4TJVA

Crystal structure of protease-associated domain of arabidopsis vacuolar sorting receptor 1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
165
structure length
165
Chain Sequence
GSRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQKACKSYSDFDISFKSKPGRLPTFVLIDRGDCYFTLKAWIAQQAGAAAILVADSKAEPLITMDTPEEDKSDADYLQNITIPSALITKTLGDSIKSALSGGDMVNMKLDWTESVPHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vacuolar-sorting receptor 1
publication title How vacuolar sorting receptor proteins interact with their cargo proteins: crystal structures of apo and cargo-bound forms of the protease-associated domain from an Arabidopsis vacuolar sorting receptor.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Protein transport
total genus 47
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2014-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4tjvA00
2XEFA 5ELYA 5F09A 4C99A 4YN3A 4C8CA 2EK8A 4C8PA 4P4FA 4C8TA 3SJXA 3RBUA 2CIJA 4C9UA 3FF3A 3SJEA 4C9EA 3BXMA 4NGSA 2XEGA 3EIFA 4P4JA 4P4BA 2OOTA 4TWEA 2C6GA 2C6CA 2PVVA 3SJFA 4P4DA 3S9NA 2PVWA 3SJGA 4OC0A 4CDKA 4MCPA 4C8UA 3S9MA 4OC3A 4OC4A 1Y9ZA 4C8AA 4NGMA 4MCQA 3IWWA 4OC5A 3D7GA 3BI1A 2C6PA 4C9AA 4NGQA 3D7HA 1CX8A 5IB9A 5D29A 3I74A 3I6SA 4C86A 4OMEA 3VTAA 2XEJA 3FECA 3BHXA 2JBKA 3D7DA 2JBJA 4NGRA 4C9VA 4W9YA 2EK9A 2OR4A 4P45A 1WVMA 2XEIA 4OC2A 3FEDA 4P4EA 4JZ0A 3D7FA 4CDJA 4JYWA 4P4IA 3BI0A 4KNGE 4C9RA 4TJXA 3S9LA 4TJVA 1XF1A 1V6CA 4C8FA 4MCRA 4NGNA 4X3RA 4C85A 1Z8LA 4NGTA 1DE4C 3IIBA 3FEEA 4P44A 3KASA 4LQGA 4OC1A 4C84A 4NGPA 4MCSA 3ICUA
chains in the Genus database with same CATH superfamily
2XEFA 5ELYA 3TYXA 5F09A 3T05A 4C99A 1KEEB 1EZBA 4YN3A 4C8CA 1ZYMA 2EK8A 4C8PA 4P4FA 4C8TA 3SJXA 3K9TA 5F5XA 3RBUA 4IIYA 1ZRSA 2CIJA 4C9UA 2YJVA 3FF3A 3SJEA 4C9EA 2AUNA 5IR2A 2FM4A 3BXMA 4E94A 4NGSA 4EYSA 2XEGA 3SR3A 3EIFA 2YJTA 1VBHA 4P4JA 4P4BA 2OOTA 4M8DA 1C30B 4TWEA 3TLYA 1NBWA 2D0PA 2B0AA 2C6GA 2C6CA 2HROA 2PVVA 4IIXA 3SJFA 3EZEA 4P4DA 3S9NA 3TLAA 2PVWA 1M6VB 3SJGA 4OC0A 4CDKA 4MCPA 3GJZA 4C8UA 3S9MA 4OC3A 4OC4A 1Y9ZA 4MJXA 4E5SA 4C8AA 2HI6A 3NOJA 4NGMA 3G23A 4COBA 1JDEA 4MCQA 5FD8A 3IWWA 4OC5A 4CO9A 5F9MA 3TLCA 1JDBC 3C8OA 3D7GA 3T07A 3BI1A 5JVLA 2C6PA 4C9AA 4NGQA 3D7HA 3KRVA 2HWGA 1CX8A 3TLGB 5IB9A 5D29A 3I74A 3I6SA 1T36B 2D0OA 4MI1A 3T5MA 2E28A 4C86A 5JYBA 4OMEA 3K4IA 3VTAA 2R82A 1GGOA 1KC7A 1R61A 2XEJA 3FECA 3BHXA 3T0TA 2JBKA 3D7DA 2JBJA 1NXJA 4NGRA 4C9VA 4W9YA 1Q5XA 4H1HA 2EK9A 2OR4A 3TLZA 5K99A 4P45A 2AUMA 1WVMA 2EZBA 1VI4A 2XEIA 4OC2A 1A9XB 1J3LA 1ZL0A 3TLGA 3FEDA 2PCNA 4P4EA 2MP0A 3D7FA 4JZ0A 4CDJA 2EZAA 1KBLA 1CE8B 4JYWA 2EZCA 4JVOA 2X0SA 4P4IA 3U1BA 3BI0A 3TLEA 1DIKA 4J0NA 4KNGE 2DIKA 4TJXA 4C9RA 2C5QA 1BXRB 3S9LA 3TLBA 4TJVA 1XF1A 1V6CA 3EZBA 4C8FA 4MCRA 1VBGA 2GP4A 4INJA 4NGNA 1C3OB 4X3RA 1CS0B 3EZAA 4C85A 1Z8LA 4NGTA 4CZ1A 5F1YA 1DE4C 3IIBA 1EZAA 3FEEA 4P44A 3KASA 4LQGA 4OC1A 4C84A 4COGA 4NGPA 4MCSA 2OLSA 3ICUA
