4COBA

Crystal structure kynurenine formamidase from pseudomonas aeruginosa
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
206
structure length
206
Chain Sequence
RYWDISPALDPNTPTWPGDTPFQQEWAARLDEQCPVNVGRITLSPHTGAHVDGPLHYRADGLPIGQVPLDVYMGPCRVIHCIGANPLVTPEHLAGQLDDLPSRVLLRTFERVPANWPEGFCAIAPATIECLAERGVRLVGIDTPSLDPQHSKTLDAHHAVGRHGMAILEGVVLDDVPAGDYELLALPLKFTHLDASPVRAVLRALP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KYNURENINE FORMAMIDASE
publication title Structure of Bacterial Kynurenine Formamidase Reveals a Crowded Binuclear-Zinc Catalytic Site Primed to Generate a Potent Nucleophile.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 53
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature ec 3.5.1.9: Arylformamidase.
pdb deposition date 2014-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04199 Cyclase Putative cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.50 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Putative cyclase 4cobA00
4CO9A 3KRVA 4CZ1A 4M8DA 4COGA 2B0AA 4J0NA 1R61A 4COBA
chains in the Genus database with same CATH superfamily
3IIBA 3KRVA 4TJXA 4C9AA 4P4FA 2XEIA 4J0NA 5JYBA 1VI4A 3BI0A 3NOJA 3EZAA 3TLYA 1NXJA 2PVVA 4JYWA 4W9YA 5K99A 2XEGA 3S9NA 4INJA 1BXRB 4COBA 5FD8A 4JVOA 4MCRA 4C8FA 4NGRA 4OMEA 1EZAA 1JDEA 1KBLA 3I6SA 4C84A 4COGA 2HROA 3BHXA 2B0AA 3VTAA 4C99A 4C9EA 2YJTA 2XEFA 2D0PA 1DE4C 3TYXA 1CE8B 3D7DA 4P4EA 3RBUA 3SJEA 3BI1A 3C8OA 3FECA 3T5MA 4CZ1A 3EIFA 4EYSA 1EZBA 2EK8A 3FEEA 4TJVA 4NGMA 2PCNA 3T05A 4C9VA 3SJFA 2EK9A 2JBJA 4M8DA 4MJXA 3KASA 2EZBA 4OC4A 3EZBA 4P44A 4C9UA 2HI6A 1DIKA 4IIYA 5ELYA 3SJXA 2DIKA 4CDKA 1J3LA 2YJVA 3BXMA 2AUMA 3T07A 4OC2A 4C86A 1KEEB 4P4BA 2AUNA 4P4IA 2GP4A 4OC5A 4NGPA 4MI1A 3D7HA 1WVMA 2JBKA 4MCPA 3SR3A 2EZCA 3K4IA 2R82A 4NGQA 4C8PA 5F09A 4E94A 3GJZA 4X3RA 2C5QA 4C9RA 4MCSA 5JVLA 3IWWA 4TWEA 1C30B 3SJGA 5F9MA 2D0OA 3D7FA 4C85A 1CS0B 4C8TA 2EZAA 3ICUA 4CO9A 4P4DA 4C8AA 4C8UA 2FM4A 1C3OB 2OOTA 4LQGA 2C6PA 3T0TA 3TLCA 4C8CA 1Z8LA 4MCQA 1Y9ZA 2MP0A 1V6CA 3FEDA 2C6CA 3EZEA 2E28A 4KNGE 3TLZA 3U1BA 2C6GA 2CIJA 3TLAA 4OC0A 4NGSA 1JDBC 4P45A 3S9MA 2OR4A 5F1YA 1VBGA 4H1HA 2HWGA 1ZL0A 3G23A 4OC3A 1XF1A 5IB9A 1NBWA 3TLGA 3K9TA 2X0SA 1M6VB 4NGNA 2PVWA 1ZYMA 4E5SA 1VBHA 1ZRSA 3FF3A 3TLEA 3TLBA 3D7GA 5F5XA 3S9LA 4NGTA 4YN3A 1CX8A 4IIXA 2XEJA 4P4JA 1KC7A 4OC1A 3TLGB 2OLSA 5IR2A 3I74A 1GGOA 1Q5XA 1A9XB 1T36B 4JZ0A 4CDJA 1R61A 5D29A
