3TLYA

Microcin c7 self immunity protein mccf active site mutant s118a/n220a/k247a in the apo state
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
335
structure length
335
Chain Sequence
b'PLLAAPLAVGDTIGFFSSSAPATVTAKNRFFRGVEFLQRKGFKLVSGKLTGKTDFYRSGTIKERAQEFNELVYNPDITCIMSTIGGDNSNSLLPFLDYDAIIANPKIIIGYADTTALLAGIYAKTGLITFYGPALIPSFGEHPPLVDITYESFIKILTRKQSGIYTYTLPEKWSDESINWNENKILRPKKLYKNNCAFYGSGKVEGRVIGGNLATLTGIWGSEWMPEIRNGDILFIEDSRASIATVERLFSMLKLNRVFDKVSAIILGKHELFDCAGSKRRPYEVLTEVLDGKQIPVLDGFDCSHTHPMLTLPLGVKLAIDFDNKNISITEQYLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MccF
publication title Structure and function of a serine carboxypeptidase adapted for degradation of the protein synthesis antibiotic microcin C7.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 117
structure length 335
sequence length 335
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02016 Peptidase_S66 LD-carboxypeptidase N-terminal domain
A PF17676 Peptidase_S66C LD-carboxypeptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Class I glutamine amidotransferase-like 3tlyA01
3.50.30.60 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 LD-carboxypeptidase A C-terminal domain-like 3tlyA02
4H1HA 5F9MA 3TLYA 3GJZA 3U1BA 4E94A 3TLEA 1ZL0A 4JVOA 3TLGB 3TLGA 3TLBA 5FD8A 4INJA 4E5SA 3T5MA 2AUMA 3G23A 5JYBA 3TLCA 4MJXA 4IIYA 4EYSA 3SR3A 5F5XA 4MI1A 3TLZA 3TYXA 3TLAA 5K99A 5F1YA 4IIXA 2AUNA 1ZRSA
chains in the Genus database with same CATH superfamily
5GIPE 5DYIA 4OXKA 4ROSA 3RRYA 5FFFA 4CDMA 4D74A 4GKVA 1H22A 1QS0B 2W6QA 3UBMA 5H7XA 4L72A 2CJWA 3KUKA 1LV7A 2BP7B 2OGTA 4QREA 2DSTA 1YJBA 5BQFA 3L7NA 4DLTA 1RQGA 3VI3B 3G6KA 2BMAA 3EVEA 4YJ3F 1TT7A 3I3OA 3G7NA 1QFYA 3R9XA 4GRAA 1VKNA 5BQ3A 3KP1A 1LJUA 1VZ2A 2ZJ0A 4TYNA 2NNWB 4L4UA 3T5TA 1K2VN 2QZ9A 3TZLA 4B7UA 1RJ9A 2UZ4A 2MSWA 3KKQA 3TLAA 2RGEA 5C8XA 4TQ9A 4YRLA 1SBTA 4E6EA 3WV5A 2XTMA 3GLTA 4ZN6A 1ODTC 2QRPA 3T6KA 1WM1A 2JFNA 1AF7A 1JIIA 1BX0A 3PB3A 3R24A 1C1DA 3L93A 4H15A 4ZODA 4I4TB 1DKNA 3G2HA 3S2SA 1ODJA 2XYRA 3PEEA 1RQXA 2X6QA 3S5JA 4EHIA 4ZEWA 1I5RA 2EZUA 3B20A 3GZTB 3PS9A 4YO7A 1OFHA 5AI9A 4G5XA 2OXIA 1Y6ZA 1Y7IA 1QCZA 3P52A 4WCFC 2JEZA 4BMXA 4M7WA 4MRVA 3B1WA 1RM0A 4QODA 3EF3A 5LYJA 3WSTA 3RWMB 5JTUA 2PX8A 5D87A 3OOWA 3VZSA 2R7LA 3WGUA 2ZAGA 3LHIA 1N2OA 1JDJA 3PYMA 4DNOA 1XEWX 1KH2A 5L6MB 4HEHA 3PQ2A 4CLEA 3KWMA 3MRVA 4LA4A 4D5GA 4CIBA 4MEJA 4P53A 3WFZA 4RTQA 5LMZA 3P2JA 3WWEA 3PDCA 4BJ6A 1OPXA 2XGGA 2VK8A 1YXMA 2FI1A 1H8EA 1UBGA 3LT1A 3ZDCA 1KAEA 3GEIA 2K5UA 1QG0A 1NX9A 1FMLA 1I51A 1NYRA 2DSNA 5IH3A 3X43A 3P0RA 4D41A 2JI7A 3C45A 5FPTA 3H8VA 4M54A 2YV4A 4MRNA 4BWVA 1PT9A 2O4UX 2OQIA 4P3YA 3A4TA 3TKLA 3TLGA 4DLNA 2V9ZA 3D31A 1MG0A 3W3ZB 4II7A 4IXMA 4QVIA 3TTTA 4NBWA 5BMVF 3HXQA 1NQAO 3V3TA 3JQFC 3GVHA 1ZIDA 2QDXA 2ZSDA 4L02A 3V97A 3V8EA 1OY1A 1E3WB 3ET4A 2Y0PA 1TZJA 2XUDA 4RQBA 3W2HA 2IHKA 2Z5VA 3GJQA 3HBLA 1ECJA 1SXJE 4V0NA 2E37A 3ZHZA 3GB9A 3N53A 1AQYA 2RJ3A 2FN4A 1Y5RA 1PNVA 3AIMA 2YDYA 3DDNA 2CHUA 4NK5A 5FLEX 1QHSA 1TQHA 5FBQB 4C8FA 3R40A 1JG4A 1PD1A 3TZCA 3VYRB 1QE3A 4YAJA 1XSEA 5JXWA 2OSVA 1IJKA 4MWZA 3MT8A 1TKRA 3QFFA 3QIVA 4MW6A 4TLAA 4U6QA 3TIFA 4BMYA 3I0MA 2FEXA 2ZULA 2P68A 1M6NA 2J6CA 1WXXA 3F7MA 3JYHA 1P7ZA 1VMEA 3FR8A 4OA5A 5ALLA 3RFCA 4BVEA 4EARA 3VZQA 1MBZA 2R6GA 3M4ZA 3RANA 4WJLA 2G5TA 4DDVA 1CF2O 1YB7A 1QTNA 3DL0A 2D2VA 4RW0A 1JKJB 5LB2A 1OIWA 1L1FA 3GUYA 4PZCA 3GEEA 4Z7JA 3A6JA 3IVXA 1UR5A 2PGXA 2W98A 4DNQA 3TFWA 1JVNA 5KSWB 2JJQA 1DT3A 4FIDA 2ZSAA 4R01A 1ABBA 4GMGA 4EJSA 3HO8A 1FQKA 1EWTA 2OV8A 5DGTA 5EGNA 1XDWA 1ZNZA 2GHRA 4BPRA 5A5VA 2R85A 3NTRA 2PSFA 4BMOB 4KDEA 4NPCA 4MJLA 3WAJA 4MK4A 4XCVA 2XTJA 1FVHA 1ZOIA 2V8BA 3I73A 4AMZA 1BZYA 1TYCA 3NG1A 3KDSE 5DNWA 3QKTA 5C31A 4ZI3A 5CT6A 2IRWA 4ERNA 4EK9A 1RP1A 3B9QA 3F8TA 3T9AA 1XO1A 3T9CA 3NNSA 2GM3A 4NE7A 4TUYB 2XKAA 4URZR 2WV9A 2YZGA 1U7WA 4RGYA 4RSRA 3PQEA 5AKGA 5ITZB 3ETHA 1EFPB 4EUEA 4F4JA 5K4GA 2V97A 1C30A 2QBYA 1CUYA 3PV0A 2GRUA 1ZU5A 2FE1A 3EWAA 5FTJA 1CUSA 2ADOA 1H9AA 3AHGA 4I19A 4RVCA 2IBMA 2I03A 4NJEB 5B30A 3VR2A 1LS1A 4D80A 2AX4A 5HIAA 1U1DA 6GPBA 5JMPA 1KO8A 4CQNA 5DWQA 3M4YA 4OHCA 5JY1A 4KJXA 5F73A 4EG6A 3QOWA 2KB0A 2NZ8A 2JFVA 4ESOA 3C3DA 4MIOA 1JLLA 4ZMRA 4R2LA 3N8NA 4FJ2A 3BGIA 1E1LA 4X20A 5T6MA 1VMIA 4XD7A 2Y66A 2C95A 3OURA 3M5DA 4OXXA 3E7XA 3B60A 2PXCA 3MTEA 1Y6JA 3CLSD 3O73A 4NATA 4LSGA 2XD9A 2F9LA 3TKAA 3ZDRA 4AJ4A 4DABA 2JCYA 2DWCA 4JBGA 4CM8B 4H1VA 2DPHA 3VJMA 1H0HA 4QFDA 4MDFA 1UADA 1L4FA 1XNRB 2ZUDA 2FSVC 4QTZA 3COPA 3VMMA 4DUYB 4KJZA 2EDAA 3DZ8A 3LT2A 4CV1A 3AF6A 1BS2A 4M99A 4DR2B 3JYOA 1IAVA 2CXRA 1KAMA 2RH4A 2H0QA 4RHCA 4AWXA 1PJAA 3EA4A 4HFJA 1YTLA 5A9SA 5JXIA 2P6RA 4WLEA 2X0FA 1QH8A 1QO9A 3R1IA 4B43A 2AC7A 2ZRLA 2X19A 2IYAA 4NU0A 1W5FA 3L7AA 3DTNA 5CDHA 3QX7A 2HPVA 3I4FA 1K66A 1EFUA 2YS7A 3RC9A 2WHRA 4KW7A 3HACA 4LSWA 4L5IA 3K70B 1IZYA 2IH2A 1ZH0A 1R8SA 1G66A 1XTUA 1QB7A 3FSJX 4W1QA 2WABA 3RVOA 5BMOA 1XZCA 5FCDA 5BW8A 2YHIB 3ENQA 2OVFA 3PFCA 4IDBA 4ND6A 1IULA 2VP0A 5ALHA 1BE1A 5CFPA 1JLHA 1RWQA 2JZOA 2SECE 4DIMA 3U4GA 5FWYA 4QOJA 1XMQB 1K7YA 1ZBQA 1PSDA 3T5DA 4U7HA 1UEIA 