3TLYA

Microcin c7 self immunity protein mccf active site mutant s118a/n220a/k247a in the apo state
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
335
structure length
335
Chain Sequence
PLLAAPLAVGDTIGFFSSSAPATVTAKNRFFRGVEFLQRKGFKLVSGKLTGKTDFYRSGTIKERAQEFNELVYNPDITCIMSTIGGDNSNSLLPFLDYDAIIANPKIIIGYADTTALLAGIYAKTGLITFYGPALIPSFGEHPPLVDITYESFIKILTRKQSGIYTYTLPEKWSDESINWNENKILRPKKLYKNNCAFYGSGKVEGRVIGGNLATLTGIWGSEWMPEIRNGDILFIEDSRASIATVERLFSMLKLNRVFDKVSAIILGKHELFDCAGSKRRPYEVLTEVLDGKQIPVLDGFDCSHTHPMLTLPLGVKLAIDFDNKNISITEQYLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of a serine carboxypeptidase adapted for degradation of the protein synthesis antibiotic microcin C7.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords MccF
total genus 117
structure length 335
sequence length 335
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02016 Peptidase_S66 LD-carboxypeptidase N-terminal domain
A PF17676 Peptidase_S66C LD-carboxypeptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Class I glutamine amidotransferase-like 3tlyA01
3.50.30.60 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 LD-carboxypeptidase A C-terminal domain-like 3tlyA02
3T5MA 4INJA 3U1BA 3TLBA 3GJZA 3TLGA 5FD8A 3TLCA 3TYXA 4EYSA 2AUMA 4E94A 3TLAA 4H1HA 1ZL0A 5JYBA 4MI1A 4MJXA 5K99A 3SR3A 2AUNA 5F5XA 3TLZA 3G23A 3TLEA 5F9MA 5F1YA 1ZRSA 3TLYA 4IIYA 4E5SA 4IIXA 4JVOA 3TLGB
chains in the Genus database with same CATH superfamily
5FOVA 3FVVA 5K8VA 3OA2A 4GM1A 4LRQA 5CGQB 1UXOA 4TL9A 4FJ2A 4F9GA 3G8AA 3N0XA 1W94A 4H77A 2BFWA 5F3WB 2X7HA 2WPDD 2FEOA 2GERA 3C45A 3CKYA 3I1IA 1LX6A 1QH1A 4MYCA 1NU8A 2SNIE 3G9UA 3FPLA 4PYRA 3V9PA 1EGQA 2H0AA 4KAAA 2E4XA 1P75A 3B6KA 1JQBA 3OZFA 2M6LA 1S89A 1GARA 4L9SA 1YR1A 1IH8A 1XOIA 2CBXA 3QEOA 1H6CA 5CCDA 2V7TA 1H3FA 1Z45A 2H4ZA 1G5QA 3WLPA 1A77A 4JIMA 1DDIA 2ST1A 5LP6A 1MUUA 4PLGA 3TLYA 3OIVA 2YXPX 4MCJA 3UMFA 4COGA 4U2DA 5LDDC 3G2LA 1F2VA 3AP2A 1R66A 3RC3A 5ICEA 3AETA 4Z9FA 4P7FA 1M8GA 1EVLA 1IWOA 1P5ZB 5THQA 4XAQA 4YACA 3EGDA 3VXKA 2P41A 3RFFA 3WICA 3A4LA 4C05A 1RJ9A 2R5WA 3FGOA 3E27A 1U7HA 3LLSA 3PE4A 4HTFB 3W04A 3I3SR 4PZ9A 4AKTA 2AMYA 1P72A 4X3OA 4P93A 4KQGA 2A9FA 3O4VA 2AW5A 1TW2A 2H63A 3I2GA 5MFPA 2J4DA 3K6RA 3RVQA 3V42A 1VLLA 1FLDA 4GU5A 4BP3A 2IPXA 4YRSA 5BURA 3VJMA 2GAOA 4HQFA 3C6YA 3QITA 3QELA 1DUIA 4HFMA 2GDJA 3DEKA 4LHXA 4YP1A 3B20A 1ZIDA 5I45A 3E1SA 1BFDA 2VDVE 1BOFA 4IDFA 4NBWA 4BO6A 1CUEA 5KX5A 3EWIA 4G85A 4M2LA 5I8WA 5BV0A 4I5IA 4JA2A 3WGIA 5BSUA 3V8PA 4D0RA 3CW2A 4ROTA 4WOCA 4K6CA 3RT9A 3EQ8A 1RRPA 5U4XA 4INAA 1MW8X 2E4WA 2JIBA 3V8QA 2OSVA 2RAVA 3D3NA 3I92A 4ND2A 5H70A 3TPZA 3UHPA 4EUHA 3DCYA 2QL6A 3GGOA 1OIXA 3OIFA 4QUBA 4ZCQA 5HOEA 2IBTA 4PZZA 3C8DA 4B4WA 1YKSA 2YRWA 2Q1WA 3N2GB 1FFWA 2VHXA 1X8XA 5IXYA 4X24A 2JI4A 5A3SA 1EDEA 4YUWA 4FMCF 1MX9A 1QG2A 1IG3A 3M6WA 3I12A 4TMZA 2HWUA 1NMQA 2O3RA 2ZLBA 3KYCB 1Z4IA 4FC6A 5JYDA 2G4VA 1D4FA 1N6RA 1FFGA 2JDID 2WTAA 4LE0A 2NUAB 3EXHB 5TPZD 3PNOA 2VF5X 2IYUA 3RAJA 4M99A 1ZMRA 2XUIA 4BFSA 1SAYA 1E2UA 4Z4HA 3MEQA 1H2YA 5HILA 2IHUA 4BNTA 3VTZA 1ZEJA 2JLWA 4LJ7A 2VYND 1QQ5A 1WBBA 2I6XA 1XU4A 4LBZA 5CLHA 1U2QA 4C7JA 2XZOA 2AN4A 1DUSA 3IIMA 5EIXA 3DVAA 2AC2A 3L0DA 4HGNA 4UXJA 4DMLA 1A4UA 3F5QA 4LVCA 4P36A 1X92A 4KDCA 4M49A 3P4XA 5HRUA 4Y1FA 2CXXA 2MYNA 1WZUA 2XKAA 4TT3A 5EMHA 1M2JA 2DFTA 2OM2A 3KJHA 2YHBA 4ENWA 2APJA 3OTHA 1U94A 1GL9B 1ZZEA 3H2HA 4PC7A 4ZO7A 1Q0UA 5DVZA 3VH3A 3OM0A 2XMCA 3CKLA 3QKTA 1QAQA 1SCQA 4HZIA 4NP6A 4ZJZA 1M6WA 1NXJA 1NYRA 1BHO1 3LWDA 5JNVA 3PNLA 4L16A 2QEQA 1ZISA 2DFDA 2AR9A 2WM9B 3P27A 2WVJA 3UMJA 5LPNA 3EOBI 4G0VA 1COWA 2NO0A 4WFIA 3DQQA 5B64A 4S1NA 1E6EA 4I1IA 3BQ9A 4L72A 1JLRA 3AZPA 5LVAA 2IXBA 1L5NA 5T57A 2G67A 1OBHA 1FE8A 1PDWA 3L4BA 5IDWA 4P4BA 3DZGA 1T6ZA 5SV2A 4CF7A 4QA9A 2P8JA 2RDMA 1KARA 1WDWB 2H6EA 3DZCA 4M9RA 2JCVA 1T4CB 3AHHA 1SXJE 1S8FA 2ZBVA 4PC3A 4AS3A 1Y6FA 2FEMA 1HT1E 2IKQA 2IYSA 3OQ6A 4FX5A 4BNLA 3A2MA 4FEAA 4PAWA 3T3OA 4ESEA 4P7KA 4CF5A 1YZTA 1BOOA 2CXQA 1M67A 1GGHA 3EVNA 4MA4A 3ZG6A 2QRHA 1RI1A 2V8BA 1OA0A 2N9UA 2BLLA 4LHWA 5F5LA 2YFQA 5FWNA 4BV8A 3C2QA 2PHZA 2QMEA 4HS4A 1E9BA 1JSXA 4XB2A 5JNSA 1KOGA 3QY0A 5HFNA 5FQOA 3CZ4A 3PPWA 3Q1LA 3JQGA 1I6WA 2JJ8A 2XIQA 1FP4B 1YMVA 3QWAA 4L78A 4ADSG 1RWOA 1Z47A 2YUIA 1I4LD 1QANA 4KX3A 2YIVX 3U5TA 1DB3A 4AO6A 1A5TA 2ZU6A 4CR7A 1NOKA 1E9EA 1GFWA 3V8RA 4GEKA 1RZUA 3KLPX 1K9VF 1RPAA 3BSWA 4GBMA 4MDEA 2CLMB 4QBGB 4A0RA 4FHFA 3O3OB 1MRZA 3ICPA 2EJCA 4P58A 3WHLA 2PEYA 4OUKX 4S1VA 2FW7A 2IXTA 4BKPA 4G3XA 4LTNA 2F1HA 4C0XA 4J1TA 4QYMA 2WICA 1VL1A 4QM6A 4GF5A 4KNWA 