4COGA

Crystal structure of kynurenine formamidase from burkholderia cenocepacia
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
207
structure length
207
Chain Sequence
TLWDISPPVSPATPVWPGDTPVAVERVWRMEAGSPVNVARLTLSPHTGAHCDAPLHYDADGAPIGAVPLDTYLGPCRVIHCIGAAPVVRPADVEAALDGVPPRVLLRTYARAAVEQWDSNFCAVAPDTVDLLAAHGVKLIGIDTPSLDPQESKTMDAHRRVRAHRMAILEGIVLDDVPPGDYELIALPLKFATLDASPVRAVLRALP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KYNURENINE FORMAMIDASE
publication title Structure of Bacterial Kynurenine Formamidase Reveals a Crowded Binuclear-Zinc Catalytic Site Primed to Generate a Potent Nucleophile.
pubmed doi rcsb
source organism Burkholderia cenocepacia
molecule tags Hydrolase
total genus 54
structure length 207
sequence length 207
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.9: Arylformamidase.
pdb deposition date 2014-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04199 Cyclase Putative cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.50 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Putative cyclase 4cogA00
4COGA 4M8DA 4CZ1A 2B0AA 1R61A 4COBA 4CO9A 3KRVA 4J0NA
chains in the Genus database with same CATH superfamily
4MJXA 4CDJA 4COGA 1CE8B 3BXMA 4C8UA 5IB9A 3VTAA 1V6CA 3FECA 3S9MA 1C3OB 2C6GA 4OC5A 2AUNA 4J0NA 3GJZA 4MCPA 4E5SA 1EZAA 5D29A 4C99A 1Y9ZA 2CIJA 1CS0B 1JDEA 4P4IA 2EZAA 4C9AA 1KBLA 3NOJA 3RBUA 3I74A 5F1YA 4C8FA 4OC4A 4C8PA 4IIXA 3FEEA 4TJVA 1WVMA 1ZL0A 4NGQA 3BHXA 3BI1A 5IR2A 2D0PA 2OR4A 3TLBA 2X0SA 4YN3A 4C9VA 4MCQA 3SJFA 4NGRA 1ZYMA 4P45A 3D7FA 2C5QA 4P4BA 3TLGA 2R82A 3I6SA 3T5MA 4NGMA 4C8AA 4CO9A 3IIBA 1CX8A 2OOTA 3U1BA 3TYXA 2XEJA 1KEEB 3BI0A 1Q5XA 5F5XA 2PCNA 3EZBA 3S9NA 3EIFA 2GP4A 4COBA 3T05A 4C8CA 3KRVA 5ELYA 2YJTA 5FD8A 3S9LA 1GGOA 3KASA 3FF3A 4EYSA 3SJGA 4NGPA 2AUMA 4JVOA 1VBHA 1NBWA 1DE4C 4JYWA 2EK9A 4P44A 1A9XB 5F09A 1BXRB 2E28A 4LQGA 2PVVA 4C9RA 3K4IA 3TLZA 4MCSA 1DIKA 1EZBA 3D7GA 3EZEA 2MP0A 4C85A 2HI6A 4P4EA 4W9YA 1M6VB 1ZRSA 3EZAA 3TLGB 1KC7A 2OLSA 4IIYA 4X3RA 4OMEA 1VI4A 4CDKA 4CZ1A 3T0TA 3D7HA 4JZ0A 3D7DA 3FEDA 3SJEA 4C86A 4MI1A 3T07A 2HWGA 5JYBA 3ICUA 4OC3A 4NGNA 3K9TA 1NXJA 1T36B 2B0AA 2PVWA 4NGSA 4C9EA 1C30B 2EK8A 3SR3A 2HROA 5JVLA 4OC0A 2JBJA 1XF1A 4OC2A 3TLEA 1J3LA 4TJXA 4H1HA 2XEFA 4C8TA 4TWEA 2D0OA 2JBKA 4E94A 1R61A 1VBGA 4KNGE 4C9UA 1Z8LA 3SJXA 4NGTA 2XEGA 2XEIA 1JDBC 2EZBA 4MCRA 3TLAA 5K99A 4P4DA 3TLYA 3G23A 4P4FA 3IWWA 4OC1A 4INJA 4C84A 4P4JA 2DIKA 5F9MA 3C8OA 4M8DA 2FM4A 3TLCA 2EZCA 2C6PA 2YJVA 2C6CA
