4COBA

Crystal structure kynurenine formamidase from pseudomonas aeruginosa
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
206
structure length
206
Chain Sequence
b'RYWDISPALDPNTPTWPGDTPFQQEWAARLDEQCPVNVGRITLSPHTGAHVDGPLHYRADGLPIGQVPLDVYMGPCRVIHCIGANPLVTPEHLAGQLDDLPSRVLLRTFERVPANWPEGFCAIAPATIECLAERGVRLVGIDTPSLDPQHSKTLDAHHAVGRHGMAILEGVVLDDVPAGDYELLALPLKFTHLDASPVRAVLRALP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KYNURENINE FORMAMIDASE
publication title Structure of Bacterial Kynurenine Formamidase Reveals a Crowded Binuclear-Zinc Catalytic Site Primed to Generate a Potent Nucleophile.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 53
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature ec 3.5.1.9: Arylformamidase.
pdb deposition date 2014-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04199 Cyclase Putative cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.50 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Putative cyclase 4cobA00
4COGA 4CZ1A 4COBA 1R61A 2B0AA 4J0NA 3KRVA 4M8DA 4CO9A
chains in the Genus database with same CATH superfamily
4NGTA 3TLEA 1DE4C 1ZL0A 3C8OA 1BXRB 1WVMA 3TLYA 4P44A 2AUMA 4COGA 1R61A 4C9EA 2YJTA 4CDKA 2PCNA 4OC0A 3T05A 3BHXA 4MCSA 2GP4A 4C9RA 2FM4A 2XEJA 4OC1A 3TLGA 2EZCA 4P45A 3U1BA 4P4JA 2CIJA 4OC4A 3BXMA 3FEDA 3D7HA 3SJXA 3TLAA 4C8PA 4IIYA 1KC7A 3IIBA 4C8TA 3D7FA 3KASA 4H1HA 3D7GA 2HROA 5JYBA 4P4DA 3SJEA 3G23A 3T0TA 4E5SA 1CS0B 4C9AA 1NXJA 2D0PA 5IR2A 4C9UA 2C6GA 3IWWA 1V6CA 3FECA 4TJXA 4JZ0A 1Y9ZA 5D29A 4C86A 1DIKA 5F09A 3TYXA 4COBA 4MI1A 5FD8A 2JBKA 3TLBA 1Q5XA 4P4EA 4W9YA 4EYSA 1EZAA 3SJFA 1EZBA 3SJGA 4LQGA 4IIXA 4C8UA 4CZ1A 2C5QA 3NOJA 3SR3A 1KBLA 4NGRA 3S9MA 3ICUA 2OOTA 2YJVA 3BI0A 4TWEA 4JYWA 4CDJA 5F5XA 1C3OB 2C6PA 5ELYA 1JDEA 3EZAA 3TLZA 2R82A 1ZRSA 2DIKA 4C84A 4OC2A 3K4IA 4JVOA 1ZYMA 4P4FA 4P4BA 4TJVA 2AUNA 1JDBC 3EZBA 1VBGA 2X0SA 1VI4A 4C8AA 2MP0A 4YN3A 2B0AA 3I74A 4J0NA 2XEIA 4OC5A 4C99A 4NGSA 3S9LA 2HWGA 4NGMA 3I6SA 4C9VA 3T07A 3TLGB 2OLSA 2XEFA 3K9TA 3KRVA 1M6VB 4MJXA 2HI6A 4X3RA 4C8FA 5K99A 4NGPA 1CE8B 3T5MA 4OMEA 4MCQA 3S9NA 4NGQA 2EK9A 5IB9A 5F1YA 2PVVA 3BI1A 4OC3A 5JVLA 4INJA 1T36B 2OR4A 3FEEA 2D0OA 1GGOA 2C6CA 2E28A 2EK8A 3RBUA 1NBWA 2PVWA 1CX8A 3GJZA 4KNGE 4M8DA 4NGNA 1XF1A 2XEGA 1A9XB 1KEEB 4MCPA 3FF3A 1J3LA 4C85A 4P4IA 5F9MA 4CO9A 1Z8LA 2JBJA 3EIFA 4E94A 3D7DA 3EZEA 1VBHA 3TLCA 3VTAA 4MCRA 1C30B 4C8CA 2EZBA 2EZAA
