4J0NA

Crystal structure of a manganese dependent isatin hydrolase
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
261
structure length
261
Chain Sequence
SAQSALSGLGAKLLSGEVEVVDCTGVLGPNTPILQLPPDFAKNTPKVEIHKISEYDSDGPFFAWNWMVLGEHSGTHFDAPHHWITGKDYSDGFTDTLDVQRLIAPVNVIDCSKESAADPDFLLTADLIKAWEAEHGEIGAGEWVVMRTDWDKRAGDEAAFLNADETGPHSPGPTPDAIEYLLSKKIVGWGSQCIGTDAGQAGGMEPPFPAHNLLHRDNCFGLASLANLDKLPAKGAILIAAPLKIERGTGSPIRALALVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A proton wire and water channel revealed in the crystal structure of isatin hydrolase.
pubmed doi rcsb
source organism Labrenzia aggregata iam 12614
molecule tags Hydrolase
molecule keywords Isatin hydrolase B
total genus 80
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 3.5.2.20: Isatin hydrolase.
pdb deposition date 2013-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04199 Cyclase Putative cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.50 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Putative cyclase 4j0nA00
4COBA 4CZ1A 4COGA 1R61A 4CO9A 3KRVA 2B0AA 4M8DA 4J0NA
chains in the Genus database with same CATH superfamily
3IWWA 4C86A 1Y9ZA 3BXMA 4C8PA 3I6SA 5F9MA 4OC3A 1KC7A 2DIKA 2PVVA 2XEJA 3S9NA 1GGOA 3I74A 3T05A 3SJGA 4NGSA 4MI1A 4JVOA 4JYWA 4C8CA 4INJA 3BI0A 5K99A 4OMEA 2E28A 1DE4C 4NGTA 4P45A 3D7FA 2PCNA 3FEDA 4C84A 2C5QA 4OC4A 2R82A 2EZBA 1JDBC 1DIKA 4CDJA 4MJXA 4COGA 3BI1A 3T5MA 1M6VB 4OC5A 2AUMA 1JDEA 5IR2A 1VBGA 3SJXA 3EZEA 2GP4A 1KEEB 1VI4A 3FF3A 3SJEA 3S9MA 4C8AA 3SR3A 2HROA 4E5SA 1EZAA 3TLGB 4OC1A 5IB9A 2AUNA 3D7GA 2XEIA 3S9LA 1XF1A 3D7HA 1T36B 2JBJA 4NGRA 1ZL0A 5F1YA 4M8DA 4P4JA 2PVWA 2CIJA 2C6PA 2YJTA 3TLEA 5D29A 3KASA 1NXJA 4H1HA 3EIFA 1KBLA 1NBWA 4C85A 1R61A 3C8OA 2HI6A 3GJZA 3TLBA 2FM4A 3FEEA 3SJFA 2JBKA 1CS0B 2MP0A 3EZBA 3KRVA 4IIXA 4C9EA 4C8UA 5ELYA 4C9AA 4C9RA 4C8FA 1EZBA 3T0TA 3NOJA 3TLGA 4NGMA 2YJVA 4P44A 4NGNA 4CO9A 2B0AA 3K4IA 3TLYA 4TJXA 3TYXA 4MCSA 2XEFA 4P4DA 1ZRSA 2C6GA 4MCQA 4C8TA 2D0OA 1ZYMA 4MCPA 4CDKA 2D0PA 1WVMA 3EZAA 2EK9A 1BXRB 5JYBA 4P4EA 3RBUA 5F09A 5FD8A 4JZ0A 3IIBA 4P4IA 2OOTA 4TWEA 3ICUA 2OR4A 4J0NA 4LQGA 2HWGA 4KNGE 4OC0A 1Q5XA 4MCRA 2C6CA 4X3RA 4P4FA 2X0SA 4W9YA 3G23A 3BHXA 4COBA 4TJVA 2OLSA 2EK8A 1VBHA 3VTAA 1CX8A 1CE8B 3TLAA 5JVLA 1A9XB 4NGQA 3TLCA 4C99A 1C30B 2EZCA 4CZ1A 1V6CA 4NGPA 1C3OB 5F5XA 4E94A 3TLZA 4IIYA 3K9TA 3T07A 2XEGA 4YN3A 3D7DA 4P4BA 1Z8LA 3U1BA 4EYSA 4C9VA 3FECA 4C9UA 2EZAA 1J3LA 4OC2A