5F7JA 3IOCA 1CHNA 1KQ3A 3M33A 4P3KA 1MR3F 4U6SA 4AP6A 4H7HA 1Z3CA 4TXNA 1XL1A 4Z2YA 1TKAA 1JAYA 4I1VA 3EY4A 4Q4CA 3GLIB 1AQLA 1Z2CA 2R00A 3VR4A 5HX7A 1OH7A 4AAYA 2PO5A 4S1VA 2LP4Y 1JDZA 3KSDO 3IVMA 5JNVA 2VTVA 2XTZA 3PI7A 4Q48A 1AA6A 3PNBA 5M7EA 2WD8A 2AYYA 2X9QA 3BRCA 1GZSA 1G5QA 4HBZA 1E79A 9LDBA 5L51A 3O7WA 1B2RA 4J9UE 1EUZA 2KM1A 2QMEA 2FF7A 4GPZA 2Q5EA 3FDFA 1DMSA 3UZUA 1E9AA 5TLSA 1II0A 3R7SA 4DT1A 4RVHA 1D4OA 1OE0A 2HA4A 4GPIB 1CDDA 1JU3A 4CFYA 3VV2A 3FFWA 1KS2A 4I3FA 2EW8A 3QE4A 3D0OA 1K89A 4OKNA 3SJGA 3NOVA 5HDQA 2G4CA 5KTPA 3HL4A 4AB1A 3GH1A 1K92A 2FOIA 5ELLA 3IR6A 1F06A 3MZ0A 3P4UA 5ARCA 3WQBA 2Y4OA 3NBFA 1GZUA 2JFPA 4WN9A 1Y5NA 3Q98A 1Q2XA 4KQGA 2CNWD 2QUHA 2PU5A 2M2IA 4P45A 5EZYF 4FSDA 2IGBA 4M55A 4YRZA 9ABPA 1BDIA 3ZWXA 1FYVA 2C98A 3S2GA 2FH5B 2IDJA 3FWZA 5BN3B 2WB2A 3AHDA 1Y9JA 5JRDS 1IK4A 4W1PA 1P9LA 1EXMA 3KQOA 4KMOA 2RGWA 1DARA 4CODB 3SZGA 3ZW8A 1F6BA 1GNQA 1SB8A 2IEGA 2ZJZA 3H83A 4PLYA 4B5KA 4YMGA 2QTTA 5FH9A 2X6TA 4L57A 1P3Y1 3QEKA 4OHXA 4NBVA 3WBJA 2WE8A 3AX6A 2AG1A 4TMXA 3S9MA 2JKVA 2ZQ5A 1IY8A 4GMKA 4HZUA 3I1FA 3TF5A 2HWKA 1XTBA 4HTFB 2E9SA 2GTIA 3JQEA 4OMUA 4HWTA 1H6AA 1YD7A 2C7GA 2QAIA 4CMHA 4MUEA 4XKJA 2PUCA 4RZUA 2OBFA 4WL0A 2II6A 4JI5B 3LPCA 2FDRA 4IKOA 1OFGA 1R6VA 2ONCA 4UCXA 1KR2A 3E9MA 4ZYLA 1DKPA 3HM9A 3T0TA 4CR7A 2EBUA 2RG1A 5ALIA 2ZWMA 1JA1A 3GGJA 5A1JA 4Z7OB 3KS9A 3RUEA 2CFSA 2ZRAA 3BE6A 4F46A 1OFUX 2MOKA 5A4FS 2HLHA 1KFEB 1M0SA 5F2EA 3LQ1A 2X8JB 3NT2A 4K8OA 4EW3A 1JSXA 4M1OA 1L4MA 4BFLA 4EUNA 4IX1A 1TDJA 2K7FA 1JAXA 4QO7A 1E89A 1DTWB 2JFZA 4LCJA 4NV3A 5D3MA 3SXUB 1I4DD 4QARA 2I62A 3ADDA 1XLVA 2UZAA 3HB4X 3LQ4A 1N2CA 5DLYA 1DS6A 5HBRA 5KJCA 3QJ5A 4DTIA 5BNIA 2VNKA 1IYZA 1CR4A 4MKZA 3CGGA 3MJSA 2HREA 3WLEA 4AVYA 4EB3A 1DT5A 3D1LA 3LBAA 2N46A 2PL1A 1ZNXA 4X6XA 3QKIA 4F3CA 1WHTB 2G3YA 4F9FA 1IE3A 3UPTA 2CZGA 4MHSA 4B79A 4HS4A 1Q0ZA 1XCGB 3JQ6A 2MCFA 3PXUA 3HJGA 1UPXA 4L4ZA 1RXVA 1KMIY 3ZCPA 1NZFA 1FDSA 1QTIA 1U8ZA 3MTDA 2GZ1A 1AKRA 3UK0A 4ZVUA 4BNXA 3BX1A 3UAXA 8MHTA 1ZGCA 2R1TB 2J67A 4HX9A 4I5GA 3ROXA 3S68A 4LF9B 3PNMA 3IUNA 1RC8A 2QX6A 3FVRA 4KKXB 4EAQA 1Z6AA 3COSA 4UXJA 5IF3A 5JQGA 3O82A 5EIHA 2M6SA 3KWLA 4QEKA 2PGOA 3AY0A 2VA9A 1PYOA 3EDCA 4U02A 5JD6A 1WG8A 1J22A 4XWYA 4YDQA 4KR9A 1R4NA 2IYQA 3BORA 5D8DA 3KYDB 3O2NA 1MRSA 4DLPA 1KERA 4CE6A 4LAFA 3LX6A 3H1PA 3C6BA 2ZR0A 3QE9Y 2FTKE 1CULC 4EW6A 4EG1A 3S6JA 2PUTA 2V4ZA 4KQCA 4CM6A 1MV5A 2SHKA 3B9PA 5HUHA 1I2MA 1FRZA 1XG5A 3H8JA 3PNLA 2WINI 4M9ZA 3K16A 3KAKA 4OHZA 1TA9A 4MUGA 1HDEA 2KS6A 4G4SP 1Q17A 2H2DA 3MRTA 1U98A 3CVOA 2P1DA 4O6VA 1J0DA 3VR5A 2AFIE 5A4DA 3H7IA 3ZIAD 3B9BA 3OCJA 3Q6NA 3FNRA 1LQUA 1T9DA 3EGDB 4HY3A 5CYOA 1P7VA 4ZKEA 3OEYA 5JC8A 1PP4A 1WCYA 2C99A 4C4OA 5JH7B 4D97A 3Q0EA 5E9WA 3SNHA 4LRTB 5CX1B 2QD3A 5EQJB 3PNPA 5AW2A 1NYLA 2JJ8A 3EHEA 3AW8A 2JJMA 2VP2A 4D9HA 4KRGA 1T3SA 3STUA 2FCRA 3UENA 1M72A 2XQIA 2ZWIA 3EZFA 1Y8ZA 2PZBA 4K6CA 4NYJQ 5DOVA 4RANA 3V7WA 1YRQA 5BSRA 4CL2A 3KB6A 4DIOA 1SUEA 3L9WA 3OQPA 1IY2A 1LPAB 4P0PB 2Q99A 4ZEXA 2PK3A 4QFBA 3BIWA 1VKZA 1SXQA 2H4HA 1N7HA 4W9RA 3PLNA 3W77A 4L75A 2ZIWB 3QTTA 1JHPA 1U6KA 5A3SA 1G21B 1OWMA 3BS4A 3KE8A 4CG3A 3J81A 1E6EA 3U7QB 1BEUB 2FSUA 3E9YA 1XK6A 2FZWA 1WHSA 5BXQC 3IAEA 3BKWA 4XFJA 1VJ0A 2HMYB 5EP1A 3WK4A 5B6JA 1RSZA 5H70A 3A2NA 4YCBA 1PVVA 3DVAA 5JDCC 5K0GA 3DLAA 3KT0A 3LO8A 3ZY3A 3BVPA 4HN4B 2OVBA 3E1SA 3G2JA 3H0CA 4YRDA 1BIFA 4TX1A 2O2SA 2ZK7A 3FB1A 1NVAA 2PKEA 4RL6A 4BJ5A 2XOKA 3ND8A 3OZGA 3TPZA 4EZEA 2J3IA 1CS0B 3FPEA 1A98A 4Z51A 1EFTA 3KX2A 3FKSD 5A6SA 2XRFA 2J6BA 5JS8A 1E7MA 3IV7A 1K7EB 2QLBA 5CX4A 5JT1A 3T1QA 4FDLA 4MDYA 4F45A 5I6DA 1KK0A 2YV1A 4BFZA 4KPFC 3WAGA 3SS8A 3SC3A 4C29A 5AVKA 5F09A 4YRKA 4QXMA 1GQOA 3IKJA 1Z15A 5C1IA 5FL7D 3D7SA 4GYWA 2FP4A 4U63A 3FY4A 3KSUA 1FW8A 2I2XB 4MYDA 2VYVD 1E2LA 1Y37A 4Q3AA 5KYUB 1EH5A 4UTRA 1FUUA 5EIXA 3ZJUA 3RIXA 4ZT6A 3L79A 5JWOA 1HKUA 1OXTA 3OE7A 4DMFA 1GZ7A 4QPZA 1NKVA 4UXIA 4J03A 4GOKA 1CJBA 3UTDA 4F12A 3E3LA 4QOGA 4JX8A 4EO4A 1N6NA 3HFSA 1TXGA 2FRXA 1AJEA 1LI5A 2QQ0A 1WU7A 3GAFA 3NTUA 4BB9A 2CDNA 4CVNA 4D0NA 2W2NA 5JY6A 3CCFA 3WZLA 1N2IA 1NQ5A 2AUMA 1CB0A 3RS7A 3M9WA 4NR0A 1AUXA 1SXGA 2LCIA 5COBA 5K8JB 3MFQA 3V8QA 1C2YA 1JIVA 4FXOA 4YQZA 3SJFA 2G6TA 3IQXA 4FNOA 4NYJR 4TV9B 5COAA 2PH5A 1U3WA 3TTYA 5IAEA 1A9OA 4M1TA 3DJYA 4CKCB 2ORYA 4LGYA 4ARZB 4ES6A 4N8SA 1USUA 7REQB 1OW3B 6REQB 2AEFA 3G9TA 1AB5A 2FPPA 2GJ8A 4ML3A 4ND4A 3VVCA 3RFVA 4V1CB 5IRCD 2WJVA 2ZG6A 1D1PA 1JWLA 4Y0NA 1RYZA 4W5WA 4X6UA 2YVKA 3B5EA 3N3AC 1PV1A 3U4IA 1JA9A 5KJ1A 4J4HA 1Q0RA 5AJXA 1NHGA 2V4UA 5C52B 1IUKA 2NG1A 2HF2A 1NZDA 3GD7A 4EGAA 1VIVA 4KAFA 2X9LA 3TTUA 4WA8A 4R31A 2XB6A 4RYDA 1AH2A 1FS6A 4WKPA 1FRNA 4WERA 3A3NA 4ENWA 4E07A 1B93A 2FZGA 2YTZA 3HDYA 2Z57A 4LCEA 3WOVA 1AY0A 1ESZA 4MRMA 5AKHA 4R0MA 2L18A 1U2QA 3DAOA 4WKNA 1M8PA 2HJSA 4JCOA 2H65A 2IF0A 3D43A 4BVAA 3U6KA 3VSCA 2PX3A 5BUZA 3E48A 1SVNA 1NVEA 2FMXA 3QE2A 3A4YA 3M70A 1TK9A 2VF4X 1JJAA 2X1HA 3JSAA 3OZUA 1FFHA 3AYXB 4BCDA 5E95A 3LSTA 3OKPA 2QI9F 3QENA 2C5AA 3FJOA 1D2MA 1MAAA 3QGMA 4R54A 2VJYA 4MGIR 4Q7KA 3PPIA 5F5XA 3T7CA 4BQPA 3W5JA 4JMLA 3ZCVA 4GECA 3TQCA 3HVIA 3SZ3A 3CRZA 