4COBA

Crystal structure kynurenine formamidase from pseudomonas aeruginosa
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
206
structure length
206
Chain Sequence
RYWDISPALDPNTPTWPGDTPFQQEWAARLDEQCPVNVGRITLSPHTGAHVDGPLHYRADGLPIGQVPLDVYMGPCRVIHCIGANPLVTPEHLAGQLDDLPSRVLLRTFERVPANWPEGFCAIAPATIECLAERGVRLVGIDTPSLDPQHSKTLDAHHAVGRHGMAILEGVVLDDVPAGDYELLALPLKFTHLDASPVRAVLRALP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords KYNURENINE FORMAMIDASE
publication title Structure of Bacterial Kynurenine Formamidase Reveals a Crowded Binuclear-Zinc Catalytic Site Primed to Generate a Potent Nucleophile.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 53
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature ec 3.5.1.9: Arylformamidase.
pdb deposition date 2014-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04199 Cyclase Putative cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.50 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Putative cyclase 4cobA00
4COBA 4CZ1A 3KRVA 1R61A 4J0NA 2B0AA 4COGA 4M8DA 4CO9A
chains in the Genus database with same CATH superfamily
4OMEA 4IIYA 1WVMA 2AUNA 4C9AA 5JVLA 3TLGB 1V6CA 2MP0A 5IB9A 3T0TA 4CO9A 2OLSA 2OR4A 1ZL0A 3D7DA 3I6SA 5F1YA 2OOTA 3S9NA 3T5MA 4IIXA 5ELYA 1DIKA 4MCSA 2JBJA 3EIFA 4C8TA 1ZRSA 2R82A 4MCRA 1GGOA 3KRVA 3SJEA 4OC2A 4E5SA 1VBGA 3FF3A 5D29A 4C8UA 1KC7A 1KBLA 4TJVA 1Y9ZA 4P4IA 1JDBC 2EZBA 4OC1A 3VTAA 1EZAA 4NGQA 5FD8A 3D7HA 4KNGE 4NGRA 1T36B 2CIJA 4OC0A 5F09A 5F9MA 1DE4C 3TLYA 2XEIA 5IR2A 4EYSA 4C9UA 4MJXA 4CDKA 3TYXA 4NGTA 4P4EA 3TLAA 4P4FA 2E28A 4COBA 4INJA 4H1HA 1C3OB 1XF1A 3SJFA 3EZBA 3FECA 4C9VA 3BI0A 4COGA 2D0OA 2XEJA 1JDEA 2C6GA 1Q5XA 2YJTA 3BI1A 4JYWA 3G23A 4TJXA 3K9TA 1NXJA 4MI1A 3TLGA 3S9LA 2XEGA 1C30B 1CX8A 2DIKA 1ZYMA 3SJGA 3I74A 2EK9A 4C99A 4OC3A 3SJXA 3TLEA 3GJZA 5K99A 2C6CA 2D0PA 1KEEB 3TLBA 4C8AA 2HWGA 3U1BA 3T05A 4E94A 2FM4A 4TWEA 4C86A 4NGMA 3S9MA 2XEFA 1A9XB 2HROA 4J0NA 3D7GA 3TLZA 4NGPA 4C84A 4OC4A 3FEDA 2EZCA 3KASA 2EK8A 2C5QA 1BXRB 3D7FA 4JZ0A 4MCPA 4P45A 3C8OA 4NGSA 3BHXA 1J3LA 1M6VB 4C8FA 3IWWA 2JBKA 1Z8LA 4CZ1A 2EZAA 2PVVA 3ICUA 4P4DA 4X3RA 3IIBA 3NOJA 4CDJA 4LQGA 2C6PA 2YJVA 1R61A 3BXMA 4YN3A 5F5XA 1NBWA 3EZEA 2HI6A 2B0AA 4P4JA 4M8DA 3T07A 4P44A 4W9YA 2GP4A 2PVWA 3TLCA 2X0SA 4C85A 4C8PA 4MCQA 1VBHA 1CE8B 4NGNA 1VI4A 3EZAA 4JVOA 3RBUA 4C9EA 2AUMA 4OC5A 2PCNA 3K4IA 3SR3A 1CS0B 4C8CA 1EZBA 3FEEA 4P4BA 5JYBA 4C9RA
