5IR2A

Crystal structure of novel cellulases from microbes associated with the gut ecosystem
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
222
structure length
222
Chain Sequence
YKKEIGMMNLEKLIQDREGISSKKFPIEDKELLFRYEQLYTGAVNDVMREFCLLEQALPGRIKPLREYHSVAGFAFTVKSAPNVKIKGEMEYRTQMLDEMQEDHFVVWDTSRDDKATLWGGVMTATAKGKKLKAACIDGGIRDTHQILNADFPVFYEYRISNGSLGRCLITHYQIPIKIGDVTIKSGDIILGDIDGVLVVPREIAYEVLLRSEEIRENEKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of novel cellulases from microbes associated with the gut ecosystem
rcsb
source organism Parabacteroides johnsonii dsm 18315
molecule tags Hydrolase
molecule keywords Cellulase
total genus 64
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2016-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03737 RraA-like Aldolase/RraA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.100 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 5ir2A00
5IR2A 2C5QA
chains in the Genus database with same CATH superfamily
4CO9A 3TLZA 5F09A 1T36B 4P45A 3FF3A 1CE8B 4OC5A 3K4IA 4NGRA 1VBHA 4NGTA 4C9VA 4E94A 4P4FA 1Y9ZA 2XEFA 4C8AA 2B0AA 3T05A 1Q5XA 5ELYA 2C6PA 1DIKA 1JDBC 3EZAA 3FEDA 4P4DA 4C85A 4OC4A 2C6CA 4EYSA 3BI1A 4MCPA 1VI4A 1ZL0A 2JBKA 3I74A 3SJGA 4C9RA 5D29A 4NGNA 4CZ1A 2EZBA 1NBWA 4MCRA 4OC2A 4X3RA 5FD8A 2OR4A 1GGOA 4MCSA 4P44A 3T5MA 3TLAA 5IB9A 3D7HA 4JZ0A 4OMEA 4OC1A 4NGSA 4P4BA 4C84A 2MP0A 4C8UA 3IIBA 1V6CA 1C3OB 2FM4A 1XF1A 2PVVA 4C9AA 2YJTA 2XEIA 3EZBA 4J0NA 4C86A 1KBLA 2GP4A 3TLYA 1VBGA 2DIKA 4MJXA 4C8TA 2D0PA 3K9TA 3TYXA 5F5XA 1C30B 4IIXA 2HI6A 5JYBA 4TWEA 1J3LA 2PCNA 2D0OA 5K99A 4MCQA 3FEEA 4CDKA 3SJXA 3FECA 3U1BA 1M6VB 1EZBA 4C8CA 2X0SA 3SJFA 4YN3A 3TLCA 3BI0A 4C99A 4COBA 2R82A 3G23A 3I6SA 4M8DA 4MI1A 3IWWA 4COGA 2HWGA 2YJVA 4JYWA 3C8OA 4OC3A 2PVWA 1EZAA 2EK8A 3S9LA 1KEEB 2XEGA 4OC0A 2C6GA 3RBUA 1BXRB 3D7DA 3TLBA 1NXJA 4C8PA 1ZRSA 2HROA 3TLEA 4H1HA 2JBJA 2OOTA 4NGPA 3VTAA 3S9NA 4TJVA 4W9YA 3T07A 3S9MA 4C9EA 3EIFA 4TJXA 3SJEA 2EZAA 4JVOA 2EK9A 3ICUA 1DE4C 1R61A 1JDEA 4C8FA 4E5SA 3BHXA 5JVLA 2CIJA 4IIYA 4CDJA 1CX8A 1ZYMA 1A9XB 1KC7A 3D7FA 4NGMA 4P4JA 5F1YA 2OLSA 5F9MA 3D7GA 3KRVA 4NGQA 2C5QA 4KNGE 5IR2A 2AUMA 1CS0B 4C9UA 4INJA 1Z8LA 3SR3A 3EZEA 3NOJA 3GJZA 3TLGB 2XEJA 2E28A 4LQGA 1WVMA 3BXMA 3T0TA 2AUNA 3KASA 4P4EA 4P4IA 2EZCA 3TLGA
