4J0NA

Crystal structure of a manganese dependent isatin hydrolase
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
261
structure length
261
Chain Sequence
b'SAQSALSGLGAKLLSGEVEVVDCTGVLGPNTPILQLPPDFAKNTPKVEIHKISEYDSDGPFFAWNWMVLGEHSGTHFDAPHHWITGKDYSDGFTDTLDVQRLIAPVNVIDCSKESAADPDFLLTADLIKAWEAEHGEIGAGEWVVMRTDWDKRAGDEAAFLNADETGPHSPGPTPDAIEYLLSKKIVGWGSQCIGTDAGQAGGMEPPFPAHNLLHRDNCFGLASLANLDKLPAKGAILIAAPLKIERGTGSPIRALALVPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Isatin hydrolase B
publication title A proton wire and water channel revealed in the crystal structure of isatin hydrolase.
pubmed doi rcsb
source organism Labrenzia aggregata iam 12614
molecule tags Hydrolase
total genus 80
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 3.5.2.20: Isatin hydrolase.
pdb deposition date 2013-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04199 Cyclase Putative cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.50 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Putative cyclase 4j0nA00
4CO9A 2B0AA 3KRVA 4M8DA 1R61A 4COGA 4COBA 4CZ1A 4J0NA
chains in the Genus database with same CATH superfamily
2X0SA 4OC5A 4CO9A 1NXJA 3BHXA 5K99A 3BXMA 3TLZA 4MCSA 1JDEA 1CS0B 3NOJA 3GJZA 3IWWA 5ELYA 3SJGA 4YN3A 2XEIA 2PCNA 4P44A 4OC0A 5IR2A 4NGMA 1Y9ZA 1ZYMA 4NGSA 4H1HA 3EIFA 4P4JA 3D7FA 1R61A 1XF1A 4E94A 1M6VB 5JYBA 4TJVA 1VBGA 3EZAA 4NGTA 4IIXA 4OC4A 2DIKA 4MJXA 3RBUA 4NGRA 3S9LA 3S9NA 3U1BA 2CIJA 1J3LA 4NGNA 1KC7A 4OMEA 4P45A 4E5SA 2OLSA 1GGOA 2B0AA 4TWEA 2XEFA 3TLYA 2D0PA 3FECA 3VTAA 2AUNA 4TJXA 1DIKA 3S9MA 2HROA 4LQGA 1C30B 3T0TA 2PVWA 3T05A 4JZ0A 2C6PA 3SJEA 4C9VA 4W9YA 4C8CA 4MCPA 4C9UA 1A9XB 3TLEA 3FF3A 3ICUA 4C99A 4MCQA 5IB9A 2OOTA 1V6CA 4P4DA 4NGQA 4OC3A 3I6SA 1C3OB 3D7HA 4OC2A 2EZBA 1ZL0A 1WVMA 4C86A 3C8OA 1KEEB 2C6CA 4J0NA 4C8FA 3FEDA 3I74A 4C9EA 1T36B 2JBJA 4P4EA 4CZ1A 2C6GA 4MI1A 2JBKA 1EZBA 2GP4A 2OR4A 4P4BA 1EZAA 3BI1A 1CX8A 4OC1A 4X3RA 3D7DA 5F5XA 3T5MA 3SJFA 3BI0A 4C8UA 1ZRSA 5F9MA 1Q5XA 2XEGA 1NBWA 3T07A 3K9TA 3FEEA 3EZBA 3KRVA 2EK9A 4M8DA 4EYSA 3SR3A 5D29A 4COBA 3TLGB 3KASA 2EZAA 4KNGE 4P4FA 5FD8A 5F09A 4NGPA 4C8AA 4CDKA 2R82A 4JVOA 3TLGA 2E28A 4C84A 4C85A 4C8TA 2EK8A 1BXRB 3D7GA 4C9AA 4INJA 2YJVA 2AUMA 1Z8LA 4COGA 3TLAA 4CDJA 5JVLA 2MP0A 3IIBA 1JDBC 3EZEA 2PVVA 3K4IA 1VI4A 3G23A 4IIYA 2D0OA 5F1YA 2C5QA 1VBHA 3TLBA 1DE4C 1KBLA 2HWGA 3TYXA 2HI6A 4C9RA 2FM4A 1CE8B 2XEJA 3TLCA 3SJXA 4MCRA 4C8PA 4JYWA 2EZCA 2YJTA 4P4IA
