4COGA

Crystal structure of kynurenine formamidase from burkholderia cenocepacia
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
207
structure length
207
Chain Sequence
TLWDISPPVSPATPVWPGDTPVAVERVWRMEAGSPVNVARLTLSPHTGAHCDAPLHYDADGAPIGAVPLDTYLGPCRVIHCIGAAPVVRPADVEAALDGVPPRVLLRTYARAAVEQWDSNFCAVAPDTVDLLAAHGVKLIGIDTPSLDPQESKTMDAHRRVRAHRMAILEGIVLDDVPPGDYELIALPLKFATLDASPVRAVLRALP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Bacterial Kynurenine Formamidase Reveals a Crowded Binuclear-Zinc Catalytic Site Primed to Generate a Potent Nucleophile.
pubmed doi rcsb
source organism Burkholderia cenocepacia
molecule tags Hydrolase
molecule keywords KYNURENINE FORMAMIDASE
total genus 54
structure length 207
sequence length 207
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.9: Arylformamidase.
pdb deposition date 2014-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04199 Cyclase Putative cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.50 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Putative cyclase 4cogA00
4COGA 4CO9A 4COBA 4J0NA 1R61A 3KRVA 4M8DA 2B0AA 4CZ1A
chains in the Genus database with same CATH superfamily
4C9AA 3T07A 2R82A 4IIXA 3EIFA 3KRVA 4OC3A 5ELYA 2PVVA 4C8FA 1V6CA 4CO9A 4MCPA 4EYSA 1NXJA 3K9TA 1EZBA 2XEGA 1WVMA 5JVLA 3TLCA 1ZRSA 3NOJA 5F5XA 4TJXA 4C8TA 3C8OA 3I74A 1A9XB 3EZEA 4NGMA 3T5MA 4JZ0A 3VTAA 4W9YA 4J0NA 3TLZA 5D29A 4M8DA 4OC5A 4P4BA 4P44A 2HI6A 4NGPA 3T0TA 4INJA 2AUNA 2D0OA 3BHXA 3EZBA 1R61A 2C5QA 1XF1A 4H1HA 1BXRB 1DE4C 2E28A 3D7HA 1KC7A 1GGOA 4OC4A 5IR2A 3K4IA 2OOTA 3RBUA 2PCNA 2EZCA 1VBHA 5K99A 1JDBC 1JDEA 3FEEA 3U1BA 3D7FA 5FD8A 2MP0A 4CDJA 4NGRA 2EZAA 1VI4A 4C84A 1C30B 4KNGE 2HROA 3SJFA 4P4JA 4C85A 4CZ1A 3EZAA 3G23A 4TJVA 3TLGA 2AUMA 3FECA 4COBA 5IB9A 3S9NA 2D0PA 3I6SA 2GP4A 4MCQA 5F1YA 4NGTA 1Y9ZA 2EZBA 2HWGA 4TWEA 4OC0A 4OC2A 4OMEA 1VBGA 3ICUA 4COGA 5F9MA 3TYXA 4YN3A 3GJZA 3KASA 3T05A 4P4EA 4NGQA 4NGNA 3TLAA 4E5SA 4JVOA 4P4IA 2EK8A 2CIJA 4P45A 2OR4A 4C8PA 1T36B 2C6CA 3TLYA 3FEDA 2B0AA 4E94A 2EK9A 4C86A 3BXMA 3IIBA 1DIKA 4CDKA 1EZAA 4C99A 3FF3A 3SJGA 4X3RA 2JBJA 2DIKA 2XEFA 4NGSA 2X0SA 2YJTA 1NBWA 2YJVA 3D7GA 2C6GA 4JYWA 5F09A 4C8CA 4C8AA 4OC1A 3SJXA 1CS0B 1J3LA 2C6PA 2OLSA 1KBLA 1C3OB 3TLEA 3TLBA 3S9MA 4C9VA 1ZL0A 4P4DA 2XEJA 3D7DA 2PVWA 4MCRA 5JYBA 3S9LA 1Z8LA 1M6VB 3IWWA 4C9UA 3SR3A 4MJXA 1ZYMA 1CE8B 2FM4A 1Q5XA 2XEIA 3TLGB 4MCSA 3BI0A 4IIYA 2JBKA 4C9RA 1CX8A 4MI1A 1KEEB 4P4FA 4C9EA 4LQGA 3BI1A 4C8UA 3SJEA