2E82A 9LDTA 1G5RA 3WRXA 1X1AA 1IZ9A 4Q93A 3PZBA 4QBIA 2Z6UA 1NJ2A 1QFSA 5CDFE 1RPJA 1KYXA 1VJDA 4OC3A 5MDHA 2XVZA 3C41J 3MGCA 5FHQA 4NGNA 3DUWA 1HUQA 3K0FB 5C51B 1N4DA 4KTTE 1H2AS 3MWFA 2R68A 3ROEA 4RVNA 1G9SA 2HSEA 1CZLA 2DZDA 2E1RA 1GNVA 2VDKB 1G9XA 1JR3E 4FLMA 4J4TA 3AFHA 1T5IA 3EF0A 3L82B 4FGKA 1P44A 2IVZA 2PNFA 4RNDB 1YRLA 4YALA 2AWNA 2AJDA 4G5OA 4BDTA 1QE5A 4LMBA 3WQHA 3IXLA 3EEBA 2R0QC 2OYSA 3PKIA 4R8SA 1LDNA 2PMFA 2X7HA 2V96A 3E58A 2XDYA 2RGNC 5HDBB 4CBVA 2PMWB 3FNGA 1ZD2P 3OX3A 4Y2SA 3BL6A 1SCJA 4D7AA 1R00A 2VXOA 5JZVA 2RHBA 4R40A 3IIBA 4ER6A 4II3A 2BRUC 4YJKA 1Z0DA 4J9VA 5DHPA 6LDHA 5JHGB 3KEQA 3HSSA 5J43A 2XKKA 1N8NA 1HDZA 3MWDA 3P1JA 4E4TA 1YS4A 1I10A 3H6HA 4X61A 1DAKA 5AKLA 4KQ1A 4CG0A 1D5WA 3TJMA 4A16A 3QV1A 5AM3A 3EK2A 1MVNA 2JGKA 5DM1A 5EWJA 3AP1A 3HKDA 3MTBA 4UBOA 2IQ5A 4E2FA 3OEED 1W4AA 1PEKE 3AF0A 2JHAA 4I0WB 1BO6A 4MR7B 4Y0VA 1IHDA 2WT9A 3CX6A 4GOJA 4LPSA 4PQGA 3PUKA 5FA6A 4CT5A 3FPLA 4OIFA 1SBIA 2UVPA 4Q6WA 3T1NA 4F6CA 4V0QA 4ZRMA 3TECE 4OSEA 3E1GA 3GJ3A 2YHSA 4F6RA 2UVQA 5KAPA 4UMEA 3LKBA 4GC9A 5CIQA 3D3QA 1Y6QA 4ZQFA 1I33A 4LZPA 4QOHA 5FYDA 1YNOA 5ICFA 1J2YA 1ES9A 4K9SA 4BZWA 4MQMA 5BNWA 4JUCA 2JIZD 3QFSA 4NAVA 4MYCA 3NAZA 4KE8A 1CERA 2CD9A 2WIDA 2YJGA 3LUBA 4GZMA 5HQJA 3SVZA 1G20E 2GS9A 3RR2A 1DIRA 1YI8A 1KOJA 1UXOA 5FTWA 3R7WB 2P62A 4E46A 1E92A 1SXHA 2X4IA 3OSZA 4QYIB 3SX2A 1WETA 2B83A 4HGNA 2Z43A 1IDN1 4PPNA 2E5FA 2UAGA 3UKDA 1ECCA 2FQ1A 4OHPA 1C3JA 2RBEA 4PWYA 3BAZA 4ZZIA 4P4LA 1E20A 2GZMA 1KBQA 2BY4A 1P5RA 3AUXA 3LZCA 4XWTA 1VSUA 1JVBA 1A7JA 3KLPX 1HY3A 2RGXA 4AXBA 1R9GA 3A9RA 1XA4A 1T25A 2ZRFA 1BWQA 5TS2A 4X85A 5AQ1A 4B3JA 4IDNA 5IJAA 1FZQA 1NN5A 2JATA 3A4MA 1ETHA 4JIMA 2FSFA 3FZYA 3LT5A 4M8DA 4DCGA 3LOUA 4JLJA 4M8LA 1HH4A 1OKKD 1BKSB 2JAXA 1XWFA 4PYLA 2Z2YA 4NF2A 2I4MA 5I3CA 1URPA 2C5HA 2XUQA 3G59A 3RVKA 3S3TA 2J5RA 1NXXA 1OIVA 1HYBA 2PVPA 3KHSA 2CFIA 3PRHA 4HVTA 3S8YA 1O97C 5TQVA 1W73A 3H18A 3N9IA 5JEEA 2V7QD 4BVKA 4EYEA 1MOSA 2VVTA 4YK7A 1GRRA 1O5TA 4QG7A 1YVUA 1G5IA 5JD4A 3LUDA 4OP1A 3DF9A 3IE1A 1N2HA 1Z34A 1P1IA 2IF2A 3UWMA 2WAAA 5SZHB 1CJCA 4BGVA 1GRQA 3AHJA 3LGAA 1JILA 1U0HC 1B6GA 3P94A 5JJBA 5J2TB 1O03A 2YUTA 4RPCA 4HAVA 1RMQA 1YQWA 3FCSB 4W1RA 3K92A 1FDTA 4Q00A 1YR1A 2XE7A 2C2OA 1XA3A 2OWDA 4GOLD 4TV8F 1T1RA 4GD3Q 1YJXA 1VL5A 3PX3A 1AD2A 5DNVA 3SHOA 1ZQ1A 2REQA 4J4BA 3WK5A 4D92A 3Q12A 4H7DA 1I8TA 3SR3A 5INTA 1U0TA 2PCJA 3QU4A 3TIVA 3V8VA 2EOAA 3HXPA 4RLQA 3ZQ6A 1HKHA 3FDZA 2X0EA 4UEJA 3U1TA 1LDMA 1KETA 1WMSA 2ERCA 3V7YA 1CW2B 2ZRIA 4P7KA 3EH2A 2PSDA 2E18A 4X3PA 5BVGA 5C8VA 1E2QA 4KLCA 1PCXA 2ZZKA 4PWZA 5I5GA 4A2WA 4MKGA 4YI3A 4P4JA 4HNGA 1RYDA 4G84A 4PG5A 4RK6A 2BKVA 3IP1A 4TMYA 4BVLA 4CNQA 3BEOA 4EKYA 1Q92A 4RXUA 3ICUA 2E28A 1RRGA 3EBPA 1XTJA 1CY1A 1PWXA 2QP9X 2J7PD 2B8EA 4HLDA 4ARUA 3VUEA 5FWNA 2EZ9A 3PXGA 1P7PA 2DC1A 3INGA 3N87A 4NU5A 5CTJA 2C8LA 1LC3A 3T3DA 4HWGA 4CDKA 4OU4A 4XRGA 3C85A 1UT6A 3PC7A 5E6UA 4J49A 1EEXB 3SBOA 5HP4A 3L77A 5FFNA 5AOCA 4AU1A 4H27A 2WPDD 3BMQA 4PLGA 1J0EA 1EZZA 3P5BA 3DTYA 1L7EA 3HWSA 1UBUS 5DCYA 1U2SA 4GHWA 3VO1A 1GWNA 1LJLA 3E3AA 1Z0UA 5D5HA 3ZHBA 4JIGA 1Q1NA 5EL0A 4DN6A 1ZJWA 5LDHA 1CF9A 1V39A 1YOVB 4L78A 1I7PA 1EQAA 3DBOB 1QRAA 2O8BA 2X8LA 1SWVA 3IBFA 2EAUA 3TVDA 2V0CA 1HE1C 2O1EA 1Y81A 2WVHA 5FQOA 1CC1S 2X0RA 4IVRA 4IXWA 3DT9A 5IAKA 1XHFA 3AJRA 2D3TA 3R77A 3T9BA 3WS7A 3SJXA 1JEYB 4F06A 4YJHB 4DV4B 3AJAA 1WMDA 4H08A 4P4FA 4Z6KA 3KYCA 4GI3A 4K03A 1Z6GA 1ZCFA 1YBVA 5CM8B 5KVVA 2JFGA 3D64A 4YCJA 2CJWB 3B89A 4R2IA 4NVRA 3WL7A 2PZGA 1NVUQ 3DE1X 4B47A 5CVUA 1EUCA 1X1EA 1JMYA 4CUZA 4MVJH 5EXXA 1I7NA 3L8MA 5FOXA 3OAAA 3AYZB 1B16A 3ZEIA 4UMDA 4HNQA 4UUOA 5LMUB 3R9XB 3NTLA 2UZ1A 4L08A 4D9MA 1EE1A 1KRHA 3HWWA 2TS1A 1QP4A 1GSIA 4R8VA 5CVDA 1MJ5A 1H1TA 2PKWA 3DD1A 3MYRA 2C5SA 1GT91 3HDHA 4B3GA 2F64A 2CWDA 3C3CA 2RHRA 3LUPA 4IO0A 3VYUB 3OUZA 1C1HA 1VJCA 1OWLA 2MHCA 2XJ4A 4F5EA 2XXBA 1NVTA 3HYTA 4KP7A 1QXSA 4LISA 2WWTA 1GL9B 3RB8A 3M0EA 4LZZA 3K1YA 5TPWA 1G19A 1IN8A 1Z5VA 2HRZA 5BSEA 3K4HA 2OUIA 4QHSA 2CF5A 1XOIA 1CUZA 4QGAA 3V4VB 3FB4A 1IWPB 1RRPA 3Q7RA 2IEDA 3UMGA 1XQ6A 1UKZA 1AMOA 2MIIA 4ZDJA 1GZVA 3B3AA 2IH4A 4OAPA 1NM5C 5JECA 2YMQA 3MD9A 2V55B 1M2JA 2HIAA 4RMNA 3RBUA 1VBMA 2X86A 3GZ4A 3H75A 5K0SA 1GTRA 4H17A 4YHBA 1CR2A 1O5IA 1WDKA 3BC1A 4QAJA 4BGDA 3B5IA 3E2MA 4CIVA 2EEPA 4RWEA 3PUZA 2ZBVA 3QOYA 4F56A 3ZD6A 4XWOA 4K3UA 5FPPA 3ZW9A 1H8HA 8AT1A 1P72A 4CEHA 1NVMB 1KDTA 2Z58A 1RRFA 3TLGB 1CZHA 3VISA 3ZE0B 1EI9A 1ZO8A 2RC6A 1OX4A 4FNGA 3DHNA 5DLDA 2R97A 2QTBA 3PEYA 4X62B 3AVWA 3R0IA 4JNCA 5DX8A 1P7CA 2NYUA 5DHFA 4TTAA 4C4ZA 3CUKA 2QV0A 3QPDA 2N1BA 4IGKA 5BR8B 4X95A 2NZVG 5CLLA 2QB5A 1EE9A 3DAPA 1RQ7A 1FNNA 5A4IS 3SYTA 4Z0NA 4ID9A 3ISTA 3T06B 5GP1A 1NMXA 1PG5A 3NB0A 3OH8A 3Q5DA 3F71A 2FW8A 3CH6A 3H84A 1D5CA 2J32A 1XEFA 2HA7A 5A3JA 1RZRA 2ZYAA 1EFAA 2J9GA 3SVTA 1Q5XA 2P67A 1CWUA 3F6SA 5FI5A 4I50A 4F97A 2EZAA 1P4AA 2XEXA 3BHMA 3ER8A 3UM9A 3V1MA 1U0JA 5HJ7A 3C8MA 4G23A 4M8KA 2QTLA 2GBCA 3OM0A 4JI2B 5EZ5A 1IMJA 1WB5A 2HWYA 3LY7A 4GYKA 1T43A 2E6UX 2WZDA 1YDEA 1VM6A 1ZIYA 2CXPA 3GVCA 3IUEA 5G02A 3RG2A 1XROA 2JI9A 2OXEA 3GFPA 5TJHA 4BZXA 1OBVA 1NYQA 2Q3LA 