4TJVA

Crystal structure of protease-associated domain of arabidopsis vacuolar sorting receptor 1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
165
structure length
165
Chain Sequence
GSRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQKACKSYSDFDISFKSKPGRLPTFVLIDRGDCYFTLKAWIAQQAGAAAILVADSKAEPLITMDTPEEDKSDADYLQNITIPSALITKTLGDSIKSALSGGDMVNMKLDWTESVPHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How vacuolar sorting receptor proteins interact with their cargo proteins: crystal structures of apo and cargo-bound forms of the protease-associated domain from an Arabidopsis vacuolar sorting receptor.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Protein transport
molecule keywords Vacuolar-sorting receptor 1
total genus 47
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2014-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4tjvA00
4YN3A 4MCPA 3S9NA 1Z8LA 4NGRA 4OC1A 5F09A 4P4EA 3SJXA 4C99A 5ELYA 3I74A 4OC2A 2EK8A 3D7FA 4OMEA 2XEJA 2XEIA 3EIFA 4MCSA 4C8PA 1DE4C 4LQGA 4OC4A 3FEDA 2C6CA 4C84A 4KNGE 1V6CA 4P4BA 4NGSA 3FECA 5IB9A 2C6PA 4P45A 3S9MA 4NGMA 3BXMA 2OOTA 1XF1A 4MCRA 3FEEA 2PVVA 3RBUA 4MCQA 4C8FA 5D29A 1CX8A 3BHXA 3I6SA 2JBKA 4NGTA 4C85A 4C8UA 3D7GA 4W9YA 3IIBA 3SJFA 3S9LA 4C9EA 4C8CA 4CDKA 4C9RA 2XEFA 3BI0A 4C86A 4TJVA 4TJXA 2JBJA 4C8TA 4NGNA 4C9AA 3D7DA 3ICUA 4NGQA 4C9UA 1WVMA 3IWWA 4OC5A 4NGPA 4OC0A 4P4JA 1Y9ZA 2C6GA 4P4FA 3BI1A 4P4DA 4CDJA 2OR4A 4P4IA 4P44A 3SJGA 4TWEA 3VTAA 4C8AA 2XEGA 4OC3A 3D7HA 3KASA 4JYWA 2PVWA 4X3RA 2CIJA 2EK9A 4JZ0A 3SJEA 3FF3A 4C9VA
chains in the Genus database with same CATH superfamily
4YN3A 4MCPA 3S9NA 1Z8LA 4NGRA 4OC1A 2OLSA 5F09A 1CS0B 2X0SA 4P4EA 2D0OA 4IIXA 3SJXA 4CO9A 1EZAA 4C99A 5ELYA 3I74A 4OC2A 2EK8A 2GP4A 4E94A 3D7FA 4OMEA 2HROA 2XEJA 2XEIA 3EIFA 4INJA 3GJZA 2DIKA 4MCSA 4C8PA 3TLGA 1A9XB 4COBA 1DE4C 4LQGA 4OC4A 3FEDA 2C6CA 5JVLA 4C84A 2R82A 4KNGE 1V6CA 1ZRSA 2C5QA 4CZ1A 4P4BA 4NGSA 2E28A 3TLBA 3NOJA 3T07A 3FECA 5IB9A 4H1HA 3C8OA 1KC7A 4E5SA 1JDBC 2C6PA 2PCNA 3T05A 1VBHA 3TLCA 1M6VB 1C3OB 4P45A 3S9MA 4NGMA 3T5MA 3BXMA 2OOTA 1Q5XA 1T36B 1NXJA 1XF1A 4MCRA 3FEEA 2PVVA 3RBUA 4MCQA 4MI1A 4C8FA 5D29A 1CX8A 4IIYA 4M8DA 3BHXA 3I6SA 5K99A 1KBLA 3G23A 2JBKA 1EZBA 3KRVA 4NGTA 4C85A 4C8UA 5IR2A 3D7GA 3TLYA 4W9YA 1J3LA 2AUNA 3IIBA 1NBWA 2EZAA 5FD8A 3SJFA 1VI4A 1DIKA 3S9LA 4C9EA 4C8CA 4CDKA 4J0NA 1BXRB 4C9RA 2XEFA 1CE8B 3BI0A 3TLEA 2AUMA 5F5XA 3TLZA 4C86A 4TJVA 4TJXA 2JBJA 2B0AA 3TYXA 4NGNA 4C8TA 4C9AA 2FM4A 3D7DA 3ICUA 4NGQA 1KEEB 4C9UA 3K4IA 1WVMA 3IWWA 4OC5A 4NGPA 2HWGA 2HI6A 4OC0A 3U1BA 1VBGA 4P4JA 1Y9ZA 3EZBA 1C30B 1JDEA 2C6GA 4P4FA 3BI1A 4JVOA 4P4DA 3EZAA 4CDJA 2OR4A 1R61A 2D0PA 4P4IA 2YJVA 4P44A 3SJGA 4TWEA 3VTAA 1GGOA 3TLGB 2EZBA 4C8AA 3EZEA 3SR3A 4EYSA 1ZL0A 2XEGA 4OC3A 3D7HA 3KASA 2MP0A 2EZCA 4JYWA 4COGA 3T0TA 2PVWA 5F1YA 4X3RA 4MJXA 3TLAA 2CIJA 2YJTA 2EK9A 5F9MA 5JYBA 1ZYMA 3K9TA 4JZ0A 3SJEA 3FF3A 4C9VA
