4TJVA

Crystal structure of protease-associated domain of arabidopsis vacuolar sorting receptor 1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
165
structure length
165
Chain Sequence
GSRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQKACKSYSDFDISFKSKPGRLPTFVLIDRGDCYFTLKAWIAQQAGAAAILVADSKAEPLITMDTPEEDKSDADYLQNITIPSALITKTLGDSIKSALSGGDMVNMKLDWTESVPHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vacuolar-sorting receptor 1
publication title How vacuolar sorting receptor proteins interact with their cargo proteins: crystal structures of apo and cargo-bound forms of the protease-associated domain from an Arabidopsis vacuolar sorting receptor.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Protein transport
total genus 47
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2014-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4tjvA00
2PVVA 5D29A 1WVMA 2XEGA 4NGNA 4NGQA 4C9AA 3S9NA 3RBUA 4P4JA 3IIBA 4MCQA 4JYWA 4P4BA 3ICUA 3IWWA 1XF1A 2EK9A 4P4DA 2PVWA 2JBJA 4MCSA 4KNGE 4LQGA 4C9VA 3D7FA 2C6PA 4NGTA 4C8FA 4OC4A 3FEEA 4C99A 4C8AA 3FF3A 3BI1A 5ELYA 4C8PA 4CDKA 1Y9ZA 2XEIA 2EK8A 4C8TA 4C9RA 4NGSA 1CX8A 3S9MA 2XEJA 4JZ0A 3D7HA 3FEDA 4P45A 1V6CA 3BI0A 4CDJA 4MCPA 4P4FA 4OC2A 3SJFA 4C85A 4OC3A 4P44A 2OR4A 4X3RA 2CIJA 4C84A 3D7GA 1DE4C 3I6SA 3FECA 4NGRA 4P4EA 2C6GA 4C8CA 5F09A 3SJEA 2OOTA 1Z8LA 4OC1A 4OMEA 4NGMA 4C8UA 4MCRA 4OC0A 4C86A 5IB9A 3VTAA 3EIFA 3S9LA 4C9UA 3BHXA 4YN3A 4OC5A 4P4IA 2JBKA 3D7DA 4TJXA 4TWEA 4C9EA 3BXMA 4NGPA 2C6CA 2XEFA 4TJVA 3SJGA 3KASA 3I74A 3SJXA 4W9YA
chains in the Genus database with same CATH superfamily
2PVVA 3EZEA 3TYXA 5D29A 1JDBC 1WVMA 2EZAA 2XEGA 4NGNA 1NBWA 4NGQA 1T36B 1EZBA 1ZRSA 4C9AA 3S9NA 3RBUA 5F1YA 4P4JA 3IIBA 4MCQA 4JYWA 4P4BA 2EZBA 3ICUA 3IWWA 1XF1A 4IIXA 2EK9A 1R61A 4P4DA 2PVWA 2D0PA 2JBJA 4MCSA 4KNGE 4LQGA 4C9VA 2EZCA 3D7FA 2C6PA 4NGTA 4C8FA 3EZAA 2E28A 4OC4A 2B0AA 3FEEA 3C8OA 3TLGB 4JVOA 4C99A 2HWGA 4C8AA 2OLSA 1GGOA 3FF3A 3KRVA 3BI1A 5ELYA 4EYSA 4J0NA 4C8PA 4CDKA 1Y9ZA 2XEIA 1ZL0A 2EK8A 1VBGA 4C8TA 2HI6A 1J3LA 4C9RA 4NGSA 3TLBA 4INJA 1CX8A 3S9MA 3SR3A 2XEJA 2D0OA 1VI4A 2DIKA 3G23A 4H1HA 4JZ0A 4M8DA 1CE8B 3D7HA 3FEDA 5FD8A 1DIKA 4P45A 3K9TA 2C5QA 2YJTA 4E5SA 1V6CA 4CO9A 3U1BA 3BI0A 4CDJA 1KC7A 1KEEB 1BXRB 1CS0B 4MCPA 4P4FA 4COGA 4OC2A 4MJXA 2MP0A 2PCNA 4MI1A 3SJFA 5F9MA 4C85A 4OC3A 3GJZA 1KBLA 1NXJA 4P44A 2OR4A 5IR2A 4COBA 3T0TA 2X0SA 4X3RA 5JYBA 2CIJA 4E94A 3EZBA 4C84A 1ZYMA 3T5MA 1EZAA 3D7GA 1DE4C 3I6SA 2HROA 1VBHA 3TLZA 3FECA 4NGRA 3T05A 3K4IA 4P4EA 4CZ1A 1JDEA 2C6GA 4C8CA 1A9XB 5F09A 2YJVA 5F5XA 3SJEA 2OOTA 1Z8LA 5JVLA 2FM4A 4OC1A 4OMEA 3TLEA 4NGMA 1Q5XA 1C3OB 4C8UA 4MCRA 4OC0A 4C86A 5K99A 4IIYA 5IB9A 3VTAA 1C30B 3TLGA 3EIFA 3S9LA 4C9UA 2AUNA 2GP4A 3BHXA 4YN3A 4OC5A 4P4IA 3TLYA 2JBKA 3D7DA 4TJXA 3TLCA 2AUMA 4TWEA 2R82A 4C9EA 3BXMA 4NGPA 2C6CA 2XEFA 4TJVA 1M6VB 3SJGA 3KASA 3TLAA 3I74A 3SJXA 3T07A 4W9YA 3NOJA
