5IR2A

Crystal structure of novel cellulases from microbes associated with the gut ecosystem
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
222
structure length
222
Chain Sequence
YKKEIGMMNLEKLIQDREGISSKKFPIEDKELLFRYEQLYTGAVNDVMREFCLLEQALPGRIKPLREYHSVAGFAFTVKSAPNVKIKGEMEYRTQMLDEMQEDHFVVWDTSRDDKATLWGGVMTATAKGKKLKAACIDGGIRDTHQILNADFPVFYEYRISNGSLGRCLITHYQIPIKIGDVTIKSGDIILGDIDGVLVVPREIAYEVLLRSEEIRENEKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cellulase
publication title Crystal structure of novel cellulases from microbes associated with the gut ecosystem
rcsb
source organism Parabacteroides johnsonii dsm 18315
total genus 64
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2016-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03737 RraA-like Aldolase/RraA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.100 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 5ir2A00
5IR2A 2C5QA
chains in the Genus database with same CATH superfamily
2OR4A 1ZL0A 4YN3A 1BXRB 2C6CA 4NGNA 4C84A 2EK8A 3BI1A 2D0OA 4IIYA 4M8DA 4CDJA 4MJXA 1C3OB 3D7HA 1CE8B 2AUNA 3S9NA 1KC7A 5D29A 4INJA 5F1YA 1EZAA 4C9RA 1NXJA 5K99A 4C8TA 3KRVA 1CX8A 3EZAA 4P44A 4P45A 1T36B 3TLGA 4OC3A 4P4BA 1VI4A 4NGRA 2R82A 5F5XA 1EZBA 3TYXA 2JBJA 5IR2A 1Z8LA 3RBUA 4W9YA 4MCQA 4EYSA 4C99A 4X3RA 3EIFA 4P4EA 2GP4A 2EK9A 4CZ1A 1V6CA 4E5SA 3K9TA 4MCSA 4OMEA 3TLGB 5JVLA 1JDEA 3FF3A 2FM4A 4JVOA 2HI6A 2PCNA 4TWEA 2B0AA 4OC4A 2X0SA 4C9EA 1KBLA 3S9LA 1Q5XA 4MI1A 2XEJA 5F09A 2C5QA 3SJEA 4J0NA 4C85A 4C8CA 2EZAA 4IIXA 4NGTA 3IIBA 2YJVA 4OC5A 3SR3A 1M6VB 3K4IA 4NGSA 3T05A 4LQGA 1KEEB 1A9XB 3TLEA 3D7DA 4P4IA 3S9MA 4C8UA 4NGPA 4C9UA 3TLAA 3TLYA 4C8AA 3BI0A 3KASA 4C9AA 3SJGA 4P4DA 3SJXA 2AUMA 2XEFA 5JYBA 3FEEA 2HROA 4E94A 4MCPA 4C8PA 4OC1A 3T07A 1WVMA 4JYWA 3SJFA 4C9VA 4P4FA 2HWGA 1DE4C 3G23A 3BHXA 3I6SA 3ICUA 3IWWA 2JBKA 3GJZA 4MCRA 4OC0A 2YJTA 3T5MA 2CIJA 4COGA 2E28A 2DIKA 5FD8A 1XF1A 3FECA 1ZYMA 5ELYA 4C86A 1C30B 4TJXA 1Y9ZA 4H1HA 3TLBA 1DIKA 4CDKA 2MP0A 2OOTA 3T0TA 1R61A 2EZBA 4NGMA 1CS0B 2C6GA 3TLCA 1ZRSA 2D0PA 4KNGE 2XEGA 3U1BA 1NBWA 1J3LA 5F9MA 3I74A 3EZEA 4JZ0A 3EZBA 2PVVA 2PVWA 4COBA 1JDBC 1VBGA 3BXMA 4NGQA 1GGOA 1VBHA 3NOJA 3TLZA 4C8FA 2XEIA 3D7FA 2EZCA 4OC2A 2C6PA 2OLSA 3C8OA 3D7GA 4P4JA 5IB9A 3VTAA 4CO9A 3FEDA 4TJVA
