4TJVA

Crystal structure of protease-associated domain of arabidopsis vacuolar sorting receptor 1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
165
structure length
165
Chain Sequence
GSRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQKACKSYSDFDISFKSKPGRLPTFVLIDRGDCYFTLKAWIAQQAGAAAILVADSKAEPLITMDTPEEDKSDADYLQNITIPSALITKTLGDSIKSALSGGDMVNMKLDWTESVPHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Vacuolar-sorting receptor 1
publication title How vacuolar sorting receptor proteins interact with their cargo proteins: crystal structures of apo and cargo-bound forms of the protease-associated domain from an Arabidopsis vacuolar sorting receptor.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 47
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2014-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4tjvA00
4OC2A 4OC0A 4OC3A 4NGPA 4C8CA 1XF1A 4C84A 4JYWA 1WVMA 3SJGA 4NGNA 4P4FA 3KASA 3D7DA 3SJEA 3BI0A 3BXMA 4P45A 2OR4A 3BHXA 4MCSA 5IB9A 4C86A 2XEJA 4TWEA 4X3RA 2PVVA 4P4IA 4C9VA 2PVWA 4MCPA 4C9AA 1Z8LA 3D7FA 4P4BA 4TJVA 2XEGA 4NGMA 4TJXA 3FECA 2EK8A 4OC5A 3D7GA 4W9YA 4NGRA 4P4JA 4C9EA 3EIFA 4OC4A 2OOTA 2C6CA 4C99A 3S9LA 4NGTA 3FF3A 3S9MA 3I74A 3IWWA 4C8TA 4NGSA 5F09A 5D29A 4C8FA 3BI1A 3S9NA 3FEEA 4OMEA 4P44A 2XEFA 2JBJA 4NGQA 4C8AA 4YN3A 2CIJA 3I6SA 4OC1A 3SJXA 3IIBA 4LQGA 4C9RA 4C8PA 3D7HA 2C6GA 4P4DA 2EK9A 4JZ0A 1CX8A 1Y9ZA 4MCRA 3ICUA 3FEDA 4MCQA 1V6CA 2C6PA 4C9UA 4KNGE 3RBUA 4CDJA 1DE4C 4C8UA 4CDKA 3SJFA 2XEIA 5ELYA 4P4EA 2JBKA 4C85A 3VTAA
chains in the Genus database with same CATH superfamily
4OC2A 4OC0A 5F1YA 4OC3A 2E28A 2YJTA 4NGPA 4C8CA 1XF1A 1A9XB 4C84A 4JYWA 1WVMA 3SJGA 1DIKA 2B0AA 3U1BA 4NGNA 4P4FA 3KASA 3D7DA 3SJEA 3BI0A 3BXMA 3GJZA 4P45A 2HROA 2D0OA 1ZL0A 1ZRSA 3TLAA 2OR4A 3BHXA 4MCSA 3TLBA 5IB9A 1VI4A 4C86A 4COBA 4MI1A 2XEJA 4TWEA 4X3RA 2PVVA 3EZAA 4IIYA 4P4IA 4C9VA 5JYBA 2PVWA 2EZBA 4MCPA 3G23A 2EZCA 4C9AA 1Z8LA 3D7FA 4P4BA 1VBHA 1C3OB 1BXRB 4TJVA 2OLSA 2R82A 3K4IA 2XEGA 3TYXA 4NGMA 1R61A 3FECA 2EK8A 4TJXA 1KEEB 4OC5A 3D7GA 4W9YA 2GP4A 4NGRA 3EZBA 1NBWA 4P4JA 4C9EA 3C8OA 2EZAA 4M8DA 2AUNA 3EIFA 4OC4A 3KRVA 2OOTA 2C6CA 2HWGA 3NOJA 4C99A 3S9LA 3TLGB 1ZYMA 4NGTA 3FF3A 3S9MA 1CS0B 3I74A 4E5SA 3IWWA 4C8TA 4NGSA 3TLZA 5F09A 4H1HA 4E94A 3TLEA 2MP0A 3TLYA 5D29A 2FM4A 2AUMA 2X0SA 4JVOA 4C8FA 1Q5XA 3BI1A 3K9TA 3SR3A 1NXJA 3S9NA 3FEEA 1EZBA 4OMEA 4IIXA 4P44A 2XEFA 2JBJA 4INJA 4NGQA 5F9MA 3TLCA 4C8AA 4YN3A 2CIJA 3I6SA 4OC1A 3SJXA 3IIBA 2C5QA 1CE8B 4LQGA 4COGA 4C9RA 4EYSA 4C8PA 2HI6A 3D7HA 2C6GA 4P4DA 4CO9A 5IR2A 1EZAA 1JDEA 2EK9A 4JZ0A 3T5MA 1CX8A 5JVLA 1T36B 1VBGA 1Y9ZA 2YJVA 1GGOA 3FEDA 3ICUA 4MCQA 4MCRA 5FD8A 1V6CA 2D0PA 2C6PA 3EZEA 4KNGE 4C9UA 3RBUA 4CDJA 3T0TA 3T05A 1C30B 1DE4C 3TLGA 4J0NA 4C8UA 1JDBC 1M6VB 2PCNA 5F5XA 4CDKA 3SJFA 2XEIA 3T07A 1KC7A 4CZ1A 5ELYA 5K99A 4MJXA 4P4EA 2DIKA 2JBKA 4C85A 1KBLA 1J3LA 3VTAA
