5IR2A

Crystal structure of novel cellulases from microbes associated with the gut ecosystem
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
222
structure length
222
Chain Sequence
YKKEIGMMNLEKLIQDREGISSKKFPIEDKELLFRYEQLYTGAVNDVMREFCLLEQALPGRIKPLREYHSVAGFAFTVKSAPNVKIKGEMEYRTQMLDEMQEDHFVVWDTSRDDKATLWGGVMTATAKGKKLKAACIDGGIRDTHQILNADFPVFYEYRISNGSLGRCLITHYQIPIKIGDVTIKSGDIILGDIDGVLVVPREIAYEVLLRSEEIRENEKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellulase
publication title Crystal structure of novel cellulases from microbes associated with the gut ecosystem
rcsb
source organism Parabacteroides johnsonii dsm 18315
molecule tags Hydrolase
total genus 64
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2016-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03737 RraA-like Aldolase/RraA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.100 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 5ir2A00
5IR2A 2C5QA
chains in the Genus database with same CATH superfamily
2EZBA 2XEIA 5IB9A 4P4BA 1VI4A 3K4IA 4OC2A 3TLGA 4NGPA 1J3LA 1C30B 4OC0A 3EZBA 3T05A 4MJXA 2EK8A 2C6PA 4MCRA 3RBUA 4C8PA 3IWWA 3EZEA 3FF3A 4C9AA 4JZ0A 3C8OA 2CIJA 5K99A 1ZYMA 4INJA 3TYXA 3I74A 2X0SA 4C8UA 4NGQA 4P45A 4TWEA 4P4DA 3KRVA 5F9MA 2D0PA 1A9XB 1NXJA 4NGTA 3KASA 4CDKA 3TLBA 5F09A 3FEEA 1CX8A 3BI1A 3NOJA 3U1BA 1BXRB 2MP0A 5ELYA 1C3OB 1Y9ZA 1T36B 4M8DA 3SJXA 4C84A 4C8TA 4E94A 2JBKA 3S9MA 4C9VA 2C6GA 4CO9A 1JDBC 1Q5XA 5FD8A 2C6CA 5D29A 3TLCA 2XEJA 4OC3A 3VTAA 1CE8B 1Z8LA 2OR4A 4OC1A 3SR3A 2HI6A 3K9TA 2R82A 2D0OA 4EYSA 2DIKA 4YN3A 1KC7A 3S9LA 4C8CA 3EIFA 1CS0B 2YJVA 2OOTA 4CZ1A 4H1HA 3D7DA 4X3RA 3D7FA 2E28A 3TLZA 4C8FA 2AUNA 1WVMA 3FEDA 2EZCA 3TLYA 1NBWA 1ZRSA 2AUMA 4COGA 2FM4A 3D7HA 5IR2A 4P4IA 4W9YA 3ICUA 1V6CA 3SJFA 2XEGA 4P4FA 4CDJA 3FECA 4C8AA 4TJXA 1KBLA 4C86A 4C9EA 4E5SA 1VBGA 4NGNA 3GJZA 4TJVA 2PVWA 4NGSA 4C99A 1ZL0A 4C85A 3T5MA 4MCSA 4LQGA 4OC5A 1R61A 2HWGA 3BI0A 1DE4C 4MCQA 2EK9A 1DIKA 3IIBA 1VBHA 3EZAA 4IIXA 2B0AA 4P44A 5F1YA 4C9RA 3G23A 5JYBA 5JVLA 4OMEA 3S9NA 1JDEA 2XEFA 2YJTA 4P4JA 2PCNA 4NGRA 4JYWA 3SJGA 1EZAA 1XF1A 3BHXA 2OLSA 2PVVA 2C5QA 2GP4A 1EZBA 1M6VB 3TLGB 3BXMA 4OC4A 2JBJA 4P4EA 3D7GA 4MI1A 4MCPA 1GGOA 3TLAA 4IIYA 4JVOA 2EZAA 4COBA 3I6SA 4NGMA 3T07A 3TLEA 4KNGE 3T0TA 1KEEB 4J0NA 5F5XA 2HROA 3SJEA 4C9UA