1MX3A 5ALMA 1E1CA 1UK9A 3COVA 4UNPA 1KI9A 5A4KA 4UE3S 1MD9A 3NWPA 4RDIA 1VLQA 3S1AA 4C22A 3W5VA 1IZZA 1GT91 3D1JA 3I32A 2EFHB 3N53A 3GUCA 1UPAA 4D5EA 5IXJA 3T7AA 3AVPA 4AWAA 4CQMB 6NULA 3HZOA 3UAVA 2RHDA 3EHDA 2CLIB 2CLKB 3Q7EA 3W78A 4C0AC 4KOEC 5LZ7A 2OHFA 4DG9A 5ADVA 4HBGA 5FLKA 2O05A 2OGWA 4DA6A 1SBIA 2FPLA 4EVSA 3WAKA 1CLEA 1I4DD 1W49A 4O02B 1L5SA 3V3TA 2BEUB 4YX9A 2IYVA 1DX6A 1PZHA 4ZVLA 1GU0A 4G97A 3IIIA 2RH9B 2EZAA 3UA4A 3UMBA 2XNDA 3ZDQA 1CY6A 3A7EA 1TO6A 1FVOA 1G8FA 5E4JA 5GONF 3ONVA 5E4FA 2GZAA 4DNFA 1ISMA 2JA1A 2Q6OA 3K96A 2QVGA 5HJ7A 2AYXA 2J9GA 3EZ6A 3ZLJA 4BFYA 2H29A 1QZZA 1YVUA 1YFKA 2JI9A 3IDSA 3PPVA 1RQNA 3SZOA 3UAYA 2OP1A 2OAQ1 3FECA 4LDZA 1G8YA 4Q9JA 4X45A 4RZSA 1JKMA 1YCDA 3DEYX 1LBIA 1YDMA 2I80A 2JDIA 1PSZA 4KR0A 4DQVA 1RLMA 3NOJA 3G0BA 5ELXA 3HB1A 4F91B 4B3TB 2BDEA 3FETA 4N9QA 4U9IS 1G21E 1QFJA 2WJGA 4JB2A 3UXMA 1VIMA 1Y6GA 4Q1AA 1ZGJA 3IELA 5DDIP 4F4IA 1PFKA 2Q5FA 4R41A 3OPVA 4RY0A 1YQXA 2YFKA 1V16A 1ISPA 2YX1A 5D3KA 5FFNA 3VUFA 5HE9A 2BFFB 3PIRA 1OD6A 1T9HA 1RCUA 1ZXLA 4KI0A 1WV1A 2FPOA 3FYHA 1PT9A 4JP5A 4JEUA 5H16A 2E21A 4ACBA 1DRVA 2AN1A 4L0MA 3X3HA 4ILKA 2C5FA 1KS9A 4GM4A 2FZ4A 3VSCA 1ULBA 2P5TB 2VSXA 3EPRA 4FOOA 1PT5A 3NUGA 3RRNA 5A3JA 1WXEA 3SM3A 3ZY3A 4MAMA 2RGAA 5JFTA 1QPGA 2P6UA 4MCIA 3PDIB 3U39A 1SIOA 1XWWA 1VI6A 1GNPA 2UUBB 3K71B 3O3MB 3LWZA 4QFMA 3TRKA 2O1SA 1OREA 4F97A 2J7KA 3GUUA 4GG1A 3NHBA 3W4JA 1PWEA 4E5KA 4TUYA 2QZ4A 3KAPA 1I1NA 4MA5A 3I83A 4JWTA 4G36A 4M89A 4Q9HA 2JVIA 3DAGA 2PXXA 3QV2A 1EUCB 4P3NA 4Q9IA 3CH5A 3LHDA 3PD7A 3OZWA 3NEAA 2QN7A 4Z9BA 4XIJA 1Y8RA 4H15A 2BAGA 1PAUA 2D59A 2OL4A 4MARA 3VO2A 1VBKA 3W6PA 3UPUA 4OHRA 1GCUA 1AM4D 2IW1A 5D87A 2ZIFA 3O0DA 4XUGB 3VV2A 5CW2A 3IRVA 2VZEA 1BA3A 4LN1A 3CO0S 1K08A 2WIFA 1K5DA 4U63A 5H1YA 5KYUA 3WQBA 5JPIA 5K6AA 2YMQA 3OQNA 1TU3A 2RHCA 2XA9A 2QRLA 3A11A 4XQ0A 1GYQA 2OP0A 2Y0PA 3OIWA 4LQCA 5EPEA 3ZGVA 5KNCA 2WU3A 4IILA 4PYNA 1XGKA 4YH1A 5JH7B 1KSHA 1JIKA 2HDHA 1G5PA 1SA0A 1Z13A 3F3YA 3KNZA 2VQFB 1N6HA 2KHZA 1FSGA 2FPPA 5FR2A 4DQDA 4YUZA 1Q7EA 1SA0B 5TJ9A 2BKLA 3LWNA 5TF4A 1IEXA 3BRWA 4XARA 4EJSB 3CFYA 1KYVA 2FXIA 2RGGA 3OCCA 4J3JA 1X0XA 2XUJA 5IDXA 3NT4A 4FXOA 1VG1A 2GM5A 3PZRA 2FWJA 4KVZA 2GPWA 2A1TR 2G9UA 2VPWA 3Q3GE 4QDKA 4JQSA 5TF0A 1LRJA 4LOIA 1YS7A 2HIHA 4GO1A 4OYLA 3BXOA 1Z8HA 2VYVD 5ICGA 1B43A 2WD9A 1R10A 2I9PA 2FUKA 2L2QA 3FKSD 1KPIA 3TS1A 2CKMA 2O0KA 5FBLB 4LF9B 2ADOA 3ENKA 1PQYA 4K9SA 4JJEA 5IT4A 1M2VA 2A9OA 2WSSA 5B1SA 3GFOA 3T8YA 2QNBA 4FNAA 4C7MA 3CV3A 4R3UC 5IBQA 1W6RA 4O1MA 3KV3O 1L3IA 1YE8A 2FEKA 2QX6A 4O2RA 4OJMX 2VYCA 3ZZ0A 5EWMA 3OEYA 5CPFA 2DFNA 2XEXA 3HBLA 5J40A 4N01A 3RBAA 4GQIA 4XDYA 1R8YA 3JQ7B 4ZOBA 3MYRA 3T07A 1EAYA 2FA9A 2VF8A 1MKYA 3OEWA 2A14A 4K88A 4NZMA 3V4RA 1RR6A 4J3FA 5L3ZA 3E8SA 5K6RA 2NO1A 5BV8A 2GVZC 1QVVA 2UKDA 4LTDA 5EQFA 4F9FA 3PFFA 1VJGA 5REQA 1UDWA 5H59A 1U28A 4O4LF 3P4UA 4BNJA 4JROA 5EINA 2HMAA 1LH0A 4N3GA 1JPVA 1OZGA 2C88A 5J58A 1BC5A 1AKQA 3QNMA 5E7JA 2FDCA 1P19A 4WXMA 4YECA 1H4VB 1MG0A 1Z8DA 2R8XA 1OXSC 3BMXA 3DONA 3M9XA 4MV9A 5LDGA 4JN6B 2HMVA 3K5WA 2UYGA 3KVYA 3H75A 4QU8A 1FVHA 5EI5A 3IQDB 4JJIA 2GM4A 4KH1A 4ZN6A 5C7OO 2HY7A 4WFKA 1WY5A 5ICSA 1U0HC 1R6BX 3EXIA 1N9GA 3A1NA 2D5AA 2VF4X 2DP4E 5E8RA 2BGWA 2Y0CA 1K9SA 1XROA 2WAOA 1JMYA 4BX9A 5K4HA 2PLAA 2RJOA 1S8AA 3QXGA 4ZZ1A 2DKFA 4AS1A 1E99A 2R79A 4IRXA 4QJBA 3BMOA 3WLOA 2VNAA 2HCRA 1I5RA 3NOOA 4MQMA 4C7VA 4FFMA 1PR4A 4OBXA 3KOYA 4H7KA 4KSBA 1P7CA 3N2IA 2NTEA 1N8KA 3N8KA 1BCRA 1AC5A 2VDPB 1HG0A 1XWFA 4B87A 2X19A 4W5QA 3EGXB 3WGQA 4CETA 5HCUA 3G5AA 4GPTA 4C0QC 1Z62A 5C53B 3AJDA 3IE1A 2R9VA 1AVTA 4JYAB 5ENVA 4DM3A 4AY2A 2WTNA 1NN3A 2AN5A 2ZJYA 1M6YA 3OM8A 5HKAA 4QARA 5JCOA 2QGNA 2CDCA 1WV0A 3KJQA 2V9ZA 2IQIA 2V7EA 3WNCA 1HURA 1RWMA 1TUIA 2DPXA 3L7IA 1Z2OX 2EERA 4DMFA 2CIJA 4AJ4A 1N1GA 3VPAA 4PQEA 1EB9A 1FFCA 2G9ZA 2IYWA 3JQ8B 2D1SA 4TQGA 5JD4A 421PA 3JYHA 3V1UA 4BZWA 2B8TA 3RC7A 4MR9B 3WOHA 2K7FA 5GM1A 3DGEC 1HORA 4DYHA 3D7HA 4K1XA 2DPYA 1FDRA 3W1VA 1VL6A 2JAHA 4G8JA 1D5WA 1GFZA 3HZRA 1MHTA 3ZE9A 4AUKA 4NDZA 1DAPA 5IABA 3AXTA 4UUAA 4J6FA 1K7SN 1H0RA 3ZVMA 5DI9A 2INGX 2VJBA 4C8PA 2HU5A 2P78A 1FP6A 3OE7D 3STVA 3X2SA 5HIMA 4KIUA 1W44A 2O3UA 4L8LA 4YMHA 3DYIA 4HAZA 4CG2A 4YVFA 4D56A 3E3LA 1D04A 4YJGA 4L4UA 1IVNA 2QROA 5ED4A 1I24A 3IO5A 2JF0A 1DBPA 4DCCA 4M0DA 1BJTA 4R1MA 4DWVA 5CT8A 5TY0A 4UMEA 3LRTA 1TTPB 1UPBA 1WEHA 3NC1C 4X1YB 1JHUA 4WVLA 1TA0A 5CX1B 5EQDA 5CT4A 1VA4A 2J3MA 3CGWA 5CIYA 4GD3Q 2WYOA 5HP4A 1ZNYA 1CY2A 3JQ9A 2H1VA 3HYNA 2VK4A 3KZCA 3U7RA 5KNBD 4EA8A 1PZFA 3D6VA 3T95A 3LUHA 2Q3JA 5BSFA 4ZVTA 4Z7QB 4IS3A 4QSMA 2VT2A 