5IR2A

Crystal structure of novel cellulases from microbes associated with the gut ecosystem
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
222
structure length
222
Chain Sequence
YKKEIGMMNLEKLIQDREGISSKKFPIEDKELLFRYEQLYTGAVNDVMREFCLLEQALPGRIKPLREYHSVAGFAFTVKSAPNVKIKGEMEYRTQMLDEMQEDHFVVWDTSRDDKATLWGGVMTATAKGKKLKAACIDGGIRDTHQILNADFPVFYEYRISNGSLGRCLITHYQIPIKIGDVTIKSGDIILGDIDGVLVVPREIAYEVLLRSEEIRENEKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellulase
publication title Crystal structure of novel cellulases from microbes associated with the gut ecosystem
rcsb
source organism Parabacteroides johnsonii dsm 18315
molecule tags Hydrolase
total genus 64
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2016-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03737 RraA-like Aldolase/RraA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.100 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 5ir2A00
2C5QA 5IR2A
chains in the Genus database with same CATH superfamily
4C86A 1KEEB 4OC5A 4MCQA 2OOTA 3SJGA 3EIFA 4C9UA 4P4FA 3BI1A 2DIKA 4MCRA 4YN3A 4P44A 3T5MA 4C8UA 2PCNA 3BXMA 3IIBA 2B0AA 4OC2A 2X0SA 4MCPA 4COBA 1NXJA 3D7HA 4JYWA 3S9NA 5F9MA 2GP4A 3FF3A 1Y9ZA 2XEJA 2JBJA 4H1HA 1CE8B 2JBKA 4C8TA 4J0NA 4C8CA 4C8PA 2E28A 3EZEA 3EZBA 4OC4A 4CDKA 5F1YA 3TLYA 5D29A 3TLBA 3TLGB 1VBGA 1VI4A 1V6CA 4OC0A 3SJFA 1T36B 3BHXA 3S9MA 2OLSA 1Q5XA 2EK9A 4IIYA 4P4BA 4P45A 1EZAA 2C6GA 1DIKA 3I74A 1NBWA 4LQGA 4C99A 4KNGE 4E5SA 4MCSA 2AUMA 5JVLA 4TWEA 4TJXA 3K4IA 1ZL0A 2AUNA 2MP0A 3ICUA 3SR3A 1Z8LA 3TLZA 1JDEA 3IWWA 3SJXA 1BXRB 1KC7A 3KASA 1WVMA 1VBHA 2HWGA 3T0TA 3FEEA 4C9AA 4OC3A 4CDJA 4P4JA 2R82A 1GGOA 4W9YA 1J3LA 1ZYMA 3TLEA 3S9LA 1XF1A 4NGNA 4E94A 1CX8A 2HROA 3NOJA 2D0PA 4C8AA 4NGSA 5F09A 3G23A 3T05A 2XEFA 1EZBA 1JDBC 5ELYA 3D7DA 4NGQA 4JVOA 5FD8A 4P4IA 3TLGA 4C8FA 3D7FA 3SJEA 2YJTA 5JYBA 1KBLA 2C6PA 4COGA 1C3OB 1R61A 4M8DA 4EYSA 4OMEA 5F5XA 4NGTA 4P4DA 4NGPA 4CZ1A 2XEGA 1ZRSA 3RBUA 2CIJA 2C5QA 3K9TA 4C9VA 2YJVA 5K99A 2EZAA 5IB9A 3GJZA 3BI0A 2EZBA 4OC1A 2C6CA 4NGMA 3VTAA 4P4EA 1DE4C 4C84A 4IIXA 3U1BA 2EZCA 4X3RA 1C30B 2PVWA 3FECA 1CS0B 1A9XB 3D7GA 4INJA 2OR4A 2FM4A 4C85A 3EZAA 4MI1A 3TLAA 3I6SA 3KRVA 4TJVA 1M6VB 3TYXA 2EK8A 4MJXA 4C9EA 2HI6A 3TLCA 3T07A 2PVVA 2XEIA 2D0OA 3C8OA 4JZ0A 4NGRA 3FEDA 4CO9A 4C9RA 5IR2A