4RIGA 4AQ7A 2FK8A 2ZEJA 3MWEA 4WNYA 2SKDA 4TSFA 2XB4A 2HLNA 2QT9A 1Z8HA 2Z56A 4U4AA 5AJTA 1S1CA 3LV8A 1G16A 1G6HA 2XE6A 1L1QA 3SLRA 1MFPA 3G1WA 5T3UA 3LLSA 4G41A 4QWWA 4TMVA 1IG3A 4U2FA 3CPHA 4P86A 3HJCA 3HBJA 1WV0A 5KYYB 2TMKA 2I9KA 1VE7A 2HRDA 1Y8RA 2D54A 3DE6X 4IUBS 1YS7A 1BFKA 1ADFA 1XELA 1YNSA 2WMOB 3H4MA 5F1PA 4MVCA 3SU8A 1T0JB 2VHVA 3N2IA 4N5NA 2A57A 1NUUA 3FNQA 3R0XA 2BLLA 4BLRA 4DUPA 5JAPA 3VR3A 2C96A 2XWBF 2A9JA 1KOFA 2FPSA 2GN2A 1RYBA 3R3UA 4ZT7A 5FWXA 3FYSA 2F1RA 4KDRA 5JSFA 3ESRA 4YWJA 2AMYA 3WL5A 2AYXA 1SK8A 4NGSA 2TMGA 1OYYA 3FSGD 4LK2A 4IDOA 1BHJA 3CN9A 1ENYA 1CEEA 4FEYA 2B4KA 4QT0A 5DTMA 4KWCA 2AQIA 4UVHA 2HTFA 3ROZA 5CG1A 1CQIA 1T3GA 1A8IA 2A5LA 2QE6A 2V54A 5IJWA 4B46A 5KBYA 1XQXA 5IBRA 1XLUA 1XZQA 3SKVA 1COWA 4DV3B 1VYVA 1EDZA 3UWDA 3EVFA 4U2KA 1D09A 4TLLB 1C30B 1NI3A 2AKAB 1HXHA 2QBYB 1E0DA 3LDGA 1OGJA 3L02A 4B7ZA 1RXYA 1V6CA 1RPTA 1DBWA 1YONA 1SHZA 3NNDA 2C8VA 3M6XA 4I2VA 4OX9Y 1ZKDA 1PJ8A 3BQMB 3LLUA 1A8UA 3VPSA 5C1BA 1Y3IA 2HLDA 1K86A 2O7NA 5SY9A 4KR3A 4I4NA 3QUCA 1W6RA 1Y80A 1E1CA 4EZBA 1GLGA 1KI6A 3DMHA 5K0CA 4QGSA 3T5AA 3Q7QA 2B36A 1WPGA 2PUAA 4B3SB 2YXEA 3CUEF 5FUQA 1JLLB 3HPQA 3WB1A 2GX6A 4RPKA 1K8RA 4OK6A 3RTGA 4X20B 5JSZB 2P41A 1TECE 5EHQA 5TNXA 3TLZA 3NVMB 1W0JA 2OZPA 4O2RA 3X44A 1M6EX 4RCYA 3KXKA 3MJFA 3SJEA 2CMGA 2H63A 3JZAA 4N12A 2OL4A 4E7PA 4G8CA 1NVGA 3DDOA 3IJEB 4J3FA 4PLHA 2Q1YA 2X22A 1S3FA 1LPOA 2RH5A 1ATIA 3KYJB 2Y1DA 3B8EA 4UE3S 521PA 5C4IA 2CUTA 1OWNA 4YY3B 4IX9A 1JHXA 1KC1A 1N0WA 3BRSA 3IB6A 2VHJA 2A92A 4DRZA 1G4AE 1BDJA 1IIBA 1V41E 1F4LA 1I3MA 3DE7X 2ZP1A 2ZJAA 4HV4A 5HFAA 5A9SB 2P9ZA 1ZU4A 1Z08A 2GZHA 3FCCA 4BQSA 1O6BA 2X7XA 3UK1A 2CXHA 4KTVE 3W5DA 4JI1B 2ZI5A 3ITNA 4HNVA 1X1TA 2O7VA 3KQUA 3I6ZA 4E2ZA 4B32A 1EQ2A 1ECBA 1JDUA 4CHGA 2PYZA 1J42A 2FEKA 1YI0A 2Q3CA 1SKYB 2VJNA 1UPBA 1Z83A 3ENWA 4E4RA 1NL3A 4QUAA 2ZATA 1YZHA 3HS3A 3L5KA 4MCPA 3KJGA 1GKLA 3I9FA 1SURA 1UAYA 2GJSA 1RXWA 4LVUA 4BASA 1HT2E 3V8BA 4WY2A 3F96A 4UC0A 5EIFA 2FQWA 2ZBGA 3CPEA 2BWJA 2RHOA 4HYYA 1WKVA 4WD3A 2ZANA 1IZ7A 2VK2A 3D6JA 3OHSX 4YJFA 3CC8A 1B3RA 3KZOA 3WC4A 1A0OA 5KOYA 4F4UA 2C42A 3CUVA 2PLAA 3DDZX 3I5AA 3MW8A 1KZGB 1TAGA 5IJZA 5FTKA 1Z2DA 5JS2A 3FTPA 4D26A 3DOUA 2MR5A 1UL1X 4JVNA 3KUCA 3GFOA 3JQGA 3ECAA 2JEOA 3OX2A 3TW8A 2QRNA 2EZBA 4WLVA 3CIOA 3R5XA 2H8GA 1FNSA 1JAZA 4KXWA 4D3SA 1GKUB 1ZSYA 2W90A 5I8WA 4DUGD 4JQCA 5FNVA 4WINA 5G1PA 1PAUA 4N5LA 1X3SA 4DT1B 2EK8A 5TB5A 2ZAOA 4UQPA 5IBPA 1Z6YA 1QVVA 3LC0A 2NU6A 4PC7A 1X74A 1Z18A 2AFRA 2EVWX 4AJPA 2XNKA 4NFSA 2JD2A 2M32A 1GSOA 4INPA 1HE3A 4RCZA 2R6FA 5D5PA 3VOSA 3WGQA 4PG7A 3I64A 1U0RA 2YY5A 3E15A 3IPXA 4WKCA 1U1EA 1AUPA 1UQTA 3MBOA 1CETA 3MLEA 4ZZ2A 5IYZF 3P2OA 1KEKA 4RPIA 1CUCA 1W5TA 3AY6A 1Z2EA 3GPIA 2PS1A 2Z8YA 2IY8A 4Y98A 4NH0A 1ONNA 3ZWAA 4WN9B 1TZKA 4IXTA 2YRFA 2BMFA 4ZA2A 3VC3A 1A2QA 3X1DA 1GZHB 2RGGA 3IEXA 1IZZA 3TIGA 3PYXA 5IU6A 4AY3A 1SG0A 3BEDA 3Q72A 3FIUA 4J3NA 2PX2A 1Z6XA 2AUTA 2WF7A 3PGVA 4RVOA 3WBBA 1QZ3A 3BFVA 3OOJA 5I8ZA 4YMLA 1S2LA 2D62A 1GL6A 3KQPA 4H7PA 5HFNA 5BSTA 1KZ1A 2PWPA 1RIIA 1X14A 1K5DA 2NTEA 1T1SA 3AU9A 5KVCA 2WHPA 4WZZA 2WKPA 2X5KO 4OREX 2PWAA 1L5RA 2Q29A 4NBNA 3IMKA 4I66A 3OCYA 3T7RA 2NSYA 3EZ7A 5A9TA 4FUQA 1PK8A 2I4LA 3EN0A 3FUVA 4ND1A 2WUWE 4MI6A 4RH3A 5EHGA 3SYRA 4HZUB 2EBFX 2DU8A 4J0QA 4Q9HA 3HYNA 1JG1A 3Q40A 3MC1A 2P2NA 1N0UA 4O2BF 5DNEA 3QBTA 1NY5A 1D6SA 1OTXA 3S5UA 5ARBA 3QPVA 2IFTA 4QELA 2PL3A 2PZKA 3FMFA 3WMEA 5LSAA 3TE6A 2OGZA 1HRKA 3K70D 3O8DA 5DNCA 2NWQA 3P96A 2VA8A 4PICA 5MN4A 3KZXA 2YYZA 1G5HA 4DL9A 3L7MA 2PRKA 4WY8A 3VKHA 3IA7A 5DHRA 1D9XA 5ERXA 4MVYA 1NXJA 2XMQA 3F2IA 1F6WA 2H7VA 1XMSA 2PUVA 4L6IA 3GRUA 4MCIA 5DGXA 5J5CA 3RRZA 1GG5A 3UUEA 4NCJA 3B48A 1G0NA 5I7EA 1ZM3A 4RESA 4JXZA 3B6ZA 2WU1A 1OI2A 2FOXA 2AN4A 2RD2A 1FDRA 5BUQA 1ECPA 2XB2A 2QZ4A 4BNIA 4WZBE 3CLVA 2WJWA 4RMJA 2I6SA 1J8FA 1TE2A 1P7YA 2OLEA 4QXPA 4V3CA 1N2JA 2YZ2A 4RABA 2WF6A 3WL4A 3LVFO 1N2CB 3M1AA 4TVOA 1ZIPA 3WLNA 4JYMA 3OZWA 1H4QA 2H06A 2C5LA 2RKWA 4L9WA 5THXA 3WXMA 3BBLA 4FN5A 1G0OA 3PRYA 1HZZA 2OV1A 1P74A 4XFKA 4D9JA 3NH9A 3E8MA 3Q9UA 1OZHA 3CR7A 3G8CA 5ARDA 4AJIA 1OYVA 3FPJA 3I9MA 2NVOA 2XGOA 1KQGA 1JG6A 3IMCA 1RACA 2O1SA 5JXGA 3W7AA 1R64A 2K7ZA 1XQYA 1Q7EA 1K7SN 5ALMA 3A37A 4O4JF 5L3VA 2ERXA 3TG8A 1ZXBA 1QQ6A 1QQTA 2J0QA 5JQGB 2PCLA 2HZ7A 3QPAA 4KHZA 1RXEA 3N76A 2C4MA 3DNMA 2Y99A 4NEGA 2ZJOA 4XI9A 5DXAA 1OJ7A 2EWWA 4PCAA 1IU9A 3FUWA 1Z5UA 4BBZA 3ZU4A 1R4NB 2OHVA 4TMWA 5K0LA 3A10A 2JJYA 2PSSA 3FDXA 3FJYA 2IHVA 1QIGA 3PGKA 3QVJA 5I7UA 3NR2A 4OP3A 1VHWA 3T7IA 2C1EA 4O1HA 4J94A 2EX1A 2ZTHA 3WGNA 3AEQA 4V3BA 4AMGA 5D51S 2PXAA 2HX1A 5C1OA 4RKWA 3RK1A 1G60A 3OLYA 5EKTA 2P9QA 4MV0A 3BGSA 4IQ4A 3R76A 3T35A 2XTNA 4W5RA 3D7RA 1E1RD 3O4HA 5TVKA 3LRXA 4I3HA 4YT2A 2PBFA 2UUBB 1GV1A 1WO8A 4FEEA 5CVTA 3OZSA 2EW2A 2CY0A 1H3EA 2XITA 3GL9A 5BT8A 1NJ5A 2ZI9A 2ZUBA 2VHQA 2HJVA 5TR9A 4H0NA 4OHFA 3DC7A 4TT3A 4FMBB 4B74A 3FYCA 2A5FA 3PFHA 2XA2A 3DJFA 4QBGB 3OZEA 1LBHA 4C7KA 4M83A 4XR9A 4EHFA 4GKBA 4RULA 2FN8A 1EM8A 3BZUA 4FQ8A 1NW9B 5ECGC 3D0QA 4EUFA 5H16A 4D0GA 4DJEC 4O0LA 3KWJA 3NEJA 1T6XA 2ORWA 5KNBD 2G17A 3EY9A 4W9NC 1Z47A 2ZS7A 3GEDA 1B43A 