ZOGA 3WABA 3IO1A 4WJBA 2O4HA 3DLJA 3TX8A 1JQGA 2AFWA 4P6YA 4PPZA 1F57A 5HVGA 2V8VA 2EK9A 3GUXA 3HUVA 2CF4A 1V6CA 2POKA 1VHOA 2PVWA 1Y0RA 2PCUA 1WVMA 1TKFA 4OMEA 4P4EA 2BOAA 3NH4A 4NGRA 3IIBA 1BPMA 5LYLA 4AXVA 4UIAA 4MCPA 2V8DA 2IJZA 4R76A 1AMPA 4P4FA 5J1QA 3EIFA 2ZEEA 3IC1A 3BXMA 4TWEA 2FVGA 3V7ZA 3RAMA 3S9LA 2ANPA 3D7FA 3FEDA 1OBRA 3KASA 4NGTA 4R6TA 8CPAA 3NFZA 5THWA 4DJLA 2AFXA 4C9EA 4OC1A 3CPXA 1XBUA 2ZEMA 2GLJA 1CG2A 2PJ8A 4FAIA 4EWTA 2C6GA 2JEWA 3B35A 1XMBA 3PBEA 3SJXA 3MN8A 2Q4ZA 3HLPA 4A39A 4MXUA 3D4UA 3H8GA 4JYWA 5HVFA 4C9AA 2OR4A 3KZWA 1ZG9A 3IFEA 4MHNA 2PIZA 3WC5A 1Y0YA 4ZY1A 2PJ4A 3PBBA 3SI0A 1TKJA 2ZEOA 1PCAA 5IB9A 2DEAA 3SJEA 2PRQA 3V38A 2RB7A 2WZNA 2O53A 4C8AA 1HDQA 4PXCA 3KQZA 2BO9A 4OIDA 2GLFA 2CTBA 1KWMA 4YU9A 4P4JA 5JH9A 2C1CA 2EK8A 2V8HA 3KR4A 1YW6A 4C9VA 5LRGA 3B3TA 4P44A 3RBUA 2ZENA 3TC8A 2CTCA 5HVHA 2AFOA 1Q7LA 1QQ9A 3I1UA 3JRUA 4NGQA 1CP6A 4C8UA 1Y9ZA 1LFWA 4PXDA 3D67A 3ICUA 1M4LA 3QNVA 1VHEA 1H8LA 1HDUA 4ZX9A 4PXEA 1YW4A 4TJXA 4Q7AA 4MHZA 3IJ3A 2EWBA 4CPAA 4NFRA 4C99A 5LRJA 1BPNA 3IWWA 5JGFA 4P45A 4YWYA 4OC3A
chains in the Genus database with same CATH superfamily
4MI1A 4OKOA 4C9RA 1LCPA 1A9XB 4CGNA 2B4DB 3K2KA 5JPHA 1MJAA 4C2XA 3GIUA 2R7HA 2G0BA 4U9ZA 1S7LA 4PK3A 2PJ5A 1K4JA 3BHXA 2GFQA 1LRZA 4ZI6A 2EZBA 3RZAA 4F8ZA 1ELLP 2BUEA 2JLMA 3NE8A 5G22A 4MFKA 1TF8A 3S9NA 4K30A 2YJVA 3WT4A 3JTKA 4CAWA 4PXBA 3D7HA 1Z4RA 3FB3A 4OC5A 5AG7A 2F7VA 3VATA 4CYPA 4F6AA 1XEBA 4KLWA 2AUNA 4LX9A 4MFZA 2I79A 3SJGA 5C88A 3BJ7A 3B2YA 5CPAA 1I12A 1VI4A 2OU2A 4C8FA 5LYDA 3T8WA 5LYIA 4RUHA 1EE3P 2KCWA 3F5BA 3LWUA 4MCQA 1Y9KA 4A32A 3H8FA 1U6MA 4KSFA 4UCNA 5CNPA 4B10A 1WK4A 2B5GA 2FIAA 2QECA 3GB0A 3RYOA 4MCSA 4C8TA 3FNCA 1V0CA 2PDOA 2WSAA 3D68A 4R87A 4UF4A 4XPLA 4AG7A 1NSAA 3NOJA 3T9YA 4A94A 3T0TA 3VWEA 3FX6A 1M4DA 3GY9A 4ZYQA 1YQEA 5I4MA 4GM5A 2WUUA 3D2PA 1KUYA 2B3VA 4MHPA 4UIBA 1VBGA 3KHXA 1MJ9A 2IL4A 4Y49C 2Z3MA 3FH4A 2O28A 2DF5A 4IAVA 4NXYA 5EMIA 3W6XA 1LOKA 4E2AA 4ZGYB 1IU8A 1HEEA 2ARHA 4KOTA 4YGOA 1XMTA 3FJUA 4MY0A 4OIWA 1BXRB 2VXKA 4E8OA 2HROA 1PYTB 4X8IA 4IK2A 4KSAA 3A9LA 4MCRA 3B3VA 2R82A 2NMTA 4FD5A 2K5TA 2J8NA 1R61A 2PJ9A 2WPWA 2GANA 2DIKA 1PUAA 2IQ6A 1OZPA 3B3SA 2QMLA 1Z8LA 2P0WA 2YNCA 3PRTA 5G20A 4MHDA 4U5YA 2BCOA 4MMOA 5D8NA 4KOWA 4R8FA 1IYKA 4UA3A 5K99A 1ZRSA 3TLGB 1IOFA 5IB0A 2C5QA 3T5MA 4NGNA 2REEA 4CAEA 4IUSA 3G3SA 4XPDC 2FE7A 2IMOA 1TKHA 3D7GA 1NSLA 3GLJA 4NEXA 4PV6A 4BMHA 2ZEDA 2J9AA 5D29A 4CGLA 5IX3A 4JLYA 3D2MA 2YJTA 2NSMA 5FVJA 3EFAA 1ARLA 3PFOA 2Z3OA 3R95A 4QBJA 2QVPA 3R1KA 4X3RA 4WWVA 1Q2YA 4AVBA 2XEGA 4KLVA 4CYQA 4KORA 1IICA 2PJ1A 1J3LA 2FM4A 3FIXA 3EZEA 1TF9A 1IY7A 2V8GA 2PE3A 5C82A 3CXQA 2Z10A 3KR5A 3PP9A 4LQ6A 4M3SA 4UCPA 2F8HA 4KOSA 1CPXA 1F2PA 2WPXA 3EC4A 4A37A 5K8MA 2Q43A 1Z4EA 2Y0MA 4XPKA 4MFQA 5A28A 4C86A 3FEEA 4A95A 4KS9A 3TLYA 2X0SA 3CT9A 1CP7A 2C6PA 1KUXA 1YVKA 3TO7A 4YFJA 1NXJA 1I1DA 1BAVA 5DWNA 1Y9WA 3SHPA 2AFSA 1JDEA 2F5IA 1GYTA 4P10A 3QAHA 4ONUA 2QYVA 4CS0B 2D4PA 3S9MA 4UFVA 5G21A 4NJQA 1ZLIA 3F8KA 4JZ0A 1IGBA 3N5FA 3VTAA 4C8PA 1ELMP 1YVOA 2H5MA 4ONWA 3PZJA 1NMTA 2FL4A 2AFUA 1S7FA 3NH8A 3QB8A 4HKFA 4JXQA 2P6GA 3L2NA 2Z3NA 1KUVA 3PFEA 2FSRA 5LYFA 2GREA 4KSIA 1ON0A 3D8PA 1MK4A 3W91A 3PB7X 1X10A 2HQYA 4H2KA 3FRMA 3SI1A 1XE4A 3H4QA 3TO9A 2R98A 1ZO0A 1J4JA 2C6CA 3MRUA 4OC3A 4UFWA 2PCNA 3CDXA 1ZLHA 5ELYA 4KNGE 2RFHA 2D4OA 2CXAA 2OH1A 3PB9X 2VZZA 4RS2A 4XNHB 3T90A 4DUKA 3T07A 3ZZIA 1FNOA 4NSQA 3E0KA 2OOTA 1DE4C 4NGSA 3NA6A 1XRYA 2FXFA 1CPSA 3IEHA 3FECA 2XEFA 1KZFA 4YN3A 2I00A 3WC6A 4B5PA 2B4BA 4O23A 4A33A 4HNYB 1YR0A 3EZAA 1DTDA 1Y7EA 3DGVA 1R43A 1EZBA 4ORFA 1YMEA 3LD2A 4OP4A 1XF1A 4XNHC 2B4DA 4CYNA 4EFDA 2QJ8A 3R9GA 2G9DA 2I3CA 4IHMA 1Z8TA 4CYOA 5DS0A 4L89A 4DNCA 2E28A 1XFOA 2EVNA 2ODFA 4ZY2A 4JVOA 4C85A 2ZEHA 3B3CA 3KGQA 4MRIA 4COGA 4TJVA 3G8WA 3JVNA 3FMCA 1QSNA 3FVLA 3MGDA 5F47A 4EYSA 5K8OA 1B87A 1IYLA 5AG5A 5JVLA 3C8OA 1VGYA 3TLAA 5JYBA 