chains in the Genus database with same CATH topology
4CO9A 3KRVA 4CZ1A 4M8DA 4COGA 2B0AA 4J0NA 1R61A 4COBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CO9 A;  3KRV A;  4CZ1 A;  4M8D A;  4COG A;  2B0A A;  4J0N A;  1R61 A;  4COB A; 
#chains in the Genus database with same CATH topology
 3IIB A;  3KRV A;  4TJX A;  4C9A A;  4P4F A;  2XEI A;  4J0N A;  5JYB A;  1VI4 A;  3BI0 A;  3NOJ A;  3EZA A;  3TLY A;  1NXJ A;  2PVV A;  4JYW A;  4W9Y A;  5K99 A;  2XEG A;  3S9N A;  4INJ A;  1BXR B;  4COB A;  5FD8 A;  4JVO A;  4MCR A;  4C8F A;  4NGR A;  4OME A;  1EZA A;  1JDE A;  1KBL A;  3I6S A;  4C84 A;  4COG A;  2HRO A;  3BHX A;  2B0A A;  3VTA A;  4C99 A;  4C9E A;  2YJT A;  2XEF A;  2D0P A;  1DE4 C;  3TYX A;  1CE8 B;  3D7D A;  4P4E A;  3RBU A;  3SJE A;  3BI1 A;  3C8O A;  3FEC A;  3T5M A;  4CZ1 A;  3EIF A;  4EYS A;  1EZB A;  2EK8 A;  3FEE A;  4TJV A;  4NGM A;  2PCN A;  3T05 A;  4C9V A;  3SJF A;  2EK9 A;  2JBJ A;  4M8D A;  4MJX A;  3KAS A;  2EZB A;  4OC4 A;  3EZB A;  4P44 A;  4C9U A;  2HI6 A;  1DIK A;  4IIY A;  5ELY A;  3SJX A;  2DIK A;  4CDK A;  1J3L A;  2YJV A;  3BXM A;  2AUM A;  3T07 A;  4OC2 A;  4C86 A;  1KEE B;  4P4B A;  2AUN A;  4P4I A;  2GP4 A;  4OC5 A;  4NGP A;  4MI1 A;  3D7H A;  1WVM A;  2JBK A;  4MCP A;  3SR3 A;  2EZC A;  3K4I A;  2R82 A;  4NGQ A;  4C8P A;  5F09 A;  4E94 A;  3GJZ A;  4X3R A;  2C5Q A;  4C9R A;  4MCS A;  5JVL A;  3IWW A;  4TWE A;  1C30 B;  3SJG A;  5F9M A;  2D0O A;  3D7F A;  4C85 A;  1CS0 B;  4C8T A;  2EZA A;  3ICU A;  4CO9 A;  4P4D A;  4C8A A;  4C8U A;  2FM4 A;  1C3O B;  2OOT A;  4LQG A;  2C6P A;  3T0T A;  3TLC A;  4C8C A;  1Z8L A;  4MCQ A;  1Y9Z A;  2MP0 A;  1V6C A;  3FED A;  2C6C A;  3EZE A;  2E28 A;  4KNG E;  3TLZ A;  3U1B A;  2C6G A;  2CIJ A;  3TLA A;  4OC0 A;  4NGS A;  1JDB C;  4P45 A;  3S9M A;  2OR4 A;  5F1Y A;  1VBG A;  4H1H A;  2HWG A;  1ZL0 A;  3G23 A;  4OC3 A;  1XF1 A;  5IB9 A;  1NBW A;  3TLG A;  3K9T A;  2X0S A;  1M6V B;  4NGN A;  2PVW A;  1ZYM A;  4E5S A;  1VBH A;  1ZRS A;  3FF3 A;  3TLE A;  3TLB A;  3D7G A;  5F5X A;  3S9L A;  4NGT A;  4YN3 A;  1CX8 A;  4IIX A;  2XEJ A;  4P4J A;  1KC7 A;  4OC1 A;  3TLG B;  2OLS A;  5IR2 A;  3I74 A;  1GGO A;  1Q5X A;  1A9X B;  1T36 B;  4JZ0 A;  4CDJ A;  1R61 A;  5D29 A; 
#chains in the Genus database with same CATH homology
 4CO9 A;  3KRV A;  4CZ1 A;  4M8D A;  4COG A;  2B0A A;  4J0N A;  1R61 A;  4COB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...