chains in the Genus database with same CATH topology
4YN3A 4MCPA 3S9NA 1Z8LA 4NGRA 4OC1A 5F09A 4P4EA 3SJXA 4C99A 5ELYA 3I74A 4OC2A 2EK8A 2GP4A 3D7FA 4OMEA 2XEJA 2XEIA 3EIFA 4MCSA 4C8PA 1DE4C 4LQGA 4OC4A 3FEDA 2C6CA 4C84A 4KNGE 1V6CA 2C5QA 4P4BA 4NGSA 3FECA 5IB9A 2C6PA 4P45A 3S9MA 4NGMA 3BXMA 2OOTA 1XF1A 4MCRA 3FEEA 2PVVA 3RBUA 4MCQA 4C8FA 5D29A 1CX8A 3BHXA 3I6SA 2JBKA 4NGTA 4C85A 4C8UA 5IR2A 3D7GA 4W9YA 3IIBA 3SJFA 3S9LA 4C9EA 4C8CA 4CDKA 4C9RA 2XEFA 3BI0A 4C86A 4TJVA 4TJXA 2JBJA 4C8TA 4NGNA 4C9AA 3D7DA 3ICUA 4NGQA 4C9UA 1WVMA 3IWWA 4OC5A 4NGPA 4OC0A 4P4JA 1Y9ZA 2C6GA 4P4FA 3BI1A 4P4DA 4CDJA 2OR4A 4P4IA 4P44A 3SJGA 4TWEA 3VTAA 4C8AA 2XEGA 4OC3A 3D7HA 3KASA 4JYWA 2PVWA 4X3RA 2CIJA 2EK9A 3K9TA 4JZ0A 3SJEA 3FF3A 4C9VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YN3 A;  4MCP A;  3S9N A;  1Z8L A;  4NGR A;  4OC1 A;  5F09 A;  4P4E A;  3SJX A;  4C99 A;  5ELY A;  3I74 A;  4OC2 A;  2EK8 A;  3D7F A;  4OME A;  2XEJ A;  2XEI A;  3EIF A;  4MCS A;  4C8P A;  1DE4 C;  4LQG A;  4OC4 A;  3FED A;  2C6C A;  4C84 A;  4KNG E;  1V6C A;  4P4B A;  4NGS A;  3FEC A;  5IB9 A;  2C6P A;  4P45 A;  3S9M A;  4NGM A;  3BXM A;  2OOT A;  1XF1 A;  4MCR A;  3FEE A;  2PVV A;  3RBU A;  4MCQ A;  4C8F A;  5D29 A;  1CX8 A;  3BHX A;  3I6S A;  2JBK A;  4NGT A;  4C85 A;  4C8U A;  3D7G A;  4W9Y A;  3IIB A;  3SJF A;  3S9L A;  4C9E A;  4C8C A;  4CDK A;  4C9R A;  2XEF A;  3BI0 A;  4C86 A;  4TJV A;  4TJX A;  2JBJ A;  4C8T A;  4NGN A;  4C9A A;  3D7D A;  3ICU A;  4NGQ A;  4C9U A;  1WVM A;  3IWW A;  4OC5 A;  4NGP A;  4OC0 A;  4P4J A;  1Y9Z A;  2C6G A;  4P4F A;  3BI1 A;  4P4D A;  4CDJ A;  2OR4 A;  4P4I A;  4P44 A;  3SJG A;  4TWE A;  3VTA A;  4C8A A;  2XEG A;  4OC3 A;  3D7H A;  3KAS A;  4JYW A;  2PVW A;  4X3R A;  2CIJ A;  2EK9 A;  4JZ0 A;  3SJE A;  3FF3 A;  4C9V A; 
#chains in the Genus database with same CATH topology
 4YN3 A;  4MCP A;  3S9N A;  1Z8L A;  4NGR A;  4OC1 A;  2OLS A;  5F09 A;  1CS0 B;  2X0S A;  4P4E A;  2D0O A;  4IIX A;  3SJX A;  4CO9 A;  1EZA A;  4C99 A;  5ELY A;  3I74 A;  4OC2 A;  2EK8 A;  2GP4 A;  4E94 A;  3D7F A;  4OME A;  2HRO A;  2XEJ A;  2XEI A;  3EIF A;  4INJ A;  3GJZ A;  2DIK A;  4MCS A;  4C8P A;  3TLG A;  1A9X B;  4COB A;  1DE4 C;  4LQG A;  4OC4 A;  3FED A;  2C6C A;  5JVL A;  4C84 A;  2R82 A;  4KNG E;  1V6C A;  1ZRS A;  2C5Q A;  4CZ1 A;  