4TNUA 4OC0A 1XJOA 2PIYA 1LAMA 2VL1A 4NF1A 4OC4A 1S3ZA 2ZOFA 2D0OA 5AGEA 1EZAA 2Z3KA 4JXRA 4M6GA 3KL9A 4UCMA 4C2ZA 4IIYA 4CZ1A 3LACA 3NE7A 1I21A 2ZPAA 1M1DA 2GE3A 2XEJA 2OZHA 3FBUA 4FD6A 1DIKA 4ZX8A 2PR8A 1NE9A 3BJ8A 1CX8A 3BI1A 3P2FA 4LQGA 2HC9A 3TT2A 4UEZA 1YK3A 3D3SA 2WYRA 4P4BA 4A38A 5KTAA 1CE8B 3R9FA 4F9VA 7CPAA 2PJ2A 3CXSA 3ISZA 2B5GB 3B3WA 4C7HA 5K8NA 4HNXB 1Z5RA 2PRBA 3D7DA 4JWPA 4FBEA 5F5XA 1P4NA 1P0HA 2ABZA 3B7IA 4M6HA 4R3KA 4M8DA 3KHZA 4OC2A 1F2OA 2HUZA 2PVVA 4PQAA 3KI9A 2J8MA 3D66A 4KOUA 2Q4YA 3DR6A 5DWMA 4MHYA 3IGRA 5G1ZA 4G1PA 4OLLA 5CBMA 1AUGA 2NYQA 4CDJA 4A31A 2EBJA 2JBKA 3I6SA 4A30A 3OWCA 3WC7A 6CPAA 5HXDA 4FWUA 4C68A 4IF5A 1QSOA 3BI0A 3DR8A 4NJRA 4PSXA 4CO9A 1AYEA 2PJ7A 4M6IA 1IIDA 4AB7A 1TXRA 3FF3A 4C9UA 4C84A 4UWJA 1YSJA 2ZEPA 4FUUA 4K3NA 2G3TA 5F49A 2PJ6A 4J0NA 3TTHA 5LRKA 3TOBA 4EVYA 2AFZA 1NBWA 3K9TA 2V77A 5IR2A 3TLEA 4C8CA 2XEIA 5K8PA 3BLNA 3PB6X 2PJ3A 4NGMA 2PJ0A 4MY3A 4P4DA 3S6GA 5FD8A 1BLLE 3PB4X 2FIWA 4F9UA 3PEIA 2ZEFA 4GXHA 2AE6A 3ISXA 4KOYA 4MJ8A 4OAEA 3P2HA 4P4IA 1FT7A 3KRVA 3I74A 1BOBA 2VZYA 4PK2A 2CIJA 2JBJA 2AFMA 2GP4A 2HI6A 1QSTA 1TIQA 4COBA 2GIVA 3B8GA 2PJAA 4LUAA 1KBLA 4CDKA 3IWGA 4UWIA 5F09A 2ZEGA 4DYOA 2PSWA 3SJFA 3K4IA 3VH9A 2ZELA 4KVOE 4A2ZA 4MI4A 1S7KA 4R7MA 4R9MA 4INJA 2Q51A 1LANA 2A4NA 4H89A 1JWQA 4MFPA 1Z2LA 1ZG8A 5J8FA 1WWZA 4UEEA 1RTQA 1ARMA 3LMSA 4QUSA 4C7IA 4UEFA 4CGOA 2CY2A 1M4IA 2GU2A 2PJBA 3DSBA 3H8EA 2DPTA 3VARA 4B12A 1R3NA 1UFHA 3VWDA 3KQXA 4CAXA 1XIXA 2FS5A 3PB8X 4BD9A 2OLSA 4QC6A 3SI2A 2OZGA 5ISVA 1ZG7A 1CJWA 5E96A 2JDCA 2FT0A 1YLEA 1CBXA 1UWYA 4NGPA 1CS0B 4W9YA 4ZY0A 4X2TA 2RC4A 3WR7A 1A2ZA 1LAPA 2Q44A 2HWGA 1GHEA 2X7BA 1YLOA 2HB6A 2HV2A 3NH5A 3CPAA 5F9MA 4EMEA 4B6ZA 3TFYA 1QMUA 2PJCA 4Z65A 4H1HA 4BBHA 5JM6A 1VIXA 2ZOGA 4J3GA 3R9EA 3WABA 3IO1A 1N71A 5A27A 1PU9A 4WJBA 3V8IA 2O4HA 3DLJA 4KVXA 4M85A 3RNZA 3TX8A 1JQGA 3EY5A 4B11A 2AFWA 2CNMA 1RXTA 2OZUA 3CXPA 4P6YA 1F57A 2Q04A 4PPZA 3S6KA 2PC1A 5HVGA 3C26A 3TCVA 1L0CA 4JJXA 4MBUA 4B13A 2V8VA 2CNTA 2P6EA 3TOAA 3IWEA 2EK9A 3GUXA 3HUVA 2CF4A 1V6CA 2B58A 2POKA 1VHOA 5EC4A 2PVWA 4C2YA 1Y0RA 3T05A 2PCUA 1WVMA 1TKFA 4OMEA 1KC7A 1Q2CA 4P4EA 2BOAA 3NH4A 4NGRA 1VHSA 3IIBA 2D0PA 2EZCA 1BPMA 3PGPA 5LYLA 3R96A 4AXVA 1ZL0A 2Q0YA 1Z9UA 4UIAA 4B5OA 4E0AA 4MCPA 4MJXA 4UFXA 1X12A 2V8DA 4CAFA 2C27A 2IJZA 4H6ZA 4R76A 4AVCA 4CRZB 1AMPA 3TYXA 4P4FA 5J1QA 3EIFA 4E5SA 4E94A 2ZEEA 1Y7RA 2ZW4A 3IC1A 3BXMA 2ZW7A 1S7NA 5H84A 4R3LA 4TWEA 2FVGA 3EO4A 3SXNA 3V7ZA 2FCKA 3RAMA 3S9LA 3TLCA 2ANPA 2OB0A 3D7FA 4ZBGA 3FEDA 1OBRA 1MJBA 1QSMA 2B3UA 2PQ8A 4Q36A 3KASA 4HPSA 3UY5A 4NGTA 4R6TA 1Q2DA 3W6SA 4MFJA 5GCNA 3G23A 8CPAA 5KTDA 1B6BA 3NFZA 3TO6A 5THWA 4DJLA 4JD6A 4PSWA 2AFXA 5AG4A 4C9EA 4OC1A 4Y49B 4L8AA 4F0YA 2Z3PA 3CPXA 1XBUA 2ZEMA 2GLJA 1CG2A 2PJ8A 1R57A 4FAIA 4EWTA 2AJ6A 3TLZA 1T36B 3IU2A 2C6GA 2JEWA 3B35A 1XMBA 3I3GA 3N7ZA 3F0AA 3PBEA 2B0AA 4CGMA 3SJXA 1KEEB 2R8VA 2Q7BA 3MN8A 1C3OB 2Q4ZA 3HLPA 1Q5XA 2R1IA 2ZW6A 4A39A 5BWAB 4MXUA 3D4UA 3H8GA 2DXQA 4JYWA 1S5KA 5HVFA 2OR4A 4C9AA 5AG6A 4HNWB 2Z0ZA 4AG9A 1RO5A 1YREA 3KZWA 1M4GA 1ZG9A 3IFEA 4MHNA 5F48A 2EUIA 2AUMA 1Z8XA 2PIZA 1GGOA 4UBRA 3WC5A 1Y0YA 3TLGA 4ZY1A 2Q4VA 4XPDB 4BINA 4KUBA 2PJ4A 2BEIA 2YGWA 3PBBA 3SI0A 1TKJA 2ZEOA 4CRYB 5JQ4A 1PCAA 1XF8A 5IB9A 2DEAA 3DNSA 2PRQA 4FD4A 4RI1A 1FY7A 2RB7A 2WZNA 3SJEA 4KOVA 1YX0A 2ATRA 4NCZA 3V38A 4CGPA 2PR1A 2O53A 2Q7SA 4C8AA 4F0XA 1HDQA 4YRHA 4B14A 1CM0A 2ZW5A 2JDDA 2YNCC 2ZXVA 4PXCA 3KQZA 5F46A 4GS4A 2BO9A 4OIDA 3S6HA 2EZAA 2GLFA 2CTBA 1KWMA 4YU9A 4P4JA 5JH9A 2C1CA 2EK8A 4U9YA 1S60A 2V8HA 1YW6A 3KR4A 2BSWA 4FD7A 4OADA 4C9VA 4MFLA 5LRGA 1VBHA 3B3TA 4QB9A 4P44A 1SQHA 2YNEA 4Q38A 3LODA 3SXOA 5IV0A 4KOXA 3RBUA 2VEZA 2MP0A 2ZENA 4KZTA 5H86A 3TC8A 1M44A 4II9A 2CTCA 5HVHA 3I9SA 2AFOA 1Q7LA 1XOVA 1QQ9A 3I1UA 4IIXA 4R57A 3ZJ0A 4CAVA 1M6VB 3CZXA 3JRUA 4NGQA 3IU1A 3JUWA 4QVTA 3GKRA 3S6FA 1CP6A 2Z3LA 1C30B 3GJZA 2G3AA 2JEVA 5F1YA 4C8UA 2CNSA 1Y9ZA 1LFWA 4KVME 3D67A 4PXDA 3ICUA 3TLBA 1M4LA 5EBVA 5KTCA 3FYNA 3QNVA 2Z11A 3EZBA 1VHEA 5HH1A 3RO0A 3KKWA 5HMNA 4AVAA 5J8CA 3SR3A 3U1BA 4X5KA 1ZYMA 1BO4A 1H8LA 1HDUA 1YGHA 2P6FA 3EXNA 3H5ZA 4ZX9A 4PXEA 3TE4A 4I49A 2QIRA 2REFA 3FXTA 1YW4A 4KUAA 1QSRA 4Q7AA 5I0CA 4TJXA 2J8RA 2DPSA 4H6UA 4MHZA 1Z8WA 4RN7A 3IJ3A 1IB1E 2EWBA 2YNDA 4CPAA 4B5PB 2EO8A 2VQYA 4NFRA 4C99A 3K9UA 5LRJA 1IOIA 1BPNA 1VKCA 2VI7A 3GYAA 3IWWA 4P45A 4YWYA 5JGFA 1JDBC 3DDDA 2BL1A 3QAYA 2VBQA
