4COBA

Crystal structure kynurenine formamidase from pseudomonas aeruginosa
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
206
structure length
206
Chain Sequence
RYWDISPALDPNTPTWPGDTPFQQEWAARLDEQCPVNVGRITLSPHTGAHVDGPLHYRADGLPIGQVPLDVYMGPCRVIHCIGANPLVTPEHLAGQLDDLPSRVLLRTFERVPANWPEGFCAIAPATIECLAERGVRLVGIDTPSLDPQHSKTLDAHHAVGRHGMAILEGVVLDDVPAGDYELLALPLKFTHLDASPVRAVLRALP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Bacterial Kynurenine Formamidase Reveals a Crowded Binuclear-Zinc Catalytic Site Primed to Generate a Potent Nucleophile.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
molecule keywords KYNURENINE FORMAMIDASE
total genus 53
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature ec 3.5.1.9: Arylformamidase.
pdb deposition date 2014-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04199 Cyclase Putative cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.50 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Putative cyclase 4cobA00
4COGA 1R61A 2B0AA 4CZ1A 4CO9A 3KRVA 4COBA 4M8DA 4J0NA
chains in the Genus database with same CATH superfamily
4C99A 1VBHA 4KNGE 1V6CA 2PVVA 4CDKA 5ELYA 4C85A 3TLAA 3SJEA 1DE4C 3TLCA 2C5QA 3NOJA 4NGPA 4OC4A 2YJTA 4JVOA 3EZBA 3GJZA 1VI4A 3D7HA 2JBJA 1C3OB 3T07A 2JBKA 4TJXA 3D7GA 3FECA 1Y9ZA 2C6GA 1JDEA 1XF1A 5JVLA 2MP0A 4OC5A 5FD8A 3VTAA 4COGA 4C9EA 3BI0A 3SJFA 2OLSA 4COBA 1WVMA 1EZAA 4E5SA 4W9YA 3TLBA 1CE8B 2FM4A 2HROA 4C86A 1R61A 2XEIA 4P4FA 4MJXA 3FF3A 4TJVA 3IWWA 4INJA 3ICUA 2EK8A 3K9TA 3T0TA 3IIBA 3S9MA 2XEFA 3KASA 4LQGA 2AUNA 3T5MA 4EYSA 5F5XA 1M6VB 1T36B 1BXRB 4OC2A 3D7FA 4YN3A 1Q5XA 4E94A 3SJXA 5JYBA 1EZBA 3FEDA 4NGMA 2GP4A 2D0PA 2B0AA 2E28A 4TWEA 3TLGB 3BHXA 3KRVA 1VBGA 2C6PA 2D0OA 3SJGA 4C9UA 1GGOA 4P4IA 4C8AA 2YJVA 4P4JA 3RBUA 3TLGA 4C8FA 1KBLA 1KC7A 3S9LA 4CZ1A 4X3RA 4P4DA 4JZ0A 1ZYMA 2PCNA 4J0NA 4MCRA 4C84A 3BI1A 5K99A 3C8OA 4CO9A 3T05A 5F09A 2HI6A 4OC3A 3TLYA 4OC1A 3FEEA 1J3LA 2PVWA 2OR4A 3EZAA 2EZCA 3EZEA 1NBWA 4MCPA 3TLEA 4C8TA 4C9RA 4C9AA 3S9NA 5D29A 2CIJA 4H1HA 1CS0B 3I74A 2AUMA 4NGSA 5F9MA 4MCSA 2HWGA 4C8PA 5IB9A 4OMEA 4C8CA 4P4EA 3TLZA 1KEEB 1C30B 1Z8LA 3D7DA 2XEJA 4MI1A 4P45A 3EIFA 4IIYA 2C6CA 4C8UA 3U1BA 2R82A 4JYWA 1NXJA 1ZRSA 4P44A 3SR3A 4M8DA 4IIXA 4NGTA 4NGRA 2EK9A 3G23A 4MCQA 2EZBA 4CDJA 4NGNA 4OC0A 2XEGA 5IR2A 5F1YA 2EZAA 2X0SA 3K4IA 1A9XB 1ZL0A 1DIKA 3BXMA 1CX8A 2DIKA 4NGQA 2OOTA 4C9VA 3TYXA 1JDBC 3I6SA 4P4BA