chains in the Genus database with same CATH topology
4COGA 4CZ1A 4COBA 1R61A 2B0AA 4J0NA 3KRVA 4M8DA 4CO9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4COG A;  4CZ1 A;  4COB A;  1R61 A;  2B0A A;  4J0N A;  3KRV A;  4M8D A;  4CO9 A; 
#chains in the Genus database with same CATH topology
 4NGT A;  3TLE A;  1DE4 C;  1ZL0 A;  3C8O A;  1BXR B;  1WVM A;  3TLY A;  4P44 A;  2AUM A;  4COG A;  1R61 A;  4C9E A;  2YJT A;  4CDK A;  2PCN A;  4OC0 A;  3T05 A;  3BHX A;  4MCS A;  2GP4 A;  4C9R A;  2FM4 A;  2XEJ A;  4OC1 A;  3TLG A;  2EZC A;  4P45 A;  3U1B A;  4P4J A;  2CIJ A;  4OC4 A;  3BXM A;  3FED A;  3D7H A;  3SJX A;  3TLA A;  4C8P A;  4IIY A;  1KC7 A;  3IIB A;  4C8T A;  3D7F A;  3KAS A;  4H1H A;  3D7G A;  2HRO A;  5JYB A;  4P4D A;  3SJE A;  3G23 A;  3T0T A;  4E5S A;  1CS0 B;  4C9A A;  1NXJ A;  2D0P A;  5IR2 A;  4C9U A;  2C6G A;  3IWW A;  1V6C A;  3FEC A;  4TJX A;  4JZ0 A;  1Y9Z A;  5D29 A;  4C86 A;  1DIK A;  5F09 A;  3TYX A;  4COB A;  4MI1 A;  5FD8 A;  2JBK A;  3TLB A;  1Q5X A;  4P4E A;  4W9Y A;  4EYS A;  1EZA A;  3SJF A;  1EZB A;  3SJG A;  4LQG A;  4IIX A;  4C8U A;  4CZ1 A;  2C5Q A;  3NOJ A;  3SR3 A;  1KBL A;  4NGR A;  3S9M A;  3ICU A;  2OOT A;  2YJV A;  3BI0 A;  4TWE A;  4JYW A;  4CDJ A;  5F5X A;  1C3O B;  2C6P A;  5ELY A;  1JDE A;  3EZA A;  3TLZ A;  2R82 A;  1ZRS A;  2DIK A;  4C84 A;  4OC2 A;  3K4I A;  4JVO A;  1ZYM A;  4P4F A;  4P4B A;  4TJV A;  2AUN A;  1JDB C;  3EZB A;  1VBG A;  2X0S A;  1VI4 A;  4C8A A;  2MP0 A;  4YN3 A;  2B0A A;  3I74 A;  4J0N A;  2XEI A;  4OC5 A;  4C99 A;  4NGS A;  3S9L A;  2HWG A;  4NGM A;  3I6S A;  4C9V A;  3T07 A;  3TLG B;  2OLS A;  2XEF A;  3K9T A;  3KRV A;  1M6V B;  4MJX A;  2HI6 A;  4X3R A;  4C8F A;  5K99 A;  4NGP A;  1CE8 B;  3T5M A;  4OME A;  4MCQ A;  3S9N A;  4NGQ A;  2EK9 A;  5IB9 A;  5F1Y A;  2PVV A;  3BI1 A;  4OC3 A;  5JVL A;  4INJ A;  1T36 B;  2OR4 A;  3FEE A;  2D0O A;  1GGO A;  2C6C A;  2E28 A;  2EK8 A;  3RBU A;  1NBW A;  2PVW A;  1CX8 A;  3GJZ A;  4KNG E;  4M8D A;  4NGN A;  1XF1 A;  2XEG A;  1A9X B;  1KEE B;  4MCP A;  3FF3 A;  1J3L A;  4C85 A;  4P4I A;  5F9M A;  4CO9 A;  1Z8L A;  2JBJ A;  3EIF A;  4E94 A;  3D7D A;  3EZE A;  1VBH A;  3TLC A;  3VTA A;  4MCR A;  1C30 B;  4C8C A;  2EZB A;  2EZA A; 
#chains in the Genus database with same CATH homology
 4COG A;  4CZ1 A;  4COB A;  1R61 A;  2B0A A;  4J0N A;  3KRV A;  4M8D A;  4CO9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...