chains in the Genus database with same CATH topology
2XEFA 5ELYA 5F09A 4C99A 4YN3A 4C8CA 2EK8A 4C8PA 4P4FA 4C8TA 3SJXA 3K9TA 3RBUA 2CIJA 4C9UA 3FF3A 3SJEA 4C9EA 5IR2A 3BXMA 4NGSA 2XEGA 3EIFA 4P4JA 4P4BA 2OOTA 4TWEA 2C6GA 2C6CA 2PVVA 3SJFA 4P4DA 3S9NA 2PVWA 3SJGA 4OC0A 4CDKA 4MCPA 4C8UA 3S9MA 4OC3A 4OC4A 1Y9ZA 4C8AA 4NGMA 4MCQA 3IWWA 4OC5A 3D7GA 3BI1A 2C6PA 4C9AA 4NGQA 3D7HA 1CX8A 5IB9A 5D29A 3I74A 3I6SA 4C86A 4OMEA 3VTAA 2XEJA 3FECA 3BHXA 2JBKA 3D7DA 2JBJA 4NGRA 4C9VA 4W9YA 2EK9A 2OR4A 4P45A 1WVMA 2XEIA 4OC2A 3FEDA 4P4EA 4JZ0A 3D7FA 4CDJA 4JYWA 4P4IA 3BI0A 4KNGE 4C9RA 4TJXA 2C5QA 3S9LA 4TJVA 1XF1A 1V6CA 4C8FA 4MCRA 2GP4A 4NGNA 4X3RA 4C85A 1Z8LA 4NGTA 1DE4C 3IIBA 3FEEA 4P44A 3KASA 4LQGA 4OC1A 4C84A 4NGPA 4MCSA 3ICUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XEF A;  5ELY A;  5F09 A;  4C99 A;  4YN3 A;  4C8C A;  2EK8 A;  4C8P A;  4P4F A;  4C8T A;  3SJX A;  3RBU A;  2CIJ A;  4C9U A;  3FF3 A;  3SJE A;  4C9E A;  3BXM A;  4NGS A;  2XEG A;  3EIF A;  4P4J A;  4P4B A;  2OOT A;  4TWE A;  2C6G A;  2C6C A;  2PVV A;  3SJF A;  4P4D A;  3S9N A;  2PVW A;  3SJG A;  4OC0 A;  4CDK A;  4MCP A;  4C8U A;  3S9M A;  4OC3 A;  4OC4 A;  1Y9Z A;  4C8A A;  4NGM A;  4MCQ A;  3IWW A;  4OC5 A;  3D7G A;  3BI1 A;  2C6P A;  4C9A A;  4NGQ A;  3D7H A;  1CX8 A;  5IB9 A;  5D29 A;  3I74 A;  3I6S A;  4C86 A;  4OME A;  3VTA A;  2XEJ A;  3FEC A;  3BHX A;  2JBK A;  3D7D A;  2JBJ A;  4NGR A;  4C9V A;  4W9Y A;  2EK9 A;  2OR4 A;  4P45 A;  1WVM A;  2XEI A;  4OC2 A;  3FED A;  4P4E A;  4JZ0 A;  3D7F A;  4CDJ A;  4JYW A;  4P4I A;  3BI0 A;  4KNG E;  4C9R A;  4TJX A;  3S9L A;  4TJV A;  1XF1 A;  1V6C A;  4C8F A;  4MCR A;  4NGN A;  4X3R A;  4C85 A;  1Z8L A;  4NGT A;  1DE4 C;  3IIB A;  3FEE A;  4P44 A;  3KAS A;  4LQG A;  4OC1 A;  4C84 A;  4NGP A;  4MCS A;  3ICU A; 
#chains in the Genus database with same CATH topology
 2XEF A;  5ELY A;  3TYX A;  5F09 A;  3T05 A;  4C99 A;  1KEE B;  1EZB A;  4YN3 A;  4C8C A;  1ZYM A;  2EK8 A;  4C8P A;  4P4F A;  4C8T A;  3SJX A;  3K9T A;  5F5X A;  3RBU A;  4IIY A;  1ZRS A;  2CIJ A;  4C9U A;  2YJV A;  3FF3 A;  3SJE A;  4C9E A;  2AUN A;  5IR2 A;  2FM4 A;  3BXM A;  4E94 A;  4NGS A;  4EYS A;  2XEG A;  3SR3 A;  3EIF A;  2YJT A;  1VBH A;  4P4J A;  4P4B A;  2OOT A;  4M8D A;  1C30 B;  4TWE A;  3TLY A;  1NBW A;  2D0P A;  2B0A A;  2C6G A;  