chains in the Genus database with same CATH topology
4CO9A 2B0AA 3KRVA 4M8DA 1R61A 4COGA 4COBA 4CZ1A 4J0NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CO9 A;  2B0A A;  3KRV A;  4M8D A;  1R61 A;  4COG A;  4COB A;  4CZ1 A;  4J0N A; 
#chains in the Genus database with same CATH topology
 2X0S A;  4OC5 A;  4CO9 A;  1NXJ A;  3BHX A;  5K99 A;  3BXM A;  3TLZ A;  4MCS A;  1JDE A;  1CS0 B;  3NOJ A;  3GJZ A;  3IWW A;  5ELY A;  3SJG A;  4YN3 A;  2XEI A;  2PCN A;  4P44 A;  4OC0 A;  5IR2 A;  4NGM A;  1Y9Z A;  1ZYM A;  4NGS A;  4H1H A;  3EIF A;  4P4J A;  3D7F A;  1R61 A;  1XF1 A;  4E94 A;  1M6V B;  5JYB A;  4TJV A;  1VBG A;  3EZA A;  4NGT A;  4IIX A;  4OC4 A;  2DIK A;  4MJX A;  3RBU A;  4NGR A;  3S9L A;  3S9N A;  3U1B A;  2CIJ A;  1J3L A;  4NGN A;  1KC7 A;  4OME A;  4P45 A;  4E5S A;  2OLS A;  1GGO A;  2B0A A;  4TWE A;  2XEF A;  3TLY A;  2D0P A;  3FEC A;  3VTA A;  2AUN A;  4TJX A;  1DIK A;  3S9M A;  2HRO A;  4LQG A;  1C30 B;  3T0T A;  2PVW A;  3T05 A;  4JZ0 A;  2C6P A;  3SJE A;  4C9V A;  4W9Y A;  4C8C A;  4MCP A;  4C9U A;  1A9X B;  3TLE A;  3FF3 A;  3ICU A;  4C99 A;  4MCQ A;  5IB9 A;  2OOT A;  1V6C A;  4P4D A;  4NGQ A;  4OC3 A;  3I6S A;  1C3O B;  3D7H A;  4OC2 A;  2EZB A;  1ZL0 A;  1WVM A;  4C86 A;  3C8O A;  1KEE B;  2C6C A;  4J0N A;  4C8F A;  3FED A;  3I74 A;  4C9E A;  1T36 B;  2JBJ A;  4P4E A;  4CZ1 A;  2C6G A;  4MI1 A;  2JBK A;  1EZB A;  2GP4 A;  2OR4 A;  4P4B A;  1EZA A;  3BI1 A;  1CX8 A;  4OC1 A;  4X3R A;  3D7D A;  5F5X A;  3T5M A;  3SJF A;  3BI0 A;  4C8U A;  1ZRS A;  5F9M A;  1Q5X A;  2XEG A;  1NBW A;  3T07 A;  3K9T A;  3FEE A;  3EZB A;  3KRV A;  2EK9 A;  4M8D A;  4EYS A;  3SR3 A;  5D29 A;  4COB A;  3TLG B;  3KAS A;  2EZA A;  4KNG E;  4P4F A;  5FD8 A;  5F09 A;  4NGP A;  4C8A A;  4CDK A;  2R82 A;  4JVO A;  3TLG A;  2E28 A;  4C84 A;  4C85 A;  4C8T A;  2EK8 A;  1BXR B;  3D7G A;  4C9A A;  4INJ A;  2YJV A;  2AUM A;  1Z8L A;  4COG A;  3TLA A;  4CDJ A;  5JVL A;  2MP0 A;  3IIB A;  1JDB C;  3EZE A;  2PVV A;  3K4I A;  1VI4 A;  3G23 A;  4IIY A;  2D0O A;  5F1Y A;  2C5Q A;  1VBH A;  3TLB A;  1DE4 C;  1KBL A;  2HWG A;  3TYX A;  2HI6 A;  4C9R A;  2FM4 A;  1CE8 B;  2XEJ A;  3TLC A;  3SJX A;  4MCR A;  4C8P A;  4JYW A;  2EZC A;  2YJT A;  4P4I A; 
#chains in the Genus database with same CATH homology
 4CO9 A;  2B0A A;  3KRV A;  4M8D A;  1R61 A;  4COG A;  4COB A;  4CZ1 A;  4J0N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...