4QDUA 4GOND 4W7SA 3TZ6A 1LLQA 2ASVA 3Q5EA 3UAZA 4DB2A 1DIOB 1ZRMA 4HQKA 3Q7TA 4TLCA 4LKOA 1OAKA 3GFRA 4OLHA 4QATA 4IJ5A 1D7AA 3VYSB 3GAZA 2GESA 4I46A 3CLRC 1T6ZA 1WHSB 3SDZA 1VG0B 1Z0JA 3VHLB 4KFCA 3G0HA 3QELA 2HUPA 3GZJA 2BFBA 2JL1A 3IUJA 5B4VA 4GNKA 3ENZA 4MV7A 1RYYA 4AO6A 3IDAA 1G7TA 1JR2A 3ZBTA 1OFTA 1TJYA 4Z4FA 9MHTA 3QKRA 3ZXSA 4J0CA 2Z6QA 3ER6A 4MEAA 3DNPA 2QYSA 3MOGA 3WGZA 1APBA 4DV0B 1LH0A 1XYYA 2QW1A 4PHHA 5E8RA 4P44A 1PIWA 1Z22A 2XH8A 1LU9A 2XNDA 5C7OO 3BSWA 1J23A 3KKNA 4NNPA 4Q02A 3W05A 3U6BA 2JFOA 4RPGA 5DBOA 4HH4A 5A6SB 5MGNA 2D0OB 2NV2B 3LGXA 5KKNB 1U1FA 4D3XA 1UDBA 5EEGA 5L45A 2Y05A 4IV5A 3VSDA 1E18A 3IILA 3JRXA 5MFZA 1DE4C 2D5LA 3E1KA 4YJGA 1BE0A 4CW7A 4JP5A 3NFYA 5IWCA 1PV4A 3QQPA 5SYNA 3CWQA 4UBJA 2AQKA 1FVXA 4O3MA 1SO8A 2BHNA 3T7KA 3BK7A 1IHPA 2YV5A 4U7GA 1KJNA 1YB2A 1DQYA 3ANMA 2EWVA 3ZK9A 1QUEA 3NANA 3T99A 2F1HA 4HAIA 2BKXA 4ARSA 5EEHA 5EC8A 5BWLA 2HA6A 1MOZA 1ZD5A 1E9DA 3WOHA 4E22A 3OTHA 2Q4TA 2HPAA 3D7GA 1FFSA 1NBOA 3PPWA 3EZLA 4IJUA 4TN5A 4H9GA 2DCUA 3VNSA 5JVDA 1DU4A 4BNHA 3F0TA 2HU7A 3IMGA 1PHRA 2FPOA 2ZVQX 1XHLA 3MJVA 1QB8A 4BQNA 1ZVJA 1P0PA 1OTHA 2NAPA 1MW8X 1DAOA 2SCUA 1BXKA 2WM8A 4DR1B 1LXCA 2QTGA 5CT5A 4LHWA 1F9EA 3JYPA 4XUGB 1DELA 3I6YA 421PA 4C1NA 4AN1A 3F6PA 4DV1B 1ATZA 5LUBA 5E0KB 2HHLA 3I76A 1O3YA 1J0XO 1U90A 4MV5A 4Y7CA 4Q15A 3NIBA 1YRYE 4C03A 5BSVA 2QLTA 1QO7A 1CEYA 2F17A 5BRAA 1DHRA 1GQFA 3THRA 3AXTA 4F0JA 5KX5F 2JIDA 3FYUC 1DEOA 2JGMA 1UPTA 5LC1A 2YCBA 1JQ3A 2XADA 3ZNQA 1YS2X 4FJ1A 3HA3A 1J07A 1JDBB 5L3RA 1CDEA 4C4RA 5A2GA 3FEEA 2JFQA 2C59A 3U4QA 1CNMA 4CEJA 5CFNA 1L1RA 3WKEA 3DR3A 2BFWA 3T3OA 3QYJA 1F51E 1VHLA 3IE0A 5K3FA 3EVCA 2A86A 3FUCA 3WYGA 4BU1A 1CYDA 3AGPA 2CYBA 1F60A 3NPAA 4MRMB 5ALFA 2HHHB 1T0BA 3ELWA 1RKXA 1SM4A 4KVAA 4DY4A 1E6LA 1VBGA 1SUBA 3UWSA 4OKIA 1FU7A 1EK6A 1NI4A 1EXNA 4OTZA 1DG9A 1L8XA 5C8ZA 4OQZA 4Z0TA 4CKYA 2DFPA 1PEDA 5E9JA 4G63A 1PUXA 2ZSHA 2IU0A 4DV2B 4HFMA 1CZRA 3IALA 3AVOA 2AJLI 1KI2A 3AP3A 3WRYC 5F98A 1OGIA 3E0XA 4M0PA 4YRSA 1CUWA 3NIDB 3CKLA 4IZOA 1I24A 3F98A 3M49A 1VCIA 4MO9A 3OJXA 3GZNA 3VDNB 4AJKA 1M34E 4KC0A 5EGSA 4ENTA 5CT4A 3HDGA 4J1SA 5EJ9A 2O6HA 3AEZA 3H0EA 3PEWA 2BM8A 4TM8A 1Z13A 5K3OA 1DRWA 3U62A 4PLZA 2PUBA 4GU5A 2AI1A 3FLAA 4XEHA 2ONYA 4KWIA 2IW1A 2BV3A 1UMDA 2OFWA 5I4CA 3U7JA 3K6JA 4Z4EA 3JWHA 3FA2A 4ILKA 4BN5A 3NM4A 1U94A 1KJWA 1ABEA 2KI5A 1P75A 2JIQA 4CG2A 5HSGA 4UXHA 1Q6ZA 5D7NA 5KINB 2AVNA 7GPBA 2IHUA 3A1WA 1B26A 3UUGA 2WLSA 1NULA 1JGTA 3GVIA 4Y9DA 4R1UA 2K6GA 4EUHA 4G4JA 1YZVA 4TTSA 4DCUA 3H2HA 5IAGA 4WFKA 1QFMA 4NKRA 3T7DA 3MJ4A 4UAUA 1FZTA 5ULLA 3LVQE 3I5XA 3COJA 5EIOA 5D29A 5JO0A 2AYZA 2PX4A 4G36A 1TTTA 1EZBA 2H4WA 5LVAA 5JSQA 1J00A 2XNCA 1Z5NA 3KSAC 3HXOA 4Z8YA 3U3RA 4BLVA 4A15A 5JI2E 2RARA 1VE9A 2BEJA 2ISCA 3AT1A 2P77A 3EXHA 3K3PA 3MWDB 1CB7A 1XHEA 4OB7A 4PZDA 4RY8A 4A6XA 4ZO4A 4DKXA 5DP2A 2WFMA 1IEVA 4NESA 2CFTA 1NOKA 1O54A 5TMDA 4UNSA 3CRNA 3O3CA 2RHJA 4I4TF 3VO9A 3WKDA 5EWJB 4ETMA 3HKDB 1EVJA 1THMA 5HCIA 3P9IA 3H1AA 4A8TA 4J0FA 5A4JA 1PN3A 2AHRA 2CWWA 3I74A 1XDUA 1JYFA 2WT4A 2XV1A 3AR5A 3HRKA 2UVPB 3HZZA 3PGLA 3QZUA 4G4IA 2XHZA 5DN6D 4F6RB 1SKBA 1O6CA 4ZC1A 2AFHA 4LYHA 4WGGA 2H5JA 5KQRA 1E2EA 4IJKA 4PBSA 3ZDZB 3D81A 3F1KA 1QYXA 2BM9A 1F4VA 1NVKA 1WRBA 2YFKA 1CVLA 3RUAA 4X65B 4S12A 1W85A 3T7SA 2QI9C 1X3LA 3K5WA 2JBJA 3ZQJA 1JT9A 1Y7HA 2B92A 5JAQA 3UAYA 3L4SO 3A6LA 2B99A 4NL4H 4GWGA 2P69A 2QEQA 3R3XA 4UM9B 2WTBA 5M04A 4E5MA 3WGGA 4CGYA 3PTAA 3GT4A 3AM1A 1H66A 1JDTA 2REBA 4DQUA 1YQUA 1Y3AA 2JCSA 2CXUA 3AHIA 4IWXA 1MW9X 2W2VA 3NS7A 5JJKA 2BDEA 4P38A 2IV3A 1IPHA 1KKLA 2OQRA 2ZIGA 2PLNA 4RGVA 1QHGA 4HN2A 3UOWA 2A0FA 2HJGA 1WXQA 3JQ8A 4HNAA 4RC9A 1KAGA 4TXLA 4OH7A 3T0IA 2Q4OA 3KSMA 3NDBB 1NN3A 4KVFA 3L7LA 1DZIA 3KPUA 3S2ZA 3V4RA 1YZYA 1OOEA 1SRRA 2A35A 1WP9A 1YE3A 4JWKA 4N5MA 4NMWA 4A3SA 1U8XX 2Q4BA 4B2PA 3COZA 5ALOA 2VOEA 2V7BA 4MR8B 3VR1A 5DM60 821PA 1ODSA 4MLZA 3QVOA 2FSPA 4MS3A 4QJIA 4UU0A 2FSGA 4EMBA 4JZYA 2YOGA 4HAXA 3W34A 1CNEA 1SXJA 1Y3CE 2GNPA 2WWHA 1UFQA 2QSUA 3NI2A 2C4NA 5DBEX 5C8YA 4M9QA 4QDOA 4GGMX 4CCWA 4JXXA 4PYMA 1UINA 2GBLA 2JRCA 4FS8A 3O2SB 1DPFA 3VPHA 1VG1A 2TRSB 2HF9A 3I01M 1KO4A 5HEKA 3R4VA 3A1VA 1G4UR 3INNA 4JVOA 4HWRA 1E1KA 1UEJA 4TSKA 4Y2YA 1XDDA 2DJIA 3K7EA 3O7MA 1GZDA 1Z4OA 2BW0A 3VZBA 2C7PA 2FQXA 3OBIA 4ZCQA 3M1YA 4L7VA 2Q3MA 5HMMA 5A06A 4KODA 3V33A 1BAPA 2REQB 4F2DA 3K8QA 3I8XA 1JIUA 5DMHA 3UFXA 1CY0A 1V5WA 3AZOA 4WOKA 3FDZB 3H5RA 2B8JA 2YN0A 4ANFA 2I22A 2XBUA 4I55A 5EAIA 2VF2A 4G9EA 1DB3A 1QGYA 1AKYA 5B3JA 2NW6A 1R1DA 1RDFA 1UP6A 2NNLD 2PH3A 5BVGB 5C32A 5CM2Z 2BGMA 2Y9PB 2B1JA 3C7CB 1FTNA 2NOAA 3CINA 2PGLA 3PQ8A 2ZSIA 4JH0A 2F1JA 4N9QA 3TLEA 3N1UA 1CP2A 1JE0A 1CHDA 4DZZA 1RKQA 2AMFA 2E4WA 4KE7A 4INJA 3EZNA 4C0AC 3BTUA 1LSOA 3PJFA 2IXAA 4JT8A 4C2UA 4RIFA 3LGSA 4MMZB 3UMSA 5HWSA 1U8UA 4W99A 2WIJA 1QANA 4F2PA 1OHHD 4JUIA 4WCFA 1UJCA 4MB2A 1W8DA 1XTRA 5HK9A 3U4HA 1Y9AA 1I30A 2C4WA 4CCAA 3NV7A 4BQOA 2A8YA 5IN5A 1XVIA 3G1TA 4JC5A 2D7JA 1MN6A 3JYLA 3PWSA 4QJ4A 2PT7A 5E6UB 5JZMA 3VR6H 2ZBUA 5IC6A 5GJWC 5AW4A 2G9UA 2BM0A 3CJRA 2G7MC 4MPDA 4OO3A 1EIWA 3KCQA 4JC4A 4UQLA 2CF6A 4RMIA 3G2QA 3B1JA 1UXKA 