1DIKA 1UM8A 2D13A 3PCRB 2A94A 3EAQA 3NATA 4R68A 2FX3A 3QX7A 1TIBA 4NESA 2YWRA 3Q5GA 1P4RA 3ANMA 2PUJA 1FS4A 2H4FA 4FYJA 4MUKA 4AMYA 4IJQA 1NE7A 4RHEA 5EHGA 4QO8A 3I72A 1HDZA 3H2YA 5JDIC 1EQUA 2ZAYA 4ZMSA 1XLTA 2VTEA 3GVCA 2IYZA 2NUBA 4X85A 2CL7X 4DC1A 5DN6A 4DV2B 1JG7A 1GA1A 2VUSA 3ZE7A 4FD2A 1AGNA 3ZR4B 1RMYA 2J67A 1S96A 1XZPA 2YWDA 1SGWA 3PEEA 2QPAA 5U1PA 5JIBA 2IYPA 4D3YA 3E2IA 3HQ4O 4MUGA 1LW6E 1D2MA 4JGBA 1U2SA 4DBLE 2J4FA 3G5TA 1A7UA 4G1UC 3GV0A 2IY8A 2Q5HA 4BNFA 3K9QO 4OSEA 5C1OA 4CT5A 1UL1X 3KS9A 4A7PA 2C42A 2OCPA 3VR5D 5ITZB 1KI3A 1BX0A 3L8GA 4P82A 3K15A 5JYEA 2HYIC 3CEJA 1A04A 3L6RA 4L07A 3ZV7A 1XQVA 2A9RA 2JGIA 1WF3A 2V7GA 3IP6A 2VJYA 1FYWA 4JVLA 5JW6A 2PL5A 2UVQA 2X8JB 3KXIA 5GQSA 2VNJA 4Q1CA 1NFRA 5HDQA 3SMQA 2YJGA 4P3XA 2BLNA 5CDYA 4TL8A 1VBFA 4NGPA 2MSNA 2W43A 2X4DA 4MZXA 3R8CA 5FKJA 4TXLA 2XT9A 1QVRA 4OLFA 4JEIA 3RVRA 2FYTA 3VI4B 3IEPA 1CZHA 1AK2A 3RG8A 3X43A 4UMFA 1TCAA 2FWRA 1K4MA 1P0CA 4MW6A 3RYIA 4DFDA 4RFSB 1B14A 1CUWA 2ZYHA 1PVDA 2OO7A 2Q2QA 3EULA 2HEIA 3STHA 3HV2A 2HA7A 3D9QX 5IKMA 1UJNA 1W29A 1T4MA 3EDYA 3QV1A 3NTQA 5D8DA 3QJ5A 3WWDA 1TKBA 5HQ3A 3HUUA 4CFSA 3VOAA 4NLLA 2GBPA 2PQ6A 3ASUA 3P9RA 4YRBA 1X3SA 4Q1FA 1YMQA 4M3NA 5IJAA 4BCBA 5KOHB 2OM6A 5EHNA 2HH9A 2NXNA 2NZ2A 2ZITA 3BK2A 3CKMA 3HLYA 2PJDA 3WIDA 4YEDA 3AJRA 3KQNA 4LSWA 1OWNA 1P39A 1QYCA 1CBUA 2AF4C 2P69A 1SCBA 3QELB 3QVOA 3ZYZA 4EKGA 1D5CA 3DEHA 2G9NA 3ZGLA 3RYCB 4Y7DA 1WQ3A 3AFGA 3BT7A 4IWYA 2EK8A 2X0SA 3LQKA 3EB9A 2HMTA 4NAUA 4TKVA 2PPLA 2PZKA 3FMGA 1P5FA 4JDUA 4PCAA 3WGJA 2Y1XA 2FP4B 3GA0A 4OGWA 3LGAA 5K9ZA 4CG3A 4OGKA 4BZPA 4Z3KA 1ZJYA 2V4UA 4E5DA 3AB7A 3KQUA 3LX4A 8AT1A 1E5XA 5CEJA 1EFVB 4DLKA 1R0RE 1DT3A 3LFTA 1K97A 2UZ1B 4EUSA 1S3SA 4AK9A 5BMVB 4X60A 3DLCA 5EJAA 1P7VA 3S2IA 3BPSA 7REQB 4GXNA 5AHXA 5IAJA 1BKDR 5TARA 4BX3A 4LNAA 2Q2WA 2GCGA 4QBIA 2IOYA 5BUZA 1ABEA 2UDPA 1Q57A 3Q9UA 4TZTA 4OTZA 4EMUA 3GLFB 2O5CA 5T5QA 4V0LA 4IIBA 1R9NA 5JSQA 3PDUA 2QF7A 4JBYA 4FUQA 1FQOA 4ARVA 5DGHA 1ODKA 2OXEA 1Q14A 3K5PA 4N54A 4I4TB 2VKQA 1XAGA 1Q84A 2V6MA 4LHYA 4HGRA 5G1NA 4HUTA 3SKVA 3LO8A 2XZLA 4YDHB 3A9TA 3UJBA 1XF9A 2NSYA 1AB5A 3ZS9A 4UE2A 5I7UA 2YMLA 4ZVUA 4OC1A 5A4AA 4MLZA 1KVTA 4M98A 1EEHA 4KR2A 1EE1A 2WF6A 1ZK0A 3MIIA 4I8IA 2FPUA 3IVCA 4KAXA 4QWWA 5BQFA 1M1UA 1NW9B 2Y99A 5AVQA 3LZ6A 3DM9B 1SG6A 4KL8S 3DLIA 4ZMRA 3JZIA 1XMQB 2FPRA 4P8RA 3DZBA 4BU1A 1BHJA 1KAOA 5EIHA 8ABPA 5CCBA 1F2DA 1M5UA 5AVOA 4KEAA 1CE8A 1NQTA 2Z9CA 1U11A 3VOSA 3S3TA 4JOCA 4IGFA 3MWDB 4AZ3B 1BE8A 3I2IA 2RHRA 3KFVA 1HI9A 4HEJA 3P2IA 2QTGA 1TMGE 3NCTA 3C5EA 2D2FA 4JEMA 3VDMA 3GLIB 4C5AA 2Y0DA 3NB0A 4I4IA 2OV2A 5C8XA 4YXWA 1R8JA 1QJCA 2FPMA 2AVDA 2R8RA 5K0ZA 1NQOA 2JFNA 2W2TA 4D4IA 1ZKDA 2PJZA 4NOKA 2WD7B 5DYNA 4P98A 2ZRKA 4B31A 4EBBA 1VIVA 1ZW1A 3F71A 3IOYA 2QQFA 3SEQA 3T3HA 1XPOA 2VI5A 1DXYA 2IUTA 3UM9A 2CF6A 4L3OA 1HDOA 3E7PA 1C9NA 4G0ZA 5FI0B 1T15A 1BS2A 5DMXA 4RELA 1J2RA 2JAQA 2QYSA 4J1TC 3BDIA 2GASA 2C4KA 1WUHS 5EJ4A 1JFRA 1IOWA 2MSEB 2IYYA 2ID4A 2WHQA 1DJLA 2VNSA 3GCDA 3KJFA 3L0CA 2YTZA 4QDZA 2B6NA 2Y66A 5CPBA 1KP9A 1T6YA 3C1AA 3DKRA 4OC5A 2JGAA 1SC1A 2HA0A 2NUTB 3V34A 3WWEA 2LKCA 1KDRA 3PP8A 4EW1A 3DA8A 2OZLB 3VZPA 4EF4A 1WW8A 2UUCB 1QHYA 3MWYW 1QOZA 3T9DA 5CK5A 1WTAA 1R6UA 3MWGA 3O31A 4GRIA 4QOFA 1OTXA 4UAVA 1HNXB 1MJHA 3RIMA 4O2AF 3I61A 3FVTA 2OBXA 2ODTX 2WM8A 2XEGA 5KQGA 1NRIA 2H11A 3A14A 2V7UA 3TW8A 2GZ2A 1M34E 2AX3A 2YJZA 1V9SA 3ONEA 4N7JA 4HS9A 1U7DA 4EX7A 4F72A 4A03A 1KNXA 4ZYXA 2PRZA 2X14A 2HK6A 2Q4DA 1P1JA 4OSOA 3PNYA 3C3KA 1KFEB 4CLOA 3GZNA 1QYXA 3A3YA 5ALQA 4UAJA 3BXZA 2H51A 4AX8A 1NP6A 1KK3A 4GQAA 2GN4A 1G20A 1MJGA 1NW6A 2OXRA 2KPOA 3DDCA 4LNUB 4PTYA 4W7HA 4YLGA 5EP3A 5KTTA 1WXIA 4WX2B 1TYDE 1ZI6A 5EP4A 2QOEA 2HSJA 2N1BA 4R1PA 1K2WA 3DD1A 2V4MA 1Z82A 1IEQA 1VE7A 1M1NA 2R8YA 3TOVA 4EO7A 3QXSA 1EIZA 5JMPA 3SOPA 2VJAA 3B5IA 4H2DA 4HHEA 3H7AA 1O03A 1FJ2A 1VPEA 1F8FA 2QTCA 3ZZMA 2JKZA 3UPTA 8ATCA 1CCWA 1KAQA 4ER0A 1B1CA 5I9NA 3A1WA 2FSVA 4BNGA 4BV3A 4YYZA 1IULA 2Z30A 4L85A 3FUUA 1OJLA 1T5IA 1QOQB 3ILSA 3ZC3A 5JANA 1KBLA 1TVCA 3B3JA 2XDQA 3SEFA 3FAZA 3PTZA 5BV2P 4QM7A 4MPDA 1OT3A 2IH2A 1HWYA 4WKNA 3BE4A 1J07A 4HGPA 2HF2A 1BJKA 3Q7SA 3U17A 1SOMA 2EU8A 4K3UA 3MWEA 2EF1A 4U3JB 5CB4A 1FU8A 2MYUA 1EVZA 4K05A 2FZWA 2HU8A 4MV5A 5AW0A 4CEJA 4EPYA 3LFUA 3NBFA 1UINA 2XTJA 2N42A 1J0CA 1Z2AA 4CKEA 4ZICA 1QFZA 2H5JA 1NXXA 5EG5A 3L8FA 2Z4TA 1ZMBA 4GSYA 4ZJYA 1ECCA 3RB8A 2EZ4A 1MC1A 1OFUX 1I9GA 5AW2A 2PVCA 3R6TA 1R5JA 1CHNA 2PQMA 3NEYA 1NMZA 4ARUA 5DM70 2XB6A 3PYLA 1VBNA 2P2SA 3QKRA 4WGGA 2O8BB 2RGBA 4RH1A 1Z4LA 4KXQA 2P67A 3R7FA 4IEFB 5JS7A 1KC1A 5CTAA 3RJ5A 