chains in the Genus database with same CATH topology
4OC2A 4OC0A 4OC3A 4NGPA 4C8CA 1XF1A 4C84A 4JYWA 1WVMA 3SJGA 4NGNA 4P4FA 3KASA 3D7DA 3SJEA 3BI0A 3BXMA 4P45A 2OR4A 3BHXA 4MCSA 5IB9A 4C86A 2XEJA 4TWEA 4X3RA 2PVVA 4P4IA 4C9VA 2PVWA 4MCPA 4C9AA 1Z8LA 3D7FA 4P4BA 4TJVA 2XEGA 4NGMA 4TJXA 3FECA 2EK8A 4OC5A 3D7GA 4W9YA 2GP4A 4NGRA 4P4JA 4C9EA 3EIFA 4OC4A 2OOTA 2C6CA 4C99A 3S9LA 4NGTA 3FF3A 3S9MA 3I74A 3IWWA 4C8TA 4NGSA 5F09A 5D29A 4C8FA 3BI1A 3K9TA 3S9NA 3FEEA 4OMEA 4P44A 2XEFA 2JBJA 4NGQA 4C8AA 4YN3A 2CIJA 3I6SA 4OC1A 3SJXA 3IIBA 2C5QA 4LQGA 4C9RA 4C8PA 3D7HA 2C6GA 4P4DA 5IR2A 2EK9A 4JZ0A 1CX8A 1Y9ZA 4MCRA 3ICUA 3FEDA 4MCQA 1V6CA 2C6PA 4C9UA 4KNGE 3RBUA 4CDJA 1DE4C 4C8UA 4CDKA 3SJFA 2XEIA 5ELYA 4P4EA 2JBKA 4C85A 3VTAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OC2 A;  4OC0 A;  4OC3 A;  4NGP A;  4C8C A;  1XF1 A;  4C84 A;  4JYW A;  1WVM A;  3SJG A;  4NGN A;  4P4F A;  3KAS A;  3D7D A;  3SJE A;  3BI0 A;  3BXM A;  4P45 A;  2OR4 A;  3BHX A;  4MCS A;  5IB9 A;  4C86 A;  2XEJ A;  4TWE A;  4X3R A;  2PVV A;  4P4I A;  4C9V A;  2PVW A;  4MCP A;  4C9A A;  1Z8L A;  3D7F A;  4P4B A;  4TJV A;  2XEG A;  4NGM A;  4TJX A;  3FEC A;  2EK8 A;  4OC5 A;  3D7G A;  4W9Y A;  4NGR A;  4P4J A;  4C9E A;  3EIF A;  4OC4 A;  2OOT A;  2C6C A;  4C99 A;  3S9L A;  4NGT A;  3FF3 A;  3S9M A;  3I74 A;  3IWW A;  4C8T A;  4NGS A;  5F09 A;  5D29 A;  4C8F A;  3BI1 A;  3S9N A;  3FEE A;  4OME A;  4P44 A;  2XEF A;  2JBJ A;  4NGQ A;  4C8A A;  4YN3 A;  2CIJ A;  3I6S A;  4OC1 A;  3SJX A;  3IIB A;  4LQG A;  4C9R A;  4C8P A;  3D7H A;  2C6G A;  4P4D A;  2EK9 A;  4JZ0 A;  1CX8 A;  1Y9Z A;  4MCR A;  3ICU A;  3FED A;  4MCQ A;  1V6C A;  2C6P A;  4C9U A;  4KNG E;  3RBU A;  4CDJ A;  1DE4 C;  4C8U A;  4CDK A;  3SJF A;  2XEI A;  5ELY A;  4P4E A;  2JBK A;  4C85 A;  3VTA A; 
#chains in the Genus database with same CATH topology
 4OC2 A;  4OC0 A;  5F1Y A;  4OC3 A;  2E28 A;  2YJT A;  4NGP A;  4C8C A;  1XF1 A;  1A9X B;  4C84 A;  4JYW A;  1WVM A;  3SJG A;  1DIK A;  2B0A A;  3U1B A;  4NGN A;  4P4F A;  3KAS A;  3D7D A;  3SJE A;  3BI0 A;  3BXM A;  3GJZ A;  4P45 A;  2HRO A;  2D0O A;  1ZL0 A;  1ZRS A;  3TLA A;  2OR4 A;  3BHX A;  4MCS A;  3TLB A;  5IB9 A;  1VI4 A;  4C86 A;  4COB A;  4MI1 A;  2XEJ A;  4TWE A;  4X3R A;  2PVV A;  3EZA A;  4IIY A;  4P4I A;  4C9V A;  5JYB A;  2PVW A;  2EZB A;  