chains in the Genus database with same CATH topology
4COGA 4CO9A 4COBA 4J0NA 1R61A 3KRVA 4M8DA 2B0AA 4CZ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4COG A;  4CO9 A;  4COB A;  4J0N A;  1R61 A;  3KRV A;  4M8D A;  2B0A A;  4CZ1 A; 
#chains in the Genus database with same CATH topology
 4C9A A;  3T07 A;  2R82 A;  4IIX A;  3EIF A;  3KRV A;  4OC3 A;  5ELY A;  2PVV A;  4C8F A;  1V6C A;  4CO9 A;  4MCP A;  4EYS A;  1NXJ A;  3K9T A;  1EZB A;  2XEG A;  1WVM A;  5JVL A;  3TLC A;  1ZRS A;  3NOJ A;  5F5X A;  4TJX A;  4C8T A;  3C8O A;  3I74 A;  1A9X B;  3EZE A;  4NGM A;  3T5M A;  4JZ0 A;  3VTA A;  4W9Y A;  4J0N A;  3TLZ A;  5D29 A;  4M8D A;  4OC5 A;  4P4B A;  4P44 A;  2HI6 A;  4NGP A;  3T0T A;  4INJ A;  2AUN A;  2D0O A;  3BHX A;  3EZB A;  1R61 A;  2C5Q A;  1XF1 A;  4H1H A;  1BXR B;  1DE4 C;  2E28 A;  3D7H A;  1KC7 A;  1GGO A;  4OC4 A;  5IR2 A;  3K4I A;  2OOT A;  3RBU A;  2PCN A;  2EZC A;  1VBH A;  5K99 A;  1JDB C;  1JDE A;  3FEE A;  3U1B A;  3D7F A;  5FD8 A;  2MP0 A;  4CDJ A;  4NGR A;  2EZA A;  1VI4 A;  4C84 A;  1C30 B;  4KNG E;  2HRO A;  3SJF A;  4P4J A;  4C85 A;  4CZ1 A;  3EZA A;  3G23 A;  4TJV A;  3TLG A;  2AUM A;  3FEC A;  4COB A;  5IB9 A;  3S9N A;  2D0P A;  3I6S A;  2GP4 A;  4MCQ A;  5F1Y A;  4NGT A;  1Y9Z A;  2EZB A;  2HWG A;  4TWE A;  4OC0 A;  4OC2 A;  4OME A;  1VBG A;  3ICU A;  4COG A;  5F9M A;  3TYX A;  4YN3 A;  3GJZ A;  3KAS A;  3T05 A;  4P4E A;  4NGQ A;  4NGN A;  3TLA A;  4E5S A;  4JVO A;  4P4I A;  2EK8 A;  2CIJ A;  4P45 A;  2OR4 A;  4C8P A;  1T36 B;  2C6C A;  3TLY A;  3FED A;  2B0A A;  4E94 A;  2EK9 A;  4C86 A;  3BXM A;  3IIB A;  1DIK A;  4CDK A;  1EZA A;  4C99 A;  3FF3 A;  3SJG A;  4X3R A;  2JBJ A;  2DIK A;  2XEF A;  4NGS A;  2X0S A;  2YJT A;  1NBW A;  2YJV A;  3D7G A;  2C6G A;  4JYW A;  5F09 A;  4C8C A;  4C8A A;  4OC1 A;  3SJX A;  1CS0 B;  1J3L A;  2C6P A;  2OLS A;  1KBL A;  1C3O B;  3TLE A;  3TLB A;  3S9M A;  4C9V A;  1ZL0 A;  4P4D A;  2XEJ A;  3D7D A;  2PVW A;  4MCR A;  5JYB A;  3S9L A;  1Z8L A;  1M6V B;  3IWW A;  4C9U A;  3SR3 A;  4MJX A;  1ZYM A;  1CE8 B;  2FM4 A;  1Q5X A;  2XEI A;  3TLG B;  4MCS A;  3BI0 A;  4IIY A;  2JBK A;  4C9R A;  1CX8 A;  4MI1 A;  1KEE B;  4P4F A;  4C9E A;  4LQG A;  3BI1 A;  4C8U A;  3SJE A; 
#chains in the Genus database with same CATH homology
 4COG A;  4CO9 A;  4COB A;  4J0N A;  1R61 A;  3KRV A;  4M8D A;  2B0A A;  4CZ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...