1PHPA 3UT6A 5JVDF 3SBXA 1E4OA 4GL2A 2QL5A 4LV6A 4IINA 4FWTA 3M33A 1AQIA 4JP2A 1YA6A 1E92A 3DJYA 5FYQA 1UOEA 1DX4A 3TL3A 1S3GA 2ZULA 2W8ZA 1IOZA 3CLUC 3ANSA 4KQ9A 5EKXA 3UGTA 1XVLA 3EGIA 1RXCA 1Q83A 2EAUA 1B1AA 3KPYA 2JH9A 3OZEA 3NXKA 3VPFA 5B1YA 2AG0A 5K0BA 3ST7A 3DLTA 3EY4A 1T9GS 4NBUA 1ZHFA 1MU0A 1ZN7A 5P8WA 4G5XA 1MA0A 2PV7A 1DEHA 5A3VA 4BBAA 2IQ5A 3AV3A 1L8XA 2BMWA 2EEZA 5CG2A 5IR2A 1X7ZA 2PUWA 2V74B 2IBMA 3QSGA 3D8HA 1Z35A 2AFRA 3BE6A 4OEHA 3CW8X 4UUNA 3TGPA 3QX9A 3LT4A 3O1JC 4RS4A 4IV0A 2OECA 4B3MB 2OOKA 5JOQA 4FU0A 1HZJA 2RIPA 4WLVA 2PE5A 3OEHD 3K9GA 1VYHA 2AYYA 4GW3A 1JHDA 2VSQA 3PF8A 1NGSA 5CUQA 1L5VA 1KQ3A 1T1EA 4UM9D 2HCTA 4CHGA 3B1JA 4D8XA 3N3AC 1ZMTA 4NONA 3KIPA 4UM7A 1E60A 4LZWA 3C3JA 4RDHA 1ISIA 1XC7A 5B1HA 1A95A 1TMYA 2C9ZA 1Z06A 3F3MA 1VGRA 5DHAA 5CLFA 4BNDB 1YTUA 2XMPA 3ICOA 1SXJA 2H7CA 4FOLA 4HH4A 4IZOA 4QRDA 4WD3A 3SYLA 1CQXA 2P9EA 4H7HA 4AX4A 5LQKA 4CEHB 3MAGA 2RGCA 1FFBA 1P6UA 2C2ZA 2B35A 4R2WA 1ZOLA 1U0RA 3LT0A 1P0MA 5EP2A 3SJGA 5DASA 2AKEA 3HPQA 1KR5A 3KK0A 3UJ7A 3CNNA 5J2UB 1WHSA 3C3PA 2XCSB 1W93A 1PGJA 2WD8A 3NHKA 3GQBA 4LVNA 3SBEA 1DFHA 1YVEI 1XMPA 4QREA 2GHTA 3BI0A 1RPNA 3ZKWB 3DO8A 1RNLA 1X1CA 3DMTA 2ZQYA 3ELYA 4XM0A 5M7EA 3U81A 3HZHA 3T9BA 2VWGA 3CC8A 4F5YA 1NBIA 4CKCB 2ZUTA 3WHKA 4AY6A 1YJ8A 4TTTS 4XGIA 3REGA 3QLVC 4IKEA 3ZHYA 4CMBA 2V5AA 3VVLA 5JATA 3EQZA 3CWZA 1C29B 4IQ4A 3TFWA 2VWHA 3W06A 4A2PA 2O19A 4WEOA 4Z1MD 5JNUA 2C6PA 1N3YA 2NU9B 1G6KA 3H5NA 3II6X 2OD2A 1IG0A 2PSHA 1N2JA 4DM7A 5KQLA 3A9WA 4IOMA 5KKNB 5G0TA 3PD0A 1ZR2A 4FS8A 3GZNB 2B2NA 4ND8A 1WXWA 4CM4A 2CGEA 1FPMA 1SPBS 1FCJA 3OZXA 2ETVA 3ETHA 3L93A 3T61A 3YASA 5JNLA 3KETA 3FVWA 2E18A 1H6AA 4R0VA 1O0BA 2VN8A 4J7UA 4B7CA 3OVMA 3RYIB 5AR1A 2NSHA 2A3RA 5B1IA 3G5UA 1IN8A 2IGTA 5EJIA 1R0BA 2IIPA 1BU8A 4M87A 1KJIA 1PK9A 5LIRA 2F59A 2EFGA 3RRFA 4KSCA 3IQEA 1ZY2A 4U02A 2R47A 3T12A 3OUTA 3V4VB 5JEDA 4B35A 2JK0A 2C61A 2W71A 1W4BA 1EE2A 1CQJB 2GB4A 4EW6A 5DHPA 4PSAA 2G8NA 3IP3A 3LPNA 4EEXA 4EG4A 1RQXA 2JFZA 3T7DA 2OFOA 1HV8A 3PT9A 5JEEA 1EP2B 3C1UA 1W1IA 2BIFA 4OKIA 3TX6A 4INPA 1GAQA 4A6PA 4AN4A 5EMLA 4NYMR 3STWA 1YJXA 4EO9A 4ZYUA 3LKBA 4EG0A 3RADC 2H31A 4WXEA 1RP7A 1KO1A 4M55A 4HDAA 1N5MA 4HEHA 3O75A 2C2YA 3W2HA 4DVGA 1XRLA 2AOTA 3RUIA 2RHMA 5CB6A 1VFPA 4XYGA 1OVMA 1RM4A 4HLNA 2NYAA 3A27A 1JQKA 1Y9EA 1B6SA 3B8EA 4B3RB 2JKYA 2MINA 3W3AA 4XIIA 1EUQA 5K0CA 1Y9JA 1W85A 1LQ2A 1T24A 3P96A 3N39C 2DC1A 3OPYA 4M9CA 4AF6A 2A84A 1ZINA 3FM9A 3K9WA 4ZT4A 4OM8A 1TD1A 4YRKA 3EZGA 3NBKA 1V8DA 3CCCA 1GILA 3Q6MA 1PKXA 4OL9A 2G0NA 4MMYB 5DGDA 1IJBA 1BDIA 4P81A 5IN5A 4ZVSA 2IH4A 1FDUA 1VL0A 2XF8A 4A6DA 3ZZ1A 5JWRA 2FNAA 1T3ZA 2F3RA 2H2AA 3KE9A 4DV4B 3IEVA 3MOSA 3QYJA 3PCXA 4UVHA 5H80A 5MFZA 4R01A 3LLVA 3H16A 4DIDA 1DMRA 1B00A 2PA0A 5KC8A 4G0OA 1TMKA 3ADPA 2V6IA 4XASA 5BNWA 4WDQA 4PPGA 4BEJA 4KB5A 4DNOA 1I2BA 3LOQA 3IPXA 4R1TA 5DLYA 3VPHA 1K89A 3ZVLA 4ZHQA 2AI2A 1ZA2A 4RZIA 2B98A 2VAWA 3M6XA 1QFYA 3E22A 2LP4Y 1GUAA 1UODA 3VSAA 1IMOA 2R1UA 1U2PA 1RZ3A 3MBOA 1QLWA 1RRMA 3GT7A 4YO7A 5HYVA 1RI3A 2H3HA 2RC5A 1T0UA 4KIWA 4QICA 5EESA 1U8AA 2JAUA 4NBKA 3AY6A 4M36A 4PX5A 1RWWA 2XWBF 3KAKA 1ATIA 3CTMA 3DO6A 3DXXA 4E5NA 3JS5A 4PWZA 5KTOA 1ZXBA 1SXQA 4YP5A 3W6ZA 3C3DA 1G5TA 1RI2A 5ECWA 2CMDA 5T6MA 2PAFA 4EI9A 4J2HA 2HUNA 5BWOA 2NN3C 1BIFA 2QVCA 1P4JA 3TLGA 3IERA 3P9NA 3O6VA 4N6OA 1C0PA 2ZANA 2EXXA 1Q0LA 1U0JA 3H2JA 4YRCA 5KO2A 3ANTA 3TINA 1S7GA 1FRFS 2WSSD 4J0CA 5LUAA 1AXEA 1F6DA 4PANA 4UUPA 2DQYA 1R6AA 1UC4B 2BUAA 3FCYA 3H2GA 1P3Y1 4QUJA 3OZAA 4RV5A 4RVDA 1UPTA 2FP4A 3OP1A 3UNXA 3V2IA 1U0SY 3F3KA 2NVUB 1RJWA 1BYUA 1JVSA 2FVXA 4UULA 3SFVA 4ZI7A 4O3MA 1KI6A 2NTYC 6REQA 2I22A 3A2NA 1O1YA 4OG2A 4HSEA 4M7RA 5K0NA 5JAIA 3NAMA 3DQPA 4BHTA 4JR0A 5D3MA 1UKAA 3TAXA 4GMHA 4LOLA 4F8EA 4OUDA 3L4KA 2O48X 4NULA 1WCXA 2QV7A 4II3A 3C6QA 1LSSA 2BEWB 2CDNA 1C14A 3H97A 2FKAA 1XCMA 2AUMA 4XGQA 5F3DA 2VTDA 1YS1X 1XYYA 4PRKA 4CWAA 5AO9A 1XTRA 2G1JA 1XZAA 2JB9A 2YZGA 4TSKA 3EGXA 3V97A 1XKTA 1V7QA 2VCYA 2BFDA 3KBBA 1H9AA 2R6R1 4DLZA 3L8MA 1HTTA 2QAJA 4D4MA 3RTDA 4PQRA 3GD7A 3HVKA 1L7NA 3NBXX 4ZI3A 2CCGA 4NFSA 2NXEA 1GR0A 1JWBB 3S27A 2IU3A 1IIRA 1KP3A 3IKLA 3T3PB 5LU9A 2OESA 3W90A 1SUEA 4LY3A 3NJ4A 3I0NA 4XSGA 4QX6A 4BLVA 3E7WA 2QK4A 1QH9A 1FQJA 1YUMA 1VLMA 2BFMA 2PO5A 2V9PA 1MEJA 4IOLA 1ODJA 4TS9A 4P4EA 2TMDA 1EX1A 4DLUA 4IGEA 4TT8A 1YRWA 3FOAA 4BRWA 3OOJA 4S3MA 2XCLA 1US8A 3Q8XB 4N8EA 3WMWA 1A9XA 1BXGA 3O4JA 2HA6A 2VXYA 2ODNA 1J9ZA 4MWDA 5CLGA 1K8XB 3RUAA 4B3DA 4D3SA 3QOFA 2Y1EA 4BGVA 1J8MF 2B6HA 4DCGA 4H35A 4FCTA 1CRQA 1CU1A 3QE2A 3O91A 4EARA 5SZIA 3RG2A 4AT1A 4YJ2A 1K4KA 4UNSA 