2FM4A

Nmr structure of the phosphoryl carrier domain of pyruvate phosphate dikinase
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
128
structure length
128
Chain Sequence
AALKAGEVIGSALPASPGAAAGKVYFTADEAKAAHEKGERVILVRLETSPEDIEGMHAAEGILTVRGGMTSHAAVVARGMGTCCVSGCGEIKINEEAKTFELGGHTFAEGDYISLDGSTGKIYKGDIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Pyruvate, phosphate dikinase
publication title Examination of the structure, stability, and catalytic potential in the engineered phosphoryl carrier domain of pyruvate phosphate dikinase.
pubmed doi rcsb
source organism Clostridium symbiosum
total genus 18
structure length 128
sequence length 128
ec nomenclature ec 2.7.9.1: Pyruvate, phosphate dikinase.
pdb deposition date 2006-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00391 PEP-utilizers PEP-utilising enzyme, mobile domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.10 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Phosphohistidine domain 2fm4A00
2EZAA 1JDEA 1GGOA 2MP0A 2R82A 1KBLA 2HI6A 3T05A 2FM4A 1ZYMA 2EZCA 1EZAA 2HROA 3EZAA 3T0TA 1VBHA 3T07A 5JVLA 1DIKA 3EZBA 3EZEA 1EZBA 2HWGA 1KC7A 2OLSA 2EZBA 2DIKA 2E28A 2X0SA 1VBGA
chains in the Genus database with same CATH superfamily
2EZAA 2YJVA 1CX8A 4TJXA 3TLGB 3TLBA 4C99A 1GGOA 1J3LA 1NBWA 4C9UA 2R82A 2XEJA 4MCQA 1WVMA 4NGNA 4OC5A 1A9XB 1VI4A 4CDJA 4P4FA 1EZAA 3EZAA 3T0TA 3IWWA 2B0AA 4P4JA 1CE8B 3ICUA 4MJXA 4TWEA 1C3OB 2PCNA 1XF1A 2OR4A 3T07A 3C8OA 2C6CA 3FF3A 1R61A 3KRVA 4MCSA 1EZBA 4CO9A 4OC4A 5D29A 2EZBA 4JVOA 3S9MA 3S9LA 1ZRSA 4MCRA 3T5MA 4C9VA 2PVVA 1KEEB 1M6VB 3G23A 4J0NA 4OC0A 2MP0A 4TJVA 5FD8A 3FEDA 3T05A 1V6CA 2EZCA 3K9TA 4C85A 2JBJA 1C30B 2AUMA 1VBHA 4P4IA 4MI1A 4E94A 2AUNA 3SJEA 3D7DA 4IIXA 4OC2A 2C5QA 2C6PA 5JVLA 3KASA 3EZBA 4P4DA 4P4BA 4COGA 3BHXA 4C84A 1ZL0A 3D7HA 2HWGA 2OLSA 3RBUA 4LQGA 4NGTA 4C8AA 3D7GA 2E28A 1Y9ZA 4OMEA 3BI0A 5ELYA 4P45A 3SJXA 4C9EA 2EK9A 4NGQA 4CDKA 4H1HA 5IR2A 2HI6A 2OOTA 2FM4A 3FEEA 3TLGA 2GP4A 1CS0B 3TLYA 4NGPA 4CZ1A 3IIBA 3BXMA 3VTAA 2HROA 2JBKA 4NGSA 3K4IA 5F1YA 2XEGA 3GJZA 4EYSA 3D7FA 5F09A 1DIKA 3TLEA 4IIYA 4C8CA 3EZEA 4P4EA 4C9AA 4MCPA 2D0OA 5K99A 3S9NA 1KC7A 1JDBC 4W9YA 4C9RA 2DIKA 2X0SA 4P44A 4X3RA 4C8TA 1NXJA 1JDEA 3U1BA 4INJA 5F9MA 4COBA 1Z8LA 1KBLA 3NOJA 3EIFA 4JYWA 1ZYMA 3SJGA 3SJFA 4NGRA 4JZ0A 4C8FA 1T36B 5IB9A 4C8UA 1DE4C 2CIJA 4C8PA 2XEFA 3TLZA 1BXRB 2YJTA 4KNGE 1Q5XA 2EK8A 4C86A 2C6GA 2D0PA 3SR3A 3TLCA 4NGMA 2PVWA 3TYXA 3BI1A 5F5XA 5JYBA 4M8DA 3I6SA 4OC1A 2XEIA 4YN3A 4OC3A 3I74A 3TLAA 4E5SA 3FECA 1VBGA
chains in the Genus database with same CATH topology