chains in the Genus database with same CATH topology
4COBA 4CZ1A 3KRVA 1R61A 4J0NA 2B0AA 4COGA 4M8DA 4CO9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4COB A;  4CZ1 A;  3KRV A;  1R61 A;  4J0N A;  2B0A A;  4COG A;  4M8D A;  4CO9 A; 
#chains in the Genus database with same CATH topology
 4OME A;  4IIY A;  1WVM A;  2AUN A;  4C9A A;  5JVL A;  3TLG B;  1V6C A;  2MP0 A;  5IB9 A;  3T0T A;  4CO9 A;  2OLS A;  2OR4 A;  1ZL0 A;  3D7D A;  3I6S A;  5F1Y A;  2OOT A;  3S9N A;  3T5M A;  4IIX A;  5ELY A;  1DIK A;  4MCS A;  2JBJ A;  3EIF A;  4C8T A;  1ZRS A;  2R82 A;  4MCR A;  1GGO A;  3KRV A;  3SJE A;  4OC2 A;  4E5S A;  1VBG A;  3FF3 A;  5D29 A;  4C8U A;  1KC7 A;  1KBL A;  4TJV A;  1Y9Z A;  4P4I A;  1JDB C;  2EZB A;  4OC1 A;  3VTA A;  1EZA A;  4NGQ A;  5FD8 A;  3D7H A;  4KNG E;  4NGR A;  1T36 B;  2CIJ A;  4OC0 A;  5F09 A;  5F9M A;  1DE4 C;  3TLY A;  2XEI A;  5IR2 A;  4EYS A;  4C9U A;  4MJX A;  4CDK A;  3TYX A;  4NGT A;  4P4E A;  3TLA A;  4P4F A;  2E28 A;  4COB A;  4INJ A;  4H1H A;  1C3O B;  1XF1 A;  3SJF A;  3EZB A;  3FEC A;  4C9V A;  3BI0 A;  4COG A;  2D0O A;  2XEJ A;  1JDE A;  2C6G A;  1Q5X A;  2YJT A;  3BI1 A;  4JYW A;  3G23 A;  4TJX A;  3K9T A;  1NXJ A;  4MI1 A;  3TLG A;  3S9L A;  2XEG A;  1C30 B;  1CX8 A;  2DIK A;  1ZYM A;  3SJG A;  3I74 A;  2EK9 A;  4C99 A;  4OC3 A;  3SJX A;  3TLE A;  3GJZ A;  5K99 A;  2C6C A;  2D0P A;  1KEE B;  3TLB A;  4C8A A;  2HWG A;  3U1B A;  3T05 A;  4E94 A;  2FM4 A;  4TWE A;  4C86 A;  4NGM A;  3S9M A;  2XEF A;  1A9X B;  2HRO A;  4J0N A;  3D7G A;  3TLZ A;  4NGP A;  4C84 A;  4OC4 A;  3FED A;  2EZC A;  3KAS A;  2EK8 A;  2C5Q A;  1BXR B;  3D7F A;  4JZ0 A;  4MCP A;  4P45 A;  3C8O A;  4NGS A;  3BHX A;  1J3L A;  1M6V B;  4C8F A;  3IWW A;  2JBK A;  1Z8L A;  4CZ1 A;  2EZA A;  2PVV A;  3ICU A;  4P4D A;  4X3R A;  3IIB A;  3NOJ A;  4CDJ A;  4LQG A;  2C6P A;  2YJV A;  1R61 A;  3BXM A;  4YN3 A;  5F5X A;  1NBW A;  3EZE A;  2HI6 A;  2B0A A;  4P4J A;  4M8D A;  3T07 A;  4P44 A;  4W9Y A;  2GP4 A;  2PVW A;  3TLC A;  2X0S A;  4C85 A;  4C8P A;  4MCQ A;  1VBH A;  1CE8 B;  4NGN A;  1VI4 A;  3EZA A;  4JVO A;  3RBU A;  4C9E A;  2AUM A;  4OC5 A;  2PCN A;  3K4I A;  3SR3 A;  1CS0 B;  4C8C A;  1EZB A;  3FEE A;  4P4B A;  5JYB A;  4C9R A; 
#chains in the Genus database with same CATH homology
 4COB A;  4CZ1 A;  3KRV A;  1R61 A;  4J0N A;  2B0A A;  4COG A;  4M8D A;  4CO9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...