5ITZA 1BQ3A 1UBTS 4HTFA 4NJEB 4LHEA 4ZAYA 3COSA 3I9V6 4REQA 4D9CA 1H85A 5CMLA 4C0WA 2EGHA 1PHRA 2VK8A 3KOXA 3Q7PA 1NIPA 4M0MA 3RSGA 4LGVA 2C7BA 3VAZA 2BCEA 2B4TO 3MAJA 2WTMA 4JEHA 3U0BA 1VKHA 1X1QA 1AE1A 4CF6A 3OKCA 5BXQC 2P5UA 3N6VA 4LRWA 4YV7A 3AUTA 2VDLB 3F73A 4JVSB 3CZMA 5FOTA 3VSEA 5JS6A 2F7SA 5L45A 2AE2A 2AJLI 3FUWA 2PGOA 1OXTA 3TBFA 4A10A 5KCZA 3INGA 1B2RA 3LLMA 2O14A 2JRCA 2KM1A 4KR7A 3LIPA 2BF4A 5HJ2A 4D46A 2C7QA 4G81A 1Q0RA 3TLZA 1FUYB 1T6BY 2DU8A 2AFVA 4GI7A 2RH5A 2H7XA 4NCXA 1FNCA 3HVIA 3WFJA 2I6UA 1UFKA 1M2VB 3X1XA 3DM5A 5AI9A 3OSUA 3BDAA 4AP5A 2C5AA 1JR3D 3FAKA 1N2CE 2O2XA 4EMBA 4KE9A 2WIAA 3MLBA 3F6PA 4OQZA 2ZIGA 4PLWA 2AZDA 3TFQA 1KFJB 4KXMA 4PTZA 2I3BA 2F1RA 5EKSA 2PANA 2YIMA 3HP4A 4QLAA 2J8ZA 2OFXA 1U6IA 3LM8A 4O33A 4E88A 5KOYA 4PLVA 5ALTA 2DWPA 4LF4B 3BICA 3FCXA 1D2CA 3UJPA 4NZPA 1VJTA 3VPCA 4DUPA 2J7PD 5AOBA 5KUTA 3SR3A 5FTKA 3Q3VA 2GCNA 3OTIA 1QCCA 1X13A 1GPH1 4GBJA 4AO7A 2A86A 4EI8A 5EZSA 4TV8A 4ZCSA 3H65A 4OI2A 2CHVA 5IG2A 2Y92A 5EE5B 1MO6A 3L1JA 2Q2NA 2YHUA 1THGA 2DULA 4G4IA 2KBFA 3VBCA 1XEXA 5KYYB 1A1SA 2QD4A 2JLZA 3F6SA 5TXGA 1FRZA 1V26A 1D2NA 2XF2A 2DH6A 4IXDA 2Q0SA 5F21A 5IH7A 1KZHA 4F4DA 4GE0A 2EZCA 4R1UA 1NQVA 2B7LA 2J9FB 4HJXA 4A3SA 4ESVA 1G38A 1J21A 4EVIA 3R40A 1DBQA 4GI1A 2GVDC 3BK7A 4V0RA 5FFMA 1U8XX 1I4EB 5JBNA 3QPWA 3KQMA 4LI3X 1OA1A 3FXAA 2Q41A 3R20A 4R8SA 5BSKA 3Q3EA 2XVZA 2YJ5A 3L7LA 1ZL2A 4Z7OB 1AQJA 4W9MC 1YOBA 1XJ5A 4UDOA 3U5ZB 4HAOA 5HJEA 4QYTA 1AOXA 1NHGA 3QZUA 4J43A 4EEKA 2GRAA 2ZI3A 2Z4RA 3BXEA 4OQPA 1NTOA 4H1WA 2RARA 1U9IA 3W7AA 1M34B 4NBRA 3LOUA 4PIVA 5A5DA 1OYVA 1S6YA 3QMPA 3U61B 1E3WA 1AUXA 1GAWA 3C3EA 3INTA 2QRVA 4FGSA 1I2MA 3CPJB 1J9GA 3I6ZA 1KTVA 4N7RA 3EEFA 4HRYA 4ZMBA 1G2QA 2PEZA 2J6CA 4N5HX 5AOAA 3G2OA 3L3BA 4FYPA 2CFIA 2AOWA 2AK2A 3AW9A 4EAQA 4P3YA 3AEXA 1W8IA 1E2NA 1UIMA 1ODTC 3GVPA 3IV9A 3L7OA 1CUBA 1RRCA 3BWDD 4JI6B 3WI7A 4A4DA 1JIVA 1JDNA 4Z3DA 5C2JB 4ND6A 1F4VA 1PL0A 3DDSA 4GR4A 4J2OA 1EA5A 4DSZA 7MDHA 1BROA 1MQ9A 4K2HA 5CDHA 1R9MA 3ESQA 1BE6A 1B73A 1P61B 3RQIA 1TEVA 2FY8A 4I6JA 5LDHA 3AY7A 4D4GA 4ZDWA 1XEWY 2BFEB 5HBRA 4ZPXA 1H2XA 1KDZA 3IKTA 1ZJ5A 1MF7A 2PZ8A 4GZ3A 5CK4A 2JLAA 4ZAXA 1DE4C 3JVVA 4BX8A 5I7EA 3D8NA 3KD3A 2PJRA 3MB8A 5LD2B 4Z4IA 3UV3A 4CL3A 3KKOA 4NU0A 1M9NA 1NF3A 2CVZA 2G5GX 3DHYA 3ZY6A 5IT5A 1T5BA 1YOVA 3OOHA 3MRTA 2ZE8A 4FE3A 3I9OA 4WXHA 1SCNE 3N7AA 5J2UA 3C14C 4P2BA 2C5QA 3OE4A 3CMMA 1RABA 3FNIA 2A4KA 4EG1A 2FP3A 1A1VA 3W6UA 2ZVQX 3KWMA 1AKUA 1ECLA 3OFVA 5JG7A 3WKBA 2P40A 5DI3A 2O8DB 2YFYA 4MVJG 2X41A 3IP5A 3FVRA 4F45A 1OX4B 1DIOB 3LUDA 4DV0B 4OHVA 3MUFA 2IF2A 2WQ7A 1JPUA 4MGHA 2NO6A 4MQ5A 3AX6A 1QZXA 4IVQA 5FB3A 4ZOLF 3ZIUA 2HJGA 1E6WA 3PXGA 3W8EA 1AA9A 1KMHA 2W2LA 3ICWA 1LX7A 3SC2B 5EHQA 1FMCA 4YFYA 2HZBA 1ACLA 1HYGA 1YR3A 2F62A 2QZSA 2Y93A 1E1RA 4IFIA 4IIDA 5KSPA 4ZP1A 2HA3A 5KQPA 2H1OA 1ZJ4A 221PA 5LCXA 3HRHA 3L0IB 2LD4A 4RL4A 2WKWA 2RE8A 5HDBB 1WUYA 3FNHA 1DC5A 1GKYA 2QIOA 3EC2A 1KEUA 1N5RA 1YIDA 2GPSA 2HIGA 3ABQB 3NM6B 3L7DA 4IFEA 2EW8A 3H4VA 4LYGA 4Z86A 3RRXA 4P7GA 1RYNA 2HQ1A 4XUCA 3DTNA 3L6CA 4JLOA 3ZY5A 3LSYA 2PUGA 4WQMA 3PXCX 3AYZB 4UVGA 5F52A 5HMMA 5K8CA 3DZJA 5L3SB 1NBEA 4KUHA 2HM7A 3L82B 4GZ5A 3HSSA 1FVFA 3Q11A 3UGQA 3UAZA 1EKXA 1Y63A 1NUTA 5ES3A 4UM5A 1CFZA 3W2GA 3WQQA 4GC5A 3U3RA 3DD5A 1TIPA 1R8SA 2P0AA 1X1EA 3V8VA 5KU1A 3N0TA 4TQUS 3WYDA 3LX6A 5B7PA 1XRPA 3O2JA 1CFJA 4AP6A 3CEPB 4KWHA 2VCHA 1FXWF 1NURA 1ZP6A 3L77A 5KYUB 5IPFA 4NBVA 3T1TA 1YR7A 2D74A 3DDUA 4RK7A 1G0OA 1SVUA 4Z0PA 1HA3A 2FRXA 3BGIA 3DFKA 2X5XA 3HU1A 1K68A 4IOJA 4PQYA 4Y2GA 3S44A 3T0GA 4KNGE 5C35A 1EQAA 1MG5A 1P9RA 3ZTWA 2VRNA 4N5MA 4R3WA 5HM6A 3KQQA 5J5AA 1KMQA 1TM5E 2P11A 3BM5A 3EUFA 5F9HA 4ME6A 1U65A 4YJHB 3CN9A 4FUTA 1A69A 2XODA 1T34A 5KIAA 4J91A 3LL7A 4CKXA 2C94A 2XUQA 4KAFA 2Q7OE 3GCGA 4WIAA 2EYQA 1O7JA 4MJLA 3K1AB 1QHNA 4O4LA 3SGLA 1ZM4A 1AU9A 1KXJA 3AHFA 1QB7A 2O2ZA 3GN1A 1X19A 1XDSA 4WZBA 5LBUA 5AVRA 4ENTA 4TTIA 2JCYA 1CJMA 2OAP1 3KALA 2IYRA 1K8RA 5IZCC 1ODCA 1VOTA 3OICA 2E9SA 2QHXA 4N0DA 4Q18A 1VMEA 3B1KA 3K30A 1PLLA 5FUMA 1IXYA 2HTFA 2VJQA 1N6LA 3IP8A 1A50B 4DT1A 2VXBA 3OX2A 1ZBDA 4BX0A 3K1ZA 3DBLB 3QBVA 4XDZA 3A6KA 4LKRA 5JAQA 2KS6A 2ZDHA 3HU5A 4H7PA 1SEPA 4FBMA 2H0RA 2QZ9A 3FRHA 4Q48A 1QO7A 2Q3MA 5T4FA 1DGQA 2C2MA 1O0CA 3WLHA 4TKVB 2PMBA 5HEKA 3AG6A 1EUZA 1HDGO 3NFRA 2RC6A 1QVWA 1AQYA 1LSUA 1PR1A 3F1KA 4B4OA 4ABTA 1ICIA 4D8TA 1O0SA 3NKFA 5T41A 3RWMB 2AK3A 3IMGA 4B33A 2WC1A 1FU4A 4IIGA 4XCQA 3ITNA 2SCUB 2QS9A 3SYTA 1KRXA 2DCMA 4MROA 2RGNA 3ABSB 1PNVA 2R4UA 2VHCA 3M1YA 2WSMA 3OY2A 1G63A 5KOHA 2WFLB 4MQ4A 5EUMA 5K5EA 4FGWA 3SZ3A 5IM4F 