chains in the Genus database with same CATH topology
4OKOA 4C9RA 1LCPA 3K2KA 2PJ5A 3BHXA 4ZI6A 3RZAA 4F8ZA 1ELLP 1TF8A 3S9NA 3WT4A 4PXBA 3D7HA 4OC5A 3VATA 2F7VA 3SJGA 3B2YA 5CPAA 4C8FA 5LYDA 3T8WA 5LYIA 4RUHA 1EE3P 3LWUA 4MCQA 3H8FA 3GB0A 4MCSA 4C8TA 4UF4A 3D68A 1NSAA 4A94A 3FX6A 5I4MA 4ZYQA 4GM5A 4MHPA 4UIBA 3KHXA 3FH4A 4IAVA 1LOKA 1HEEA 3FJUA 4OIWA 1PYTB 4X8IA 4IK2A 4MCRA 3B3VA 2PJ9A 2IQ6A 3B3SA 1Z8LA 3PRTA 2BCOA 4MMOA 5D8NA 4R8FA 2C5QA 4NGNA 2IMOA 1TKHA 3D7GA 3GLJA 2ZEDA 2J9AA 5D29A 2NSMA 1ARLA 3PFOA 2QVPA 4X3RA 4WWVA 2XEGA 2PJ1A 1TF9A 1IY7A 2V8GA 2PE3A 3KR5A 2F8HA 1CPXA 1F2PA 4A37A 5K8MA 2Q43A 4C86A 3FEEA 3CT9A 1CP7A 2C6PA 1BAVA 2AFSA 1GYTA 4P10A 2QYVA 3S9MA 4NJQA 1ZLIA 4JZ0A 1IGBA 3N5FA 3VTAA 4C8PA 1ELMP 4ONWA 2AFUA 3NH8A 3L2NA 3PFEA 5LYFA 2GREA 4KSIA 3PB7X 4H2KA 3SI1A 3MRUA 2C6CA 3CDXA 1ZLHA 5ELYA 4KNGE 2RFHA 4DUKA 3PB9X 1FNOA 2OOTA 1DE4C 4NGSA 3NA6A 1XRYA 1CPSA 3IEHA 3FECA 2XEFA 4YN3A 3WC6A 4O23A 1DTDA 1Y7EA 3DGVA 1R43A 1YMEA 4OP4A 1XF1A 4EFDA 2QJ8A 2G9DA 2I3CA 4IHMA 5DS0A 1XFOA 4ZY2A 4C85A 2ZEHA 3B3CA 3KGQA 4MRIA 4TJVA 3FMCA 3FVLA 5K8OA 1VGYA 4TNUA 4OC0A 1XJOA 2PIYA 1LAMA 2VL1A 4OC4A 2ZOFA 3KL9A 2XEJA 4ZX8A 3BI1A 1CX8A 4LQGA 2HC9A 4UEZA 2WYRA 4P4BA 4A38A 4F9VA 7CPAA 2PJ2A 3ISZA 5K8NA 3B3WA 1Z5RA 4FBEA 3D7DA 2ABZA 3B7IA 3KHZA 4OC2A 1F2OA 2PVVA 4PQAA 3KI9A 3D66A 4MHYA 4G1PA 5CBMA 2NYQA 4CDJA 2JBKA 3I6SA 3WC7A 6CPAA 5HXDA 4FWUA 3BI0A 4NJRA 1AYEA 2PJ7A 4C9UA 1TXRA 3FF3A 4C84A 1YSJA 2ZEPA 4FUUA 4K3NA 2PJ6A 5LRKA 2AFZA 5IR2A 3K9TA 2V77A 4C8CA 2XEIA 5K8PA 3PB6X 2PJ3A 4NGMA 2PJ0A 4P4DA 1BLLE 3PB4X 4F9UA 3PEIA 2ZEFA 3ISXA 4P4IA 1FT7A 3I74A 2CIJA 2JBJA 2AFMA 2GP4A 2PJAA 4CDKA 5F09A 2ZEGA 4DYOA 3SJFA 3VH9A 2ZELA 4R7MA 2Q51A 1LANA 1Z2LA 1ZG8A 4UEEA 1RTQA 1ARMA 3LMSA 4UEFA 2GU2A 2PJBA 3H8EA 3VARA 1R3NA 3KQXA 3PB8X 4BD9A 3SI2A 1ZG7A 1CBXA 1UWYA 4NGPA 4W9YA 4ZY0A 4X2TA 1LAPA 1YLOA 2HB6A 3NH5A 3CPAA 4EMEA 4B6ZA 1QMUA 2PJCA 4Z65A 5JM6A 1VIXA 2ZOGA 3WABA 3IO1A 4WJBA 2O4HA 3DLJA 3TX8A 1JQGA 2AFWA 4P6YA 4PPZA 1F57A 5HVGA 2V8VA 2EK9A 3GUXA 3HUVA 2CF4A 1V6CA 2POKA 1VHOA 2PVWA 1Y0RA 2PCUA 1WVMA 1TKFA 4OMEA 4P4EA 2BOAA 3NH4A 4NGRA 3IIBA 1BPMA 5LYLA 4AXVA 4UIAA 4MCPA 2V8DA 2IJZA 4R76A 1AMPA 4P4FA 5J1QA 3EIFA 2ZEEA 3IC1A 3BXMA 4TWEA 2FVGA 3V7ZA 3RAMA 3S9LA 2ANPA 3D7FA 3FEDA 1OBRA 3KASA 4NGTA 4R6TA 8CPAA 3NFZA 5THWA 4DJLA 2AFXA 4C9EA 4OC1A 3CPXA 1XBUA 2ZEMA 2GLJA 1CG2A 2PJ8A 4FAIA 4EWTA 2C6GA 2JEWA 3B35A 1XMBA 3PBEA 3SJXA 3MN8A 2Q4ZA 3HLPA 4A39A 4MXUA 3D4UA 3H8GA 4JYWA 5HVFA 4C9AA 2OR4A 3KZWA 1ZG9A 3IFEA 4MHNA 2PIZA 3WC5A 1Y0YA 4ZY1A 2PJ4A 3PBBA 3SI0A 1TKJA 2ZEOA 1PCAA 5IB9A 2DEAA 3SJEA 2PRQA 3V38A 2RB7A 2WZNA 2O53A 4C8AA 1HDQA 4PXCA 3KQZA 2BO9A 4OIDA 2GLFA 2CTBA 1KWMA 4YU9A 4P4JA 5JH9A 2C1CA 2EK8A 2V8HA 3KR4A 1YW6A 4C9VA 5LRGA 3B3TA 4P44A 3RBUA 2ZENA 3TC8A 2CTCA 5HVHA 2AFOA 1Q7LA 1QQ9A 3I1UA 3JRUA 4NGQA 1CP6A 4C8UA 1Y9ZA 1LFWA 4PXDA 3D67A 3ICUA 1M4LA 3QNVA 1VHEA 1H8LA 1HDUA 4ZX9A 4PXEA 1YW4A 4TJXA 4Q7AA 4MHZA 3IJ3A 2EWBA 4CPAA 4NFRA 4C99A 5LRJA 1BPNA 3IWWA 5JGFA 4P45A 4YWYA 4OC3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OKO A;  4C9R A;  1LCP A;  3K2K A;  2PJ5 A;  3BHX A;  4ZI6 A;  3RZA A;  4F8Z A;  1ELL P;  1TF8 A;  3S9N A;  3WT4 A;  4PXB A;  3D7H A;  4OC5 A;  3VAT A;  2F7V A;  3SJG A;  3B2Y A;  5CPA A;  4C8F A;  5LYD A;  3T8W A;  5LYI A;  4RUH A;  1EE3 P;  3LWU A;  4MCQ A;  3H8F A;  3GB0 A;  4MCS A;  4C8T A;  