chains in the Genus database with same CATH topology
4C86A 4OC5A 4MCQA 2OOTA 3SJGA 3EIFA 4C9UA 4P4FA 3BI1A 4MCRA 4YN3A 4P44A 4C8UA 3BXMA 3IIBA 4OC2A 4MCPA 3D7HA 4JYWA 3S9NA 2GP4A 3FF3A 1Y9ZA 2XEJA 2JBJA 2JBKA 4C8TA 4C8CA 4C8PA 4OC4A 4CDKA 5D29A 4OC0A 1V6CA 3SJFA 3BHXA 3S9MA 2EK9A 4P4BA 4P45A 2C6GA 3I74A 4LQGA 4C99A 4KNGE 4MCSA 4TWEA 4TJXA 3ICUA 1Z8LA 3IWWA 3SJXA 3KASA 1WVMA 3FEEA 4C9AA 4OC3A 4CDJA 4P4JA 4W9YA 3S9LA 1XF1A 4NGNA 1CX8A 4C8AA 4NGSA 5F09A 2XEFA 5ELYA 3D7DA 4NGQA 4P4IA 4C8FA 3D7FA 3SJEA 2C6PA 4OMEA 4NGTA 4P4DA 4NGPA 2XEGA 3RBUA 2CIJA 2C5QA 3K9TA 4C9VA 5IB9A 3BI0A 4OC1A 2C6CA 4NGMA 3VTAA 4P4EA 1DE4C 4C84A 4X3RA 2PVWA 3FECA 3D7GA 2OR4A 4C85A 3I6SA 4TJVA 2EK8A 4C9EA 2PVVA 2XEIA 4JZ0A 4NGRA 3FEDA 4C9RA 5IR2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C5Q A;  5IR2 A; 
#chains in the Genus database with same CATH topology
 4C86 A;  1KEE B;  4OC5 A;  4MCQ A;  2OOT A;  3SJG A;  3EIF A;  4C9U A;  4P4F A;  3BI1 A;  2DIK A;  4MCR A;  4YN3 A;  4P44 A;  3T5M A;  4C8U A;  2PCN A;  3BXM A;  3IIB A;  2B0A A;  4OC2 A;  2X0S A;  4MCP A;  4COB A;  1NXJ A;  3D7H A;  4JYW A;  3S9N A;  5F9M A;  2GP4 A;  3FF3 A;  1Y9Z A;  2XEJ A;  2JBJ A;  4H1H A;  1CE8 B;  2JBK A;  4C8T A;  4J0N A;  4C8C A;  4C8P A;  2E28 A;  3EZE A;  3EZB A;  4OC4 A;  4CDK A;  5F1Y A;  3TLY A;  5D29 A;  3TLB A;  3TLG B;  1VBG A;  1VI4 A;  1V6C A;  4OC0 A;  3SJF A;  1T36 B;  3BHX A;  3S9M A;  2OLS A;  1Q5X A;  2EK9 A;  4IIY A;  4P4B A;  4P45 A;  1EZA A;  2C6G A;  1DIK A;  3I74 A;  1NBW A;  4LQG A;  4C99 A;  4KNG E;  4E5S A;  4MCS A;  2AUM A;  5JVL A;  4TWE A;  4TJX A;  3K4I A;  1ZL0 A;  2AUN A;  2MP0 A;  3ICU A;  3SR3 A;  1Z8L A;  3TLZ A;  1JDE A;  3IWW A;  3SJX A;  1BXR B;  1KC7 A;  3KAS A;  1WVM A;  1VBH A;  2HWG A;  3T0T A;  3FEE A;  4C9A A;  4OC3 A;  4CDJ A;  4P4J A;  2R82 A;  1GGO A;  4W9Y A;  1J3L A;  1ZYM