4J0NA

Crystal structure of a manganese dependent isatin hydrolase
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
261
structure length
261
Chain Sequence
SAQSALSGLGAKLLSGEVEVVDCTGVLGPNTPILQLPPDFAKNTPKVEIHKISEYDSDGPFFAWNWMVLGEHSGTHFDAPHHWITGKDYSDGFTDTLDVQRLIAPVNVIDCSKESAADPDFLLTADLIKAWEAEHGEIGAGEWVVMRTDWDKRAGDEAAFLNADETGPHSPGPTPDAIEYLLSKKIVGWGSQCIGTDAGQAGGMEPPFPAHNLLHRDNCFGLASLANLDKLPAKGAILIAAPLKIERGTGSPIRALALVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A proton wire and water channel revealed in the crystal structure of isatin hydrolase.
pubmed doi rcsb
source organism Labrenzia aggregata iam 12614
molecule tags Hydrolase
molecule keywords Isatin hydrolase B
total genus 80
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 3.5.2.20: Isatin hydrolase.
pdb deposition date 2013-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04199 Cyclase Putative cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.50 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Putative cyclase 4j0nA00
2B0AA 3KRVA 4COGA 4COBA 4J0NA 4CO9A 4CZ1A 1R61A 4M8DA
chains in the Genus database with same CATH superfamily
4LQGA 2EK8A 1ZL0A 1XF1A 4P4FA 2X0SA 4OC3A 3TYXA 3VTAA 4C86A 4OC2A 4C9VA 4NGPA 4NGSA 3SJEA 3FF3A 4P45A 5F5XA 1CS0B 3T07A 4CO9A 4NGRA 4C8AA 5F1YA 4EYSA 2HROA 1KEEB 3TLYA 2XEGA 1JDBC 3BXMA 4C8PA 4CDKA 1Z8LA 3D7GA 2JBJA 5ELYA 1EZBA 1ZRSA 2D0OA 3ICUA 4MCPA 1J3LA 2PVWA 1ZYMA 4OC5A 1CX8A 1T36B 4C99A 3EZAA 3NOJA 4COBA 5JVLA 2YJTA 3SJFA 2E28A 3TLGB 2FM4A 5JYBA 2C6CA 3EZBA 4TWEA 3TLGA 2OOTA 4P4EA 2JBKA 2D0PA 4C8TA 4C8CA 5IB9A 4YN3A 3C8OA 2EK9A 3I74A 4INJA 3I6SA 3BI1A 2AUNA 3K9TA 4P44A 4CDJA 2HWGA 4NGMA 4OC4A 3T5MA 5IR2A 3TLCA 3IWWA 3TLZA 2DIKA 1M6VB 3TLAA 4H1HA 4IIYA 4MCQA 5FD8A 3SR3A 5D29A 4TJVA 4IIXA 3D7DA 4E5SA 3FECA 1DE4C 4C85A 2AUMA 3EZEA 4C9RA 4CZ1A 3S9LA 3BI0A 4P4BA 1WVMA 1C3OB 4C8FA 3TLEA 4COGA 2C6PA 4NGQA 1NBWA 4OC1A 1VI4A 4OC0A 4TJXA 2C6GA 4OMEA 3D7FA 4X3RA 2PCNA 4P4JA 1VBGA 1CE8B 3FEEA 4W9YA 1DIKA 3SJGA 1V6CA 4KNGE 4MCRA 4JYWA 4E94A 3TLBA 3BHXA 3FEDA 4C84A 1VBHA 4P4IA 2EZBA 4JZ0A 2OLSA 1NXJA 2GP4A 3GJZA 1Q5XA 4MJXA 2XEJA 4C8UA 1A9XB 1R61A 3K4IA 4M8DA 2XEIA 4NGTA 3SJXA 3S9NA 3U1BA 1Y9ZA 2PVVA 1KC7A 2EZAA 4J0NA 1KBLA 5F9MA 1GGOA 1EZAA 3KASA 3EIFA 4JVOA 2C5QA 2B0AA 3T0TA 4C9EA 2CIJA 3IIBA 2EZCA 4C9AA 5F09A 1C30B 1JDEA 2R82A 4MI1A 3G23A 3KRVA 2XEFA 4P4DA 4NGNA 1BXRB 4MCSA 2HI6A 3T05A 2MP0A 3S9MA 5K99A 4C9UA 3D7HA 2YJVA 3RBUA 2OR4A