chains in the Genus database with same CATH topology
2XEIA 5IB9A 4P4BA 4OC2A 4NGPA 4OC0A 2EK8A 2C6PA 4MCRA 3RBUA 4C8PA 3IWWA 3FF3A 4JZ0A 2CIJA 3I74A 4C8UA 4NGQA 4P45A 4TWEA 4P4DA 4NGTA 3KASA 4CDKA 5F09A 3FEEA 1CX8A 3BI1A 5ELYA 1Y9ZA 3SJXA 4C84A 4C8TA 2JBKA 3S9MA 4C9VA 2C6GA 2C6CA 5D29A 2XEJA 4OC3A 3VTAA 2OR4A 1Z8LA 4OC1A 3K9TA 3S9LA 4YN3A 4C8CA 3EIFA 2OOTA 3D7DA 4X3RA 3D7FA 4C8FA 1WVMA 3FEDA 3D7HA 5IR2A 4P4IA 4W9YA 3ICUA 1V6CA 3SJFA 2XEGA 4P4FA 4CDJA 3FECA 4C8AA 4TJXA 4C86A 4C9EA 4NGNA 4TJVA 2PVWA 4NGSA 4C99A 4C85A 4MCSA 4LQGA 4OC5A 3BI0A 4MCQA 1DE4C 2EK9A 4P44A 3IIBA 4C9RA 4OMEA 3S9NA 2XEFA 4P4JA 4NGRA 4JYWA 3SJGA 1XF1A 3BHXA 2PVVA 2C5QA 2GP4A 3BXMA 4OC4A 2JBJA 4P4EA 3D7GA 4MCPA 3I6SA 4NGMA 4KNGE 4C9AA 3SJEA 4C9UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IR2 A;  2C5Q A; 
#chains in the Genus database with same CATH topology
 2EZB A;  2XEI A;  5IB9 A;  4P4B A;  1VI4 A;  3K4I A;  4OC2 A;  3TLG A;  4NGP A;  1J3L A;  1C30 B;  4OC0 A;  3EZB A;  3T05 A;  4MJX A;  2EK8 A;  2C6P A;  4MCR A;  3RBU A;  4C8P A;  3IWW A;  3EZE A;  3FF3 A;  4C9A A;  4JZ0 A;  3C8O A;  2CIJ A;  5K99 A;  1ZYM A;  4INJ A;  3TYX A;  3I74 A;  2X0S A;  4C8U A;  4NGQ A;  4P45 A;  4TWE A;  4P4D A;  3KRV A;  5F9M A;  2D0P A;  1A9X B;  1NXJ A;  4NGT A;  3KAS A;  4CDK A;  3TLB A;  5F09 A;  3FEE A;  1CX8 A;  3BI1 A;  3NOJ A;  3U1B A;  1BXR B;  2MP0 A;  5ELY A;  1C3O B;  1Y9Z A;  1T36 B;  4M8D A;  3SJX A;  4C84 A;  4C8T A;  4E94 A;  2JBK A;  3S9M A;  4C9V A;  2C6G A;  4CO9 A;  1JDB C;  1Q5X A;  5FD8 A;  2C6C A;  5D29 A;  3TLC A;  2XEJ A;  4OC3 A;  3VTA A;  1CE8 B;  1Z8L A;  2OR4 A;  4OC1 A;  3SR3 A;  2HI6 A;  3K9T A;  2R82 A;  2D0O A;  4EYS A;  2DIK A;  4YN3 A;  1KC7 A;  3S9L A;  4C8C A;  3EIF A;  1CS0 B;  2YJV A;  2OOT A;  4CZ1 A;  4H1H A;  3D7D A;  4X3R A;  3D7F A;  2E28 A;  3TLZ A;  4C8F A;  2AUN A;  1WVM