chains in the Genus database with same CATH topology
2OR4A 4YN3A 2C6CA 4NGNA 4C84A 2EK8A 3BI1A 4CDJA 3D7HA 3S9NA 5D29A 4C9RA 4C8TA 1CX8A 4P44A 4P45A 4OC3A 4P4BA 4NGRA 2JBJA 5IR2A 1Z8LA 3RBUA 4W9YA 4MCQA 4C99A 4X3RA 3EIFA 4P4EA 2GP4A 2EK9A 1V6CA 3K9TA 4MCSA 4OMEA 3FF3A 4TWEA 4C9EA 4OC4A 3S9LA 2XEJA 5F09A 2C5QA 3SJEA 4C85A 4C8CA 4NGTA 3IIBA 4OC5A 4NGSA 4LQGA 3D7DA 4P4IA 3S9MA 4C8UA 4NGPA 4C9UA 4C8AA 3BI0A 3KASA 4C9AA 3SJGA 4P4DA 3SJXA 2XEFA 3FEEA 4MCPA 4C8PA 4OC1A 4C9VA 1WVMA 4JYWA 3SJFA 4P4FA 1DE4C 3I6SA 3BHXA 3ICUA 3IWWA 4MCRA 2JBKA 4OC0A 2CIJA 1XF1A 3FECA 5ELYA 4C86A 4TJXA 1Y9ZA 4CDKA 2OOTA 4NGMA 2C6GA 4KNGE 2XEGA 3I74A 4JZ0A 2PVVA 2PVWA 4NGQA 3BXMA 4C8FA 2XEIA 3D7FA 4OC2A 2C6PA 3D7GA 4P4JA 5IB9A 3VTAA 3FEDA 4TJVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IR2 A;  2C5Q A; 
#chains in the Genus database with same CATH topology
 2OR4 A;  1ZL0 A;  4YN3 A;  1BXR B;  2C6C A;  4NGN A;  4C84 A;  2EK8 A;  3BI1 A;  2D0O A;  4IIY A;  4M8D A;  4CDJ A;  4MJX A;  1C3O B;  3D7H A;  1CE8 B;  2AUN A;  3S9N A;  1KC7 A;  5D29 A;  4INJ A;  5F1Y A;  1EZA A;  4C9R A;  1NXJ A;  5K99 A;  4C8T A;  3KRV A;  1CX8 A;  3EZA A;  4P44 A;  4P45 A;  1T36 B;  3TLG A;  4OC3 A;  4P4B A;  1VI4 A;  4NGR A;  2R82 A;  5F5X A;  1EZB A;  3TYX A;  2JBJ A;  5IR2 A;  1Z8L A;  3RBU A;  4W9Y A;  4MCQ A;  4EYS A;  4C99 A;  4X3R A;  3EIF A;  4P4E A;  2GP4 A;  2EK9 A;  4CZ1 A;  1V6C A;  4E5S A;  3K9T A;  4MCS A;  4OME A;  3TLG B;  5JVL A;  1JDE A;  3FF3 A;  2FM4 A;  4JVO A;  2HI6 A;  2PCN A;  4TWE A;  2B0A A;  4OC4 A;  2X0S A;  4C9E A;  1KBL A;  3S9L A;  1Q5X A;  4MI1 A;  2XEJ A;  5F09 A;  2C5Q A;  3SJE A;  4J0N A;  4C85 A;  4C8C A;  2EZA A;  4IIX A;  4NGT A;  3IIB A;  2YJV A;  4OC5 A;  3SR3 A;  1M6V B;  3K4I A;  4NGS A;  3T05 A;  4LQG A;  1KEE B;  1A9X B;  3TLE A;  3D7D A;  4P4I A;  3S9M A;  4C8U A;  4NGP A;  4C9U A;  3TLA