4UHDA 121PA 2FRVA 1ZA1A 1P1BA 4BGEA 1GN8A 4RTJA 1O6GA 9MHTA 4FYVA 2ZSKA 2V9CA 1OHHA 1NVKA 2W6QA 1JEOA 4KWTA 3V5NA 2ZEJA 2VPTA 1H4SA 1KEVA 2V3WA 3NRJA 2JZNA 4GX2A 4HDRA 5ADUS 2AB0A 1CZNA 3FTEA 3ONDA 3R3SA 1Z6PA 1KY4A 4LOHA 3NAQA 4U2CA 2WWWA 3TSWA 1Z83A 1OAKA 3U7JA 5JD6A 1JE0A 2HJRA 4K6OA 1Z4PX 2J0UB 1D3AA 2Z9DA 3RT7A 1P9OA 3RYFA 3SU8A 1L8LA 1YB2A 3ZJYA 4HAYA 4Y9TA 4U2BA 4R9UC 3RIHA 4EYSA 5CDTA 1NRWA 1IONA 4OQEA 2C7PA 1J8QA 1J0EA 2ASEA 4XPIB 3FTNA 4YR7A 1ESNA 1I9CA 5ALJA 2Z95A 4FILA 4TJVA 3V33A 5JADA 2WAMA 1XQ6A 2J87A 4HWPA 1Q1EA 1VYVA 3EMKA 3AVOA 1H0SA 3CBQA 1M1ZA 1ZONA 2JEZA 4BLRA 4PFKA 2IEZA 4JKIA 4PFJA 5KEIA 5YASA 4M1WA 4RENA 4LJ9A 4PXAA 1XZ8A 1DX9A 4MRVA 3TB4A 4TX1A 4BB6A 3V4FA 3RAGA 2IU0A 1TX4B 5C32A 2HJVA 4LK2A 1I5EA 1SPXA 4L6IA 5E1OA 9ATCA 1HO3A 1F5NA 2PSDA 1L6RA 4X8HA 4CCSA 2DETA 4DB2A 4V3BA 4ECAA 1RYDA 2CB9A 1H05A 3QPAA 3VO9A 4ZCMA 3RTEA 4R8KA 2CHUA 4NH0A 4DCMA 2C6GA 5IULC 4JLPA 3JQGB 1XYGA 4B9AA 2BV3A 4KXYA 4P84A 4XX0A 5A7HA 2IUUA 1Z0FA 3S2ZA 3CZQA 1X7GA 3NQ41 4HNAA 2C95A 3K0KA 3EFEA 4KKVA 1IZ8A 5J59A 3TL6A 1IBKB 3I34X 3RVBA 4K6GA 4F2PA 2ZSJA 4LF8B 3UXEA 1XELA 1PDVA 2XEIA 2WLSA 2FOLA 2OOTA 4GDMA 4OC2A 1NP7A 4F92B 2QLJA 1MNQA 4Y6GB 3VNVA 3K9TA 2GBFA 4XGRA 2PLWA 4C43A 2CDAA 2R86A 1XLVA 3PQ2A 1U0NA 3VPBA 2F17A 3JQBC 5IVKA 4PX9A 4CLRA 4LZPA 3IBSA 2HAEA 2Q6LA 1TI7A 3G9XA 1PR5A 4G4SP 4EPTA 2UYHA 3GG2A 1C0IA 2P2ZA 4GGOA 1WCYA 1JU3A 5DNWA 3PX3A 5IJ9A 1GYPA 2C83A 1YB4A 1Z7YA 3E4CA 2Z1MA 4TXMA 5EIFA 2XNJA 1KEZA 4CFYA 2VQDA 2HFJA 3GMIA 4L8YA 1RQPA 3HDHA 4H3SA 1AGRA 5AJWA 1V6AA 2HO5A 2B1IA 3DKPA 4C78A 4I08A 1N6IA 2WVHA 4IHJF 4MQFA 1RZVA 4J6EA 4Y6QA 2XEJA 4G0MA 2A5LA 3EPHA 1KIMA 3UK0A 1JW9B 2A30A 3FBTA 2B92A 1C3OB 1UXHA 4O5AA 5DM1A 1NVGA 1Z74A 4FGKA 3AWDA 5C8VA 1NX9A 2IEBA 1CZRA 1Z33A 2QB5A 5THKA 3T0FA 4D81A 4DGQA 1QHIA 1JWLA 4ZOLA 3DOUA 3I5AA 3VU9B 2GNOA 5AXAA 3NVAA 2JLQA 4ZTZB 2OE2A 2AFHA 3GFFA 1PR3A 1DRJA 2AEJA 4M8NE 1ZGCA 1DAKA 1QGDA 1IMJA 2PZBA 2Y76A 1QPBA 3AB8A 4YJ3B 4DNXA 5DIZA 3H6KA 2C3MA 2JARA 2P4QA 3HR4A 5FA8A 7AT1A 1CQWA 1O8BA 1WAMA 3HKBA 3T38A 1KMNA 3TZLA 1O08A 1XNGA 1XNHA 1JN0A 1XQ9A 2CXSA 3B60A 3DT8A 3OQBA 2YHIB 4W9RA 1BD3A 3GGJA 4DBZA 1P0PA 2KMLA 2PAAA 2NUPB 4E6PA 3WB9A 1PJ8A 1V7ZA 1K6XA 3ZQ4A 1TK3A 1R88A 1RIFA 3CRNA 2D1FA 3DOJA 3FCOA 2QORA 5DHRA 4I3GA 1FOEB 1L4MA 4DEYA 2XBUA 2FKNA 3TNFA 3UGJA 2PSSA 2HXSA 4OP2A 2H54A 3LHIA 4MWSA 2BSQA 4BZZA 4H17A 2ONJA 2BFCB 2GPAA 5I9LA 4YAEA 4GOJA 2RHTA 2XT0A 3LUFA 4IJKA 4QXMA 4R1SA 2RAUA 5EZYB 2V4ZA 4ZVRA 2O52A 3AU9A 1H5QA 3UXYA 5HUQA 4LWZA 3ZHVA 3AY3A 2WMYA 1DDGA 1JYFA 3QXXA 1Z7EA 3UV6A 3MFQA 3QUCA 3U7QB 4UDYX 4WN9A 1Y3DE 4YCNA 4R81A 2QRQA 5FUVA 5FYDA 4BJHB 3PI7A 1QP7A 5JECA 4HEQA 2WVGA 3KPUA 4A2QA 1LI7A 1LBTA 3X1MA 3T06B 2ONKA 3PC4A 3EFHA 4YCJA 5MHTA 3LYHA 2LW7A 4QXPA 5DHTA 5HG0A 1BZYA 1CYDA 5I7WA 1UQUA 3L7KA 1RE0A 1MORA 4V03A 2G72A 5F7XA 1Z56C 2QUIA 4C0BA 5KS2A 2R65A 1TC2A 4E0BA 5E4TA 5BWCA 1MLDA 1O6BA 2DKNA 1R9JA 2E3JA 4FFSA 2R8EA 2ZAOA 1F4LA 1J2JA 4F7WA 5ES4B 1KS2A 4C14A 5DM0A 4U7JA 3N8GA 1WP4A 1KY3A 2QLTA 3S0JA 3WK4A 4MQFB 4MSUA 1TO1E 1YRHA 3FRJA 3GFBA 5L7TA 2FSGA 1N2IA 3N5CA 3R5SA 4NK4A 2ON6A 1UOQA 4I1VA 4NOMA 4CMIB 1A5AB 4BNDA 4NGTA 4GPEA 5I7SA 1E2GA 1KXZA 1NRJB 4MQEA 1QS0B 1JHVA 1MAWA 4NAHA 4PRLA 3C16C 3VR6A 3MMPA 3QVGA 4OV6B 4E03A 3OCJA 1V0JA 1TJPB 5IJ9B 1EEXB 2A0UA 3LFHA 2RAPA 1HL3A 2WJAA 3A25A 4IO1A 2IX9A 4K9KA 4C7KA 1ZGZA 3FBWA 1NY5A 2A1TS 4XYBA 5AKHA 4BWYA 2PPVA 4C0LA 5JSZA 1U2TA 4HDOB 3UYKA 4EK9A 1K8QA 1O4WA 5TGZA 3AFHA 1YDGA 3NRCA 2XKJE 1HMYA 5HWSA 1J8VA 2IV3A 1E20A 3IH5A 4KUGA 3WMRA 3BD7A 1OH7A 1Y34E 2A78A 4QGGA 3ZGXA 3NP7A 2F1IA 3VTKA 2ENWA 4P35A 1X15A 1L4BA 4MI3A 2X4LA 3K2EA 2GARA 5ALHA 3WBFA 1M2FA 2P0YA 3FPAA 5EXPA 4CIAA 1A8IA 4OL0A 4W7SA 3EZLA 3P5BA 2PX6A 4YROA 4BLTA 3QPUA 1BQ4A 4K86A 3KJNA 5LB4A 2DE0X 4RQTA 1DIBA 2QPTA 3CZPA 3QU4A 1M54A 1OGJA 1DEXA 4JDPA 5SY9A 1Q7RA 1YE5A 2J30A 1AS3A 3PRYA 4PG7A 5AI6A 3VFDA 4A0FA 5CGZA 3HXOA 1D0IA 4DIKA 2D62A 2P30A 1OZHA 5KOJA 1EBBA 4YC7A 4CHTA 3V00A 4JOBA 1G17A 4PGFA 4XJXA 2XWJI 1NVVQ 4F1KA 4RGQA 1DRUA 3TD6A 3KQTA 3MGCA 2AOTB 3KYDA 1OWMA 3QLJA 2EL9A 3H19A 3CMCO 4JC8A 2XSZD 5E6RB 4OC3A 3EAFA 4P7BA 3PJDA 4PFSA 4KCGA 2REQB 2VHUA 4BY9E 4F3TA 2VBIA 1B8PA 1FYFA 3EFOB 1O6CA 4HH0A 2OMKA 4W5OA 1ABBA 2RCNA 4AMVA 1PF7E 1NG1A 1W8DA 2I4LA 3CS3A 2AWOA 4TWRA 4A0QA 1XZFA 4IGIA 3PWSA 1YIOA 4JJZA 4CUKA 4DDHA 2V45A 4WK6A 1UWLA 4TS1A 5CM9C 1Z63A 4NOLA 1D1SA 1A7AA 1L4EA 3L6BA 1X8JA 4YAOA 3LC0A 1QKIA 1QFXA 2O1EA 2ZSBA 1MFPA 4V1CI 4KACA 4B45A 2V65A 2FF5A 2ZBUA 3H11B 4U3JA 4YRDA 4RY2A 1RPZA 4MYHA 4MS1A 4UPDA 2FR0A 4OKSA 2EJTA 