4COBA

Crystal structure kynurenine formamidase from pseudomonas aeruginosa
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
206
structure length
206
Chain Sequence
RYWDISPALDPNTPTWPGDTPFQQEWAARLDEQCPVNVGRITLSPHTGAHVDGPLHYRADGLPIGQVPLDVYMGPCRVIHCIGANPLVTPEHLAGQLDDLPSRVLLRTFERVPANWPEGFCAIAPATIECLAERGVRLVGIDTPSLDPQHSKTLDAHHAVGRHGMAILEGVVLDDVPAGDYELLALPLKFTHLDASPVRAVLRALP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Bacterial Kynurenine Formamidase Reveals a Crowded Binuclear-Zinc Catalytic Site Primed to Generate a Potent Nucleophile.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
molecule keywords KYNURENINE FORMAMIDASE
total genus 53
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature ec 3.5.1.9: Arylformamidase.
pdb deposition date 2014-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04199 Cyclase Putative cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.50 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Putative cyclase 4cobA00
4CZ1A 4COBA 4COGA 3KRVA 2B0AA 4J0NA 4CO9A 1R61A 4M8DA
chains in the Genus database with same CATH superfamily
1JDEA 4CZ1A 4YN3A 4C85A 4COBA 2OR4A 3T05A 2D0PA 2YJVA 2C5QA 4KNGE 4P4EA 2CIJA 4C99A 1KBLA 3TLYA 1NXJA 1VBGA 1M6VB 4C8UA 4P4FA 1A9XB 3D7DA 2PVWA 1V6CA 2E28A 4LQGA 1ZL0A 3K4IA 3TLBA 4OMEA 4P45A 3IIBA 5IB9A 4P4BA 3SJEA 4NGQA 4C8PA 4NGTA 3BI1A 4E94A 3FEDA 4NGPA 5JYBA 4C9EA 4MCQA 4P4JA 1KC7A 3TLCA 3ICUA 3TLGB 2PCNA 3TLGA 4OC5A 1Z8LA 4C8AA 2FM4A 3EZAA 4P44A 2AUMA 1T36B 4J0NA 4IIYA 2JBKA 2EZCA 2XEGA 3BHXA 3EZBA 3EIFA 5D29A 3SJXA 4C9RA 1WVMA 3EZEA 3I74A 3RBUA 2GP4A 4NGSA 2OOTA 4CDKA 1C3OB 3TLEA 3SR3A 4COGA 2XEJA 2B0AA 1EZBA 3BXMA 1R61A 4NGMA 2R82A 4C86A 2XEIA 1XF1A 4MCSA 1DIKA 3T5MA 3VTAA 3IWWA 2YJTA 3NOJA 2DIKA 2C6CA 2EK9A 1NBWA 4X3RA 3FECA 2X0SA 4TJXA 1Q5XA 2HROA 4JVOA 2EZAA 3KASA 4C8FA 2OLSA 4MJXA 4MCPA 4NGNA 4CO9A 4TWEA 3TLZA 5JVLA 1DE4C 3D7GA 1CX8A 3D7FA 3FF3A 4MI1A 4MCRA 3SJGA 2PVVA 4C84A 4EYSA 2AUNA 1VI4A 4OC0A 2XEFA 3D7HA 4IIXA 4TJVA 4JZ0A 2JBJA 2HI6A 2EZBA 4C9AA 2C6PA 3S9MA 4NGRA 4P4DA 3G23A 4OC4A 1VBHA 5FD8A 4OC2A 5ELYA 4C8TA 3T0TA 3C8OA 4CDJA 1ZYMA 3K9TA 1J3LA 4P4IA 3I6SA 5F09A 4C8CA 1Y9ZA 4H1HA 3SJFA 1CE8B 2EK8A 3TLAA 5K99A 5F9MA 3FEEA 2MP0A 4E5SA 1JDBC 4INJA 4OC1A 5IR2A 4W9YA 1EZAA 3S9NA 4OC3A 2HWGA 3GJZA 3KRVA 4M8DA 4C9UA 3U1BA 2D0OA 1KEEB 2C6GA 1BXRB 1C30B 3BI0A 3TYXA 1GGOA 4C9VA 1CS0B 5F5XA 3T07A 3S9LA 1ZRSA 4JYWA 5F1YA