A;  3FED A;  2EZC A;  3TLY A;  1NBW A;  1ZRS A;  2AUM A;  4COG A;  2FM4 A;  3D7H A;  5IR2 A;  4P4I A;  4W9Y A;  3ICU A;  1V6C A;  3SJF A;  2XEG A;  4P4F A;  4CDJ A;  3FEC A;  4C8A A;  4TJX A;  1KBL A;  4C86 A;  4C9E A;  4E5S A;  1VBG A;  4NGN A;  3GJZ A;  4TJV A;  2PVW A;  4NGS A;  4C99 A;  1ZL0 A;  4C85 A;  3T5M A;  4MCS A;  4LQG A;  4OC5 A;  1R61 A;  2HWG A;  3BI0 A;  1DE4 C;  4MCQ A;  2EK9 A;  1DIK A;  3IIB A;  1VBH A;  3EZA A;  4IIX A;  2B0A A;  4P44 A;  5F1Y A;  4C9R A;  3G23 A;  5JYB A;  5JVL A;  4OME A;  3S9N A;  1JDE A;  2XEF A;  2YJT A;  4P4J A;  2PCN A;  4NGR A;  4JYW A;  3SJG A;  1EZA A;  1XF1 A;  3BHX A;  2OLS A;  2PVV A;  2C5Q A;  2GP4 A;  1EZB A;  1M6V B;  3TLG B;  3BXM A;  4OC4 A;  2JBJ A;  4P4E A;  3D7G A;  4MI1 A;  4MCP A;  1GGO A;  3TLA A;  4IIY A;  4JVO A;  2EZA A;  4COB A;  3I6S A;  4NGM A;  3T07 A;  3TLE A;  4KNG E;  3T0T A;  1KEE B;  4J0N A;  5F5X A;  2HRO A;  3SJE A;  4C9U A; 
#chains in the Genus database with same CATH homology
 2XEI A;  5IB9 A;  4P4B A;  4OC2 A;  4NGP A;  4OC0 A;  2EK8 A;  2C6P A;  4MCR A;  3RBU A;  4C8P A;  3IWW A;  3FF3 A;  4JZ0 A;  2CIJ A;  3I74 A;  4C8U A;  4NGQ A;  4P45 A;  4TWE A;  4P4D A;  4NGT A;  3KAS A;  4CDK A;  5F09 A;  3FEE A;  1CX8 A;  3BI1 A;  5ELY A;  1Y9Z A;  3SJX A;  4C84 A;  4C8T A;  2JBK A;  3S9M A;  4C9V A;  2C6G A;  2C6C A;  5D29 A;  2XEJ A;  4OC3 A;  3VTA A;  2OR4 A;  1Z8L A;  4OC1 A;  3K9T A;  3S9L A;  4YN3 A;  4C8C A;  3EIF A;  2OOT A;  3D7D A;  4X3R A;  3D7F A;  4C8F A;  1WVM A;  3FED A;  3D7H A;  5IR2 A;  4P4I A;  4W9Y A;  3ICU A;  1V6C A;  3SJF A;  2XEG A;  4P4F A;  4CDJ A;  3FEC A;  4C8A A;  4TJX A;  4C86 A;  4C9E A;  4NGN A;  4TJV A;  2PVW A;  4NGS A;  4C99 A;  4C85 A;  4MCS A;  4LQG A;  4OC5 A;  3BI0 A;  4MCQ A;  1DE4 C;  2EK9 A;  4P44 A;  3IIB A;  4C9R A;  4OME A;  3S9N A;  2XEF A;  4P4J A;  4NGR A;  4JYW A;  3SJG A;  1XF1 A;  3BHX A;  2PVV A;  2C5Q A;  2GP4 A;  3BXM A;  4OC4 A;  2JBJ A;  4P4E A;  3D7G A;  4MCP A;  3I6S A;  4NGM A;  4KNG E;  4C9A A;  3SJE A;  4C9U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...