2EZAA 1JDEA 1GGOA 2MP0A 2R82A 1KBLA 2HI6A 3T05A 2FM4A 1ZYMA 2EZCA 1EZAA 2HROA 3EZAA 3T0TA 1VBHA 3T07A 5JVLA 1DIKA 3EZBA 3EZEA 1EZBA 2HWGA 1KC7A 2OLSA 2EZBA 2DIKA 2E28A 2X0SA 1VBGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EZA A;  1JDE A;  1GGO A;  2MP0 A;  2R82 A;  1KBL A;  2HI6 A;  3T05 A;  2FM4 A;  1ZYM A;  2EZC A;  1EZA A;  2HRO A;  3EZA A;  3T0T A;  1VBH A;  3T07 A;  5JVL A;  1DIK A;  3EZB A;  3EZE A;  1EZB A;  2HWG A;  1KC7 A;  2OLS A;  2EZB A;  2DIK A;  2E28 A;  2X0S A;  1VBG A; 
#chains in the Genus database with same CATH topology
 2EZA A;  2YJV A;  1CX8 A;  4TJX A;  3TLG B;  3TLB A;  4C99 A;  1GGO A;  1J3L A;  1NBW A;  4C9U A;  2R82 A;  2XEJ A;  4MCQ A;  1WVM A;  4NGN A;  4OC5 A;  1A9X B;  1VI4 A;  4CDJ A;  4P4F A;  1EZA A;  3EZA A;  3T0T A;  3IWW A;  2B0A A;  4P4J A;  1CE8 B;  3ICU A;  4MJX A;  4TWE A;  1C3O B;  2PCN A;  1XF1 A;  2OR4 A;  3T07 A;  3C8O A;  2C6C A;  3FF3 A;  1R61 A;  3KRV A;  4MCS A;  1EZB A;  4CO9 A;  4OC4 A;  5D29 A;  2EZB A;  4JVO A;  3S9M A;  3S9L A;  1ZRS A;  4MCR A;  3T5M A;  4C9V A;  2PVV A;  1KEE B;  1M6V B;  3G23 A;  4J0N A;  4OC0 A;  2MP0 A;  4TJV A;  5FD8 A;  3FED A;  3T05 A;  1V6C A;  2EZC A;  3K9T A;  4C85 A;  2JBJ A;  1C30 B;  2AUM A;  1VBH A;  4P4I A;  4MI1 A;  4E94 A;  2AUN A;  3SJE A;  3D7D A;  4IIX A;  4OC2 A;  2C5Q A;  2C6P A;  5JVL A;  3KAS A;  3EZB A;  4P4D A;  4P4B A;  4COG A;  3BHX A;  4C84 A;  1ZL0 A;  3D7H A;  2HWG A;  2OLS A;  3RBU A;  4LQG A;  4NGT A;  4C8A A;  3D7G A;  2E28 A;  1Y9Z A;  4OME A;  3BI0 A;  5ELY A;  4P45 A;  3SJX A;  4C9E A;  2EK9 A;  4NGQ A;  4CDK A;  4H1H A;  5IR2 A;  2HI6 A;  2OOT A;  2FM4 A;  3FEE A;  3TLG A;  2GP4 A;  1CS0 B;  3TLY A;  4NGP A;  4CZ1 A;  3IIB A;  3BXM A;  3VTA A;  2HRO A;  2JBK A;  4NGS A;  3K4I A;  5F1Y A;  2XEG A;  3GJZ A;  4EYS A;  3D7F A;  5F09 A;  1DIK A;  3TLE A;  4IIY A;  4C8C A;  3EZE A;  4P4E A;  4C9A A;  4MCP A;  2D0O A;  5K99 A;  3S9N A;  1KC7 A;  1JDB C;  4W9Y A;  4C9R A;  2DIK A;  2X0S A;  4P44 A;  4X3R A;  4C8T A;  1NXJ A;  1JDE A;  3U1B A;  4INJ A;  5F9M A;  4COB A;  1Z8L A;  1KBL A;  3NOJ A;  3EIF A;  4JYW A;  1ZYM A;  3SJG A;  3SJF A;  4NGR A;  4JZ0 A;  4C8F A;  1T36 B;  5IB9 A;  4C8U A;  1DE4 C;  2CIJ A;  4C8P A;  2XEF A;  3TLZ A;  1BXR B;  2YJT A;  4KNG E;  1Q5X A;  2EK8 A;  4C86 A;  2C6G A;  2D0P A;  3SR3 A;  3TLC A;  4NGM A;  2PVW A;  3TYX A;  3BI1 A;  5F5X A;  5JYB A;  4M8D A;  3I6S A;  4OC1 A;  2XEI A;  4YN3 A;  4OC3 A;  3I74 A;  3TLA A;  4E5S A;  3FEC A;  1VBG A; 
#chains in the Genus database with same CATH homology
 2EZA A;  1JDE A;  1GGO A;  2MP0 A;  2R82 A;  1KBL A;  2HI6 A;  3T05 A;  2FM4 A;  1ZYM A;  2EZC A;  1EZA A;  2HRO A;  3EZA A;  3T0T A;  1VBH A;  3T07 A;  5JVL A;  1DIK A;  3EZB A;  3EZE A;  1EZB A;  2HWG A;  1KC7 A;  2OLS A;  2EZB A;  2DIK A;  2E28 A;  2X0S A;  1VBG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...