A;  3TLE A;  3S9L A;  1XF1 A;  4NGN A;  4E94 A;  1CX8 A;  2HRO A;  3NOJ A;  2D0P A;  4C8A A;  4NGS A;  5F09 A;  3G23 A;  3T05 A;  2XEF A;  1EZB A;  1JDB C;  5ELY A;  3D7D A;  4NGQ A;  4JVO A;  5FD8 A;  4P4I A;  3TLG A;  4C8F A;  3D7F A;  3SJE A;  2YJT A;  5JYB A;  1KBL A;  2C6P A;  4COG A;  1C3O B;  1R61 A;  4M8D A;  4EYS A;  4OME A;  5F5X A;  4NGT A;  4P4D A;  4NGP A;  4CZ1 A;  2XEG A;  1ZRS A;  3RBU A;  2CIJ A;  2C5Q A;  3K9T A;  4C9V A;  2YJV A;  5K99 A;  2EZA A;  5IB9 A;  3GJZ A;  3BI0 A;  2EZB A;  4OC1 A;  2C6C A;  4NGM A;  3VTA A;  4P4E A;  1DE4 C;  4C84 A;  4IIX A;  3U1B A;  2EZC A;  4X3R A;  1C30 B;  2PVW A;  3FEC A;  1CS0 B;  1A9X B;  3D7G A;  4INJ A;  2OR4 A;  2FM4 A;  4C85 A;  3EZA A;  4MI1 A;  3TLA A;  3I6S A;  3KRV A;  4TJV A;  1M6V B;  3TYX A;  2EK8 A;  4MJX A;  4C9E A;  2HI6 A;  3TLC A;  3T07 A;  2PVV A;  2XEI A;  2D0O A;  3C8O A;  4JZ0 A;  4NGR A;  3FED A;  4CO9 A;  4C9R A;  5IR2 A; 
#chains in the Genus database with same CATH homology
 4C86 A;  4OC5 A;  4MCQ A;  2OOT A;  3SJG A;  3EIF A;  4C9U A;  4P4F A;  3BI1 A;  4MCR A;  4YN3 A;  4P44 A;  4C8U A;  3BXM A;  3IIB A;  4OC2 A;  4MCP A;  3D7H A;  4JYW A;  3S9N A;  2GP4 A;  3FF3 A;  1Y9Z A;  2XEJ A;  2JBJ A;  2JBK A;  4C8T A;  4C8C A;  4C8P A;  4OC4 A;  4CDK A;  5D29 A;  4OC0 A;  1V6C A;  3SJF A;  3BHX A;  3S9M A;  2EK9 A;  4P4B A;  4P45 A;  2C6G A;  3I74 A;  4LQG A;  4C99 A;  4KNG E;  4MCS A;  4TWE A;  4TJX A;  3ICU A;  1Z8L A;  3IWW A;  3SJX A;  3KAS A;  1WVM A;  3FEE A;  4C9A A;  4OC3 A;  4CDJ A;  4P4J A;  4W9Y A;  3S9L A;  1XF1 A;  4NGN A;  1CX8 A;  4C8A A;  4NGS A;  5F09 A;  2XEF A;  5ELY A;  3D7D A;  4NGQ A;  4P4I A;  4C8F A;  3D7F A;  3SJE A;  2C6P A;  4OME A;  4NGT A;  4P4D A;  4NGP A;  2XEG A;  3RBU A;  2CIJ A;  2C5Q A;  3K9T A;  4C9V A;  5IB9 A;  3BI0 A;  4OC1 A;  2C6C A;  4NGM A;  3VTA A;  4P4E A;  1DE4 C;  4C84 A;  4X3R A;  2PVW A;  3FEC A;  3D7G A;  2OR4 A;  4C85 A;  3I6S A;  4TJV A;  2EK8 A;  4C9E A;  2PVV A;  2XEI A;  4JZ0 A;  4NGR A;  3FED A;  4C9R A;  5IR2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...