chains in the Genus database with same CATH topology
4COGA 4M8DA 4CZ1A 2B0AA 1R61A 4COBA 4CO9A 3KRVA 4J0NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4COG A;  4M8D A;  4CZ1 A;  2B0A A;  1R61 A;  4COB A;  4CO9 A;  3KRV A;  4J0N A; 
#chains in the Genus database with same CATH topology
 4MJX A;  4CDJ A;  4COG A;  1CE8 B;  3BXM A;  4C8U A;  5IB9 A;  3VTA A;  1V6C A;  3FEC A;  3S9M A;  1C3O B;  2C6G A;  4OC5 A;  2AUN A;  4J0N A;  3GJZ A;  4MCP A;  4E5S A;  1EZA A;  5D29 A;  4C99 A;  1Y9Z A;  2CIJ A;  1CS0 B;  1JDE A;  4P4I A;  2EZA A;  4C9A A;  1KBL A;  3NOJ A;  3RBU A;  3I74 A;  5F1Y A;  4C8F A;  4OC4 A;  4C8P A;  4IIX A;  3FEE A;  4TJV A;  1WVM A;  1ZL0 A;  4NGQ A;  3BHX A;  3BI1 A;  5IR2 A;  2D0P A;  2OR4 A;  3TLB A;  2X0S A;  4YN3 A;  4C9V A;  4MCQ A;  3SJF A;  4NGR A;  1ZYM A;  4P45 A;  3D7F A;  2C5Q A;  4P4B A;  3TLG A;  2R82 A;  3I6S A;  3T5M A;  4NGM A;  4C8A A;  4CO9 A;  3IIB A;  1CX8 A;  2OOT A;  3U1B A;  3TYX A;  2XEJ A;  1KEE B;  3BI0 A;  1Q5X A;  5F5X A;  2PCN A;  3EZB A;  3S9N A;  3EIF A;  2GP4 A;  4COB A;  3T05 A;  4C8C A;  3KRV A;  5ELY A;  2YJT A;  5FD8 A;  3S9L A;  1GGO A;  3KAS A;  3FF3 A;  4EYS A;  3SJG A;  4NGP A;  2AUM A;  4JVO A;  1VBH A;  1NBW A;  1DE4 C;  4JYW A;  2EK9 A;  4P44 A;  1A9X B;  5F09 A;  1BXR B;  2E28 A;  4LQG A;  2PVV A;  4C9R A;  3K4I A;  3TLZ A;  4MCS A;  1DIK A;  1EZB A;  3D7G A;  3EZE A;  2MP0 A;  4C85 A;  2HI6 A;  4P4E A;  4W9Y A;  1M6V B;  1ZRS A;  3EZA A;  3TLG B;  1KC7 A;  2OLS A;  4IIY A;  4X3R A;  4OME A;  1VI4 A;  4CDK A;  4CZ1 A;  3T0T A;  3D7H A;  4JZ0 A;  3D7D A;  3FED A;  3SJE A;  4C86 A;  4MI1 A;  3T07 A;  2HWG A;  5JYB A;  3ICU A;  4OC3 A;  4NGN A;  3K9T A;  1NXJ A;  1T36 B;  2B0A A;  2PVW A;  4NGS A;  4C9E A;  1C30 B;  2EK8 A;  3SR3 A;  2HRO A;  5JVL A;  4OC0 A;  2JBJ A;  1XF1 A;  4OC2 A;  3TLE A;  1J3L A;  4TJX A;  4H1H A;  2XEF A;  4C8T A;  4TWE A;  2D0O A;  2JBK A;  4E94 A;  1R61 A;  1VBG A;  4KNG E;  4C9U A;  1Z8L A;  3SJX A;  4NGT A;  2XEG A;  2XEI A;  1JDB C;  2EZB A;  4MCR A;  3TLA A;  5K99 A;  4P4D A;  3TLY A;  3G23 A;  4P4F A;  3IWW A;  4OC1 A;  4INJ A;  4C84 A;  4P4J A;  2DIK A;  5F9M A;  3C8O A;  4M8D A;  2FM4 A;  3TLC A;  2EZC A;  2C6P A;  2YJV A;  2C6C A; 
#chains in the Genus database with same CATH homology
 4COG A;  4M8D A;  4CZ1 A;  2B0A A;  1R61 A;  4COB A;  4CO9 A;  3KRV A;  4J0N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...