2C6C A;  2HRO A;  2PVV A;  4IIX A;  3SJF A;  3EZE A;  4P4D A;  3S9N A;  3TLA A;  2PVW A;  1M6V B;  3SJG A;  4OC0 A;  4CDK A;  4MCP A;  3GJZ A;  4C8U A;  3S9M A;  4OC3 A;  4OC4 A;  1Y9Z A;  4MJX A;  4E5S A;  4C8A A;  2HI6 A;  3NOJ A;  4NGM A;  3G23 A;  4COB A;  1JDE A;  4MCQ A;  5FD8 A;  3IWW A;  4OC5 A;  4CO9 A;  5F9M A;  3TLC A;  1JDB C;  3C8O A;  3D7G A;  3T07 A;  3BI1 A;  5JVL A;  2C6P A;  4C9A A;  4NGQ A;  3D7H A;  3KRV A;  2HWG A;  1CX8 A;  3TLG B;  5IB9 A;  5D29 A;  3I74 A;  3I6S A;  1T36 B;  2D0O A;  4MI1 A;  3T5M A;  2E28 A;  4C86 A;  5JYB A;  4OME A;  3K4I A;  3VTA A;  2R82 A;  1GGO A;  1KC7 A;  1R61 A;  2XEJ A;  3FEC A;  3BHX A;  3T0T A;  2JBK A;  3D7D A;  2JBJ A;  1NXJ A;  4NGR A;  4C9V A;  4W9Y A;  1Q5X A;  4H1H A;  2EK9 A;  2OR4 A;  3TLZ A;  5K99 A;  4P45 A;  2AUM A;  1WVM A;  2EZB A;  1VI4 A;  2XEI A;  4OC2 A;  1A9X B;  1J3L A;  1ZL0 A;  3TLG A;  3FED A;  2PCN A;  4P4E A;  2MP0 A;  3D7F A;  4JZ0 A;  4CDJ A;  2EZA A;  1KBL A;  1CE8 B;  4JYW A;  2EZC A;  4JVO A;  2X0S A;  4P4I A;  3U1B A;  3BI0 A;  3TLE A;  1DIK A;  4J0N A;  4KNG E;  2DIK A;  4TJX A;  4C9R A;  2C5Q A;  1BXR B;  3S9L A;  3TLB A;  4TJV A;  1XF1 A;  1V6C A;  3EZB A;  4C8F A;  4MCR A;  1VBG A;  2GP4 A;  4INJ A;  4NGN A;  1C3O B;  4X3R A;  1CS0 B;  3EZA A;  4C85 A;  1Z8L A;  4NGT A;  4CZ1 A;  5F1Y A;  1DE4 C;  3IIB A;  1EZA A;  3FEE A;  4P44 A;  3KAS A;  4LQG A;  4OC1 A;  4C84 A;  4COG A;  4NGP A;  4MCS A;  2OLS A;  3ICU A; 
#chains in the Genus database with same CATH homology
 2XEF A;  5ELY A;  5F09 A;  4C99 A;  4YN3 A;  4C8C A;  2EK8 A;  4C8P A;  4P4F A;  4C8T A;  3SJX A;  3K9T A;  3RBU A;  2CIJ A;  4C9U A;  3FF3 A;  3SJE A;  4C9E A;  5IR2 A;  3BXM A;  4NGS A;  2XEG A;  3EIF A;  4P4J A;  4P4B A;  2OOT A;  4TWE A;  2C6G A;  2C6C A;  2PVV A;  3SJF A;  4P4D A;  3S9N A;  2PVW A;  3SJG A;  4OC0 A;  4CDK A;  4MCP A;  4C8U A;  3S9M A;  4OC3 A;  4OC4 A;  1Y9Z A;  4C8A A;  4NGM A;  4MCQ A;  3IWW A;  4OC5 A;  3D7G A;  3BI1 A;  2C6P A;  4C9A A;  4NGQ A;  3D7H A;  1CX8 A;  5IB9 A;  5D29 A;  3I74 A;  3I6S A;  4C86 A;  4OME A;  3VTA A;  2XEJ A;  3FEC A;  3BHX A;  2JBK A;  3D7D A;  2JBJ A;  4NGR A;  4C9V A;  4W9Y A;  2EK9 A;  2OR4 A;  4P45 A;  1WVM A;  2XEI A;  4OC2 A;  3FED A;  4P4E A;  4JZ0 A;  3D7F A;  4CDJ A;  4JYW A;  4P4I A;  3BI0 A;  4KNG E;  4C9R A;  4TJX A;  2C5Q A;  3S9L A;  4TJV A;  1XF1 A;  1V6C A;  4C8F A;  4MCR A;  2GP4 A;  4NGN A;  4X3R A;  4C85 A;  1Z8L A;  4NGT A;  1DE4 C;  3IIB A;  3FEE A;  4P44 A;  3KAS A;  4LQG A;  4OC1 A;  4C84 A;  4NGP A;  4MCS A;  3ICU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...