4J0NA

Crystal structure of a manganese dependent isatin hydrolase
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
261
structure length
261
Chain Sequence
SAQSALSGLGAKLLSGEVEVVDCTGVLGPNTPILQLPPDFAKNTPKVEIHKISEYDSDGPFFAWNWMVLGEHSGTHFDAPHHWITGKDYSDGFTDTLDVQRLIAPVNVIDCSKESAADPDFLLTADLIKAWEAEHGEIGAGEWVVMRTDWDKRAGDEAAFLNADETGPHSPGPTPDAIEYLLSKKIVGWGSQCIGTDAGQAGGMEPPFPAHNLLHRDNCFGLASLANLDKLPAKGAILIAAPLKIERGTGSPIRALALVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Isatin hydrolase B
publication title A proton wire and water channel revealed in the crystal structure of isatin hydrolase.
pubmed doi rcsb
source organism Labrenzia aggregata iam 12614
molecule tags Hydrolase
total genus 80
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 3.5.2.20: Isatin hydrolase.
pdb deposition date 2013-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04199 Cyclase Putative cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.50 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Putative cyclase 4j0nA00
4COGA 4CO9A 3KRVA 4J0NA 2B0AA 4M8DA 1R61A 4CZ1A 4COBA
chains in the Genus database with same CATH superfamily
1Z8LA 3EZAA 4EYSA 4MJXA 4OC5A 3T05A 2YJTA 1NXJA 2D0PA 4P4FA 4C9RA 2OR4A 1A9XB 4P4IA 3U1BA 4E94A 4MCPA 4OC0A 3K4IA 1DIKA 5IR2A 4KNGE 5D29A 4W9YA 4E5SA 5K99A 4X3RA 3K9TA 4MCRA 2PCNA 4C8TA 1BXRB 5JVLA 2XEFA 4P4EA 4P4BA 1Y9ZA 2AUNA 3S9MA 3SJEA 1KC7A 4CO9A 3S9NA 1T36B 1DE4C 3IWWA 4C8CA 1J3LA 4JYWA 1V6CA 4NGNA 4OC4A 3SJGA 3VTAA 3EZEA 2XEIA 1CS0B 4OC1A 4C8UA 4C8PA 2C6PA 1EZAA 2JBJA 3NOJA 1C30B 3TYXA 1KBLA 2JBKA 2PVVA 3BI1A 2E28A 3TLGA 5ELYA 3BI0A 3TLEA 5IB9A 3FECA 4TJVA 4JZ0A 3D7GA 1CE8B 2C6CA 3FF3A 5JYBA 2D0OA 3KRVA 1Q5XA 3D7HA 5FD8A 5F09A 4NGRA 3T0TA 2C5QA 1NBWA 3RBUA 4P4JA 4NGTA 2EK8A 3ICUA 2B0AA 1JDBC 3BHXA 4M8DA 1WVMA 4OC3A 4P4DA 2XEJA 3TLZA 2OOTA 1GGOA 4YN3A 4C9VA 3FEEA 1VI4A 1ZRSA 4P44A 3SR3A 4C8FA 2AUMA 4C9EA 2EZBA 3EZBA 2HWGA 5F9MA 2YJVA 2MP0A 1ZYMA 2OLSA 1R61A 2DIKA 1CX8A 2FM4A 1EZBA 1JDEA 2R82A 4C9AA 4NGMA 3TLBA 2EZAA 3D7FA 4IIYA 4P45A 2EZCA 4NGSA 4MI1A 4MCQA 4C9UA 4MCSA 4TJXA 4JVOA 3TLAA 3T5MA 3TLGB 4CDJA 4CDKA 4NGPA 2PVWA 5F1YA 4COBA 3I6SA 3TLCA 4LQGA 3EIFA 4C8AA 3BXMA 2GP4A 2CIJA 3D7DA 2HROA 3TLYA 4C86A 1ZL0A 3S9LA 3T07A 3G23A 3KASA 4C84A 2XEGA 4IIXA 3IIBA 4INJA 3SJXA 3GJZA 1XF1A 1KEEB 4OC2A 4C85A 5F5XA 4OMEA 4CZ1A 1C3OB 4COGA 1VBHA 2EK9A 2HI6A 3C8OA 3FEDA 4J0NA 4C99A 3I74A 4NGQA 1VBGA 2C6GA 4TWEA 2X0SA 1M6VB 4H1HA 3SJFA