4UF4 A;  3D68 A;  1NSA A;  4A94 A;  3FX6 A;  5I4M A;  4ZYQ A;  4GM5 A;  4MHP A;  4UIB A;  3KHX A;  3FH4 A;  4IAV A;  1LOK A;  1HEE A;  3FJU A;  4OIW A;  1PYT B;  4X8I A;  4IK2 A;  4MCR A;  3B3V A;  2PJ9 A;  2IQ6 A;  3B3S A;  1Z8L A;  3PRT A;  2BCO A;  4MMO A;  5D8N A;  4R8F A;  4NGN A;  2IMO A;  1TKH A;  3D7G A;  3GLJ A;  2ZED A;  2J9A A;  5D29 A;  2NSM A;  1ARL A;  3PFO A;  2QVP A;  4X3R A;  4WWV A;  2XEG A;  2PJ1 A;  1TF9 A;  1IY7 A;  2V8G A;  2PE3 A;  3KR5 A;  2F8H A;  1CPX A;  1F2P A;  4A37 A;  5K8M A;  2Q43 A;  4C86 A;  3FEE A;  3CT9 A;  1CP7 A;  2C6P A;  1BAV A;  2AFS A;  1GYT A;  4P10 A;  2QYV A;  3S9M A;  4NJQ A;  1ZLI A;  4JZ0 A;  1IGB A;  3N5F A;  3VTA A;  4C8P A;  1ELM P;  4ONW A;  2AFU A;  3NH8 A;  3L2N A;  3PFE A;  5LYF A;  2GRE A;  4KSI A;  3PB7 X;  4H2K A;  3SI1 A;  3MRU A;  2C6C A;  3CDX A;  1ZLH A;  5ELY A;  4KNG E;  2RFH A;  4DUK A;  3PB9 X;  1FNO A;  2OOT A;  1DE4 C;  4NGS A;  3NA6 A;  1XRY A;  1CPS A;  3IEH A;  3FEC A;  2XEF A;  4YN3 A;  3WC6 A;  4O23 A;  1DTD A;  1Y7E A;  3DGV A;  1R43 A;  1YME A;  4OP4 A;  1XF1 A;  4EFD A;  2QJ8 A;  2G9D A;  2I3C A;  4IHM A;  5DS0 A;  1XFO A;  4ZY2 A;  4C85 A;  2ZEH A;  3B3C A;  3KGQ A;  4MRI A;  4TJV A;  3FMC A;  3FVL A;  5K8O A;  1VGY A;  4TNU A;  4OC0 A;  1XJO A;  2PIY A;  1LAM A;  2VL1 A;  4OC4 A;  2ZOF A;  3KL9 A;  2XEJ A;  4ZX8 A;  3BI1 A;  1CX8 A;  4LQG A;  2HC9 A;  4UEZ A;  2WYR A;  4P4B A;  4A38 A;  4F9V A;  7CPA A;  2PJ2 A;  3ISZ A;  5K8N A;  3B3W A;  1Z5R A;  4FBE A;  3D7D A;  2ABZ A;  3B7I A;  3KHZ A;  4OC2 A;  1F2O A;  2PVV A;  4PQA A;  3KI9 A;  3D66 A;  4MHY A;  4G1P A;  5CBM A;  2NYQ A;  4CDJ A;  2JBK A;  3I6S A;  3WC7 A;  6CPA A;  5HXD A;  4FWU A;  3BI0 A;  4NJR A;  1AYE A;  2PJ7 A;  4C9U A;  1TXR A;  3FF3 A;  4C84 A;  1YSJ A;  2ZEP A;  4FUU A;  4K3N A;  2PJ6 A;  5LRK A;  2AFZ A;  3K9T A;  2V77 A;  4C8C A;  2XEI A;  5K8P A;  3PB6 X;  2PJ3 A;  4NGM A;  2PJ0 A;  4P4D A;  1BLL E;  3PB4 X;  4F9U A;  3PEI A;  2ZEF A;  3ISX A;  4P4I A;  1FT7 A;  3I74 A;  2CIJ A;  2JBJ A;  2AFM A;  2PJA A;  4CDK A;  5F09 A;  2ZEG A;  4DYO A;  3SJF A;  3VH9 A;  2ZEL A;  4R7M A;  2Q51 A;  1LAN A;  1Z2L A;  1ZG8 A;  4UEE A;  1RTQ A;  1ARM A;  3LMS A;  4UEF A;  2GU2 A;  2PJB A;  3H8E A;  3VAR A;  1R3N A;  3KQX A;  3PB8 X;  4BD9 A;  3SI2 A;  1ZG7 A;  1CBX A;  1UWY A;  4NGP A;  4W9Y A;  4ZY0 A;  4X2T A;  1LAP A;  1YLO A;  2HB6 A;  3NH5 A;  3CPA A;  4EME A;  4B6Z A;  1QMU A;  2PJC A;  4Z65 A;  5JM6 A;  1VIX A;  2ZOG A;  3WAB A;  3IO1 A;  4WJB A;  2O4H A;  3DLJ A;  3TX8 A;  1JQG A;  2AFW A;  4P6Y A;  4PPZ A;  1F57 A;  5HVG A;  2V8V A;  2EK9 A;  3GUX A;  3HUV A;  2CF4 A;  1V6C A;  2POK A;  1VHO A;  2PVW A;  1Y0R A;  2PCU A;  1WVM A;  1TKF A;  4OME A;  4P4E A;  2BOA A;  3NH4 A;  4NGR A;  3IIB A;  1BPM A;  5LYL A;  4AXV A;  4UIA A;  4MCP A;  2V8D A;  2IJZ A;  4R76 A;  1AMP A;  4P4F A;  5J1Q A;  3EIF A;  2ZEE A;  3IC1 A;  3BXM A;  4TWE A;  2FVG A;  3V7Z A;  3RAM A;  3S9L A;  2ANP A;  3D7F A;  3FED A;  1OBR A;  3KAS A;  4NGT A;  4R6T A;  8CPA A;  3NFZ A;  5THW A;  4DJL A;  2AFX A;  4C9E A;  4OC1 A;  3CPX A;  1XBU A;  2ZEM A;  2GLJ A;  1CG2 A;  2PJ8 A;  4FAI A;  4EWT A;  2C6G A;  2JEW A;  3B35 A;  1XMB A;  3PBE A;  3SJX A;  3MN8 A;  2Q4Z A;  3HLP A;  4A39 A;  4MXU A;  3D4U A;  3H8G A;  4JYW A;  5HVF A;  4C9A A;  2OR4 A;  3KZW A;  1ZG9 A;  3IFE A;  4MHN A;  2PIZ A;  3WC5 A;  1Y0Y A;  4ZY1 A;  2PJ4 A;  3PBB A;  3SI0 A;  1TKJ A;  2ZEO A;  1PCA A;  5IB9 A;  2DEA A;  3SJE A;  2PRQ A;  3V38 A;  2RB7 A;  2WZN A;  2O53 A;  4C8A A;  1HDQ A;  4PXC A;  3KQZ A;  2BO9 A;  4OID A;  2GLF A;  2CTB A;  1KWM A;  4YU9 A;  4P4J A;  5JH9 A;  2C1C A;  2EK8 A;  2V8H A;  3KR4 A;  1YW6 A;  4C9V A;  5LRG A;  3B3T A;  4P44 A;  3RBU A;  2ZEN A;  3TC8 A;  2CTC A;  5HVH A;  2AFO A;  1Q7L A;  1QQ9 A;  3I1U A;  3JRU A;  4NGQ A;  1CP6 A;  4C8U A;  1Y9Z A;  1LFW A;  4PXD A;  3D67 A;  3ICU A;  1M4L A;  3QNV A;  1VHE A;  1H8L A;  1HDU A;  4ZX9 A;  4PXE A;  1YW4 A;  4TJX A;  4Q7A A;  4MHZ A;  3IJ3 A;  2EWB A;  4CPA A;  4NFR A;  4C99 A;  5LRJ A;  1BPN A;  3IWW A;  5JGF A;  4P45 A;  4YWY A;  4OC3 A; 