chains in the Genus database with same CATH topology
5F09A 4P45A 3FF3A 4OC5A 4NGRA 4NGTA 4C9VA 4P4FA 1Y9ZA 2XEFA 4C8AA 5ELYA 2C6PA 3FEDA 4P4DA 4C85A 4OC4A 2C6CA 3BI1A 4MCPA 2JBKA 3I74A 4C9RA 3SJGA 5D29A 4NGNA 4MCRA 4OC2A 4X3RA 2OR4A 4MCSA 4P44A 5IB9A 3D7HA 4JZ0A 4OMEA 4OC1A 4NGSA 4P4BA 4C84A 4C8UA 3IIBA 1V6CA 2PVVA 1XF1A 4C9AA 2XEIA 4C86A 2GP4A 4C8TA 3K9TA 4TWEA 4MCQA 3FEEA 4CDKA 3SJXA 3FECA 4C8CA 3SJFA 4YN3A 3BI0A 4C99A 3I6SA 3IWWA 4JYWA 4OC3A 2PVWA 2EK8A 3S9LA 2XEGA 4OC0A 2C6GA 3RBUA 3D7DA 4C8PA 2OOTA 2JBJA 3VTAA 4NGPA 3S9NA 4TJVA 4W9YA 3S9MA 4C9EA 3EIFA 4TJXA 3SJEA 2EK9A 3ICUA 1DE4C 4C8FA 3BHXA 2CIJA 4CDJA 1CX8A 3D7FA 4NGMA 4P4JA 3D7GA 4NGQA 2C5QA 4KNGE 5IR2A 4C9UA 1Z8LA 2XEJA 4LQGA 1WVMA 3BXMA 3KASA 4P4EA 4P4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IR2 A;  2C5Q A; 
#chains in the Genus database with same CATH topology
 4CO9 A;  3TLZ A;  5F09 A;  1T36 B;  4P45 A;  3FF3 A;  1CE8 B;  4OC5 A;  3K4I A;  4NGR A;  1VBH A;  4NGT A;  4C9V A;  4E94 A;  4P4F A;  1Y9Z A;  2XEF A;  4C8A A;  2B0A A;  3T05 A;  1Q5X A;  5ELY A;  2C6P A;  1DIK A;  1JDB C;  3EZA A;  3FED A;  4P4D A;  4C85 A;  4OC4 A;  2C6C A;  4EYS A;  3BI1 A;  4MCP A;  1VI4 A;  1ZL0 A;  2JBK A;  3I74 A;  3SJG A;  4C9R A;  5D29 A;  4NGN A;  4CZ1 A;  2EZB A;  1NBW A;  4MCR A;  4OC2 A;  4X3R A;  5FD8 A;  2OR4 A;  1GGO A;  4MCS A;  4P44 A;  3T5M A;  3TLA A;  5IB9 A;  3D7H A;  4JZ0 A;  4OME A;  4OC1 A;  4NGS A;  4P4B A;  4C84 A;  2MP0 A;  4C8U A;  3IIB A;  1V6C A;  1C3O B;  2FM4 A;  1XF1 A;  2PVV A;  4C9A A;  2YJT A;  2XEI A;  3EZB A;  4J0N A;  4C86 A;  1KBL A;  2GP4 A;  3TLY A;  1VBG A;  2DIK A;  4MJX A;  4C8T A;  2D0P A;  3K9T A;  3TYX A;  5F5X A;  1C30 B;  4IIX A;  2HI6 A;  5JYB A;  4TWE A;  1J3L A;  2PCN A;  2D0O A;  5K99 A;  4MCQ A;  3FEE A;  4CDK A;  3SJX A;  3FEC A;  3U1B A;  1M6V B;  1EZB A;  4C8C A;  2X0S A;  