4P4B A;  4NGS A;  2E28 A;  3TLB A;  3NOJ A;  3T07 A;  3FEC A;  5IB9 A;  4H1H A;  3C8O A;  1KC7 A;  4E5S A;  1JDB C;  2C6P A;  2PCN A;  3T05 A;  1VBH A;  3TLC A;  1M6V B;  1C3O B;  4P45 A;  3S9M A;  4NGM A;  3T5M A;  3BXM A;  2OOT A;  1Q5X A;  1T36 B;  1NXJ A;  1XF1 A;  4MCR A;  3FEE A;  2PVV A;  3RBU A;  4MCQ A;  4MI1 A;  4C8F A;  5D29 A;  1CX8 A;  4IIY A;  4M8D A;  3BHX A;  3I6S A;  5K99 A;  1KBL A;  3G23 A;  2JBK A;  1EZB A;  3KRV A;  4NGT A;  4C85 A;  4C8U A;  5IR2 A;  3D7G A;  3TLY A;  4W9Y A;  1J3L A;  2AUN A;  3IIB A;  1NBW A;  2EZA A;  5FD8 A;  3SJF A;  1VI4 A;  1DIK A;  3S9L A;  4C9E A;  4C8C A;  4CDK A;  4J0N A;  1BXR B;  4C9R A;  2XEF A;  1CE8 B;  3BI0 A;  3TLE A;  2AUM A;  5F5X A;  3TLZ A;  4C86 A;  4TJV A;  4TJX A;  2JBJ A;  2B0A A;  3TYX A;  4NGN A;  4C8T A;  4C9A A;  2FM4 A;  3D7D A;  3ICU A;  4NGQ A;  1KEE B;  4C9U A;  3K4I A;  1WVM A;  3IWW A;  4OC5 A;  4NGP A;  2HWG A;  2HI6 A;  4OC0 A;  3U1B A;  1VBG A;  4P4J A;  1Y9Z A;  3EZB A;  1C30 B;  1JDE A;  2C6G A;  4P4F A;  3BI1 A;  4JVO A;  4P4D A;  3EZA A;  4CDJ A;  2OR4 A;  1R61 A;  2D0P A;  4P4I A;  2YJV A;  4P44 A;  3SJG A;  4TWE A;  3VTA A;  1GGO A;  3TLG B;  2EZB A;  4C8A A;  3EZE A;  3SR3 A;  4EYS A;  1ZL0 A;  2XEG A;  4OC3 A;  3D7H A;  3KAS A;  2MP0 A;  2EZC A;  4JYW A;  4COG A;  3T0T A;  2PVW A;  5F1Y A;  4X3R A;  4MJX A;  3TLA A;  2CIJ A;  2YJT A;  2EK9 A;  5F9M A;  5JYB A;  1ZYM A;  3K9T A;  4JZ0 A;  3SJE A;  3FF3 A;  4C9V A; 
#chains in the Genus database with same CATH homology
 4YN3 A;  4MCP A;  3S9N A;  1Z8L A;  4NGR A;  4OC1 A;  5F09 A;  4P4E A;  3SJX A;  4C99 A;  5ELY A;  3I74 A;  4OC2 A;  2EK8 A;  2GP4 A;  3D7F A;  4OME A;  2XEJ A;  2XEI A;  3EIF A;  4MCS A;  4C8P A;  1DE4 C;  4LQG A;  4OC4 A;  3FED A;  2C6C A;  4C84 A;  4KNG E;  1V6C A;  2C5Q A;  4P4B A;  4NGS A;  3FEC A;  5IB9 A;  2C6P A;  4P45 A;  3S9M A;  4NGM A;  3BXM A;  2OOT A;  1XF1 A;  4MCR A;  3FEE A;  2PVV A;  3RBU A;  4MCQ A;  4C8F A;  5D29 A;  1CX8 A;  3BHX A;  3I6S A;  2JBK A;  4NGT A;  4C85 A;  4C8U A;  5IR2 A;  3D7G A;  4W9Y A;  3IIB A;  3SJF A;  3S9L A;  4C9E A;  4C8C A;  4CDK A;  4C9R A;  2XEF A;  3BI0 A;  4C86 A;  4TJV A;  4TJX A;  2JBJ A;  4C8T A;  4NGN A;  4C9A A;  3D7D A;  3ICU A;  4NGQ A;  4C9U A;  1WVM A;  3IWW A;  4OC5 A;  4NGP A;  4OC0 A;  4P4J A;  1Y9Z A;  2C6G A;  4P4F A;  3BI1 A;  4P4D A;  4CDJ A;  2OR4 A;  4P4I A;  4P44 A;  3SJG A;  4TWE A;  3VTA A;  4C8A A;  2XEG A;  4OC3 A;  3D7H A;  3KAS A;  4JYW A;  2PVW A;  4X3R A;  2CIJ A;  2EK9 A;  3K9T A;  4JZ0 A;  3SJE A;  3FF3 A;  4C9V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...