chains in the Genus database with same CATH topology
4COBA 4CZ1A 4COGA 1R61A 4CO9A 3KRVA 2B0AA 4M8DA 4J0NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4COB A;  4CZ1 A;  4COG A;  1R61 A;  4CO9 A;  3KRV A;  2B0A A;  4M8D A;  4J0N A; 
#chains in the Genus database with same CATH topology
 3IWW A;  4C86 A;  1Y9Z A;  3BXM A;  4C8P A;  3I6S A;  5F9M A;  4OC3 A;  1KC7 A;  2DIK A;  2PVV A;  2XEJ A;  3S9N A;  1GGO A;  3I74 A;  3T05 A;  3SJG A;  4NGS A;  4MI1 A;  4JVO A;  4JYW A;  4C8C A;  4INJ A;  3BI0 A;  5K99 A;  4OME A;  2E28 A;  1DE4 C;  4NGT A;  4P45 A;  3D7F A;  2PCN A;  3FED A;  4C84 A;  2C5Q A;  4OC4 A;  2R82 A;  2EZB A;  1JDB C;  1DIK A;  4CDJ A;  4MJX A;  4COG A;  3BI1 A;  3T5M A;  1M6V B;  4OC5 A;  2AUM A;  1JDE A;  5IR2 A;  1VBG A;  3SJX A;  3EZE A;  2GP4 A;  1KEE B;  1VI4 A;  3FF3 A;  3SJE A;  3S9M A;  4C8A A;  3SR3 A;  2HRO A;  4E5S A;  1EZA A;  3TLG B;  4OC1 A;  5IB9 A;  2AUN A;  3D7G A;  2XEI A;  3S9L A;  1XF1 A;  3D7H A;  1T36 B;  2JBJ A;  4NGR A;  1ZL0 A;  5F1Y A;  4M8D A;  4P4J A;  2PVW A;  2CIJ A;  2C6P A;  2YJT A;  3TLE A;  5D29 A;  3KAS A;  1NXJ A;  4H1H A;  3EIF A;  1KBL A;  1NBW A;  4C85 A;  1R61 A;  3C8O A;  2HI6 A;  3GJZ A;  3TLB A;  2FM4 A;  3FEE A;  3SJF A;  2JBK A;  1CS0 B;  2MP0 A;  3EZB A;  3KRV A;  4IIX A;  4C9E A;  4C8U A;  5ELY A;  4C9A A;  4C9R A;  4C8F A;  1EZB A;  3T0T A;  3NOJ A;  3TLG A;  4NGM A;  2YJV A;  4P44 A;  4NGN A;  4CO9 A;  2B0A A;  3K4I A;  3TLY A;  4TJX A;  3TYX A;  4MCS A;  2XEF A;  4P4D A;  1ZRS A;  2C6G A;  4MCQ A;  4C8T A;  2D0O A;  1ZYM A;  4MCP A;  4CDK A;  2D0P A;  1WVM A;  3EZA A;  2EK9 A;  1BXR B;  5JYB A;  4P4E A;  3RBU A;  5F09 A;  5FD8 A;  4JZ0 A;  3IIB A;  4P4I A;  2OOT A;  4TWE A;  3ICU A;  2OR4 A;  4J0N A;  4LQG A;  2HWG A;  4KNG E;  4OC0 A;  1Q5X A;  4MCR A;  2C6C A;  4X3R A;  4P4F A;  2X0S A;  4W9Y A;  3G23 A;  3BHX A;  4COB A;  4TJV A;  2OLS A;  2EK8 A;  1VBH A;  3VTA A;  1CX8 A;  1CE8 B;  3TLA A;  5JVL A;  1A9X B;  4NGQ A;  3TLC A;  4C99 A;  1C30 B;  2EZC A;  4CZ1 A;  1V6C A;  4NGP A;  1C3O B;  5F5X A;  4E94 A;  3TLZ A;  4IIY A;  3K9T A;  3T07 A;  2XEG A;  4YN3 A;  3D7D A;  4P4B A;  1Z8L A;  3U1B A;  4EYS A;  4C9V A;  3FEC A;  4C9U A;  2EZA A;  1J3L A;  4OC2 A; 
#chains in the Genus database with same CATH homology
 4COB A;  4CZ1 A;  4COG A;  1R61 A;  4CO9 A;  3KRV A;  2B0A A;  4M8D A;  4J0N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...