#chains in the Genus database with same CATH topology
 4MI1 A;  4OKO A;  4C9R A;  1LCP A;  1A9X B;  4CGN A;  2B4D B;  3K2K A;  5JPH A;  1MJA A;  4C2X A;  3GIU A;  2R7H A;  2G0B A;  4U9Z A;  1S7L A;  4PK3 A;  2PJ5 A;  1K4J A;  3BHX A;  2GFQ A;  1LRZ A;  4ZI6 A;  2EZB A;  3RZA A;  4F8Z A;  1ELL P;  2BUE A;  2JLM A;  3NE8 A;  5G22 A;  4MFK A;  1TF8 A;  3S9N A;  4K30 A;  2YJV A;  3WT4 A;  3JTK A;  4CAW A;  4PXB A;  3D7H A;  1Z4R A;  3FB3 A;  4OC5 A;  5AG7 A;  2F7V A;  3VAT A;  4CYP A;  4F6A A;  1XEB A;  4KLW A;  2AUN A;  4LX9 A;  4MFZ A;  2I79 A;  3SJG A;  5C88 A;  3BJ7 A;  3B2Y A;  5CPA A;  1I12 A;  1VI4 A;  2OU2 A;  4C8F A;  5LYD A;  3T8W A;  5LYI A;  4RUH A;  1EE3 P;  2KCW A;  3F5B A;  3LWU A;  4MCQ A;  1Y9K A;  4A32 A;  3H8F A;  1U6M A;  4KSF A;  4UCN A;  5CNP A;  4B10 A;  1WK4 A;  2B5G A;  2FIA A;  2QEC A;  3GB0 A;  3RYO A;  4MCS A;  4C8T A;  3FNC A;  1V0C A;  2PDO A;  2WSA A;  3D68 A;  4R87 A;  4UF4 A;  4XPL A;  4AG7 A;  1NSA A;  3NOJ A;  3T9Y A;  4A94 A;  3T0T A;  3VWE A;  3FX6 A;  1M4D A;  3GY9 A;  4ZYQ A;  1YQE A;  5I4M A;  4GM5 A;  2WUU A;  3D2P A;  1KUY A;  2B3V A;  4MHP A;  4UIB A;  1VBG A;  3KHX A;  1MJ9 A;  2IL4 A;  4Y49 C;  2Z3M A;  3FH4 A;  2O28 A;  2DF5 A;  4IAV A;  4NXY A;  5EMI A;  3W6X A;  1LOK A;  4E2A A;  4ZGY B;  1IU8 A;  1HEE A;  2ARH A;  4KOT A;  4YGO A;  1XMT A;  3FJU A;  4MY0 A;  4OIW A;  1BXR B;  2VXK A;  4E8O A;  2HRO A;  1PYT B;  4X8I A;  4IK2 A;  4KSA A;  3A9L A;  4MCR A;  3B3V A;  2R82 A;  2NMT A;  4FD5 A;  2K5T A;  2J8N A;  1R61 A;  2PJ9 A;  2WPW A;  2GAN A;  2DIK A;  1PUA A;  2IQ6 A;  1OZP A;  3B3S A;  2QML A;  1Z8L A;  2P0W A;  2YNC A;  3PRT A;  5G20 A;  4MHD A;  4U5Y A;  2BCO A;  4MMO A;  5D8N A;  4KOW A;  4R8F A;  1IYK A;  4UA3 A;  5K99 A;  1ZRS A;  3TLG B;  1IOF A;  5IB0 A;  2C5Q A;  3T5M A;  4NGN A;  2REE A;  4CAE A;  4IUS A;  3G3S A;  4XPD C;  2FE7 A;  2IMO A;  1TKH A;  3D7G A;  1NSL A;  3GLJ A;  4NEX A;  4PV6 A;  4BMH A;  2ZED A;  2J9A A;  5D29 A;  4CGL A;  5IX3 A;  4JLY A;  3D2M A;  2YJT A;  2NSM A;  5FVJ A;  3EFA A;  1ARL A;  3PFO A;  2Z3O A;  3R95 A;  4QBJ A;  2QVP A;  3R1K A;  4X3R A;  4WWV A;  1Q2Y A;  4AVB A;  2XEG A;  4KLV A;  4CYQ A;  4KOR A;  1IIC A;  2PJ1 A;  1J3L A;  2FM4 A;  3FIX A;  3EZE A;  1TF9 A;  1IY7 A;  2V8G A;  2PE3 A;  5C82 A;  3CXQ A;  2Z10 A;  3KR5 A;  3PP9 A;  4LQ6 A;  4M3S A;  4UCP A;  2F8H A;  4KOS A;  1CPX A;  1F2P A;  2WPX A;  3EC4 A;  4A37 A;  5K8M A;  2Q43 A;  1Z4E A;  2Y0M A;  4XPK A;  4MFQ A;  5A28 A;  4C86 A;  3FEE A;  4A95 A;  4KS9 A;  3TLY A;  2X0S A;  3CT9 A;  1CP7 A;  2C6P A;  1KUX A;  1YVK A;  3TO7 A;  4YFJ A;  1NXJ A;  1I1D A;  1BAV A;  5DWN A;  1Y9W A;  3SHP A;  2AFS A;  1JDE A;  2F5I A;  1GYT A;  4P10 A;  3QAH A;  4ONU A;  2QYV A;  4CS0 B;  2D4P A;  3S9M A;  4UFV A;  5G21 A;  4NJQ A;  1ZLI A;  3F8K A;  4JZ0 A;  1IGB A;  3N5F A;  3VTA A;  4C8P A;  1ELM P;  1YVO A;  2H5M A;  4ONW A;  3PZJ A;  1NMT A;  2FL4 A;  2AFU A;  1S7F A;  3NH8 A;  3QB8 A;  4HKF A;  4JXQ A;  2P6G A;  3L2N A;  2Z3N A;  1KUV A;  3PFE A;  2FSR A;  5LYF A;  2GRE A;  4KSI A;  1ON0 A;  3D8P A;  1MK4 A;  3W91 A;  3PB7 X;  1X10 A;  2HQY A;  4H2K A;  3FRM A;  3SI1 A;  1XE4 A;  3H4Q A;  3TO9 A;  2R98 A;  1ZO0 A;  1J4J A;  2C6C A;  3MRU A;  4OC3 A;  4UFW A;  2PCN A;  3CDX A;  1ZLH A;  5ELY A;  4KNG E;  2RFH A;  2D4O A;  2CXA A;  2OH1 A;  3PB9 X;  2VZZ A;  4RS2 A;  4XNH B;  3T90 A;  4DUK A;  3T07 A;  3ZZI A;  1FNO A;  4NSQ A;  3E0K A;  2OOT A;  1DE4 C;  4NGS A;  3NA6 A;  1XRY A;  2FXF A;  1CPS A;  3IEH A;  3FEC A;  2XEF A;  1KZF A;  4YN3 A;  2I00 A;  3WC6 A;  4B5P A;  2B4B A;  4O23 A;  4A33 A;  4HNY B;  1YR0 A;  