4TJVA

Crystal structure of protease-associated domain of arabidopsis vacuolar sorting receptor 1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
165
structure length
165
Chain Sequence
GSRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQKACKSYSDFDISFKSKPGRLPTFVLIDRGDCYFTLKAWIAQQAGAAAILVADSKAEPLITMDTPEEDKSDADYLQNITIPSALITKTLGDSIKSALSGGDMVNMKLDWTESVPHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How vacuolar sorting receptor proteins interact with their cargo proteins: crystal structures of apo and cargo-bound forms of the protease-associated domain from an Arabidopsis vacuolar sorting receptor.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Protein transport
molecule keywords Vacuolar-sorting receptor 1
total genus 47
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2014-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4tjvA00
3FECA 4OC4A 3D7GA 1WVMA 4C9VA 2PVWA 2XEJA 5IB9A 4MCQA 4C8TA 3S9NA 3EIFA 3S9MA 3BI0A 1XF1A 4NGRA 3SJXA 1CX8A 2JBJA 4NGNA 4C8AA 4C8CA 3FEEA 3D7HA 4P4IA 4C85A 4P4FA 3I6SA 4YN3A 3IIBA 4OC3A 2OOTA 2C6GA 4CDJA 3D7FA 2PVVA 4P4BA 1V6CA 2XEFA 4P4DA 3BI1A 4TJXA 4OC0A 1Z8LA 4OC1A 4OMEA 4C86A 4C8PA 4NGMA 4JYWA 4MCPA 4MCSA 1Y9ZA 2JBKA 4C9EA 4C9AA 2EK8A 4NGQA 3SJGA 4CDKA 4C9UA 3SJFA 4JZ0A 3SJEA 3FF3A 3BHXA 3D7DA 2OR4A 3I74A 1DE4C 4X3RA 4NGPA 2XEIA 3RBUA 4NGTA 4OC5A 4TWEA 2XEGA 4P44A 4C8UA 4C84A 3FEDA 3IWWA 3ICUA 4P4JA 4P45A 3S9LA 2EK9A 2C6PA 2CIJA 4OC2A 5D29A 4NGSA 4P4EA 4W9YA 4C99A 4C8FA 5F09A 2C6CA 3KASA 4LQGA 4TJVA 3BXMA 4C9RA 5ELYA 4MCRA 3VTAA 4KNGE
chains in the Genus database with same CATH superfamily
2GP4A 4EYSA 1VBGA 3FECA 4E94A 4OC4A 3D7GA 2D0PA 1WVMA 4C9VA 2PVWA 2XEJA 1VI4A 5IB9A 2OLSA 4MCQA 4C8TA 3S9NA 3EIFA 3S9MA 3BI0A 1XF1A 4NGRA 3SJXA 1CX8A 2JBJA 4NGNA 4C8AA 5K99A 4C8CA 3FEEA 1BXRB 3D7HA 4E5SA 4P4IA 4C85A 3TLGA 3C8OA 1EZAA 3TLEA 4P4FA 3K4IA 1Q5XA 3I6SA 5F9MA 4YN3A 3IIBA 1NXJA 1EZBA 2AUMA 4OC3A 1VBHA 1T36B 2OOTA 4CO9A 2C6GA 4CDJA 1CE8B 3EZBA 4INJA 3D7FA 1JDBC 2EZAA 3TYXA 1CS0B 2D0OA 4J0NA 3TLZA 4IIXA 2PVVA 4P4BA 5JVLA 1V6CA 2XEFA 4IIYA 4P4DA 1KC7A 4CZ1A 1C3OB 3SR3A 3BI1A 3T07A 3T05A 4TJXA 4OC0A 1Z8LA 4OC1A 4JVOA 2EZCA 4OMEA 4C86A 4C8PA 1DIKA 4NGMA 4JYWA 4MCPA 4MCSA 1Y9ZA 2JBKA 4C9EA 3T0TA 4C9AA 2EK8A 2R82A 4NGQA 3TLCA 5JYBA 3TLYA 2FM4A 3SJGA 4CDKA 4C9UA 3SJFA 2C5QA 3U1BA 2AUNA 1KBLA 1KEEB 4JZ0A 3SJEA 1ZYMA 1A9XB 3BHXA 3D7DA 3FF3A 2OR4A 3I74A 3TLGB 1DE4C 4MI1A 4X3RA 4NGPA 2E28A 2X0SA 2XEIA 1NBWA 3GJZA 5IR2A 3RBUA 3TLAA 4NGTA 4OC5A 4TWEA 2XEGA 1GGOA 3NOJA 1M6VB 4P44A 4C8UA 1J3LA 3T5MA 4C84A 4M8DA 3FEDA 2DIKA 3IWWA 3ICUA 2B0AA 2MP0A 2HWGA 4P4JA 3EZEA 2HI6A 4P45A 4COGA 2EK9A 2YJTA 3S9LA 3TLBA 2C6PA 3KRVA 2CIJA 4COBA 2YJVA 4OC2A 5D29A 2HROA 4H1HA 4NGSA 5F1YA 4MJXA 4P4EA 4W9YA 4C99A 4C8FA 5F5XA 1ZL0A 3G23A 5F09A 2C6CA 3KASA 4LQGA 4TJVA 1ZRSA 3BXMA 1R61A 4C9RA 3K9TA 5ELYA 3EZAA 4MCRA 1JDEA 2PCNA 2EZBA 3VTAA 1C30B 5FD8A 4KNGE