1EFRA 2QG4A 3ED5A 1U8FO 3MT9A 1YDMA 4EFDA 5CFLA 3U19A 2IYZA 4H16A 3ZYCA 4EAAA 2WNSA 3LE8A 1K6MA 1YRAA 2H1HA 3BT7A 2O8BB 4NZ9A 3ZY5A 4ENUA 1LVHA 4M38A 3G7UA 1QQ7A 1PKXA 4O8CA 5B5SA 5CD1A 1TOAA 3QXGA 2C00A 2V7GA 1V5IA 2IHJA 2VPZA 3AEKA 4NQZA 4OL0A 1HTTA 2I0FA 1BQ3A 1H3NA 1M6HA 1UXHA 3GA7A 3B38A 3HJBA 3T61A 1JI3A 4WTOA 3SJBA 2HMAA 4GT1A 3UJAA 4AJNA 4BP8A 2A0WA 3D4BA 4FGZA 4I9NA 1MPTA 5SICE 3U4DA 3TVYA 2BSXA 3MUFA 1ENPA 2LKCA 2VUIB 3ACCA 3EPRA 3KYCB 3DMPA 4M21A 2VLBA 4OFWA 1P33A 2F3RA 2YXDA 3K15A 2GVNA 3CZMA 2HIGA 4HXFB 2I66A 2PBLA 3V7UA 4BBAA 3IVCA 3Q8XB 3GHYA 1CD5A 4HQ6A 2A94A 4XPIA 2YFHA 3D3NA 1EUCB 4LYDA 3TQTA 1LRLA 2OM2A 2QUJA 3GELA 2ZJ1A 3DOCA 1C7EA 2HQSA 4LRXA 1H4TA 4ZVLA 2WJPA 2GH1A 3N0XA 4EGQA 1XAHA 2W6OA 2ZUWA 1AKUA 2WF8A 3ZW7A 4FB4A 3ESDA 5K3DA 2DLCX 2Z5FA 1KZ7B 2QRZA 2UZ1B 4CJXA 4KITB 4XM2A 4JBLA 4R68A 3REQA 1V25A 4IXDA 4TXJA 4V2IA 5TMBA 3TWOA 4X8HA 2XCOA 3EFBA 5IAJA 1DNPA 2XNHA 3HA7A 5ALQA 3NHBA 2V5UA 3LP5A 3R44A 5HR5A 2V74B 3ZY4A 5HHTA 4V0OA 2GP4A 2QE7D 4LEIA 3WO0A 2IS6A 1BWPA 5JPDA 4H6WA 1MU0A 2E49A 3PUIA 3PXDA 2B35A 4TXMA 2ZWVA 4HDAA 3URMA 7ABPA 3GIWA 2J5BA 2MJLA 3OT1A 3AHEA 4MMYB 4IQGA 1YL5A 1ULZA 3BH6A 1T34A 3NUQA 5B2ZA 4XAQA 1KSHA 2PS0A 2QM3A 4DEXA 4FDUA 1JG2A 1Z33A 2J87A 2QL5A 2ZW9A 3OWOA 3TRIA 3DOEA 4KU4A 2GGSA 1E2HA 1EFKA 3L6OO 4QU9A 4C3OB 4IVNA 4EYKA 3JZIA 2AW5A 2OC4A 3PVZA 2ICAA 3IAUA 4TWJA 2XUJA 3WRVA 1VHTA 1D3AA 2A14A 3KL2A 5IFKA 1K4YA 1A50B 1G1MA 3KL4A 4J3JA 3C3KA 4XB6B 3U1BA 2ZIAA 4F3KA 4CEHB 1W7AA 2OAP1 4KXNA 3IKMB 2LUOA 3CTPA 3LQKA 4LYEA 1GGHA 1EVKA 1K7XB 1X8XA 4RUKA 1OX4B 3BD9A 3NYRA 4RSGA 3ZZTA 4J8PA 4JBXA 2Q62A 4DCSA 1OREA 4GRDA 3QFCA 3BSYA 3I6SA 4ZEOA 4C4SA 1FXWA 2HEGA 3GMDA 2GA9A 2YH2A 3PI6A 4O8ZA 3UW3A 4AQYB 3K9HA 4BAUA 2O5EA 4BX0A 1OX6A 4BC0A 4KO8A 1G63A 2A88A 3E2IA 1GDTA 1MXHA 2ZI4A 3RIYA 1ZH2A 1GPUA 1KK2A 3FPGA 1NMSA 1P7WA 5DTEA 1R6TA 4OQNA 3NFRA 2BTOA 1WDWB 4N6NA 3LUFA 5TT0A 1LDYA 2FMTA 4LJ6A 2EQAA 1E9CA 3VKFA 2GCOA 5HBGA 4GKJB 2ANCA 3STWA 4F4HA 1FFWA 3DA8A 4I50B 4K81B 3DEYX 2WMDA 4NG4A 4GXNA 3ELUA 1OXXK 1ZYMA 3NATA 4RQTA 1LSJA 1TNDA 3FPSA 3UMYA 1EE2A 4N3AA 1KZ6A 1O96B 4YBZA 1ZHFA 4ZCSA 2Z2XA 4I4CA 3GGOA 2QRGA 3K9FC 3NP7A 3IDQA 1I36A 2OZEA 4MIKA 1RNLA 1UIRA 4FCWA 1OC4A 2FPIA 4HRXA 4P2BA 4RF4A 2FSVA 4M98A 1MC4A 3U3MA 3KQWA 3OA0A 1KI7A 1W59A 4BATA 4NPHA 1V1MA 1OLXA 2Y9MB 3A58B 4JLBA 4PHFA 3WLQA 1NMQA 1UJ5A 4F92B 1Y1KE 3DOOA 3QU5A 3EVNA 4EX7A 5LXTA 1D2RA 1Y8RB 3MWYW 3R5FA 1QRSA 1CF4A 1T5HX 3D3KA 5K6RA 1VJ5A 2CZQA 3E2PA 1TLFA 3GDFA 2IXGA 1AT1A 4FX2A 1LRKA 2PTHA 1IB0A 4FJ0A 1SR8A 5LBTA 2VG8A 5FWXB 3ZDQA 3WGJA 3WMRA 2DH5A 1ZZEA 5JNTA 2WM9B 4B4KA 1VE1A 3AR9A 4ZVVA 3C4VA 1QWOA 1D1TA 1E2FA 5JCZA 4GC5A 4HG2A 1G17A 1CQIB 1OVGA 1V35A 2YNMA 1V3VA 3AGQA 1S01A 4KDFA 5T8KC 2VATA 4BO1A 4BQIA 3FBWA 3L04A 4D4KA 1WDTA 1HR0B 1RKBA 1Y33E 2CHEA 1W2WB 2CXNA 2BGNA 2OCLA 1P4HA 4MQ6A 3OZRA 5F3DA 4AWAA 2CV1A 1A88A 1VGQA 2CLSA 3GH3A 1MAWA 3TNLA 1XDBA 3T8YA 1H8ED 1ISIA 4FMCB 3VDXA 2E2WA 1QIHA 4JROA 1L1EA 4ILEA 3QX9A 1EK5A 2WNHA 1UWLA 2K4MA 2V5AA 4MV6A 5K6AC 2C57A 1E1CB 1TFRA 1FUKA 1KI6B 1UFKA 3G5AA 3I9OA 4MVXA 2NO9A 1JEQA 4O63O 3GLFE 3VKVA 2AX3A 1EK0A 1SC6A 3KBOA 2AC4A 1YASA 5B37A 4IMRA 4BXOA 2A78A 1WVGA 3L84A 3C0KA 3KR0A 1D8AA 5A71A 1KS9A 3UAVA 1GTL1 2W6CX 4V0SA 4F4DA 1T8YA 2PH1A 4U7TB 1HDCA 1ZNQO 3Q6MA 5AHWA 5FBWB 3TG2A 3FHLA 3G89A 5BV0A 1N1MA 4AUEA 2GK3A 5G4KA 1MUUA 3TOVA 2ZRJA 4C22A 1I1OA 4G1CA 4RPJA 1K6JA 4AUNA 2QRMA 4QVGA 5K01A 1KNQA 2W00A 4HPJB 4B4WA 2UXDB 2G25A 5E1MA 1HNNA 3EZBA 1CUUA 1XRLA 1YVRA 4YN3A 1WXFA 4YWHA 2YWDA 3G0OA 4ID3A 4R1SA 3FZEA 5IB9A 2M6RA 1ADBA 3D5EA 2X58A 2E21A 1J8QA 1QPGA 2GTHA 2WC1A 1NTOA 3OU7A 3TMKA 5JH7F 4IHJA 3FMPB 2H4YA 1W76A 5ED4A 4HGYA 3WMGA 3ZEAA 4MDEA 4K9KA 4RLSA 1XEWY 2HWXA 1N3LA 2WTMA 5K3SA 2NSHA 4O33A 1N2SA 4G0XA 3H6KA 2P40A 3WBKA 4UEKA 5DTJA 3W4JA 2IEYA 1L5KA 3PE6A 3AIIA 4NXMB 3TGLA 4TJXA 1VG8A 2C78A 3DE2X 3E7PA 1QV9A 3OF5A 1NN1A 1Z38A 2Y67A 3MF4A 5HIKA 3OWXA 3UXHA 3O8CA 3OJCA 4OY3A 4CQLB 2ZJ7A 1HEUA 3D8HA 1I32A 2EEZA 1T0IA 1XN1A 3KFVA 4ZARA 1EVLA 1SELA 1W9MA 1JEOA 4EPXA 4RD1A 4NV1A 1TA4A 4H60A 4P3OA 3QXHA 1WWKA 2PKYX 2O2EA 2WU8A 5CPBA 4YJFB 3DDWA 3FFXA 3ZG6A 3ZVKA 2PT9A 1K2WA 1B4DA 1SVWA 1N5KA 3C98A 3FKJA 3ICQB 2XYVA 2IS1A 1XWWA 2VQ3A 3ITKA 4TRMA 4HF7A 5KTRA 1E58A 1JJIA 1Y1PA 2XTAA 3JQGB 1WLSA 3M89A 1H2FA 4LW8A 4OSOA 3TW8B 2QL6A 4WUTA 4G0WA 1TLLA 3FCAA 3NIFB 1QLHA 3QPUA 4XRRA 5CA0A 2OYCA 1AGRA 3VOBA 2WQZA 4QTYA 3IIJA 4C99A 3I9LA 5HZMA 1W8IA 2A84A 4FINA 1HL7A 1XZNA 4FXPA 2B8WA 4LS3A 4RH1A 1G291 4UOQA 1YBAA 2ONKA 3K4QA 5FNVB 4B3CA 1EMDA 4IJQA 5BRJA 5EE9A 3B1FA 3ZXXA 1W0CA 2FWJA 2HSZA 2Y1WA 1FFBA 1R0XA 1K98A 4FBGA 2HJHA 4LDQA 1TMOA 2HIHA 1AK1A 2NU6B 3TD9A 4FEAA 4PR3A 4ZQIA 2ZI6A 3VR2D 3QJYA 1FCJA 4HDMB 4CDJA 4QYWA 1L8LA 2Z4TA 3LF1A 5EINA 2PD6A 3S44A 3MMXA 4DLZA 5KS2A 4L2IA 3UMRA 4C14A 4YUXA 4ISBA 1R0SA 6YASA 2JS7A 1SJ9A 3I12A 5J2UA 3B1VA 3ANTA 4BO0A 4JLPA 2H17A 3ZUPA 4PBRA 3N8DA 5H68A 1C0KA 4LGCA 3V42A 3LP8A 3I6MA 3M81A 4XD7D 4ZHQA 1JWBB 2FLKA 3NTVA 4R2WA 5LBIA 1NRIA 2IZ1A 2QTRA 2B34A 3L49A 1OU4A 2FPLA 3QUTA 4X6LA 1ZMXA 4FYVA 2L42A 1KJ8A 1WL8A 4Z9FA 4C43A 