4MCP A;  3G23 A;  2EZC A;  4C9A A;  1Z8L A;  3D7F A;  4P4B A;  1VBH A;  1C3O B;  1BXR B;  4TJV A;  2OLS A;  2R82 A;  3K4I A;  2XEG A;  3TYX A;  4NGM A;  1R61 A;  3FEC A;  2EK8 A;  4TJX A;  1KEE B;  4OC5 A;  3D7G A;  4W9Y A;  2GP4 A;  4NGR A;  3EZB A;  1NBW A;  4P4J A;  4C9E A;  3C8O A;  2EZA A;  4M8D A;  2AUN A;  3EIF A;  4OC4 A;  3KRV A;  2OOT A;  2C6C A;  2HWG A;  3NOJ A;  4C99 A;  3S9L A;  3TLG B;  1ZYM A;  4NGT A;  3FF3 A;  3S9M A;  1CS0 B;  3I74 A;  4E5S A;  3IWW A;  4C8T A;  4NGS A;  3TLZ A;  5F09 A;  4H1H A;  4E94 A;  3TLE A;  2MP0 A;  3TLY A;  5D29 A;  2FM4 A;  2AUM A;  2X0S A;  4JVO A;  4C8F A;  1Q5X A;  3BI1 A;  3K9T A;  3SR3 A;  1NXJ A;  3S9N A;  3FEE A;  1EZB A;  4OME A;  4IIX A;  4P44 A;  2XEF A;  2JBJ A;  4INJ A;  4NGQ A;  5F9M A;  3TLC A;  4C8A A;  4YN3 A;  2CIJ A;  3I6S A;  4OC1 A;  3SJX A;  3IIB A;  2C5Q A;  1CE8 B;  4LQG A;  4COG A;  4C9R A;  4EYS A;  4C8P A;  2HI6 A;  3D7H A;  2C6G A;  4P4D A;  4CO9 A;  5IR2 A;  1EZA A;  1JDE A;  2EK9 A;  4JZ0 A;  3T5M A;  1CX8 A;  5JVL A;  1T36 B;  1VBG A;  1Y9Z A;  2YJV A;  1GGO A;  3FED A;  3ICU A;  4MCQ A;  4MCR A;  5FD8 A;  1V6C A;  2D0P A;  2C6P A;  3EZE A;  4KNG E;  4C9U A;  3RBU A;  4CDJ A;  3T0T A;  3T05 A;  1C30 B;  1DE4 C;  3TLG A;  4J0N A;  4C8U A;  1JDB C;  1M6V B;  2PCN A;  5F5X A;  4CDK A;  3SJF A;  2XEI A;  3T07 A;  1KC7 A;  4CZ1 A;  5ELY A;  5K99 A;  4MJX A;  4P4E A;  2DIK A;  2JBK A;  4C85 A;  1KBL A;  1J3L A;  3VTA A; 
#chains in the Genus database with same CATH homology
 4OC2 A;  4OC0 A;  4OC3 A;  4NGP A;  4C8C A;  1XF1 A;  4C84 A;  4JYW A;  1WVM A;  3SJG A;  4NGN A;  4P4F A;  3KAS A;  3D7D A;  3SJE A;  3BI0 A;  3BXM A;  4P45 A;  2OR4 A;  3BHX A;  4MCS A;  5IB9 A;  4C86 A;  2XEJ A;  4TWE A;  4X3R A;  2PVV A;  4P4I A;  4C9V A;  2PVW A;  4MCP A;  4C9A A;  1Z8L A;  3D7F A;  4P4B A;  4TJV A;  2XEG A;  4NGM A;  4TJX A;  3FEC A;  2EK8 A;  4OC5 A;  3D7G A;  4W9Y A;  2GP4 A;  4NGR A;  4P4J A;  4C9E A;  3EIF A;  4OC4 A;  2OOT A;  2C6C A;  4C99 A;  3S9L A;  4NGT A;  3FF3 A;  3S9M A;  3I74 A;  3IWW A;  4C8T A;  4NGS A;  5F09 A;  5D29 A;  4C8F A;  3BI1 A;  3K9T A;  3S9N A;  3FEE A;  4OME A;  4P44 A;  2XEF A;  2JBJ A;  4NGQ A;  4C8A A;  4YN3 A;  2CIJ A;  3I6S A;  4OC1 A;  3SJX A;  3IIB A;  2C5Q A;  4LQG A;  4C9R A;  4C8P A;  3D7H A;  2C6G A;  4P4D A;  5IR2 A;  2EK9 A;  4JZ0 A;  1CX8 A;  1Y9Z A;  4MCR A;  3ICU A;  3FED A;  4MCQ A;  1V6C A;  2C6P A;  4C9U A;  4KNG E;  3RBU A;  4CDJ A;  1DE4 C;  4C8U A;  4CDK A;  3SJF A;  2XEI A;  5ELY A;  4P4E A;  2JBK A;  4C85 A;  3VTA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...