4COGA

Crystal structure of kynurenine formamidase from burkholderia cenocepacia
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
207
structure length
207
Chain Sequence
TLWDISPPVSPATPVWPGDTPVAVERVWRMEAGSPVNVARLTLSPHTGAHCDAPLHYDADGAPIGAVPLDTYLGPCRVIHCIGAAPVVRPADVEAALDGVPPRVLLRTYARAAVEQWDSNFCAVAPDTVDLLAAHGVKLIGIDTPSLDPQESKTMDAHRRVRAHRMAILEGIVLDDVPPGDYELIALPLKFATLDASPVRAVLRALP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Bacterial Kynurenine Formamidase Reveals a Crowded Binuclear-Zinc Catalytic Site Primed to Generate a Potent Nucleophile.
pubmed doi rcsb
source organism Burkholderia cenocepacia
molecule tags Hydrolase
molecule keywords KYNURENINE FORMAMIDASE
total genus 54
structure length 207
sequence length 207
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.9: Arylformamidase.
pdb deposition date 2014-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04199 Cyclase Putative cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.50 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Putative cyclase 4cogA00
4COBA 2B0AA 4J0NA 4CO9A 4CZ1A 4COGA 1R61A 3KRVA 4M8DA
chains in the Genus database with same CATH superfamily
4MCPA 2EZCA 4OC2A 4TWEA 4NGPA 1KC7A 1GGOA 4TJXA 2PVVA 2YJVA 3SR3A 3KRVA 4NGTA 2C6CA 1ZRSA 1VBHA 4P4EA 4OC0A 3S9MA 1BXRB 1EZAA 2JBKA 3FEDA 4C8FA 1R61A 3ICUA 3BI0A 2OLSA 2XEIA 2HROA 3I6SA 3SJEA 2R82A 3SJXA 1WVMA 4CDJA 5JYBA 3TLGA 4X3RA 1M6VB 3SJGA 3TLGB 2PVWA 3EZBA 5IB9A 2FM4A 2AUNA 1KEEB 3D7HA 2DIKA 5JVLA 3GJZA 3IWWA 4NGNA 1DIKA 2B0AA 4C9RA 1CX8A 5ELYA 1CS0B 4CDKA 4JZ0A 4C8PA 5F5XA 3TLBA 2EK9A 1NXJA 4MI1A 3TLYA 4OMEA 4W9YA 3EZEA 3TLEA 3U1BA 1Q5XA 1J3LA 2JBJA 3BI1A 3EIFA 3FECA 5F1YA 4OC3A 3C8OA 2C5QA 4C85A 2EZBA 4M8DA 5F9MA 4C9UA 1DE4C 3D7DA 1XF1A 3RBUA 1C3OB 1NBWA 4LQGA 4C9AA 3EZAA 2C6PA 2YJTA 4NGRA 4P44A 4J0NA 4OC4A 4TJVA 3T5MA 4P4FA 4P4JA 4COBA 4C9VA 4MJXA 3I74A 4IIXA 4C8CA 2X0SA 4JYWA 1ZYMA 4COGA 3KASA 1ZL0A 2HI6A 3T0TA 3NOJA 5K99A 3FEEA 4C84A 1EZBA 2XEJA 2PCNA 2CIJA 3T05A 4NGSA 3IIBA 4P4IA 3K4IA 4P4DA 4H1HA 3BHXA 3K9TA 5F09A 2MP0A 4INJA 2D0OA 1V6CA 2AUMA 2D0PA 4EYSA 4KNGE 3TLAA 4IIYA 1KBLA 4CZ1A 4OC5A 3VTAA 5D29A 3SJFA 3D7FA 3TYXA 1VI4A 2XEGA 4YN3A 2GP4A 4C86A 4CO9A 4NGQA 4MCQA 1JDBC 2C6GA 2XEFA 5IR2A 4MCRA 1Z8LA 1T36B 1Y9ZA 3FF3A 4OC1A 3S9LA 3TLCA 3S9NA 3G23A 4C8AA 4C8TA 4C8UA 4NGMA 3T07A 2EK8A 1C30B 2EZAA 4MCSA 1JDEA 1CE8B 4P4BA 1A9XB 2OR4A 4E94A 1VBGA 3D7GA 4JVOA 3TLZA 2OOTA 4P45A 2HWGA 4C9EA 4C99A 5FD8A 4E5SA 2E28A 3BXMA