1BN7A 1UWVA 2EF0A 4FWBA 4YCSA 3U7FB 1RQNA 5LUAA 3SZRA 5FBKA 1QTRA 3PGMA 5KHAA 3VTFA 4OK3A 3W2TA 3DBLA 1TL7C 4A6PA 2WHPB 4I4IA 4WFJA 3NPMA 4P8RA 5MN5A 4RJKA 1T9AA 1P2VA 1TLTA 2AG5A 5HOQA 3SIPA 4EF5A 4HRVA 2GAIA 1E3QA 5E7MA 2I2FA 2NVBA 3QQ5A 4NIMA 4JZ0A 4FZ3A 1ZKMA 3DE5X 4L74A 3PUHA 4DEYA 4R7TA 4HP8A 1MB9A 5L7YA 2VP6A 1JDVA 4L76A 3NGXA 1VLVA 1HE8B 4UZEA 4QUJA 4DLUA 3QFRA 3FR7A 4BB6A 1X1RA 4P5EA 2DBQA 3D54D 4BGUA 1G5FA 1RJFA 3MMPA 2JIBA 2P2DA 3DL4A 4B48A 4O29A 3AV3A 3TRKA 1YULA 4PLWA 1MB4A 1HYEA 4YRQA 4UTOA 1YRWA 4HB2A 5IKXA 2ODPA 1ZA2A 4OHVA 1ADCA 3GCDA 4L73A 1NW6A 1I3LA 1M2EA 2E6KA 1XRMA 3G1UA 5DHTA 1ZOPA 2IWHA 3RFTA 4DRXA 1IBKB 1UDCA 3ZLTA 5HKAA 3PWTA 2CB0A 2CBXA 1N25A 1HC7A 1S3IA 1NF2A 1SU4A 2X3UA 2Y1KA 2H2GA 5GM2A 1SC9A 3DB1A 3ZHYA 4X45A 3N2GA 1H05A 3VR4D 1BNCA 1YDFA 5HUJA 3UHFA 5JNRA 4JUAA 5CK5A 1WW8A 5H3HA 3IP3A 3JAWA 5ALGA 2G9ZA 4CMBA 3S7ZA 2QYTA 2CNDA 1XAIA 1MG5A 2V65A 3U9SA 3CO5A 4F5DA 6ADHA 4TL9A 1CCWA 3GCWA 1E96A 4IL5A 2HHCA 3NYQA 1E79D 2VWQA 4EWLA 5J4YA 2JANA 3PWKA 4L4RA 4D1YA 3KQLA 3NWPA 3HR4A 1VP3A 4ACBA 2GBPA 2ZVDA 2B7LA 3K32A 4GPTA 1BJTA 1SK9A 4P2GA 2CL7X 3TO5A 3U3XA 3BHXA 3DLPX 2AEEA 1Q91A 1U0NA 4L9RA 1I4LD 3G8BA 1LY1A 1MXFA 3GX1A 3K53A 3M6WA 1F8XA 5JDCA 1Q95A 1T3HA 1KYZA 1NRJB 3BULA 1SG9A 2HU5A 3F5FA 4JFRA 5LKAA 4JX9A 1FFAA 2I87A 1HQYE 5ALRA 1ID8A 1GVHA 4RJ2A 3VNQA 1CSEE 1M1NA 1QYWA 2WPNA 3MMZA 2XDWA 3PHBE 4RZQA 4XH9B 3ZK7A 4CYMA 3O3OB 4JLAA 4KN6A 1NQOA 1GITA 3HCBA 3NXKA 1Q20A 3PNKA 3PQFA 4XUDA 1R8YA 2SNIE 3N8HA 4EKIA 5EJ5A 3A3PA 2ZUSA 4G9BA 3USCS 1KPHA 4QYMA 4N7BA 3BB3A 2JF0A 2P2LA 4R16A 1U6JA 1K6EA 4R5MA 4XGQA 3TQSA 1NVFA 3HBFA 4G5RA 2XCRB 2ZJ5A 4MWCA 1J1UA 2DEUA 1K08A 3ASVA 1QBKC 3P0EA 4IGEA 4RQAA 3WJ1A 4MI9A 2VDWB 3VUFA 2B1QA 3RVNA 5DSZA 4X7PA 4DM7A 3HUTA 2GUGA 2GZAA 2GHTA 4H6VA 4FK8A 4HATA 1D2GA 1UFOA 3KR9A 2HEIA 2GLUA 1RYHA 4DCOA 1C9KA 1LNZA 3UMBA 1JQAA 3S29A 1MFZA 3I6QA 3SG0A 5AD1A 3ESZA 4KQEA 2JHFA 2IZ0A 4KEAA 4P0QB 4MIEA 1H5QA 1FUIA 1TD1A 1CRWG 1XCLA 2QENA 5LIPA 5KTSA 1EM8B 4KLAA 1B23P 5AK5A 4IF6A 1WULS 3DO8A 4MX8A 5KCMA 5AW1A 1LLDA 2BFEB 4HLUA 5ICMA 1KF0A 5FBVB 3TSZA 3KKMA 2FZEA 2BVNA 1XMXA 4YT5A 2H2AA 3IRUA 2QGZA 1OQAA 3ZK8A 4PX5A 3TEJA 3GROA 3U16A 1SVIA 3NHZA 1YFJA 1ZRHA 4LXYA 2FW1A 2KQUA 1U0BB 1T1EA 1JHDA 5JAOA 3LBNA 2OAGA 1N0VC 4AJEA 3H1GA 2EFJA 4O2AF 1TI7A 4LV6A 4QU0A 5DI9A 3WNBA 3QELB 2WSLA 1KYIA 5CLHA 2BFBB 5AW0A 5AI5A 1JE1A 4G89A 5CIYA 1PGPA 5JQWA 2P2ZA 2AKYA 4AP5A 2D6FA 5CUQA 4P0TA 3OD5A 4KR0A 3TI7A 1X2BA 4U0KA 4BQEA 4CQLA 1YA6A 1C4KA 2YN4A 3LWZA 2D7DA 2C3OA 3PHIA 3MOIA 4IAOA 4C6SA 2BGUA 4BX9A 2A7QA 4TRNA 2YXLA 4EHLA 3H97A 4AS2A 3DVSX 3FI0A 5DI3B 3ABSB 3DWIA 4B9EA 1FYWA 3EZ2A 1C1XA 1F38A 1VRWA 3W6UA 2YRXA 3KE9A 1HDIA 4MVJI 3ZBPA 2BE7A 2R5NA 4R05A 3WMFA 3OOSA 1TPZA 1IONA 1D0IA 1NLMA 2BGRA 2P78A 4YJGB 2AVDA 3K6SA 3C3JA 2AZ4A 2NV0A 2C1XA 2P5SA 2SKCA 2ZRDA 3CS3A 1CY8A 3O31A 1P1RA 4P3PA 4PYIA 1CBUA 4QU8A 2B5OA 3NCTA 4A6DA 1WSAA 1GRNA 3NBXX 5CXSA 5D01A 5F51A 1A1VA 3RJ9A 3LA6A 4K6FA 4XIYA 1UM8A 2YJTA 1XU9A 5C2JB 5FOTA 3J7AC 4KWTA 1U2ZA 2O5RA 1T5TA 3FUXA 5BRNA 3R7BA 3AL3A 1RLUA 3DMFA 3HKCA 3T3NA 4Z4GA 1D6MA 3HFRA 3N59A 4Q1VA 4R4JA 4RLFA 5DHAA 1EK2A 3BE5A 3I04A 1OLUB 1EGMB 2QG9A 3ORYA 1GARA 1UBLS 3AWIA 3QF4A 4QSMA 3ORSA 4QQ8A 5KJEA 3ROFA 5TJ9A 1SBYA 5JVDB 1EBUA 4X00A 4L5AA 3VR5D 1SKMA 1Z2OX 1P81A 3O94A 4ZYWA 5JHHB 1TW3A 1GUYA 2J6HA 3NBMA 3T5CA 3R6TA 3VNVA 1AHHA 2SCUB 4UUAA 3IAM1 1MX5A 2GN6A 4GX0A 2Z6AA 4HDOB 3RQIA 1IB6A 3VC7A 5BQPA 1J56A 1DJOA 3ERCA 1KO7A 2JFHA 3VNAA 3UFBA 2HCFA 1GN8A 5KNCA 4W5QA 3AINA 1LQTA 4CM9A 3KQYA 1VLMA 2RH8A 2XE4A 2RGNA 2XWJI 1OWPA 4MKHA 2BCGY 3L8HA 3MAAC 1KK1A 5AK0A 4R71A 3ECCA 1MEEA 3EPPA 3QITA 4ITUA 4OF4A 2BRUA 1PGQA 4UCWA 1DUSA 1A9ZA 3MMSA 1PNQA 1W35A 3RYCA 3I9JA 4M49A 3R3WA 1M2FA 4DTCA 1M1UA 2H31A 1XZ8A 4PC1A 16PKA 1KVTA 2I6TA 5ER6A 3FTFA 1E69A 5C1DA 1GYPA 5GAJA 1NAHA 4K26A 4HXGA 4CEJB 4BNVA 1W49A 3NJRA 3V4FA 1ZHOA 1JQ5A 3FROA 5I45A 1UJBA 3LDFA 4IXNA 2CLCX 4AD8A 5K3FB 5CR9A 1M0WA 3SFVA 2IE0A 3ZJYA 3ZZMA 2PIAA 3K1ZA 1NNLA 1XZAA 4AW9A 1NUAA 2IPMA 2Q5CA 3BD6A 1KH3A 1KDVA 4DE5A 4KE9A 2PLWA 2OD2A 3C1AA 3B70A 4NCKA 4RENA 1NI4B 5ES4B 4UU7A 5CM9C 2PWYA 5CDGA 2XOKD 3KOYA 3OM8A 1L8QA 4PZ9A 3HC7A 3E6AA 1E1DA 1U0OC 4PLPA 5K51A 3S2FA 5D7BA 5AMXA 3WX0A 5KPDA 2UVDA 1JH9A 4JBIA 2PTGA 4F85A 1VCNA 1ADJA 3GCXA 1TF2A 5DVZA 1WTCA 2C9DA 4JFAA 2WUFA 2O2DA 1Q21A 2VKQA 3GZNB 3ND7A 4MYHA 3GP8A 4YRGA 4B6QA 3NHYA 4KACA 4OA8A 4TTIA 2NPFA 4G0ZA 5TEVA 2NACA 1HSZA 2JH9A 3TQQA 4TL7A 4HH1A 1S3SA 2CLHB 1YI1A 4ZAXA 4Z9XA 2HWGA 1AV7A 3FMOB 1Z45A 2YWXA 5LIRA 2V58A 4ME6A 1UMDB 2PBZA 4CDNA 5HGXA 721PA 3DD5A 1NBME 1NN0A 1W9HA 2HDOA 1PS9A 2IY7A 3OE7D 3LZDA 2DULA 2BEWA 1D8TA 4GBGA 4JR2A 4OPMA 1Q0QA 1YOBA 4DJ5X 5DRYA 5KQGA 4U7WA 4FLEA 2O8NA 2Q28A 3QIAA 2GWRA 3KUXA 5CW2A 2HFKA 3WIDA 5C7IO 1NWCA 1VJGA 4MULA 1ORIA 1ILWA 1XMOB 3CU5A 1U2GC 2BEVB 2GK4A 4PSDA 1EUYA 1W4LA 5EWLA 1LX7A 3INTA 1F8GA 1JR6A 1VL6A 1UDAA 3ZVLA 4FGJA 5BSFA 5IM4A 2CSXA 4DYHA 3RUCA 5KEIA 3EQ7A 5E6SA 2LDBA 5H02A 1HLFA 4E5UA 4YLGA 3EZEA 2EP8A 3EXHB 3WQRA 2AR9A 3VI4B 2I99A 2VFAA 4EEXA 1ID1A 2FW6A 1ZN2A 2XQKA 3DCYA 1NXTA 2QP3A 2XUPA 