2FM4A

Nmr structure of the phosphoryl carrier domain of pyruvate phosphate dikinase
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
128
structure length
128
Chain Sequence
AALKAGEVIGSALPASPGAAAGKVYFTADEAKAAHEKGERVILVRLETSPEDIEGMHAAEGILTVRGGMTSHAAVVARGMGTCCVSGCGEIKINEEAKTFELGGHTFAEGDYISLDGSTGKIYKGDIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Examination of the structure, stability, and catalytic potential in the engineered phosphoryl carrier domain of pyruvate phosphate dikinase.
pubmed doi rcsb
source organism Clostridium symbiosum
molecule tags Transferase
molecule keywords Pyruvate, phosphate dikinase
total genus 18
structure length 128
sequence length 128
ec nomenclature ec 2.7.9.1: Pyruvate, phosphate dikinase.
pdb deposition date 2006-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00391 PEP-utilizers PEP-utilising enzyme, mobile domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.10 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Phosphohistidine domain 2fm4A00
3EZBA 1VBGA 3EZEA 2R82A 2MP0A 2DIKA 2HI6A 1ZYMA 3T07A 1KC7A 2FM4A 1VBHA 3T05A 5JVLA 2X0SA 1EZAA 3EZAA 1JDEA 2OLSA 2HROA 3T0TA 2EZBA 1EZBA 1KBLA 1DIKA 2EZCA 2EZAA 2E28A 2HWGA 1GGOA
chains in the Genus database with same CATH superfamily
4LQGA 4X3RA 3S9NA 4COBA 5D29A 4P4JA 2C6PA 3GJZA 2CIJA 4COGA 3I6SA 4C9UA 3NOJA 4MCQA 3D7DA 3T07A 3KASA 3SJGA 3TLZA 3D7GA 4KNGE 3K4IA 1VBHA 4C8PA 3EIFA 4C9AA 1R61A 4C8FA 3BHXA 3D7FA 1Y9ZA 1EZAA 4OC3A 1JDEA 3BXMA 4P44A 2HROA 3TLBA 2PVVA 4OMEA 1EZBA 5F1YA 4CDJA 1JDBC 3BI1A 4P4FA 4NGNA 4P4BA 4C85A 1GGOA 3U1BA 1CS0B 2YJVA 4NGQA 2YJTA 3S9LA 4JYWA 4MCRA 3C8OA 4MCPA 3FEEA 2C5QA 2DIKA 2MP0A 4CZ1A 3TLEA 4CO9A 1ZYMA 3I74A 4NGTA 4W9YA 4OC0A 2OOTA 3BI0A 3RBUA 2D0PA 4C9VA 2C6CA 4CDKA 1DE4C 2X0SA 3D7HA 3EZAA 3TLCA 4MCSA 2OLSA 3IIBA 3VTAA 3T0TA 4IIYA 2D0OA 4TWEA 3T5MA 1KBLA 2XEIA 1DIKA 2EZCA 4NGMA 5F09A 2E28A 2JBKA 4EYSA 1Z8LA 4YN3A 3T05A 1A9XB 3KRVA 3TLGA 3TLYA 4C84A 2C6GA 3EZBA 3FECA 3SJXA 4H1HA 4OC5A 3TLAA 1VBGA 2AUNA 4INJA 4C9RA 3K9TA 2R82A 4C99A 3SR3A 3FEDA 2HI6A 4C9EA 5FD8A 4TJXA 1ZRSA 1C30B 4E5SA 1WVMA 3S9MA 2FM4A 4JZ0A 4M8DA 4C8UA 5JVLA 2JBJA 2AUMA 4MJXA 2XEFA 4MI1A 4P45A 1V6CA 3SJFA 2GP4A 5K99A 4NGRA 5JYBA 4NGPA 4J0NA 4OC1A 4IIXA 3G23A 3TYXA 2XEGA 4NGSA 4TJVA 4C8TA 4C86A 3FF3A 1CX8A 1J3LA 2PCNA 4JVOA 1NBWA 2PVWA 1T36B 4P4DA 4E94A 1CE8B 1NXJA 1M6VB 4P4EA 1Q5XA 1C3OB 3EZEA 5IR2A 1VI4A 5IB9A 5F9MA 4C8AA 1KC7A 2OR4A 4P4IA 2EK8A 2B0AA 4OC2A 4C8CA 1BXRB 2EK9A 2XEJA 5ELYA 3TLGB 1XF1A 3ICUA 2EZBA 1ZL0A 3SJEA 4OC4A 3IWWA 1KEEB 2EZAA 5F5XA 2HWGA
chains in the Genus database with same CATH topology