chains in the Genus database with same CATH topology
4CZ1A 4COBA 4COGA 3KRVA 2B0AA 4J0NA 4CO9A 1R61A 4M8DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CZ1 A;  4COB A;  4COG A;  3KRV A;  2B0A A;  4J0N A;  4CO9 A;  1R61 A;  4M8D A; 
#chains in the Genus database with same CATH topology
 1JDE A;  4CZ1 A;  4YN3 A;  4C85 A;  4COB A;  2OR4 A;  3T05 A;  2D0P A;  2YJV A;  2C5Q A;  4KNG E;  4P4E A;  2CIJ A;  4C99 A;  1KBL A;  3TLY A;  1NXJ A;  1VBG A;  1M6V B;  4C8U A;  4P4F A;  1A9X B;  3D7D A;  2PVW A;  1V6C A;  2E28 A;  4LQG A;  1ZL0 A;  3K4I A;  3TLB A;  4OME A;  4P45 A;  3IIB A;  5IB9 A;  4P4B A;  3SJE A;  4NGQ A;  4C8P A;  4NGT A;  3BI1 A;  4E94 A;  3FED A;  4NGP A;  5JYB A;  4C9E A;  4MCQ A;  4P4J A;  1KC7 A;  3TLC A;  3ICU A;  3TLG B;  2PCN A;  3TLG A;  4OC5 A;  1Z8L A;  4C8A A;  2FM4 A;  3EZA A;  4P44 A;  2AUM A;  1T36 B;  4J0N A;  4IIY A;  2JBK A;  2EZC A;  2XEG A;  3BHX A;  3EZB A;  3EIF A;  5D29 A;  3SJX A;  4C9R A;  1WVM A;  3EZE A;  3I74 A;  3RBU A;  2GP4 A;  4NGS A;  2OOT A;  4CDK A;  1C3O B;  3TLE A;  3SR3 A;  4COG A;  2XEJ A;  2B0A A;  1EZB A;  3BXM A;  1R61 A;  4NGM A;  2R82 A;  4C86 A;  2XEI A;  1XF1 A;  4MCS A;  1DIK A;  3T5M A;  3VTA A;  3IWW A;  2YJT A;  3NOJ A;  2DIK A;  2C6C A;  2EK9 A;  1NBW A;  4X3R A;  3FEC A;  2X0S A;  4TJX A;  1Q5X A;  2HRO A;  4JVO A;  2EZA A;  3KAS A;  4C8F A;  2OLS A;  4MJX A;  4MCP A;  4NGN A;  4CO9 A;  4TWE A;  3TLZ A;  5JVL A;  1DE4 C;  3D7G A;  1CX8 A;  3D7F A;  3FF3 A;  4MI1 A;  4MCR A;  3SJG A;  2PVV A;  4C84 A;  4EYS A;  2AUN A;  1VI4 A;  4OC0 A;  2XEF A;  3D7H A;  4IIX A;  4TJV A;  4JZ0 A;  2JBJ A;  2HI6 A;  2EZB A;  4C9A A;  2C6P A;  3S9M A;  4NGR A;  4P4D A;  3G23 A;  4OC4 A;  1VBH A;  5FD8 A;  4OC2 A;  5ELY A;  4C8T A;  3T0T A;  3C8O A;  4CDJ A;  1ZYM A;  3K9T A;  1J3L A;  4P4I A;  3I6S A;  5F09 A;  4C8C A;  1Y9Z A;  4H1H A;  3SJF A;  1CE8 B;  2EK8 A;  3TLA A;  5K99 A;  5F9M A;  3FEE A;  2MP0 A;  4E5S A;  1JDB C;  4INJ A;  4OC1 A;  5IR2 A;  4W9Y A;  1EZA A;  3S9N A;  4OC3 A;  2HWG A;  3GJZ A;  3KRV A;  4M8D A;  4C9U A;  3U1B A;  2D0O A;  1KEE B;  2C6G A;  1BXR B;  1C30 B;  3BI0 A;  3TYX A;  1GGO A;  4C9V A;  1CS0 B;  5F5X A;  3T07 A;  3S9L A;  1ZRS A;  4JYW A;  5F1Y A; 
#chains in the Genus database with same CATH homology
 4CZ1 A;  4COB A;  4COG A;  3KRV A;  2B0A A;  4J0N A;  4CO9 A;  1R61 A;  4M8D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...