chains in the Genus database with same CATH topology
2B0AA 3KRVA 4COGA 4COBA 4J0NA 4CO9A 4CZ1A 1R61A 4M8DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B0A A;  3KRV A;  4COG A;  4COB A;  4J0N A;  4CO9 A;  4CZ1 A;  1R61 A;  4M8D A; 
#chains in the Genus database with same CATH topology
 4LQG A;  2EK8 A;  1ZL0 A;  1XF1 A;  4P4F A;  2X0S A;  4OC3 A;  3TYX A;  3VTA A;  4C86 A;  4OC2 A;  4C9V A;  4NGP A;  4NGS A;  3SJE A;  3FF3 A;  4P45 A;  5F5X A;  1CS0 B;  3T07 A;  4CO9 A;  4NGR A;  4C8A A;  5F1Y A;  4EYS A;  2HRO A;  1KEE B;  3TLY A;  2XEG A;  1JDB C;  3BXM A;  4C8P A;  4CDK A;  1Z8L A;  3D7G A;  2JBJ A;  5ELY A;  1EZB A;  1ZRS A;  2D0O A;  3ICU A;  4MCP A;  1J3L A;  2PVW A;  1ZYM A;  4OC5 A;  1CX8 A;  1T36 B;  4C99 A;  3EZA A;  3NOJ A;  4COB A;  5JVL A;  2YJT A;  3SJF A;  2E28 A;  3TLG B;  2FM4 A;  5JYB A;  2C6C A;  3EZB A;  4TWE A;  3TLG A;  2OOT A;  4P4E A;  2JBK A;  2D0P A;  4C8T A;  4C8C A;  5IB9 A;  4YN3 A;  3C8O A;  2EK9 A;  3I74 A;  4INJ A;  3I6S A;  3BI1 A;  2AUN A;  3K9T A;  4P44 A;  4CDJ A;  2HWG A;  4NGM A;  4OC4 A;  3T5M A;  5IR2 A;  3TLC A;  3IWW A;  3TLZ A;  2DIK A;  1M6V B;  3TLA A;  4H1H A;  4IIY A;  4MCQ A;  5FD8 A;  3SR3 A;  5D29 A;  4TJV A;  4IIX A;  3D7D A;  4E5S A;  3FEC A;  1DE4 C;  4C85 A;  2AUM A;  3EZE A;  4C9R A;  4CZ1 A;  3S9L A;  3BI0 A;  4P4B A;  1WVM A;  1C3O B;  4C8F A;  3TLE A;  4COG A;  2C6P A;  4NGQ A;  1NBW A;  4OC1 A;  1VI4 A;  4OC0 A;  4TJX A;  2C6G A;  4OME A;  3D7F A;  4X3R A;  2PCN A;  4P4J A;  1VBG A;  1CE8 B;  3FEE A;  4W9Y A;  1DIK A;  3SJG A;  1V6C A;  4KNG E;  4MCR A;  4JYW A;  4E94 A;  3TLB A;  3BHX A;  3FED A;  4C84 A;  1VBH A;  4P4I A;  2EZB A;  4JZ0 A;  2OLS A;  1NXJ A;  2GP4 A;  3GJZ A;  1Q5X A;  4MJX A;  2XEJ A;  4C8U A;  1A9X B;  1R61 A;  3K4I A;  4M8D A;  2XEI A;  4NGT A;  3SJX A;  3S9N A;  3U1B A;  1Y9Z A;  2PVV A;  1KC7 A;  2EZA A;  4J0N A;  1KBL A;  5F9M A;  1GGO A;  1EZA A;  3KAS A;  3EIF A;  4JVO A;  2C5Q A;  2B0A A;  3T0T A;  4C9E A;  2CIJ A;  3IIB A;  2EZC A;  4C9A A;  5F09 A;  1C30 B;  1JDE A;  2R82 A;  4MI1 A;  3G23 A;  3KRV A;  2XEF A;  4P4D A;  4NGN A;  1BXR B;  4MCS A;  2HI6 A;  3T05 A;  2MP0 A;  3S9M A;  5K99 A;  4C9U A;  3D7H A;  2YJV A;  3RBU A;  2OR4 A; 
#chains in the Genus database with same CATH homology
 2B0A A;  3KRV A;  4COG A;  4COB A;  4J0N A;  4CO9 A;  4CZ1 A;  1R61 A;  4M8D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...