3EZA A;  1DTD A;  1Y7E A;  3DGV A;  1R43 A;  1EZB A;  4ORF A;  1YME A;  3LD2 A;  4OP4 A;  1XF1 A;  4XNH C;  2B4D A;  4CYN A;  4EFD A;  2QJ8 A;  3R9G A;  2G9D A;  2I3C A;  4IHM A;  1Z8T A;  4CYO A;  5DS0 A;  4L89 A;  4DNC A;  2E28 A;  1XFO A;  2EVN A;  2ODF A;  4ZY2 A;  4JVO A;  4C85 A;  2ZEH A;  3B3C A;  3KGQ A;  4MRI A;  4COG A;  4TJV A;  3G8W A;  3JVN A;  3FMC A;  1QSN A;  3FVL A;  3MGD A;  5F47 A;  4EYS A;  5K8O A;  1B87 A;  1IYL A;  5AG5 A;  5JVL A;  3C8O A;  1VGY A;  3TLA A;  5JYB A;  4TNU A;  4OC0 A;  1XJO A;  2PIY A;  1LAM A;  2VL1 A;  4NF1 A;  4OC4 A;  1S3Z A;  2ZOF A;  2D0O A;  5AGE A;  1EZA A;  2Z3K A;  4JXR A;  4M6G A;  3KL9 A;  4UCM A;  4C2Z A;  4IIY A;  4CZ1 A;  3LAC A;  3NE7 A;  1I21 A;  2ZPA A;  1M1D A;  2GE3 A;  2XEJ A;  2OZH A;  3FBU A;  4FD6 A;  1DIK A;  4ZX8 A;  2PR8 A;  1NE9 A;  3BJ8 A;  1CX8 A;  3BI1 A;  3P2F A;  4LQG A;  2HC9 A;  3TT2 A;  4UEZ A;  1YK3 A;  3D3S A;  2WYR A;  4P4B A;  4A38 A;  5KTA A;  1CE8 B;  3R9F A;  4F9V A;  7CPA A;  2PJ2 A;  3CXS A;  3ISZ A;  2B5G B;  3B3W A;  4C7H A;  5K8N A;  4HNX B;  1Z5R A;  2PRB A;  3D7D A;  4JWP A;  4FBE A;  5F5X A;  1P4N A;  1P0H A;  2ABZ A;  3B7I A;  4M6H A;  4R3K A;  4M8D A;  3KHZ A;  4OC2 A;  1F2O A;  2HUZ A;  2PVV A;  4PQA A;  3KI9 A;  2J8M A;  3D66 A;  4KOU A;  2Q4Y A;  3DR6 A;  5DWM A;  4MHY A;  3IGR A;  5G1Z A;  4G1P A;  4OLL A;  5CBM A;  1AUG A;  2NYQ A;  4CDJ A;  4A31 A;  2EBJ A;  2JBK A;  3I6S A;  4A30 A;  3OWC A;  3WC7 A;  6CPA A;  5HXD A;  4FWU A;  4C68 A;  4IF5 A;  1QSO A;  3BI0 A;  3DR8 A;  4NJR A;  4PSX A;  4CO9 A;  1AYE A;  2PJ7 A;  4M6I A;  1IID A;  4AB7 A;  1TXR A;  3FF3 A;  4C9U A;  4C84 A;  4UWJ A;  1YSJ A;  2ZEP A;  4FUU A;  4K3N A;  2G3T A;  5F49 A;  2PJ6 A;  4J0N A;  3TTH A;  5LRK A;  3TOB A;  4EVY A;  2AFZ A;  1NBW A;  3K9T A;  2V77 A;  5IR2 A;  3TLE A;  4C8C A;  2XEI A;  5K8P A;  3BLN A;  3PB6 X;  2PJ3 A;  4NGM A;  2PJ0 A;  4MY3 A;  4P4D A;  3S6G A;  5FD8 A;  1BLL E;  3PB4 X;  2FIW A;  4F9U A;  3PEI A;  2ZEF A;  4GXH A;  2AE6 A;  3ISX A;  4KOY A;  4MJ8 A;  4OAE A;  3P2H A;  4P4I A;  1FT7 A;  3KRV A;  3I74 A;  1BOB A;  2VZY A;  4PK2 A;  2CIJ A;  2JBJ A;  2AFM A;  2GP4 A;  2HI6 A;  1QST A;  1TIQ A;  4COB A;  2GIV A;  3B8G A;  2PJA A;  4LUA A;  1KBL A;  4CDK A;  3IWG A;  4UWI A;  5F09 A;  2ZEG A;  4DYO A;  2PSW A;  3SJF A;  3K4I A;  3VH9 A;  2ZEL A;  4KVO E;  4A2Z A;  4MI4 A;  1S7K A;  4R7M A;  4R9M A;  4INJ A;  2Q51 A;  1LAN A;  2A4N A;  4H89 A;  1JWQ A;  4MFP A;  1Z2L A;  1ZG8 A;  5J8F A;  1WWZ A;  4UEE A;  1RTQ A;  1ARM A;  3LMS A;  4QUS A;  4C7I A;  4UEF A;  4CGO A;  2CY2 A;  1M4I A;  2GU2 A;  2PJB A;  3DSB A;  3H8E A;  2DPT A;  3VAR A;  4B12 A;  1R3N A;  1UFH A;  3VWD A;  3KQX A;  4CAX A;  1XIX A;  2FS5 A;  3PB8 X;  4BD9 A;  2OLS A;  4QC6 A;  3SI2 A;  2OZG A;  5ISV A;  1ZG7 A;  1CJW A;  5E96 A;  2JDC A;  2FT0 A;  1YLE A;  1CBX A;  1UWY A;  4NGP A;  1CS0 B;  4W9Y A;  4ZY0 A;  4X2T A;  2RC4 A;  3WR7 A;  1A2Z A;  1LAP A;  2Q44 A;  2HWG A;  1GHE A;  2X7B A;  1YLO A;  2HB6 A;  2HV2 A;  3NH5 A;  3CPA A;  5F9M A;  4EME A;  4B6Z A;  3TFY A;  1QMU A;  2PJC A;  4Z65 A;  4H1H A;  4BBH A;  5JM6 A;  1VIX A;  2ZOG A;  4J3G A;  3R9E A;  3WAB A;  3IO1 A;  1N71 A;  5A27 A;  1PU9 A;  4WJB A;  3V8I A;  2O4H A;  3DLJ A;  4KVX A;  4M85 A;  3RNZ A;  3TX8 A;  1JQG A;  3EY5 A;  4B11 A;  2AFW A;  2CNM A;  1RXT A;  2OZU A;  3CXP A;  4P6Y A;  1F57 A;  2Q04 A;  4PPZ A;  3S6K A;  2PC1 A;  5HVG A;  3C26 A;  3TCV A;  1L0C A;  4JJX A;  4MBU A;  4B13 A;  2V8V A;  2CNT A;  2P6E A;  3TOA A;  3IWE A;  2EK9 A;  3GUX A;  3HUV A;  2CF4 A;  1V6C A;  2B58 A;  2POK A;  1VHO A;  5EC4 A;  2PVW A;  4C2Y A;  1Y0R A;  3T05 A;  2PCU A;  1WVM A;  1TKF A;  4OME A;  1KC7 A;  1Q2C A;  4P4E A;  2BOA A;  3NH4 A;  4NGR A;  1VHS A;  3IIB A;  2D0P A;  2EZC A;  1BPM A;  3PGP A;  5LYL A;  3R96 A;  4AXV A;  1ZL0 A;  2Q0Y A;  1Z9U A;  4UIA