chains in the Genus database with same CATH topology
4COGA 1R61A 2B0AA 4CZ1A 4CO9A 3KRVA 4COBA 4M8DA 4J0NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4COG A;  1R61 A;  2B0A A;  4CZ1 A;  4CO9 A;  3KRV A;  4COB A;  4M8D A;  4J0N A; 
#chains in the Genus database with same CATH topology
 4C99 A;  1VBH A;  4KNG E;  1V6C A;  2PVV A;  4CDK A;  5ELY A;  4C85 A;  3TLA A;  3SJE A;  1DE4 C;  3TLC A;  2C5Q A;  3NOJ A;  4NGP A;  4OC4 A;  2YJT A;  4JVO A;  3EZB A;  3GJZ A;  1VI4 A;  3D7H A;  2JBJ A;  1C3O B;  3T07 A;  2JBK A;  4TJX A;  3D7G A;  3FEC A;  1Y9Z A;  2C6G A;  1JDE A;  1XF1 A;  5JVL A;  2MP0 A;  4OC5 A;  5FD8 A;  3VTA A;  4COG A;  4C9E A;  3BI0 A;  3SJF A;  2OLS A;  4COB A;  1WVM A;  1EZA A;  4E5S A;  4W9Y A;  3TLB A;  1CE8 B;  2FM4 A;  2HRO A;  4C86 A;  1R61 A;  2XEI A;  4P4F A;  4MJX A;  3FF3 A;  4TJV A;  3IWW A;  4INJ A;  3ICU A;  2EK8 A;  3K9T A;  3T0T A;  3IIB A;  3S9M A;  2XEF A;  3KAS A;  4LQG A;  2AUN A;  3T5M A;  4EYS A;  5F5X A;  1M6V B;  1T36 B;  1BXR B;  4OC2 A;  3D7F A;  4YN3 A;  1Q5X A;  4E94 A;  3SJX A;  5JYB A;  1EZB A;  3FED A;  4NGM A;  2GP4 A;  2D0P A;  2B0A A;  2E28 A;  4TWE A;  3TLG B;  3BHX A;  3KRV A;  1VBG A;  2C6P A;  2D0O A;  3SJG A;  4C9U A;  1GGO A;  4P4I A;  4C8A A;  2YJV A;  4P4J A;  3RBU A;  3TLG A;  4C8F A;  1KBL A;  1KC7 A;  3S9L A;  4CZ1 A;  4X3R A;  4P4D A;  4JZ0 A;  1ZYM A;  2PCN A;  4J0N A;  4MCR A;  4C84 A;  3BI1 A;  5K99 A;  3C8O A;  4CO9 A;  3T05 A;  5F09 A;  2HI6 A;  4OC3 A;  3TLY A;  4OC1 A;  3FEE A;  1J3L A;  2PVW A;  2OR4 A;  3EZA A;  2EZC A;  3EZE A;  1NBW A;  4MCP A;  3TLE A;  4C8T A;  4C9R A;  4C9A A;  3S9N A;  5D29 A;  2CIJ A;  4H1H A;  1CS0 B;  3I74 A;  2AUM A;  4NGS A;  5F9M A;  4MCS A;  2HWG A;  4C8P A;  5IB9 A;  4OME A;  4C8C A;  4P4E A;  3TLZ A;  1KEE B;  1C30 B;  1Z8L A;  3D7D A;  2XEJ A;  4MI1 A;  4P45 A;  3EIF A;  4IIY A;  2C6C A;  4C8U A;  3U1B A;  2R82 A;  4JYW A;  1NXJ A;  1ZRS A;  4P44 A;  3SR3 A;  4M8D A;  4IIX A;  4NGT A;  4NGR A;  2EK9 A;  3G23 A;  4MCQ A;  2EZB A;  4CDJ A;  4NGN A;  4OC0 A;  2XEG A;  5IR2 A;  5F1Y A;  2EZA A;  2X0S A;  3K4I A;  1A9X B;  1ZL0 A;  1DIK A;  3BXM A;  1CX8 A;  2DIK A;  4NGQ A;  2OOT A;  4C9V A;  3TYX A;  1JDB C;  3I6S A;  4P4B A; 
#chains in the Genus database with same CATH homology
 4COG A;  1R61 A;  2B0A A;  4CZ1 A;  4CO9 A;  3KRV A;  4COB A;  4M8D A;  4J0N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...