4ZDIA 3RRMA 5I3ZA 2W4IA 4UREA 4L5JA 3UJDA 4Z51A 5KYVA 1N6OA 4HYYA 3AF5A 3F46A 3TUIC 3WYCA 4Q24A 5JI2E 3IAAA 3OTOB 4RIFA 1V3TA 3FWNA 3TZHA 5KYNA 3MOGA 5FUXA 3HJBA 3DE1X 1GGFA 3QI7A 3SHOA 4JJ8A 1EXWA 2OYRA 1BS9A 3CR7A 3BMOB 3BRWD 4TPKA 2OZKA 3ZHSA 2Y67A 2YICA 1T5HX 2ATCA 2HSGA 1QG0A 2DF8A 2F3SA 1IY2A 1JAHA 1MB2A 1T9KA 1UXJA 2WJVA 4WNAB 3TIIA 4EW3A 4HADA 2XNHA 1VL2A 3DEJA 4MRMB 4EUNA 1O4VA 2WJJA 2XXBA 3IUEA 3MCWA 2QM7A 4RFVA 2I0FA 2FMFA 3H86A 3PNPA 3FWHA 4MCRA 3JR3A 1N4AA 4P0QB 3EF1A 1L4GA 1TXGA 4ZT5A 4Q7QA 4Q9NA 2X0RA 4FKZA 2YV3A 4MUMA 4XSHA 1YBHA 3FZEA 4I3FA 1E2FA 2I3ZA 2CUNA 4LWQA 4O2AB 1O94A 3OIUA 3R4CA 1PV2A 2CHFA 1V96A 2WJ3A 2V7PA 3HY6A 1EXNA 4HNRA 2K6GA 3WYGA 3GQBB 1TAUA 2ZE6A 5CYFA 2EHDA 3EWSA 1U3FA 4RQUA 1SZCA 4U7GA 1F9EA 4QC2A 1K7YA 1YZGA 4TSFD 3SWWA 1BN6A 2JFWA 2G28A 4S12A 3T5MA 1QDLB 2WSYB 3AK4A 1T8PA 4E07A 3NFYA 3L7MA 1JTVA 3QA3E 4BATA 3ANNA 3DH0A 2XYRA 4WTOA 3WSWA 3KSMA 1UWVA 3O2QB 5D7NA 1GHTA 3CSUA 3EGWA 3WYEA 1G98A 2PVPA 1A7JA 1XU9A 2HRDA 4LY6A 4CMHA 4NE2A 5H8WA 1EVJA 3HPRA 4O4LB 1NLZA 2NYVA 2J85A 2EKDA 1VCNA 3BB1A 4ETIA 5I7RA 2CNLA 3AQ4A 4OH1A 1RXIA 1G6HA 2RHJA 4OX9Y 2O20A 4J0FA 1AKVA 1CUUA 1BXRA 1MB4A 5CXSA 2CVOA 1N75A 4C9AA 4U7FA 4JC0A 1VGQA 5F64A 3PKIA 4PZDA 3Q8LA 8OHMA 4YRMA 3LH5A 1DCFA 2E4UA 5LXTF 1J1IA 1VFNA 3SQXA 4Y2SA 1ZESA 2VDKB 4QIHA 2G4CA 4G1VA 1IAQA 5HX7A 2GUWA 1VHJA 3NHZA 2XGJA 3ZWKA 4QJIA 4XR9A 1UMBB 3K70D 2A0YA 3H5IA 4TLMB 2OGUA 1NJ5A 1OQAA 1Y98A 3GPCA 1VHTA 4JC4A 1U0LA 3A31A 3K73O 3DTYA 4TRJA 2Q3LA 3PNSA 1QWOA 5JXHA 4TM7A 4Y98A 3E35A 4NAVA 1GQRA 4TSRA 2DYKA 1PR6A 5FWAA 2A92A 4Q37A 4X1IA 3EODA 3OO0A 1EJ6A 2JVKA 2CL5A 3I6YA 3IHTA 3ROPA 3S2FA 3FMFA 3AINA 4DCJA 3WKDA 4F2GA 2ZBDA 4HPJB 5J2TA 3H5WA 4QAQA 1ISSA 4QL3A 1J39A 1X8KA 4UD2A 3AVTA 2Y1GA 5CD1A 2Y1FA 1ATZA 1GGEA 1QU3A 1JHAA 5AUNB 4PGGA 4KREA 1NKTA 2QTVA 4OXKA 3U6BA 2AIRA 1XJCA 2X13A 5G1PA 1GVNB 3JQQA 5GONB 3RE1A 1ZUNB 3NBAA 2CFOA 3KLBA 4FMBB 5JVDB 4QBHA 3QPBA 5F7JA 5IAEA 2ZRAA 1ULTA 4RVCA 4TLLB 3FDIA 3ZWPA 1J70A 1FTYA 1HLFA 3QVMA 1BWRA 3EMVA 1EDDA 1AGYA 4X20B 5EPUA 1Q0ZA 1Z6QA 2CMGA 2J5BA 3ZCUA 1BVUA 1YCHA 1Z5NA 2FX5A 3ACCA 3PDHA 3GLFA 4DXAA 5DM2A 3BIFA 2V59A 5JZVA 4CUJA 4AG6A 3PCTA 2FSPA 2FRDA 3PUJA 4MVCA 1PD0A 1ARZA 2FPGA 1GZ6A 3C7CB 4GSKA 1JFVA 3FUVA 3MXTA 5E1MA 4AF8A 4IHQA 1G4AE 3N8IA 1NNLA 4MS3B 2I6FA 3K1YA 2GGSA 1T5SA 2J3DA 5E3IA 1NVEA 5NLLA 3K4PA 3NTOA 4M8IA 1GD1O 2V6FA 4ZCIA 3DC7A 1VTKA 4H3KB 3JWJA 3C8HA 2EX1A 2R1VA 2ZJ5A 4FYXA 4V0ME 3T9CA 5C5EA 2NAPA 5AVTA 3J7TA 2H4WA 4FN4A 3A6LA 5I8ZA 2R8ZA 2JBKA 2XDAA 5GWXA 3BQMB 1PSWA 4HSGA 4UEKA 1IQ0A 4HDQB 2B7BA 3QWHA 2H17A 3ANLA 4MRMA 1NQAO 2ZIVB 1E58A 2JD1A 1ZJJA 2QW1A 4U8GA 1DTWB 1I1HA 1VQ1A 2EFJA 5IFLA 3GX1A 3JVUA 2QSYA 4G1MB 2VZLA 3KYCA 5LYYA 2KB0A 1G5IA 4E08A 1VJCA 3O1IC 2IY9A 3CTPA 3SFZA 4F3CA 1XTTA 4JLWA 5AVJA 3U6KA 4PAOA 3DXZA 4IMIB 5FTMA 1LF0A 2PGNA 2I3GA 4NI5A 2QN6A 4DRXA 4RETA 2UXDB 5TQJA 1KC7A 4H7JA 4QQ8A 2QBYA 2I2WA 1ZOPA 3JAWA 4KQ1A 4DMCA 5KYGA 2FPIA 2NXJA 4CTJA 2NX2A 1JFLA 1HYEA 1K92A 1OASA 2FG6C 1YE3A 2BGMA 1P31A 3EVCA 3EDQA 4FCCA 4QJ5A 4EP1A 3NANA 3AI1A 3F3SA 1E5DA 1ORWA 1SUSA 2H8KA 1I7PA 2OA0A 4P5EA 4IJ5A 4EI2A 1PUIA 4YREA 4RE6A 3BEDA 3F74A 1VJ1A 1WZNA 3BREA 1FSSA 2ERYA 3PWKA 1QHHB 2Z08A 3NCHA 3AF2A 1QORA 4TKUB 2LBPA 1ODFA 4Z7NB 2AV6A 4TTQA 1Q95A 4WCFC 2WINI 4EJ0A 2VPYA 4YQEA 2Y2VA 4LYDA 2PLRA 4K7JA 1E69A 5TJHA 3EVEA 3CNOA 3VO8A 721PA 4G9EA 1JB1A 1OV6A 5IBRA 3H13A 3WMGA 2CLFB 2KX7A 1HEYA 3E7FA 2GXQA 2E49A 5DBGA 2V1XA 5F3RA 2PLNA 5I7AA 3CLKA 4ZK2A 2OBBA 4P4SB 1J5EB 3C39A 3FJ1A 5J5VA 3F98A 2BMDA 4A5OA 2H0QA 4U39A 1X80B 5I47A 5I6DA 4U7DA 3MGGA 3DW3X 4HXEB 3IURA 4HQ0A 3UOGA 2ECPA 1Z0JA 3U9SA 3KYDB 4DLTA 3VZBA 3ZJUA 2BUBA 3MPUA 5J23A 4NJMA 4FFDA 4C5BA 3B1ZA 1IZ9A 3VH1A 1EWQA 3UWSA 1ZMXA 2J3HA 5CJJA 2ZTLA 2I4IA 1PTJC 1WDTA 5WRFA 4ZYLA 4WGFA 4IM7A 4EFLA 4XCXA 2V5VA 2X86A 3NX4A 5TNXA 2ZRCA 3ZCQA 1Z7BA 1H2WA 5FF9A 2Y4NA 3GJ0A 4U5QA 2I65A 2ABWA 2QL9A 3WXMA 3LLUA 2PU5A 1A9YA 1QMGA 3E22B 2HT1A 2ZE7A 4EYQA 5K2OA 1M8KA 2XUHA 3NBMA 1GKIA 3P9ZA 2E5FA 3SJ7A 2XB4A 1ZSVA 3TQTA 3VHLB 5F98A 2CZGA 4AF7A 3WK9A 1ZM7A 5KSYA 1LBSA 2XOXA 2EGGA 2D0DA 4TTAA 1RKQA 4P4NA 1CNEA 3DBVO 2Z3VA 4B6FA 4Y2HA 1G16A 3S68A 2EHJA 3ZXIA 5JWHA 2BJVA 3ZHQA 5IANA 1H2HA 4ZU3A 1TEHA 1YJQA 5ULLA 2DPMA 1R4MB 4LZNA 1YJ5A 2IHYA 4YB8A 2EYUA 4I4TA 1P3JA 3I04M 4X1YA 4C85A 5CNMA 3OEED 1RQ7A 4Z2AA 1A5BB 4ENPA 3PIDA 1EH5A 3KAQA 3ADDA 3G3EA 3D6NB 1BQEA 4XX0B 2VQSA 4G4GA 2LCFA 4BFZA 2G80A 3EA0A 4II2A 4NYIQ 1XD2B 4I55A 5JS1A 1BEUB 1CS0B 2R96A 3MF4A 3OQJA 4P31A 3ZZTA 2EWMA 2FPSA 4ZI7F 5G0WA 1QQAA 3UWDA 4D5GA 4B2YA 4P4DA 