chains in the Genus database with same CATH topology
2GP4A 3FECA 4OC4A 3D7GA 1WVMA 4C9VA 2PVWA 2XEJA 5IB9A 4MCQA 4C8TA 3S9NA 3EIFA 3S9MA 3BI0A 1XF1A 4NGRA 3SJXA 1CX8A 2JBJA 4NGNA 4C8AA 4C8CA 3FEEA 3D7HA 4P4IA 4C85A 4P4FA 3I6SA 4YN3A 3IIBA 4OC3A 2OOTA 2C6GA 4CDJA 3D7FA 2PVVA 4P4BA 1V6CA 2XEFA 4P4DA 3BI1A 4TJXA 4OC0A 1Z8LA 4OC1A 4OMEA 4C86A 4C8PA 4NGMA 4JYWA 4MCPA 4MCSA 1Y9ZA 2JBKA 4C9EA 4C9AA 2EK8A 4NGQA 3SJGA 4CDKA 4C9UA 3SJFA 2C5QA 4JZ0A 3SJEA 3FF3A 3BHXA 3D7DA 2OR4A 3I74A 1DE4C 4X3RA 4NGPA 2XEIA 5IR2A 3RBUA 4NGTA 4OC5A 4TWEA 2XEGA 4P44A 4C8UA 4C84A 3FEDA 3IWWA 3ICUA 4P4JA 4P45A 3S9LA 2EK9A 2C6PA 2CIJA 4OC2A 5D29A 4NGSA 4P4EA 4W9YA 4C99A 4C8FA 5F09A 2C6CA 3KASA 4LQGA 4TJVA 3BXMA 4C9RA 3K9TA 5ELYA 4MCRA 3VTAA 4KNGE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FEC A;  4OC4 A;  3D7G A;  1WVM A;  4C9V A;  2PVW A;  2XEJ A;  5IB9 A;  4MCQ A;  4C8T A;  3S9N A;  3EIF A;  3S9M A;  3BI0 A;  1XF1 A;  4NGR A;  3SJX A;  1CX8 A;  2JBJ A;  4NGN A;  4C8A A;  4C8C A;  3FEE A;  3D7H A;  4P4I A;  4C85 A;  4P4F A;  3I6S A;  4YN3 A;  3IIB A;  4OC3 A;  2OOT A;  2C6G A;  4CDJ A;  3D7F A;  2PVV A;  4P4B A;  1V6C A;  2XEF A;  4P4D A;  3BI1 A;  4TJX A;  4OC0 A;  1Z8L A;  4OC1 A;  4OME A;  4C86 A;  4C8P A;  4NGM A;  4JYW A;  4MCP A;  4MCS A;  1Y9Z A;  2JBK A;  4C9E A;  4C9A A;  2EK8 A;  4NGQ A;  3SJG A;  4CDK A;  4C9U A;  3SJF A;  4JZ0 A;  3SJE A;  3FF3 A;  3BHX A;  3D7D A;  2OR4 A;  3I74 A;  1DE4 C;  4X3R A;  4NGP A;  2XEI A;  3RBU A;  4NGT A;  4OC5 A;  4TWE A;  2XEG A;  4P44 A;  4C8U A;  4C84 A;  3FED A;  3IWW A;  3ICU A;  4P4J A;  4P45 A;  3S9L A;  2EK9 A;  2C6P A;  2CIJ A;  4OC2 A;  5D29 A;  4NGS A;  4P4E A;  4W9Y A;  4C99 A;  4C8F A;  5F09 A;  2C6C A;  3KAS A;  4LQG A;  4TJV A;  3BXM A;  4C9R A;  5ELY A;  4MCR A;  3VTA A;  4KNG E; 
#chains in the Genus database with same CATH topology
 2GP4 A;  4EYS A;  1VBG A;  3FEC A;  4E94 A;  4OC4 A;  3D7G A;  2D0P A;  1WVM A;  4C9V A;  2PVW A;  2XEJ A;  1VI4 A;  5IB9 A;  2OLS A;  4MCQ A;  4C8T A;  3S9N A;  3EIF A;  3S9M A;  3BI0 A;  1XF1 A;  4NGR A;  3SJX A;  1CX8 A;  2JBJ A;  4NGN A;  4C8A A;  5K99 A;  4C8C A;  3FEE A;  1BXR B;  3D7H A;  4E5S A;  4P4I A;  4C85 A;  3TLG A;  3C8O A;  1EZA A;  3TLE A;  4P4F A;  3K4I A;  1Q5X A;  3I6S A;  5F9M A;  4YN3 A;  3IIB A;  1NXJ A;  1EZB A;  2AUM A;  