3EZBA 1VBGA 3EZEA 2R82A 2MP0A 2DIKA 2HI6A 1ZYMA 3T07A 1KC7A 2FM4A 1VBHA 3T05A 5JVLA 2X0SA 1EZAA 3EZAA 1JDEA 2OLSA 2HROA 3T0TA 2EZBA 1EZBA 1KBLA 1DIKA 2EZCA 2EZAA 2E28A 2HWGA 1GGOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EZB A;  1VBG A;  3EZE A;  2R82 A;  2MP0 A;  2DIK A;  2HI6 A;  1ZYM A;  3T07 A;  1KC7 A;  2FM4 A;  1VBH A;  3T05 A;  5JVL A;  2X0S A;  1EZA A;  3EZA A;  1JDE A;  2OLS A;  2HRO A;  3T0T A;  2EZB A;  1EZB A;  1KBL A;  1DIK A;  2EZC A;  2EZA A;  2E28 A;  2HWG A;  1GGO A; 
#chains in the Genus database with same CATH topology
 4LQG A;  4X3R A;  3S9N A;  4COB A;  5D29 A;  4P4J A;  2C6P A;  3GJZ A;  2CIJ A;  4COG A;  3I6S A;  4C9U A;  3NOJ A;  4MCQ A;  3D7D A;  3T07 A;  3KAS A;  3SJG A;  3TLZ A;  3D7G A;  4KNG E;  3K4I A;  1VBH A;  4C8P A;  3EIF A;  4C9A A;  1R61 A;  4C8F A;  3BHX A;  3D7F A;  1Y9Z A;  1EZA A;  4OC3 A;  1JDE A;  3BXM A;  4P44 A;  2HRO A;  3TLB A;  2PVV A;  4OME A;  1EZB A;  5F1Y A;  4CDJ A;  1JDB C;  3BI1 A;  4P4F A;  4NGN A;  4P4B A;  4C85 A;  1GGO A;  3U1B A;  1CS0 B;  2YJV A;  4NGQ A;  2YJT A;  3S9L A;  4JYW A;  4MCR A;  3C8O A;  4MCP A;  3FEE A;  2C5Q A;  2DIK A;  2MP0 A;  4CZ1 A;  3TLE A;  4CO9 A;  1ZYM A;  3I74 A;  4NGT A;  4W9Y A;  4OC0 A;  2OOT A;  3BI0 A;  3RBU A;  2D0P A;  4C9V A;  2C6C A;  4CDK A;  1DE4 C;  2X0S A;  3D7H A;  3EZA A;  3TLC A;  4MCS A;  2OLS A;  3IIB A;  3VTA A;  3T0T A;  4IIY A;  2D0O A;  4TWE A;  3T5M A;  1KBL A;  2XEI A;  1DIK A;  2EZC A;  4NGM A;  5F09 A;  2E28 A;  2JBK A;  4EYS A;  1Z8L A;  4YN3 A;  3T05 A;  1A9X B;  3KRV A;  3TLG A;  3TLY A;  4C84 A;  2C6G A;  3EZB A;  3FEC A;  3SJX A;  4H1H A;  4OC5 A;  3TLA A;  1VBG A;  2AUN A;  4INJ A;  4C9R A;  3K9T A;  2R82 A;  4C99 A;  3SR3 A;  3FED A;  2HI6 A;  4C9E A;  5FD8 A;  4TJX A;  1ZRS A;  1C30 B;  4E5S A;  1WVM A;  3S9M A;  2FM4 A;  4JZ0 A;  4M8D A;  4C8U A;  5JVL A;  2JBJ A;  2AUM A;  4MJX A;  2XEF A;  4MI1 A;  4P45 A;  1V6C A;  3SJF A;  2GP4 A;  5K99 A;  4NGR A;  5JYB A;  4NGP A;  4J0N A;  4OC1 A;  4IIX A;  3G23 A;  3TYX A;  2XEG A;  4NGS A;  4TJV A;  4C8T A;  4C86 A;  3FF3 A;  1CX8 A;  1J3L A;  2PCN A;  4JVO A;  1NBW A;  2PVW A;  1T36 B;  4P4D A;  4E94 A;  1CE8 B;  1NXJ A;  1M6V B;  4P4E A;  1Q5X A;  1C3O B;  3EZE A;  5IR2 A;  1VI4 A;  5IB9 A;  5F9M A;  4C8A A;  1KC7 A;  2OR4 A;  4P4I A;  2EK8 A;  2B0A A;  4OC2 A;  4C8C A;  1BXR B;  2EK9 A;  2XEJ A;  5ELY A;  3TLG B;  1XF1 A;  3ICU A;  2EZB A;  1ZL0 A;  3SJE A;  4OC4 A;  3IWW A;  1KEE B;  2EZA A;  5F5X A;  2HWG A; 
#chains in the Genus database with same CATH homology
 3EZB A;  1VBG A;  3EZE A;  2R82 A;  2MP0 A;  2DIK A;  2HI6 A;  1ZYM A;  3T07 A;  1KC7 A;  2FM4 A;  1VBH A;  3T05 A;  5JVL A;  2X0S A;  1EZA A;  3EZA A;  1JDE A;  2OLS A;  2HRO A;  3T0T A;  2EZB A;  1EZB A;  1KBL A;  1DIK A;  2EZC A;  2EZA A;  2E28 A;  2HWG A;  1GGO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...