chains in the Genus database with same CATH topology
2PVVA 5D29A 1WVMA 2XEGA 4NGNA 4NGQA 4C9AA 3S9NA 3RBUA 4P4JA 3IIBA 4MCQA 4JYWA 4P4BA 3ICUA 3IWWA 1XF1A 2EK9A 4P4DA 2PVWA 2JBJA 4MCSA 4KNGE 4LQGA 4C9VA 3D7FA 2C6PA 4NGTA 4C8FA 4OC4A 3FEEA 4C99A 4C8AA 3FF3A 3BI1A 5ELYA 4C8PA 4CDKA 1Y9ZA 2XEIA 2EK8A 4C8TA 4C9RA 4NGSA 1CX8A 3S9MA 2XEJA 4JZ0A 3D7HA 3FEDA 4P45A 3K9TA 2C5QA 1V6CA 3BI0A 4CDJA 4MCPA 4P4FA 4OC2A 3SJFA 4C85A 4OC3A 4P44A 5IR2A 2OR4A 4X3RA 2CIJA 4C84A 3D7GA 1DE4C 3I6SA 3FECA 4NGRA 4P4EA 2C6GA 4C8CA 5F09A 3SJEA 2OOTA 1Z8LA 4OC1A 4OMEA 4NGMA 4C8UA 4MCRA 4OC0A 4C86A 5IB9A 3VTAA 3EIFA 3S9LA 4C9UA 2GP4A 3BHXA 4YN3A 4OC5A 4P4IA 2JBKA 3D7DA 4TJXA 4TWEA 4C9EA 3BXMA 4NGPA 2C6CA 2XEFA 4TJVA 3SJGA 3KASA 3I74A 3SJXA 4W9YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PVV A;  5D29 A;  1WVM A;  2XEG A;  4NGN A;  4NGQ A;  4C9A A;  3S9N A;  3RBU A;  4P4J A;  3IIB A;  4MCQ A;  4JYW A;  4P4B A;  3ICU A;  3IWW A;  1XF1 A;  2EK9 A;  4P4D A;  2PVW A;  2JBJ A;  4MCS A;  4KNG E;  4LQG A;  4C9V A;  3D7F A;  2C6P A;  4NGT A;  4C8F A;  4OC4 A;  3FEE A;  4C99 A;  4C8A A;  3FF3 A;  3BI1 A;  5ELY A;  4C8P A;  4CDK A;  1Y9Z A;  2XEI A;  2EK8 A;  4C8T A;  4C9R A;  4NGS A;  1CX8 A;  3S9M A;  2XEJ A;  4JZ0 A;  3D7H A;  3FED A;  4P45 A;  1V6C A;  3BI0 A;  4CDJ A;  4MCP A;  4P4F A;  4OC2 A;  3SJF A;  4C85 A;  4OC3 A;  4P44 A;  2OR4 A;  4X3R A;  2CIJ A;  4C84 A;  3D7G A;  1DE4 C;  3I6S A;  3FEC A;  4NGR A;  4P4E A;  2C6G A;  4C8C A;  5F09 A;  3SJE A;  2OOT A;  1Z8L A;  4OC1 A;  4OME A;  4NGM A;  4C8U A;  4MCR A;  4OC0 A;  4C86 A;  5IB9 A;  3VTA A;  3EIF A;  3S9L A;  4C9U A;  3BHX A;  4YN3 A;  4OC5 A;  4P4I A;  2JBK A;  3D7D A;  4TJX A;  4TWE A;  4C9E A;  3BXM A;  4NGP A;  2C6C A;  2XEF A;  4TJV A;  3SJG A;  3KAS A;  3I74 A;  3SJX A;  4W9Y A; 
#chains in the Genus database with same CATH topology
 2PVV A;  3EZE A;  3TYX A;  5D29 A;  1JDB C;  1WVM A;  2EZA A;  2XEG A;  4NGN A;  1NBW A;  4NGQ A;  1T36 B;  1EZB A;  1ZRS A;  4C9A A;  3S9N A;  3RBU A;  5F1Y A;  4P4J A;  3IIB A;  4MCQ A;  4JYW A;  4P4B A;  2EZB A;  3ICU A;  3IWW A;  1XF1 A;  4IIX A;  2EK9 A;  1R61 A;  4P4D A;  2PVW A;  2D0P A;  2JBJ A;  4MCS A;  4KNG E;  4LQG A;  4C9V A;  2EZC A;  3D7F A;  2C6P A;  4NGT A;  4C8F A;  3EZA A;  2E28 A;  4OC4 A;  2B0A A;  3FEE A;  3C8O A;  3TLG B;  