2H16A 1H5NA 4LHVA 5AM5A 1GCAA 3U81A 5AI0A 2O3RA 3ZWQA 2DH6A 3S0JA 3DMGA 5CLIA 3WGMA 1DUIA 4EHHA 4EQ6A 3LPMA 3RHZA 4L3OA 3RUFA 1SGWA 1VOTA 2GPYA 2PD4A 3F9CA 1E2IA 2YZMA 4MAMA 4UARA 5DSXA 4LPKA 5LDDC 1GPLA 1P4RA 4A82A 5IDYA 1SQ5A 5AVSA 3H13A 4G07A 1TU3A 3X2SA 4EYQA 2AFHB 3PA6A 1ZRSA 2JGAA 4Q37A 4RETA 2B1GA 1X15A 3UCXA 1TB4A 3QJGA 4JDUA 4F04A 5BV7A 4UZSA 2WM2A 4ZHSA 4LMAA 3Q85A 2OO5C 3LA8A 2EIXA 4ZU3A 1ZJ5A 1W85B 4BFCA 5BSKA 2DQKA 1OH5A 4WPGA 4TZ0A 5IZ4A 1L4UA 1HE4A 1N8KA 4M0UA 5AUPB 5JPIA 3MG9A 3TRFA 1CFZA 3FOCA 4D82A 2E5LB 4EVSA 1JIXA 4MITA 5IP5A 2WF9A 4TL8A 5A5DA 3GA5A 3QXXA 4PZ0A 4A26A 3IHWA 4J16A 2OV2A 3D7LA 5KQMA 4Q1CA 1IBSA 1GFSA 2PJZA 2PRYA 3AI3A 5H81A 2VSXA 2IYSA 3RGWS 5ITSA 1KAQA 1ZN7A 1KXJA 2JHPA 3DHWC 2QMOA 4M9UA 4RHYA 5IC4A 2AS0A 1JMVA 4RIHA 4JUDX 3CG4A 2HBQA 1P29A 2CXOA 3GO4A 4ZEVA 1TGVA 2RMKA 5KTMA 4AKGA 4FCCA 4ZVQA 1XXHA 2GFQA 3LC1O 1XJ0A 4AFNA 4KIGA 3DT8A 1KHTA 3R3VA 2R84A 2WT8A 4Q39A 1NW4A 2VH1A 3NKLA 3IQFA 4BCBA 1B6TA 4D8TA 3EF1A 3L0IB 2DTEA 3PC8C 1MV8A 2ZBQA 3E8XA 5BSMA 1C7FA 3ELYA 3GEGA 4JS0A 4UMFA 1ECLA 4ITRC 1TW2A 1IY9A 1GG2A 3EVBA 3ZI0A 3A11A 5GOTA 2JJ2D 4MS3B 1NG1A 5JTTA 7MDHA 4GPEA 4R2HA 2ZKIA 2PHZA 2O05A 5FWDA 3C5WP 3MFYA 3WJ7A 3N2YA 2GFHA 3PP8A 4AJHA 4CL3A 4TWZA 2GAJA 5C8YB 4EFMA 1Z4IA 1TC2A 3EAQA 2R8OA 1A4UA 3WTCA 1Z6ZA 1E0SA 3AOEA 1UF9A 4EYGA 1TVCA 1F3LA 2NM0A 1ND6A 3BG5A 3B52X 4PCUA 3L0DA 1WPXA 2NYVA 2WBLC 3EB9A 1YVDA 4EO7A 2ZE6A 3WYCA 4HVCA 5LPNA 3VSEA 4CLHA 5FTNA 4UBIA 3VNBA 1X2EA 3L6EA 1DAEA 1VIMA 4ZMBA 1KEZA 3PC2A 1K88A 2D5BA 1PD0A 2I6GA 2Y2UA 4MAFA 4QBFA 5IMBA 3UFXB 1SUPA 3F90A 4D9CA 1X7HA 4FYWA 1RWPA 4U7FA 4I55B 2CVFA 3FHJA 1JT2A 1PR3A 4RJTA 5KJFA 5ALPA 2GEDA 3L6CA 1RWOA 4EY7A 4WSOA 2RONA 3K9WA 3JQRA 5JFOA 1PK9A 1W2GA 2I7XA 3DZBA 4K46A 2ATVA 4TTTS 3IWWA 3LQQA 3HSYA 1H2WA 2I6FA 1FJGB 3V4ZA 5AVZA 4P3NA 1LPSA 1BG6A 1VLQA 5C18A 4GMXA 3A2KA 1DUVG 2PANA 4HX2A 2MT9A 3I01A 2JZNA 4C8PA 1PZXA 3BHIA 3PNYA 3LL4A 2DKOA 3EIWA 1HDXA 3F6CA 2FWIA 4G3XA 4RQUA 5B1IA 1M0TA 1BDHA 4DR3B 4ER0A 3OEHA 3LWDA 1MZVA 4IRXA 3RVQA 4B85A 1JHRA 3ISVA 1ZICA 2DTDA 2Y8EA 1YCGA 4FZJA 4JJEA 4RDHA 4UM9D 3SS9X 3FSRA 3OFJA 4AO7A 2PFSA 4DLSA 3WGIA 3WNCA 2RE8A 1NM5A 2CV0A 1PT7A 1T8UA 3UMCA 4AO8A 3U60B 1P9NA 2GQ0A 4LJ9A 1YHNA 3FGZA 3INYA 3AI7A 3IX7A 3W04A 1GXSA 5CH5A 4BFWA 3O8QA 3NOXA 2GAFA 4E94A 5AVYA 1BJRE 3OLXA 3C6KA 3I4CA 1J1IA 1JW9B 3JD3A 3O2QB 5ALNA 4TS4A 2GXUA 1LTKA 3O03A 2J31A 2QLLA 5FRDA 1YR8A 4KV7A 3UG7A 3DAGA 3TGWA 2YV3A 1GPYA 4Z0PA 1J2RA 2B78A 3WYFA 5LU9A 2YINC 4C7MA 4HDNA 1U04A 1OZGA 1UBJS 3AEKB 1T8SA 3HU2A 3Q3HA 5B1EA 4OQPA 4N4AA 1SHLA 4COGA 3HG7A 3QPBA 4XQEA 3E61A 2BC9A 3FCOA 3DXXA 1C0EA 3EBLA 1QSGA 2FAXA 3MM4A 2DWQA 2GPTA 4HPWA 4PPGA 1XFAA 3E9DA 2VWHA 3UPUA 4RIEA 3DEZA 1MX9A 3DDCA 3P7MA 1W581 1ULHA 1QGZA 2WNIA 2X2FA 3U3KA 3UXMA 4IY1A 4JV5B 3F2VA 3QA9A 5KWSA 4GUAA 3AFOA 3D0KA 5BWOA 2IBTA 3R0QA 3PNSA 1Z8DA 1RAEA 3QOFA 4XPIB 2HOQA 4DGQA 5E4FA 3UQYS 5KDDA 4YUAA 1PL7A 1REQA 1ZHHA 3L1VA 4IIUA 5FXMA 5CBPA 2YMPA 4MDHA 1X1BA 4PNPA 3H05A 1XFDA 4R1TA 3TR0A 2HSWA 3KEOA 1DWQA 1GR0A 1F7VA 2GFIA 1SQ0A 2FR0A 3Q3JB 4FHCA 1N9ZA 1XXLA 1DEHA 4YGYA 3QMPA 2XIQA 4KMSA 2CL6X 3REQB 1I0ZA 4M7RA 4BEBA 5I7HA 2IIBA 1UBKS 2QR2A 1TUEA 1FYFA 5HA5A 3AF4A 3GGDA 4Q3KA 2W58A 2EKZA 5C5DA 3AKEA 2RB4A 3G0GA 3LX5A 4FE4A 2O7SA 3VOAA 3GY0A 1ZBDA 3QVKA 3TAHA 2Q5HA 1UZAA 3BB4A 2V59A 4G2TA 5D1NA 3ZV6A 1QVZA 1R6BX 3AR3A 1Z2AA 2Q5OA 4MYSA 3DHEA 4XB1A 5B53A 5C46F 3A3YA 4B3MB 3UAGA 5J23A 4AMBA 1CTQA 3V8PA 5KTYA 1O9BA 2JLWA 5HJ2A 3U5ZB 2W2OA 4EL0A 1XRRA 2D59A 4JOQA 3CTMA 4Z9YA 1EESA 1MIOA 1YBMA 4FR2A 4OB8A 1M8KA 2C5BA 1JG3A 1S89A 3RTDA 2O19A 3F78A 5IVKA 1P73A 3VVLA 4RD3A 5K0ZA 1EX7A 2KPOA 3GDGA 4KIJA 4X90A 2ZIFA 3PU6A 1A72A 1WQ1R 3UUFA 1KTIA 4HNSA 1A77A 1A8SA 1H6BA 2I80A 4OHKA 5ERYA 4CRWB 4Z3OA 4GM4A 3A6ZA 4Y7DA 5GJVC 3HEAA 1VIYA 4MTLA 4HO1X 2D00A 2XB8A 4TKUA 3MAJA 1QHEA 2EZ8A 1W5EA 5GWXA 1VPEA 3TXYA 1UBCA 2PFKA 4Q7LA 5BMVA 4Z4IA 2AZDA 4CCYA 1KP3A 2P91A 1DINA 3EXEB 2GCEA 2FZLA 3M3HA 3PKZA 1GZ3A 1E2NA 1WIWA 3AG5A 3R3HA 1J0AA 2CLKB 4RZ2A 5EP2A 1J8DA 1WABA 5IKOA 1EXWA 1ZUNA 1EA7A 5AESA 3VTAA 2QW8A 4ZWNA 4JJ6A 5C4MA 2X8BA 4XGIA 2V7TA 1CQJA 3V8RA 1I7QB 4XJSA 3VC1A 2QXTA 3ZCSA 5I8PA 2ID9A 4JZKA 1U3GA 2Q6OA 1E3IA 5GPBA 5ILGA 2LNDA 4HNUA 1QQAA 2GCOB 1E0JA 3ANXA 3K70C 4OMCA 4Y6GB 3KB2A 3QH4A 1AHIA 5JXHA 1PSWA 3HYCA 1Z5GA 1J9GA 3L05A 4Y2TA 1XMVA 4PTZA 3WKCA 1NU6A 4Z1MA 1QGUB 2PAFA 5B2EA 4MQ5A 5DTRA 3GFTA 4XARA 4ZI7F 3EEQA 1PQUA 5B3LA 1HSOA 4KGDA 1SCBA 1C2TA 2HBYA 3MTGA 4EJ0A 5A5GA 2FPIB 3V9PA 1XVTA 2HYIC 3CF4A 1TK2A 1KDPA 3H11A 2L69A 2CE7A 4WIAA 5EE5B 5EJ4A 3ZJ4A 4XIJA 4ARVA 4ADSG 1V1MB 2WWIA 1OLXB 3OAAD 1PO7A 2EFDB 5DASA 4S35A 2BI4A 4BKQA 4IJMA 2XVAA 4FILA 3W4KA 1NUQA 3L1KA 4G2NA 4IUCS 3RJTA 4CMJA 1G7SA 4IV8A 2YVQA 5KTOA 5LXTB 1JAHA 3K94A 4BRZA 5JS1A 4HOYA 1AKMA 1UUFA 5KKCA 4LMRA 4QBTA 4WBNF 5KYVA 1WXEA 1Y9DA 1E32A 3L01A 2QG6A 3DVRX 1LBQA 4NEHB 2GHIA 4UHFA 4KSYA 1RPAA 4Q3OA 5CJPA 1V11A 4GMFA 2F55A 2YQZA 4PPYA 4ALJA 2GZDA 1JJ7A 1JFTA 4LDJA 1CT9A 3BWMA 1XP5A 3MT0A 3IV6A 1T2CA 4B3RB 3MOSA 5HZKA 2FFHA 1PZMA 2Y0EA 1LW6E 2CNKA 5L9AA 1OASA 2XMPA 5K4AA 4ABYA 5HF9A