A;  4B5O A;  4E0A A;  4MCP A;  4MJX A;  4UFX A;  1X12 A;  2V8D A;  4CAF A;  2C27 A;  2IJZ A;  4H6Z A;  4R76 A;  4AVC A;  4CRZ B;  1AMP A;  3TYX A;  4P4F A;  5J1Q A;  3EIF A;  4E5S A;  4E94 A;  2ZEE A;  1Y7R A;  2ZW4 A;  3IC1 A;  3BXM A;  2ZW7 A;  1S7N A;  5H84 A;  4R3L A;  4TWE A;  2FVG A;  3EO4 A;  3SXN A;  3V7Z A;  2FCK A;  3RAM A;  3S9L A;  3TLC A;  2ANP A;  2OB0 A;  3D7F A;  4ZBG A;  3FED A;  1OBR A;  1MJB A;  1QSM A;  2B3U A;  2PQ8 A;  4Q36 A;  3KAS A;  4HPS A;  3UY5 A;  4NGT A;  4R6T A;  1Q2D A;  3W6S A;  4MFJ A;  5GCN A;  3G23 A;  8CPA A;  5KTD A;  1B6B A;  3NFZ A;  3TO6 A;  5THW A;  4DJL A;  4JD6 A;  4PSW A;  2AFX A;  5AG4 A;  4C9E A;  4OC1 A;  4Y49 B;  4L8A A;  4F0Y A;  2Z3P A;  3CPX A;  1XBU A;  2ZEM A;  2GLJ A;  1CG2 A;  2PJ8 A;  1R57 A;  4FAI A;  4EWT A;  2AJ6 A;  3TLZ A;  1T36 B;  3IU2 A;  2C6G A;  2JEW A;  3B35 A;  1XMB A;  3I3G A;  3N7Z A;  3F0A A;  3PBE A;  2B0A A;  4CGM A;  3SJX A;  1KEE B;  2R8V A;  2Q7B A;  3MN8 A;  1C3O B;  2Q4Z A;  3HLP A;  1Q5X A;  2R1I A;  2ZW6 A;  4A39 A;  5BWA B;  4MXU A;  3D4U A;  3H8G A;  2DXQ A;  4JYW A;  1S5K A;  5HVF A;  2OR4 A;  4C9A A;  5AG6 A;  4HNW B;  2Z0Z A;  4AG9 A;  1RO5 A;  1YRE A;  3KZW A;  1M4G A;  1ZG9 A;  3IFE A;  4MHN A;  5F48 A;  2EUI A;  2AUM A;  1Z8X A;  2PIZ A;  1GGO A;  4UBR A;  3WC5 A;  1Y0Y A;  3TLG A;  4ZY1 A;  2Q4V A;  4XPD B;  4BIN A;  4KUB A;  2PJ4 A;  2BEI A;  2YGW A;  3PBB A;  3SI0 A;  1TKJ A;  2ZEO A;  4CRY B;  5JQ4 A;  1PCA A;  1XF8 A;  5IB9 A;  2DEA A;  3DNS A;  2PRQ A;  4FD4 A;  4RI1 A;  1FY7 A;  2RB7 A;  2WZN A;  3SJE A;  4KOV A;  1YX0 A;  2ATR A;  4NCZ A;  3V38 A;  4CGP A;  2PR1 A;  2O53 A;  2Q7S A;  4C8A A;  4F0X A;  1HDQ A;  4YRH A;  4B14 A;  1CM0 A;  2ZW5 A;  2JDD A;  2YNC C;  2ZXV A;  4PXC A;  3KQZ A;  5F46 A;  4GS4 A;  2BO9 A;  4OID A;  3S6H A;  2EZA A;  2GLF A;  2CTB A;  1KWM A;  4YU9 A;  4P4J A;  5JH9 A;  2C1C A;  2EK8 A;  4U9Y A;  1S60 A;  2V8H A;  1YW6 A;  3KR4 A;  2BSW A;  4FD7 A;  4OAD A;  4C9V A;  4MFL A;  5LRG A;  1VBH A;  3B3T A;  4QB9 A;  4P44 A;  1SQH A;  2YNE A;  4Q38 A;  3LOD A;  3SXO A;  5IV0 A;  4KOX A;  3RBU A;  2VEZ A;  2MP0 A;  2ZEN A;  4KZT A;  5H86 A;  3TC8 A;  1M44 A;  4II9 A;  2CTC A;  5HVH A;  3I9S A;  2AFO A;  1Q7L A;  1XOV A;  1QQ9 A;  3I1U A;  4IIX A;  4R57 A;  3ZJ0 A;  4CAV A;  1M6V B;  3CZX A;  3JRU A;  4NGQ A;  3IU1 A;  3JUW A;  4QVT A;  3GKR A;  3S6F A;  1CP6 A;  2Z3L A;  1C30 B;  3GJZ A;  2G3A A;  2JEV A;  5F1Y A;  4C8U A;  2CNS A;  1Y9Z A;  1LFW A;  4KVM E;  3D67 A;  4PXD A;  3ICU A;  3TLB A;  1M4L A;  5EBV A;  5KTC A;  3FYN A;  3QNV A;  2Z11 A;  3EZB A;  1VHE A;  5HH1 A;  3RO0 A;  3KKW A;  5HMN A;  4AVA A;  5J8C A;  3SR3 A;  3U1B A;  4X5K A;  1ZYM A;  1BO4 A;  1H8L A;  1HDU A;  1YGH A;  2P6F A;  3EXN A;  3H5Z A;  4ZX9 A;  4PXE A;  3TE4 A;  4I49 A;  2QIR A;  2REF A;  3FXT A;  1YW4 A;  4KUA A;  1QSR A;  4Q7A A;  5I0C A;  4TJX A;  2J8R A;  2DPS A;  4H6U A;  4MHZ A;  1Z8W A;  4RN7 A;  3IJ3 A;  1IB1 E;  2EWB A;  2YND A;  4CPA A;  4B5P B;  2EO8 A;  2VQY A;  4NFR A;  4C99 A;  3K9U A;  5LRJ A;  1IOI A;  1BPN A;  1VKC A;  2VI7 A;  3GYA A;  3IWW A;  4P45 A;  4YWY A;  5JGF A;  1JDB C;  3DDD A;  2BL1 A;  3QAY A;  2VBQ A; 
#chains in the Genus database with same CATH homology
 4OKO A;  4C9R A;  1LCP A;  3K2K A;  2PJ5 A;  3BHX A;  4ZI6 A;  3RZA A;  4F8Z A;  1ELL P;  1TF8 A;  3S9N A;  3WT4 A;  4PXB A;  3D7H A;  4OC5 A;  3VAT A;  2F7V A;  3SJG A;  3B2Y A;  5CPA A;  4C8F A;  5LYD A;  3T8W A;  5LYI A;  4RUH A;  1EE3 P;  3LWU A;  4MCQ A;  3H8F A;  3GB0 A;  4MCS A;  4C8T A;  4UF4 A;  3D68 A;  1NSA A;  4A94 A;  3FX6 A;  5I4M A;  4ZYQ A;  4GM5 A;  4MHP A;  4UIB A;  3KHX A;  3FH4 A;  4IAV A;  1LOK A;  1HEE A;  3FJU A;  4OIW A;  1PYT B;  4X8I A;  4IK2 A;  4MCR A;  3B3V A;  2PJ9 A;  2IQ6 A;  3B3S A;  1Z8L A;  3PRT A;  2BCO A;  4MMO A;  5D8N A;  4R8F A;  2C5Q A;  4NGN A;  2IMO A;  