2FM4A

Nmr structure of the phosphoryl carrier domain of pyruvate phosphate dikinase
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
128
structure length
128
Chain Sequence
AALKAGEVIGSALPASPGAAAGKVYFTADEAKAAHEKGERVILVRLETSPEDIEGMHAAEGILTVRGGMTSHAAVVARGMGTCCVSGCGEIKINEEAKTFELGGHTFAEGDYISLDGSTGKIYKGDIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pyruvate, phosphate dikinase
publication title Examination of the structure, stability, and catalytic potential in the engineered phosphoryl carrier domain of pyruvate phosphate dikinase.
pubmed doi rcsb
source organism Clostridium symbiosum
molecule tags Transferase
total genus 18
structure length 128
sequence length 128
ec nomenclature ec 2.7.9.1: Pyruvate, phosphate dikinase.
pdb deposition date 2006-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00391 PEP-utilizers PEP-utilising enzyme, mobile domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.10 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Phosphohistidine domain 2fm4A00
1JDEA 1KC7A 1ZYMA 1GGOA 2EZBA 1VBHA 3EZEA 2R82A 2DIKA 2HROA 2HWGA 2MP0A 2E28A 3T07A 3T05A 1EZAA 1DIKA 3EZBA 2OLSA 1EZBA 2EZCA 3T0TA 1KBLA 5JVLA 2X0SA 2FM4A 1VBGA 2EZAA 2HI6A 3EZAA
chains in the Genus database with same CATH superfamily
1JDEA 4C8FA 4OC2A 4P4FA 4OC5A 5ELYA 3TLGB 2XEIA 4IIYA 5IR2A 5IB9A 3SJEA 4COBA 3SJGA 3VTAA 3BXMA 4TJVA 4NGQA 4C9AA 4E5SA 4NGTA 4NGNA 2MP0A 1C30B 3D7DA 3GJZA 3ICUA 2OLSA 3FF3A 3TLYA 4TWEA 3S9MA 2B0AA 4W9YA 2XEGA 1ZL0A 3T0TA 2AUMA 1CS0B 3U1BA 1Z8LA 4TJXA 2FM4A 1ZRSA 4MJXA 2C6PA 4C8TA 4H1HA 3TLGA 4E94A 1VI4A 3IIBA 1NXJA 4JVOA 4OC0A 4C86A 4NGMA 2D0PA 4JZ0A 2R82A 4OMEA 2HROA 4MCQA 3TLAA 5F09A 1Y9ZA 2D0OA 3RBUA 4P44A 3T07A 4C9VA 2C5QA 4COGA 3T05A 2OR4A 1R61A 4OC4A 4C8CA 1CX8A 1EZBA 1V6CA 4C99A 1CE8B 2YJTA 3D7HA 3K9TA 4P4JA 4EYSA 4M8DA 4KNGE 4IIXA 2X0SA 4NGPA 1M6VB 3T5MA 1NBWA 4CZ1A 1DE4C 2PVVA 2HI6A 5FD8A 2XEJA 4C9UA 4P4DA 4P4IA 3FEDA 4CO9A 2OOTA 3KASA 3FECA 1BXRB 2AUNA 4NGRA 3S9NA 3D7FA 4CDKA 3C8OA 5JYBA 2E28A 4NGSA 3TYXA 1XF1A 3TLEA 1EZAA 1DIKA 4OC3A 3BI1A 2XEFA 3FEEA 1T36B 2EZCA 1J3LA 2CIJA 3SJFA 1WVMA 4MCSA 2GP4A 5D29A 4YN3A 3SJXA 3I6SA 3BHXA 5JVLA 1A9XB 4C84A 4C9RA 2EK8A 4INJA 5K99A 3EZAA 1KC7A 4X3RA 4OC1A 1GGOA 4C85A 4MI1A 2EZBA 1VBHA 3EZEA 2PVWA 3NOJA 3S9LA 5F5XA 2JBJA 3D7GA 2DIKA 2PCNA 4MCPA 3KRVA 3TLZA 3IWWA 4LQGA 4P4BA 2HWGA 2JBKA 1Q5XA 4MCRA 4P45A 4C8PA 1JDBC 3I74A 4P4EA 3TLBA 2YJVA 2EK9A 3K4IA 3EZBA 5F9MA 4J0NA 1KEEB 2C6GA 4JYWA 2C6CA 3G23A 4C9EA 3SR3A 1C3OB 3BI0A 3TLCA 1KBLA 3EIFA 1VBGA 4C8AA 5F1YA 2EZAA 4CDJA 1ZYMA 4C8UA
chains in the Genus database with same CATH topology