chains in the Genus database with same CATH topology
4COBA 2B0AA 4J0NA 4CO9A 4CZ1A 4COGA 1R61A 3KRVA 4M8DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4COB A;  2B0A A;  4J0N A;  4CO9 A;  4CZ1 A;  4COG A;  1R61 A;  3KRV A;  4M8D A; 
#chains in the Genus database with same CATH topology
 4MCP A;  2EZC A;  4OC2 A;  4TWE A;  4NGP A;  1KC7 A;  1GGO A;  4TJX A;  2PVV A;  2YJV A;  3SR3 A;  3KRV A;  4NGT A;  2C6C A;  1ZRS A;  1VBH A;  4P4E A;  4OC0 A;  3S9M A;  1BXR B;  1EZA A;  2JBK A;  3FED A;  4C8F A;  1R61 A;  3ICU A;  3BI0 A;  2OLS A;  2XEI A;  2HRO A;  3I6S A;  3SJE A;  2R82 A;  3SJX A;  1WVM A;  4CDJ A;  5JYB A;  3TLG A;  4X3R A;  1M6V B;  3SJG A;  3TLG B;  2PVW A;  3EZB A;  5IB9 A;  2FM4 A;  2AUN A;  1KEE B;  3D7H A;  2DIK A;  5JVL A;  3GJZ A;  3IWW A;  4NGN A;  1DIK A;  2B0A A;  4C9R A;  1CX8 A;  5ELY A;  1CS0 B;  4CDK A;  4JZ0 A;  4C8P A;  5F5X A;  3TLB A;  2EK9 A;  1NXJ A;  4MI1 A;  3TLY A;  4OME A;  4W9Y A;  3EZE A;  3TLE A;  3U1B A;  1Q5X A;  1J3L A;  2JBJ A;  3BI1 A;  3EIF A;  3FEC A;  5F1Y A;  4OC3 A;  3C8O A;  2C5Q A;  4C85 A;  2EZB A;  4M8D A;  5F9M A;  4C9U A;  1DE4 C;  3D7D A;  1XF1 A;  3RBU A;  1C3O B;  1NBW A;  4LQG A;  4C9A A;  3EZA A;  2C6P A;  2YJT A;  4NGR A;  4P44 A;  4J0N A;  4OC4 A;  4TJV A;  3T5M A;  4P4F A;  4P4J A;  4COB A;  4C9V A;  4MJX A;  3I74 A;  4IIX A;  4C8C A;  2X0S A;  4JYW A;  1ZYM A;  4COG A;  3KAS A;  1ZL0 A;  2HI6 A;  3T0T A;  3NOJ A;  5K99 A;  3FEE A;  4C84 A;  1EZB A;  2XEJ A;  2PCN A;  2CIJ A;  3T05 A;  4NGS A;  3IIB A;  4P4I A;  3K4I A;  4P4D A;  4H1H A;  3BHX A;  3K9T A;  5F09 A;  2MP0 A;  4INJ A;  2D0O A;  1V6C A;  2AUM A;  2D0P A;  4EYS A;  4KNG E;  3TLA A;  4IIY A;  1KBL A;  4CZ1 A;  4OC5 A;  3VTA A;  5D29 A;  3SJF A;  3D7F A;  3TYX A;  1VI4 A;  2XEG A;  4YN3 A;  2GP4 A;  4C86 A;  4CO9 A;  4NGQ A;  4MCQ A;  1JDB C;  2C6G A;  2XEF A;  5IR2 A;  4MCR A;  1Z8L A;  1T36 B;  1Y9Z A;  3FF3 A;  4OC1 A;  3S9L A;  3TLC A;  3S9N A;  3G23 A;  4C8A A;  4C8T A;  4C8U A;  4NGM A;  3T07 A;  2EK8 A;  1C30 B;  2EZA A;  4MCS A;  1JDE A;  1CE8 B;  4P4B A;  1A9X B;  2OR4 A;  4E94 A;  1VBG A;  3D7G A;  4JVO A;  3TLZ A;  2OOT A;  4P45 A;  2HWG A;  4C9E A;  4C99 A;  5FD8 A;  4E5S A;  2E28 A;  3BXM A; 
#chains in the Genus database with same CATH homology
 4COB A;  2B0A A;  4J0N A;  4CO9 A;  4CZ1 A;  4COG A;  1R61 A;  3KRV A;  4M8D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...