4JVO A;  4C99 A;  2HWG A;  4C8A A;  2OLS A;  1GGO A;  3FF3 A;  3KRV A;  3BI1 A;  5ELY A;  4EYS A;  4J0N A;  4C8P A;  4CDK A;  1Y9Z A;  2XEI A;  1ZL0 A;  2EK8 A;  1VBG A;  4C8T A;  2HI6 A;  1J3L A;  4C9R A;  4NGS A;  3TLB A;  4INJ A;  1CX8 A;  3S9M A;  3SR3 A;  2XEJ A;  2D0O A;  1VI4 A;  2DIK A;  3G23 A;  4H1H A;  4JZ0 A;  4M8D A;  1CE8 B;  3D7H A;  3FED A;  5FD8 A;  1DIK A;  4P45 A;  3K9T A;  2C5Q A;  2YJT A;  4E5S A;  1V6C A;  4CO9 A;  3U1B A;  3BI0 A;  4CDJ A;  1KC7 A;  1KEE B;  1BXR B;  1CS0 B;  4MCP A;  4P4F A;  4COG A;  4OC2 A;  4MJX A;  2MP0 A;  2PCN A;  4MI1 A;  3SJF A;  5F9M A;  4C85 A;  4OC3 A;  3GJZ A;  1KBL A;  1NXJ A;  4P44 A;  2OR4 A;  5IR2 A;  4COB A;  3T0T A;  2X0S A;  4X3R A;  5JYB A;  2CIJ A;  4E94 A;  3EZB A;  4C84 A;  1ZYM A;  3T5M A;  1EZA A;  3D7G A;  1DE4 C;  3I6S A;  2HRO A;  1VBH A;  3TLZ A;  3FEC A;  4NGR A;  3T05 A;  3K4I A;  4P4E A;  4CZ1 A;  1JDE A;  2C6G A;  4C8C A;  1A9X B;  5F09 A;  2YJV A;  5F5X A;  3SJE A;  2OOT A;  1Z8L A;  5JVL A;  2FM4 A;  4OC1 A;  4OME A;  3TLE A;  4NGM A;  1Q5X A;  1C3O B;  4C8U A;  4MCR A;  4OC0 A;  4C86 A;  5K99 A;  4IIY A;  5IB9 A;  3VTA A;  1C30 B;  3TLG A;  3EIF A;  3S9L A;  4C9U A;  2AUN A;  2GP4 A;  3BHX A;  4YN3 A;  4OC5 A;  4P4I A;  3TLY A;  2JBK A;  3D7D A;  4TJX A;  3TLC A;  2AUM A;  4TWE A;  2R82 A;  4C9E A;  3BXM A;  4NGP A;  2C6C A;  2XEF A;  4TJV A;  1M6V B;  3SJG A;  3KAS A;  3TLA A;  3I74 A;  3SJX A;  3T07 A;  4W9Y A;  3NOJ A; 
#chains in the Genus database with same CATH homology
 2PVV A;  5D29 A;  1WVM A;  2XEG A;  4NGN A;  4NGQ A;  4C9A A;  3S9N A;  3RBU A;  4P4J A;  3IIB A;  4MCQ A;  4JYW A;  4P4B A;  3ICU A;  3IWW A;  1XF1 A;  2EK9 A;  4P4D A;  2PVW A;  2JBJ A;  4MCS A;  4KNG E;  4LQG A;  4C9V A;  3D7F A;  2C6P A;  4NGT A;  4C8F A;  4OC4 A;  3FEE A;  4C99 A;  4C8A A;  3FF3 A;  3BI1 A;  5ELY A;  4C8P A;  4CDK A;  1Y9Z A;  2XEI A;  2EK8 A;  4C8T A;  4C9R A;  4NGS A;  1CX8 A;  3S9M A;  2XEJ A;  4JZ0 A;  3D7H A;  3FED A;  4P45 A;  3K9T A;  2C5Q A;  1V6C A;  3BI0 A;  4CDJ A;  4MCP A;  4P4F A;  4OC2 A;  3SJF A;  4C85 A;  4OC3 A;  4P44 A;  5IR2 A;  2OR4 A;  4X3R A;  2CIJ A;  4C84 A;  3D7G A;  1DE4 C;  3I6S A;  3FEC A;  4NGR A;  4P4E A;  2C6G A;  4C8C A;  5F09 A;  3SJE A;  2OOT A;  1Z8L A;  4OC1 A;  4OME A;  4NGM A;  4C8U A;  4MCR A;  4OC0 A;  4C86 A;  5IB9 A;  3VTA A;  3EIF A;  3S9L A;  4C9U A;  2GP4 A;  3BHX A;  4YN3 A;  4OC5 A;  4P4I A;  2JBK A;  3D7D A;  4TJX A;  4TWE A;  4C9E A;  3BXM A;  4NGP A;  2C6C A;  2XEF A;  4TJV A;  3SJG A;  3KAS A;  3I74 A;  3SJX A;  4W9Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...