4OC3 A;  1VBH A;  1T36 B;  2OOT A;  4CO9 A;  2C6G A;  4CDJ A;  1CE8 B;  3EZB A;  4INJ A;  3D7F A;  1JDB C;  2EZA A;  3TYX A;  1CS0 B;  2D0O A;  4J0N A;  3TLZ A;  4IIX A;  2PVV A;  4P4B A;  5JVL A;  1V6C A;  2XEF A;  4IIY A;  4P4D A;  1KC7 A;  4CZ1 A;  1C3O B;  3SR3 A;  3BI1 A;  3T07 A;  3T05 A;  4TJX A;  4OC0 A;  1Z8L A;  4OC1 A;  4JVO A;  2EZC A;  4OME A;  4C86 A;  4C8P A;  1DIK A;  4NGM A;  4JYW A;  4MCP A;  4MCS A;  1Y9Z A;  2JBK A;  4C9E A;  3T0T A;  4C9A A;  2EK8 A;  2R82 A;  4NGQ A;  3TLC A;  5JYB A;  3TLY A;  2FM4 A;  3SJG A;  4CDK A;  4C9U A;  3SJF A;  2C5Q A;  3U1B A;  2AUN A;  1KBL A;  1KEE B;  4JZ0 A;  3SJE A;  1ZYM A;  1A9X B;  3BHX A;  3D7D A;  3FF3 A;  2OR4 A;  3I74 A;  3TLG B;  1DE4 C;  4MI1 A;  4X3R A;  4NGP A;  2E28 A;  2X0S A;  2XEI A;  1NBW A;  3GJZ A;  5IR2 A;  3RBU A;  3TLA A;  4NGT A;  4OC5 A;  4TWE A;  2XEG A;  1GGO A;  3NOJ A;  1M6V B;  4P44 A;  4C8U A;  1J3L A;  3T5M A;  4C84 A;  4M8D A;  3FED A;  2DIK A;  3IWW A;  3ICU A;  2B0A A;  2MP0 A;  2HWG A;  4P4J A;  3EZE A;  2HI6 A;  4P45 A;  4COG A;  2EK9 A;  2YJT A;  3S9L A;  3TLB A;  2C6P A;  3KRV A;  2CIJ A;  4COB A;  2YJV A;  4OC2 A;  5D29 A;  2HRO A;  4H1H A;  4NGS A;  5F1Y A;  4MJX A;  4P4E A;  4W9Y A;  4C99 A;  4C8F A;  5F5X A;  1ZL0 A;  3G23 A;  5F09 A;  2C6C A;  3KAS A;  4LQG A;  4TJV A;  1ZRS A;  3BXM A;  1R61 A;  4C9R A;  3K9T A;  5ELY A;  3EZA A;  4MCR A;  1JDE A;  2PCN A;  2EZB A;  3VTA A;  1C30 B;  5FD8 A;  4KNG E; 
#chains in the Genus database with same CATH homology
 2GP4 A;  3FEC A;  4OC4 A;  3D7G A;  1WVM A;  4C9V A;  2PVW A;  2XEJ A;  5IB9 A;  4MCQ A;  4C8T A;  3S9N A;  3EIF A;  3S9M A;  3BI0 A;  1XF1 A;  4NGR A;  3SJX A;  1CX8 A;  2JBJ A;  4NGN A;  4C8A A;  4C8C A;  3FEE A;  3D7H A;  4P4I A;  4C85 A;  4P4F A;  3I6S A;  4YN3 A;  3IIB A;  4OC3 A;  2OOT A;  2C6G A;  4CDJ A;  3D7F A;  2PVV A;  4P4B A;  1V6C A;  2XEF A;  4P4D A;  3BI1 A;  4TJX A;  4OC0 A;  1Z8L A;  4OC1 A;  4OME A;  4C86 A;  4C8P A;  4NGM A;  4JYW A;  4MCP A;  4MCS A;  1Y9Z A;  2JBK A;  4C9E A;  4C9A A;  2EK8 A;  4NGQ A;  3SJG A;  4CDK A;  4C9U A;  3SJF A;  2C5Q A;  4JZ0 A;  3SJE A;  3FF3 A;  3BHX A;  3D7D A;  2OR4 A;  3I74 A;  1DE4 C;  4X3R A;  4NGP A;  2XEI A;  5IR2 A;  3RBU A;  4NGT A;  4OC5 A;  4TWE A;  2XEG A;  4P44 A;  4C8U A;  4C84 A;  3FED A;  3IWW A;  3ICU A;  4P4J A;  4P45 A;  3S9L A;  2EK9 A;  2C6P A;  2CIJ A;  4OC2 A;  5D29 A;  4NGS A;  4P4E A;  4W9Y A;  4C99 A;  4C8F A;  5F09 A;  2C6C A;  3KAS A;  4LQG A;  4TJV A;  3BXM A;  4C9R A;  3K9T A;  5ELY A;  4MCR A;  3VTA A;  4KNG E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...