4J0NA

Crystal structure of a manganese dependent isatin hydrolase
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
261
structure length
261
Chain Sequence
SAQSALSGLGAKLLSGEVEVVDCTGVLGPNTPILQLPPDFAKNTPKVEIHKISEYDSDGPFFAWNWMVLGEHSGTHFDAPHHWITGKDYSDGFTDTLDVQRLIAPVNVIDCSKESAADPDFLLTADLIKAWEAEHGEIGAGEWVVMRTDWDKRAGDEAAFLNADETGPHSPGPTPDAIEYLLSKKIVGWGSQCIGTDAGQAGGMEPPFPAHNLLHRDNCFGLASLANLDKLPAKGAILIAAPLKIERGTGSPIRALALVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Isatin hydrolase B
publication title A proton wire and water channel revealed in the crystal structure of isatin hydrolase.
pubmed doi rcsb
source organism Labrenzia aggregata iam 12614
total genus 80
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 3.5.2.20: Isatin hydrolase.
pdb deposition date 2013-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04199 Cyclase Putative cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.50 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Putative cyclase 4j0nA00
4J0NA 2B0AA 1R61A 4COBA 4COGA 4CZ1A 3KRVA 4M8DA 4CO9A
chains in the Genus database with same CATH superfamily
4MCPA 2EK8A 4P4FA 1BXRB 4OMEA 2C6CA 4COBA 5IB9A 1VI4A 1VBHA 2CIJA 4M8DA 3RBUA 1VBGA 3FEEA 4YN3A 4C8PA 1R61A 2D0PA 4OC1A 4P45A 1Z8LA 3TLBA 2EZAA 3TLCA 2MP0A 1V6CA 3VTAA 4C86A 1ZL0A 4NGSA 1EZAA 4C9RA 3NOJA 2XEIA 1WVMA 5FD8A 2OLSA 4OC4A 4X3RA 1NXJA 4NGMA 4TJVA 4MCQA 2PVWA 4NGTA 4TWEA 3BI1A 1CX8A 1NBWA 4CO9A 4P4BA 4CDJA 2YJVA 2GP4A 5JVLA 4OC0A 2C6PA 2OOTA 5F09A 4JYWA 2E28A 1EZBA 2XEJA 3U1BA 3T5MA 1ZRSA 2AUNA 3S9MA 1Y9ZA 3BXMA 2JBKA 3IIBA 4CZ1A 3T07A 2JBJA 3TYXA 2XEFA 3TLGB 4C99A 2B0AA 2PCNA 1Q5XA 4OC2A 4C8AA 2EK9A 4P44A 3T05A 3TLAA 4P4DA 2EZBA 5ELYA 4MJXA 5F1YA 1XF1A 4NGQA 2PVVA 3I6SA 3I74A 5F5XA 4C9EA 4C8CA 1JDEA 1KEEB 4IIYA 4CDKA 2AUMA 4C8UA 5JYBA 3S9NA 5IR2A 3K4IA 4C9AA 1ZYMA 3SR3A 2D0OA 1C30B 4TJXA 1C3OB 3FF3A 4NGPA 3ICUA 4P4EA 4C9UA 2EZCA 4KNGE 4C8TA 1KC7A 2C6GA 3TLEA 4MCRA 4C8FA 1T36B 2HROA 3FECA 3TLZA 4JZ0A 4EYSA 1M6VB 4W9YA 4C84A 4MCSA 4INJA 3KASA 4COGA 3EZBA 4LQGA 1DE4C 3D7HA 2DIKA 5K99A 3TLGA 4OC5A 1A9XB 5D29A 3IWWA 3G23A 2HI6A 1J3LA 1GGOA 4C9VA 3K9TA 1JDBC 1DIKA 2FM4A 4P4IA 4NGRA 2C5QA 3SJFA 3EZAA 3EZEA 3TLYA 4NGNA 3D7DA 2OR4A 2HWGA 3GJZA 3BHXA 3S9LA 3D7GA 3EIFA 4H1HA 4C85A 4OC3A 2X0SA 3SJEA 4IIXA 2YJTA 3T0TA 3C8OA 1CS0B 1KBLA 3SJXA 4E5SA 3KRVA 2XEGA 4E94A 3BI0A 4J0NA 4MI1A 2R82A 4JVOA 4P4JA 1CE8B 3SJGA 3FEDA 3D7FA 5F9MA