A;  3TLY A;  4C8A A;  3BI0 A;  3KAS A;  4C9A A;  3SJG A;  4P4D A;  3SJX A;  2AUM A;  2XEF A;  5JYB A;  3FEE A;  2HRO A;  4E94 A;  4MCP A;  4C8P A;  4OC1 A;  3T07 A;  1WVM A;  4JYW A;  3SJF A;  4C9V A;  4P4F A;  2HWG A;  1DE4 C;  3G23 A;  3BHX A;  3I6S A;  3ICU A;  3IWW A;  2JBK A;  3GJZ A;  4MCR A;  4OC0 A;  2YJT A;  3T5M A;  2CIJ A;  4COG A;  2E28 A;  2DIK A;  5FD8 A;  1XF1 A;  3FEC A;  1ZYM A;  5ELY A;  4C86 A;  1C30 B;  4TJX A;  1Y9Z A;  4H1H A;  3TLB A;  1DIK A;  4CDK A;  2MP0 A;  2OOT A;  3T0T A;  1R61 A;  2EZB A;  4NGM A;  1CS0 B;  2C6G A;  3TLC A;  1ZRS A;  2D0P A;  4KNG E;  2XEG A;  3U1B A;  1NBW A;  1J3L A;  5F9M A;  3I74 A;  3EZE A;  4JZ0 A;  3EZB A;  2PVV A;  2PVW A;  4COB A;  1JDB C;  1VBG A;  3BXM A;  4NGQ A;  1GGO A;  1VBH A;  3NOJ A;  3TLZ A;  4C8F A;  2XEI A;  3D7F A;  2EZC A;  4OC2 A;  2C6P A;  2OLS A;  3C8O A;  3D7G A;  4P4J A;  5IB9 A;  3VTA A;  4CO9 A;  3FED A;  4TJV A; 
#chains in the Genus database with same CATH homology
 2OR4 A;  4YN3 A;  2C6C A;  4NGN A;  4C84 A;  2EK8 A;  3BI1 A;  4CDJ A;  3D7H A;  3S9N A;  5D29 A;  4C9R A;  4C8T A;  1CX8 A;  4P44 A;  4P45 A;  4OC3 A;  4P4B A;  4NGR A;  2JBJ A;  5IR2 A;  1Z8L A;  3RBU A;  4W9Y A;  4MCQ A;  4C99 A;  4X3R A;  3EIF A;  4P4E A;  2GP4 A;  2EK9 A;  1V6C A;  3K9T A;  4MCS A;  4OME A;  3FF3 A;  4TWE A;  4C9E A;  4OC4 A;  3S9L A;  2XEJ A;  5F09 A;  2C5Q A;  3SJE A;  4C85 A;  4C8C A;  4NGT A;  3IIB A;  4OC5 A;  4NGS A;  4LQG A;  3D7D A;  4P4I A;  3S9M A;  4C8U A;  4NGP A;  4C9U A;  4C8A A;  3BI0 A;  3KAS A;  4C9A A;  3SJG A;  4P4D A;  3SJX A;  2XEF A;  3FEE A;  4MCP A;  4C8P A;  4OC1 A;  4C9V A;  1WVM A;  4JYW A;  3SJF A;  4P4F A;  1DE4 C;  3I6S A;  3BHX A;  3ICU A;  3IWW A;  4MCR A;  2JBK A;  4OC0 A;  2CIJ A;  1XF1 A;  3FEC A;  5ELY A;  4C86 A;  4TJX A;  1Y9Z A;  4CDK A;  2OOT A;  4NGM A;  2C6G A;  4KNG E;  2XEG A;  3I74 A;  4JZ0 A;  2PVV A;  2PVW A;  4NGQ A;  3BXM A;  4C8F A;  2XEI A;  3D7F A;  4OC2 A;  2C6P A;  3D7G A;  4P4J A;  5IB9 A;  3VTA A;  3FED A;  4TJV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...