1JDEA 1KC7A 1ZYMA 1GGOA 2EZBA 1VBHA 3EZEA 2R82A 2DIKA 2HROA 2HWGA 2MP0A 2E28A 3T07A 3T05A 1EZAA 1DIKA 3EZBA 2OLSA 1EZBA 2EZCA 3T0TA 1KBLA 5JVLA 2X0SA 2FM4A 1VBGA 2EZAA 2HI6A 3EZAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JDE A;  1KC7 A;  1ZYM A;  1GGO A;  2EZB A;  1VBH A;  3EZE A;  2R82 A;  2DIK A;  2HRO A;  2HWG A;  2MP0 A;  2E28 A;  3T07 A;  3T05 A;  1EZA A;  1DIK A;  3EZB A;  2OLS A;  1EZB A;  2EZC A;  3T0T A;  1KBL A;  5JVL A;  2X0S A;  2FM4 A;  1VBG A;  2EZA A;  2HI6 A;  3EZA A; 
#chains in the Genus database with same CATH topology
 1JDE A;  4C8F A;  4OC2 A;  4P4F A;  4OC5 A;  5ELY A;  3TLG B;  2XEI A;  4IIY A;  5IR2 A;  5IB9 A;  3SJE A;  4COB A;  3SJG A;  3VTA A;  3BXM A;  4TJV A;  4NGQ A;  4C9A A;  4E5S A;  4NGT A;  4NGN A;  2MP0 A;  1C30 B;  3D7D A;  3GJZ A;  3ICU A;  2OLS A;  3FF3 A;  3TLY A;  4TWE A;  3S9M A;  2B0A A;  4W9Y A;  2XEG A;  1ZL0 A;  3T0T A;  2AUM A;  1CS0 B;  3U1B A;  1Z8L A;  4TJX A;  2FM4 A;  1ZRS A;  4MJX A;  2C6P A;  4C8T A;  4H1H A;  3TLG A;  4E94 A;  1VI4 A;  3IIB A;  1NXJ A;  4JVO A;  4OC0 A;  4C86 A;  4NGM A;  2D0P A;  4JZ0 A;  2R82 A;  4OME A;  2HRO A;  4MCQ A;  3TLA A;  5F09 A;  1Y9Z A;  2D0O A;  3RBU A;  4P44 A;  3T07 A;  4C9V A;  2C5Q A;  4COG A;  3T05 A;  2OR4 A;  1R61 A;  4OC4 A;  4C8C A;  1CX8 A;  1EZB A;  1V6C A;  4C99 A;  1CE8 B;  2YJT A;  3D7H A;  3K9T A;  4P4J A;  4EYS A;  4M8D A;  4KNG E;  4IIX A;  2X0S A;  4NGP A;  1M6V B;  3T5M A;  1NBW A;  4CZ1 A;  1DE4 C;  2PVV A;  2HI6 A;  5FD8 A;  2XEJ A;  4C9U A;  4P4D A;  4P4I A;  3FED A;  4CO9 A;  2OOT A;  3KAS A;  3FEC A;  1BXR B;  2AUN A;  4NGR A;  3S9N A;  3D7F A;  4CDK A;  3C8O A;  5JYB A;  2E28 A;  4NGS A;  3TYX A;  1XF1 A;  3TLE A;  1EZA A;  1DIK A;  4OC3 A;  3BI1 A;  2XEF A;  3FEE A;  1T36 B;  2EZC A;  1J3L A;  2CIJ A;  3SJF A;  1WVM A;  4MCS A;  2GP4 A;  5D29 A;  4YN3 A;  3SJX A;  3I6S A;  3BHX A;  5JVL A;  1A9X B;  4C84 A;  4C9R A;  2EK8 A;  4INJ A;  5K99 A;  3EZA A;  1KC7 A;  4X3R A;  4OC1 A;  1GGO A;  4C85 A;  4MI1 A;  2EZB A;  1VBH A;  3EZE A;  2PVW A;  3NOJ A;  3S9L A;  5F5X A;  2JBJ A;  3D7G A;  2DIK A;  2PCN A;  4MCP A;  3KRV A;  3TLZ A;  3IWW A;  4LQG A;  4P4B A;  2HWG A;  2JBK A;  1Q5X A;  4MCR A;  4P45 A;  4C8P A;  1JDB C;  3I74 A;  4P4E A;  3TLB A;  2YJV A;  2EK9 A;  3K4I A;  3EZB A;  5F9M A;  4J0N A;  1KEE B;  2C6G A;  4JYW A;  2C6C A;  3G23 A;  4C9E A;  3SR3 A;  1C3O B;  3BI0 A;  3TLC A;  1KBL A;  3EIF A;  1VBG A;  4C8A A;  5F1Y A;  2EZA A;  4CDJ A;  1ZYM A;  4C8U A; 
#chains in the Genus database with same CATH homology
 1JDE A;  1KC7 A;  1ZYM A;  1GGO A;  2EZB A;  1VBH A;  3EZE A;  2R82 A;  2DIK A;  2HRO A;  2HWG A;  2MP0 A;  2E28 A;  3T07 A;  3T05 A;  1EZA A;  1DIK A;  3EZB A;  2OLS A;  1EZB A;  2EZC A;  3T0T A;  1KBL A;  5JVL A;  2X0S A;  2FM4 A;  1VBG A;  2EZA A;  2HI6 A;  3EZA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...