chains in the Genus database with same CATH topology
4J0NA 2B0AA 1R61A 4COBA 4COGA 4CZ1A 3KRVA 4M8DA 4CO9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J0N A;  2B0A A;  1R61 A;  4COB A;  4COG A;  4CZ1 A;  3KRV A;  4M8D A;  4CO9 A; 
#chains in the Genus database with same CATH topology
 4MCP A;  2EK8 A;  4P4F A;  1BXR B;  4OME A;  2C6C A;  4COB A;  5IB9 A;  1VI4 A;  1VBH A;  2CIJ A;  4M8D A;  3RBU A;  1VBG A;  3FEE A;  4YN3 A;  4C8P A;  1R61 A;  2D0P A;  4OC1 A;  4P45 A;  1Z8L A;  3TLB A;  2EZA A;  3TLC A;  2MP0 A;  1V6C A;  3VTA A;  4C86 A;  1ZL0 A;  4NGS A;  1EZA A;  4C9R A;  3NOJ A;  2XEI A;  1WVM A;  5FD8 A;  2OLS A;  4OC4 A;  4X3R A;  1NXJ A;  4NGM A;  4TJV A;  4MCQ A;  2PVW A;  4NGT A;  4TWE A;  3BI1 A;  1CX8 A;  1NBW A;  4CO9 A;  4P4B A;  4CDJ A;  2YJV A;  2GP4 A;  5JVL A;  4OC0 A;  2C6P A;  2OOT A;  5F09 A;  4JYW A;  2E28 A;  1EZB A;  2XEJ A;  3U1B A;  3T5M A;  1ZRS A;  2AUN A;  3S9M A;  1Y9Z A;  3BXM A;  2JBK A;  3IIB A;  4CZ1 A;  3T07 A;  2JBJ A;  3TYX A;  2XEF A;  3TLG B;  4C99 A;  2B0A A;  2PCN A;  1Q5X A;  4OC2 A;  4C8A A;  2EK9 A;  4P44 A;  3T05 A;  3TLA A;  4P4D A;  2EZB A;  5ELY A;  4MJX A;  5F1Y A;  1XF1 A;  4NGQ A;  2PVV A;  3I6S A;  3I74 A;  5F5X A;  4C9E A;  4C8C A;  1JDE A;  1KEE B;  4IIY A;  4CDK A;  2AUM A;  4C8U A;  5JYB A;  3S9N A;  5IR2 A;  3K4I A;  4C9A A;  1ZYM A;  3SR3 A;  2D0O A;  1C30 B;  4TJX A;  1C3O B;  3FF3 A;  4NGP A;  3ICU A;  4P4E A;  4C9U A;  2EZC A;  4KNG E;  4C8T A;  1KC7 A;  2C6G A;  3TLE A;  4MCR A;  4C8F A;  1T36 B;  2HRO A;  3FEC A;  3TLZ A;  4JZ0 A;  4EYS A;  1M6V B;  4W9Y A;  4C84 A;  4MCS A;  4INJ A;  3KAS A;  4COG A;  3EZB A;  4LQG A;  1DE4 C;  3D7H A;  2DIK A;  5K99 A;  3TLG A;  4OC5 A;  1A9X B;  5D29 A;  3IWW A;  3G23 A;  2HI6 A;  1J3L A;  1GGO A;  4C9V A;  3K9T A;  1JDB C;  1DIK A;  2FM4 A;  4P4I A;  4NGR A;  2C5Q A;  3SJF A;  3EZA A;  3EZE A;  3TLY A;  4NGN A;  3D7D A;  2OR4 A;  2HWG A;  3GJZ A;  3BHX A;  3S9L A;  3D7G A;  3EIF A;  4H1H A;  4C85 A;  4OC3 A;  2X0S A;  3SJE A;  4IIX A;  2YJT A;  3T0T A;  3C8O A;  1CS0 B;  1KBL A;  3SJX A;  4E5S A;  3KRV A;  2XEG A;  4E94 A;  3BI0 A;  4J0N A;  4MI1 A;  2R82 A;  4JVO A;  4P4J A;  1CE8 B;  3SJG A;  3FED A;  3D7F A;  5F9M A; 
#chains in the Genus database with same CATH homology
 4J0N A;  2B0A A;  1R61 A;  4COB A;  4COG A;  4CZ1 A;  3KRV A;  4M8D A;  4CO9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...