1TKH A;  3D7G A;  3GLJ A;  2ZED A;  2J9A A;  5D29 A;  2NSM A;  1ARL A;  3PFO A;  2QVP A;  4X3R A;  4WWV A;  2XEG A;  2PJ1 A;  1TF9 A;  1IY7 A;  2V8G A;  2PE3 A;  3KR5 A;  2F8H A;  1CPX A;  1F2P A;  4A37 A;  5K8M A;  2Q43 A;  4C86 A;  3FEE A;  3CT9 A;  1CP7 A;  2C6P A;  1BAV A;  2AFS A;  1GYT A;  4P10 A;  2QYV A;  3S9M A;  4NJQ A;  1ZLI A;  4JZ0 A;  1IGB A;  3N5F A;  3VTA A;  4C8P A;  1ELM P;  4ONW A;  2AFU A;  3NH8 A;  3L2N A;  3PFE A;  5LYF A;  2GRE A;  4KSI A;  3PB7 X;  4H2K A;  3SI1 A;  3MRU A;  2C6C A;  3CDX A;  1ZLH A;  5ELY A;  4KNG E;  2RFH A;  4DUK A;  3PB9 X;  1FNO A;  2OOT A;  1DE4 C;  4NGS A;  3NA6 A;  1XRY A;  1CPS A;  3IEH A;  3FEC A;  2XEF A;  4YN3 A;  3WC6 A;  4O23 A;  1DTD A;  1Y7E A;  3DGV A;  1R43 A;  1YME A;  4OP4 A;  1XF1 A;  4EFD A;  2QJ8 A;  2G9D A;  2I3C A;  4IHM A;  5DS0 A;  1XFO A;  4ZY2 A;  4C85 A;  2ZEH A;  3B3C A;  3KGQ A;  4MRI A;  4TJV A;  3FMC A;  3FVL A;  5K8O A;  1VGY A;  4TNU A;  4OC0 A;  1XJO A;  2PIY A;  1LAM A;  2VL1 A;  4OC4 A;  2ZOF A;  3KL9 A;  2XEJ A;  4ZX8 A;  3BI1 A;  1CX8 A;  4LQG A;  2HC9 A;  4UEZ A;  2WYR A;  4P4B A;  4A38 A;  4F9V A;  7CPA A;  2PJ2 A;  3ISZ A;  5K8N A;  3B3W A;  1Z5R A;  4FBE A;  3D7D A;  2ABZ A;  3B7I A;  3KHZ A;  4OC2 A;  1F2O A;  2PVV A;  4PQA A;  3KI9 A;  3D66 A;  4MHY A;  4G1P A;  5CBM A;  2NYQ A;  4CDJ A;  2JBK A;  3I6S A;  3WC7 A;  6CPA A;  5HXD A;  4FWU A;  3BI0 A;  4NJR A;  1AYE A;  2PJ7 A;  4C9U A;  1TXR A;  3FF3 A;  4C84 A;  1YSJ A;  2ZEP A;  4FUU A;  4K3N A;  2PJ6 A;  5LRK A;  2AFZ A;  5IR2 A;  3K9T A;  2V77 A;  4C8C A;  2XEI A;  5K8P A;  3PB6 X;  2PJ3 A;  4NGM A;  2PJ0 A;  4P4D A;  1BLL E;  3PB4 X;  4F9U A;  3PEI A;  2ZEF A;  3ISX A;  4P4I A;  1FT7 A;  3I74 A;  2CIJ A;  2JBJ A;  2AFM A;  2GP4 A;  2PJA A;  4CDK A;  5F09 A;  2ZEG A;  4DYO A;  3SJF A;  3VH9 A;  2ZEL A;  4R7M A;  2Q51 A;  1LAN A;  1Z2L A;  1ZG8 A;  4UEE A;  1RTQ A;  1ARM A;  3LMS A;  4UEF A;  2GU2 A;  2PJB A;  3H8E A;  3VAR A;  1R3N A;  3KQX A;  3PB8 X;  4BD9 A;  3SI2 A;  1ZG7 A;  1CBX A;  1UWY A;  4NGP A;  4W9Y A;  4ZY0 A;  4X2T A;  1LAP A;  1YLO A;  2HB6 A;  3NH5 A;  3CPA A;  4EME A;  4B6Z A;  1QMU A;  2PJC A;  4Z65 A;  5JM6 A;  1VIX A;  2ZOG A;  3WAB A;  3IO1 A;  4WJB A;  2O4H A;  3DLJ A;  3TX8 A;  1JQG A;  2AFW A;  4P6Y A;  4PPZ A;  1F57 A;  5HVG A;  2V8V A;  2EK9 A;  3GUX A;  3HUV A;  2CF4 A;  1V6C A;  2POK A;  1VHO A;  2PVW A;  1Y0R A;  2PCU A;  1WVM A;  1TKF A;  4OME A;  4P4E A;  2BOA A;  3NH4 A;  4NGR A;  3IIB A;  1BPM A;  5LYL A;  4AXV A;  4UIA A;  4MCP A;  2V8D A;  2IJZ A;  4R76 A;  1AMP A;  4P4F A;  5J1Q A;  3EIF A;  2ZEE A;  3IC1 A;  3BXM A;  4TWE A;  2FVG A;  3V7Z A;  3RAM A;  3S9L A;  2ANP A;  3D7F A;  3FED A;  1OBR A;  3KAS A;  4NGT A;  4R6T A;  8CPA A;  3NFZ A;  5THW A;  4DJL A;  2AFX A;  4C9E A;  4OC1 A;  3CPX A;  1XBU A;  2ZEM A;  2GLJ A;  1CG2 A;  2PJ8 A;  4FAI A;  4EWT A;  2C6G A;  2JEW A;  3B35 A;  1XMB A;  3PBE A;  3SJX A;  3MN8 A;  2Q4Z A;  3HLP A;  4A39 A;  4MXU A;  3D4U A;  3H8G A;  4JYW A;  5HVF A;  4C9A A;  2OR4 A;  3KZW A;  1ZG9 A;  3IFE A;  4MHN A;  2PIZ A;  3WC5 A;  1Y0Y A;  4ZY1 A;  2PJ4 A;  3PBB A;  3SI0 A;  1TKJ A;  2ZEO A;  1PCA A;  5IB9 A;  2DEA A;  3SJE A;  2PRQ A;  3V38 A;  2RB7 A;  2WZN A;  2O53 A;  4C8A A;  1HDQ A;  4PXC A;  3KQZ A;  2BO9 A;  4OID A;  2GLF A;  2CTB A;  1KWM A;  4YU9 A;  4P4J A;  5JH9 A;  2C1C A;  2EK8 A;  2V8H A;  3KR4 A;  1YW6 A;  4C9V A;  5LRG A;  3B3T A;  4P44 A;  3RBU A;  2ZEN A;  3TC8 A;  2CTC A;  5HVH A;  2AFO A;  1Q7L A;  1QQ9 A;  3I1U A;  3JRU A;  4NGQ A;  1CP6 A;  4C8U A;  1Y9Z A;  1LFW A;  4PXD A;  3D67 A;  3ICU A;  1M4L A;  3QNV A;  1VHE A;  1H8L A;  1HDU A;  4ZX9 A;  4PXE A;  1YW4 A;  4TJX A;  4Q7A A;  4MHZ A;  3IJ3 A;  2EWB A;  4CPA A;  4NFR A;  4C99 A;  5LRJ A;  1BPN A;  3IWW A;  5JGF A;  4P45 A;  4YWY A;  4OC3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...