chains in the Genus database with same CATH topology
4COGA 4CO9A 3KRVA 4J0NA 2B0AA 4M8DA 1R61A 4CZ1A 4COBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4COG A;  4CO9 A;  3KRV A;  4J0N A;  2B0A A;  4M8D A;  1R61 A;  4CZ1 A;  4COB A; 
#chains in the Genus database with same CATH topology
 1Z8L A;  3EZA A;  4EYS A;  4MJX A;  4OC5 A;  3T05 A;  2YJT A;  1NXJ A;  2D0P A;  4P4F A;  4C9R A;  2OR4 A;  1A9X B;  4P4I A;  3U1B A;  4E94 A;  4MCP A;  4OC0 A;  3K4I A;  1DIK A;  5IR2 A;  4KNG E;  5D29 A;  4W9Y A;  4E5S A;  5K99 A;  4X3R A;  3K9T A;  4MCR A;  2PCN A;  4C8T A;  1BXR B;  5JVL A;  2XEF A;  4P4E A;  4P4B A;  1Y9Z A;  2AUN A;  3S9M A;  3SJE A;  1KC7 A;  4CO9 A;  3S9N A;  1T36 B;  1DE4 C;  3IWW A;  4C8C A;  1J3L A;  4JYW A;  1V6C A;  4NGN A;  4OC4 A;  3SJG A;  3VTA A;  3EZE A;  2XEI A;  1CS0 B;  4OC1 A;  4C8U A;  4C8P A;  2C6P A;  1EZA A;  2JBJ A;  3NOJ A;  1C30 B;  3TYX A;  1KBL A;  2JBK A;  2PVV A;  3BI1 A;  2E28 A;  3TLG A;  5ELY A;  3BI0 A;  3TLE A;  5IB9 A;  3FEC A;  4TJV A;  4JZ0 A;  3D7G A;  1CE8 B;  2C6C A;  3FF3 A;  5JYB A;  2D0O A;  3KRV A;  1Q5X A;  3D7H A;  5FD8 A;  5F09 A;  4NGR A;  3T0T A;  2C5Q A;  1NBW A;  3RBU A;  4P4J A;  4NGT A;  2EK8 A;  3ICU A;  2B0A A;  1JDB C;  3BHX A;  4M8D A;  1WVM A;  4OC3 A;  4P4D A;  2XEJ A;  3TLZ A;  2OOT A;  1GGO A;  4YN3 A;  4C9V A;  3FEE A;  1VI4 A;  1ZRS A;  4P44 A;  3SR3 A;  4C8F A;  2AUM A;  4C9E A;  2EZB A;  3EZB A;  2HWG A;  5F9M A;  2YJV A;  2MP0 A;  1ZYM A;  2OLS A;  1R61 A;  2DIK A;  1CX8 A;  2FM4 A;  1EZB A;  1JDE A;  2R82 A;  4C9A A;  4NGM A;  3TLB A;  2EZA A;  3D7F A;  4IIY A;  4P45 A;  2EZC A;  4NGS A;  4MI1 A;  4MCQ A;  4C9U A;  4MCS A;  4TJX A;  4JVO A;  3TLA A;  3T5M A;  3TLG B;  4CDJ A;  4CDK A;  4NGP A;  2PVW A;  5F1Y A;  4COB A;  3I6S A;  3TLC A;  4LQG A;  3EIF A;  4C8A A;  3BXM A;  2GP4 A;  2CIJ A;  3D7D A;  2HRO A;  3TLY A;  4C86 A;  1ZL0 A;  3S9L A;  3T07 A;  3G23 A;  3KAS A;  4C84 A;  2XEG A;  4IIX A;  3IIB A;  4INJ A;  3SJX A;  3GJZ A;  1XF1 A;  1KEE B;  4OC2 A;  4C85 A;  5F5X A;  4OME A;  4CZ1 A;  1C3O B;  4COG A;  1VBH A;  2EK9 A;  2HI6 A;  3C8O A;  3FED A;  4J0N A;  4C99 A;  3I74 A;  4NGQ A;  1VBG A;  2C6G A;  4TWE A;  2X0S A;  1M6V B;  4H1H A;  3SJF A; 
#chains in the Genus database with same CATH homology
 4COG A;  4CO9 A;  3KRV A;  4J0N A;  2B0A A;  4M8D A;  1R61 A;  4CZ1 A;  4COB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...