3SJF A;  4YN3 A;  3TLC A;  3BI0 A;  4C99 A;  4COB A;  2R82 A;  3G23 A;  3I6S A;  4M8D A;  4MI1 A;  3IWW A;  4COG A;  2HWG A;  2YJV A;  4JYW A;  3C8O A;  4OC3 A;  2PVW A;  1EZA A;  2EK8 A;  3S9L A;  1KEE B;  2XEG A;  4OC0 A;  2C6G A;  3RBU A;  1BXR B;  3D7D A;  3TLB A;  1NXJ A;  4C8P A;  1ZRS A;  2HRO A;  3TLE A;  4H1H A;  2JBJ A;  2OOT A;  4NGP A;  3VTA A;  3S9N A;  4TJV A;  4W9Y A;  3T07 A;  3S9M A;  4C9E A;  3EIF A;  4TJX A;  3SJE A;  2EZA A;  4JVO A;  2EK9 A;  3ICU A;  1DE4 C;  1R61 A;  1JDE A;  4C8F A;  4E5S A;  3BHX A;  5JVL A;  2CIJ A;  4IIY A;  4CDJ A;  1CX8 A;  1ZYM A;  1A9X B;  1KC7 A;  3D7F A;  4NGM A;  4P4J A;  5F1Y A;  2OLS A;  5F9M A;  3D7G A;  3KRV A;  4NGQ A;  2C5Q A;  4KNG E;  5IR2 A;  2AUM A;  1CS0 B;  4C9U A;  4INJ A;  1Z8L A;  3SR3 A;  3EZE A;  3NOJ A;  3GJZ A;  3TLG B;  2XEJ A;  2E28 A;  4LQG A;  1WVM A;  3BXM A;  3T0T A;  2AUN A;  3KAS A;  4P4E A;  4P4I A;  2EZC A;  3TLG A; 
#chains in the Genus database with same CATH homology
 5F09 A;  4P45 A;  3FF3 A;  4OC5 A;  4NGR A;  4NGT A;  4C9V A;  4P4F A;  1Y9Z A;  2XEF A;  4C8A A;  5ELY A;  2C6P A;  3FED A;  4P4D A;  4C85 A;  4OC4 A;  2C6C A;  3BI1 A;  4MCP A;  2JBK A;  3I74 A;  4C9R A;  3SJG A;  5D29 A;  4NGN A;  4MCR A;  4OC2 A;  4X3R A;  2OR4 A;  4MCS A;  4P44 A;  5IB9 A;  3D7H A;  4JZ0 A;  4OME A;  4OC1 A;  4NGS A;  4P4B A;  4C84 A;  4C8U A;  3IIB A;  1V6C A;  2PVV A;  1XF1 A;  4C9A A;  2XEI A;  4C86 A;  2GP4 A;  4C8T A;  3K9T A;  4TWE A;  4MCQ A;  3FEE A;  4CDK A;  3SJX A;  3FEC A;  4C8C A;  3SJF A;  4YN3 A;  3BI0 A;  4C99 A;  3I6S A;  3IWW A;  4JYW A;  4OC3 A;  2PVW A;  2EK8 A;  3S9L A;  2XEG A;  4OC0 A;  2C6G A;  3RBU A;  3D7D A;  4C8P A;  2OOT A;  2JBJ A;  3VTA A;  4NGP A;  3S9N A;  4TJV A;  4W9Y A;  3S9M A;  4C9E A;  3EIF A;  4TJX A;  3SJE A;  2EK9 A;  3ICU A;  1DE4 C;  4C8F A;  3BHX A;  2CIJ A;  4CDJ A;  1CX8 A;  3D7F A;  4NGM A;  4P4J A;  3D7G A;  4NGQ A;  2C5Q A;  4KNG E;  5IR2 A;  4C9U A;  1Z8L A;  2XEJ A;  4LQG A;  1WVM A;  3BXM A;  3KAS A;  4P4E A;  4P4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...