3GBSA 4OVKA 3RU3A 3OTQA 1PBTA 3ESDA 4G9BA 5LZ5A 3UVEA 4EECA 2QX9A 1Y5NA 5D5HA 5IXSA 1L7AA 1WCIB 2VTBA 2FHSA 1ETHA 3H1TA 1W4LA 2OCLA 4IQ0A 3SI7A 3V4PB 4RZQA 3AP3A 3HVHA 4DJFC 1E66A 3WBBA 4H7FA 1U1EA 2DEUA 4TZ6A 1VSQA 1QGOA 1E59A 3DDWA 4PCUA 4V0QA 1JJIA 4BJ1A 5MN6A 1ZAYA 4R8MA 4UD6A 4JT8A 5H02A 1M2OA 1U04A 4K3VA 1J7JA 3GOHA 1J23A 1PFVA 3HDVA 3A6HA 1O6ZA 1Z0DA 2B4KA 2X58A 3RRZA 2Q9CA 4BDSA 4RJKA 2K2QB 5AM0A 3DVSX 3GDOA 4RVFA 3BRQA 2GBLC 3GW8A 2G07A 3WLEA 1MTZA 3PPXA 3WKAA 2C03A 4DRYA 2C9YA 3MWJA 3ZH2A 4PFQA 4M0KA 2GZDA 4J0IA 5B58C 4TOIA 4UUMA 3NNDA 2GK7A 1Z25A 1H3NA 2F2TA 2F8LA 3MERA 2WPNA 2YJNA 3OESA 4QEDA 4N40A 4Y6SA 4E2WA 1WKCA 3IUBA 1MX1A 4J9VA 2ICAA 1GDTA 3IILA 2J9RA 2N47A 3ZWWA 2IZOA 1S3FA 1SKYE 1BCRB 2IOQA 2QT0A 2ZJOA 2ERCA 3C41J 3CUYA 3Q7IA 4I9FA 2OAGA 3L0ZA 4L7QA 4ND8B 3GD5A 1NMYA 4KQJA 4O63O 5L4NA 4YV2A 1RM3A 3F5FA 2VEDA 4E5UA 3NHWA 5I4KA 2QAGC 3FNRA 5TQ0A 1LS1A 3CLSD 3VNAA 2NP7A 4LRXA 1AO3A 3KELA 1VLVA 4O4JA 4ZT7A 4DR1B 3K92A 1JILA 1FVXA 2AFIB 2JJ1A 1H0HA 3KT8A 1T10A 3ZXUB 4EO4A 5B57C 1J97A 1T9GR 3WGVA 4WL0A 1OH8A 1VPDA 5JQWA 2GTIA 2V0NA 5AVUA 3JZAA 4S1TA 1PFUA 4DMMA 3F4BA 3HO6A 5DV9A 2FFHA 4NYJQ 3PUWA 1L5OA 1I5OA 5KNDD 1KF0A 4BRZA 1Y6ZA 3DAHA 2VHWA 1Q7BA 4QTTB 4KVFA 1FTQA 1I3KA 3UATA 1BU5A 4UUBA 4L3WA 1PJ2A 1T5OA 1U0TA 4WI1A 1W36C 2AQIA 5AXCA 3U3MA 1FMFA 2NU7B 3QLTA 1WCWA 2R82A 1XZDA 2BZ0A 1Y82A 4ZOLB 4H27A 3VDXA 3W1EA 2XWQA 4DQUA 5DFAA 2R751 3OA0A 3I74A 5KX5F 1E2LA 4EY3A 3DNFA 2JBAB 3WIOA 5EMKA 1S1MA 4WERA 3A06A 4FMCB 5BVHA 5DTQA 1HT2E 1ORVA 5LP6B 1RI4A 2VQEB 3U13A 3D0KA 2F8MA 4C0JA 4EQZA 3NHJA 1E9VA 3LNTA 3CYFA 3K1AA 4GMXA 3KWFA 4XJSA 4F5EA 4CR6A 2Y3IA 1G19A 1ZUNA 5JVDA 4NFLA 5LQUA 1XRNA 3FKJA 2BDUA 3DR3A 3VQTA 2FFAA 1T0HB 2A0KA 1LTHR 2JI6A 3GRKA 4G26A 2VDWA 1XAHA 1DARA 3QFHA 4P22A 1LQTA 1QV9A 3DYBA 5AW8A 1FL9A 4J8PA 2C2KA 4LYEA 3PQ4A 3TLKA 1S9HA 4J29A 2OXTA 3RASA 4A5SA 5CLJA 5B4UA 4EFMA 4IF6A 5ICFA 1I36A 2IUEA 4TS3A 3TR5A 2R7KA 5A5VA 5LQAA 2QL7A 1P2VA 4Q9DA 3LBNA 5CXUA 1XDBA 3QKIA 1JTEA 5A5GA 3C8OA 2B3TA 1SR8A 3JATB 4UNIA 4X1IB 4K2AA 3UV7A 4B34A 2WA2A 3LX8A 1QF9A 2GJ4A 3N2YA 4RCZA 3EGCA 4YXFA 3A6PC 1TTQB 2RI6A 1UT8A 1WUKS 3R75A 4U2FA 4LMAA 2F67A 1P2BA 3PV0A 5K2MA 1TUGA 1MABA 1VLJA 3BBPA 3MJRA 1NSYA 3DUFB 1WS6A 1RKVA 3QI2A 5JU6A 3CZRA 3ORQA 3HRIA 4WFJA 2QDKA 5G41A 3GLHB 3WWOA 2BEKA 2X1MA 4B3IA 2JBHA 3TUZC 3K2QA 3MTAA 1N1MA 4I1PA 3OT4A 3G0OA 3UAWA 1ZI9A 1TF5A 1PG5A 3KSRA 3CLSC 3S8EA 3SJEA 3QEMA 3U62A 5IRCD 4AQ7A 2W2MA 4IJUA 5G4LA 4ASUA 4C20A 5JHHB 2ZXUA 1XZBA 2PK3A 3MT7A 3PGA1 4AZSA 4FNGA 3MMSA 5EJ8A 1T2NA 4W8GA 1WBDA 1YVDA 4YHHB 3RKRA 5AK3A 4EIWA 2FMHA 5DKFA 1U8YA 1KYTA 2VH1A 3QW4B 2X5OA 1EUDB 1ORDA 2GN2A 1GFSA 1S2DA 2OHJA 3DEIA 3PLNA 4Q7MB 4AZ0B 4H0FA 3DFZA 5A4MS 5FWYA 5IB9A 2DERA 4GGMX 3LPDA 4E1BA 4RGBA 3ZWMA 3Q9LA 3EXFB 4G5FA 4LZLA 3RYFB 2PWBA 5C51B 2WYHA 2NNWB 3HCCA 2JS7A 1VKZA 1JEQA 2J3EA 4I50A 2Z5VA 2ODQA 2W70A 2AMVA 4ND3A 2ES4A 3ELWA 3L40A 4WV3A 5EE3A 3A6FA 1DIRA 3QH4A 4LA4A 3GFRA 3SYRA 2X77A 3C5VA 3P97A 3QWFA 4JQYA 4Y2JA 4MB6A 1JQJC 1AJEA 5A05A 4PGMA 1P3DA 1SU8A 3M6IA 4H08A 3ZY4A 3ENZA 3FPSA 3IMCA 1VCMA 4D42A 3K94A 3WG9A 1A88A 1V5WA 1RACA 4QFBA 3S70A 3B2EA 4LXXA 5TQ2A 2IYQA 4D79A 3H1AA 4P92A 1CJCA 1YS6A 2PDAA 3UTDA 2IH5A 3Q40A 3SZLA 3BFPA 1U7TA 4JI7B 1W59A 2JFXA 4BEWA 2J0VA 5BMVF 4DPLA 4FIZA 4W5RA 3VZRA 3DV0B 2ZYIA 4KOAA 2BD0A 2X8WA 1X1DA 2WWIA 3AUJB 3O2SB 1HLPA 1ZGAA 1BGVA 2H9IA 3LQ1A 4HT3B 2IRWA 1XJQA 1XKLA 2QRPA 3GGGA 4WE3A 4WSOA 5AKKA 3C98A 5FRDA 2EKQA 3EIUA 3ZW8A 4E14A 1YC5A 1M73E 1YS9A 2ZRHA 4YRGA 5K0SA 1Y1LA 2E55A 2R1VB 2WIDA 4Q4JA 4Y1RA 4B4DA 1SK9A 4BNVA 3TECE 3BCSA 4BVFA 3I30X 3QMMA 4WLNA 3WZ2A 4LNUA 2ZRMA 3CGGA 3HO8A 4I4TF 1AZWA 1TZJA 5BT9A 1RJGA 2I71A 3UBTA 4OO3A 4MWZA 3U7HB 2R5NA 4BWGA 5EJ7A 5HW0A 4MV0A 5BRAA 2B8JA 3RS8A 1W9HA 4RD2A 1JAIA 2WP8J 1B8UA 2E89A 3IODA 4KAJA 4Y2TA 4CQLA 4Z4CA 2UYYA 2FN3A 4GYYA 1IJKA 1ZHHA 2BGGA 3ZH9B 4EUFA 1CJSA 1NUSA 3FGPA 3FMOB 1SKBA 2ROQA 2IJGX 5CFPA 4J1QA 1CNFA 3JQBA 1O57A 2GFIA 2ZCJA 2CV0A 4URFA 4DTIA 1NY6A 4LVOA 4OC0A 1YL7A 3V7NA 2ZRLA 5CA1A 1XRRA 5KVAA 2CN1A 2UVPB 3CBGA 2H1CA 2UYCA 5GONA 1O97D 2ZRDA 2P4HX 2RHWA 4HDKB 5TVGA 4GKKB 3H84A 5FUYA 5AQ1A 3H8WA 4KBYA 1QIKA 4RV9A 10MHA 1F17A 3FSRA 3RBZA 1FLNA 3OU7A 1INLA 1NV8A 4NQZA 1ACMA 2XCOA 4PU0A 1WA5A 2WUVA 3G2QA 5EA2A 1M0SA 5BQPA 1FW8A 5C8ZA 3ZDCA 5J3JA 1F4PA 1H2BA 3TXYA 1FJGB 3FZNA 2W6JD 1BXZA 3KOOA 1WR8A 1DKOA 2XVAA 1ZN8A 1CXZA 4HYQA 2M6RA 2SKCA 5AYVA 4WK0B 1JQEA 1UIRA 4C6SA 1J5XA 1PGOA 3U3JA 3GLHA 1Y6RA 1U5BA 1BKSB 5KI6A 3BCUA 4G0PA 3IE2A 4LRYA 1USVA 1Z4KA 2AWNA 3S4YA 1UK8A 2PY6A 2VYNA 5FV4A 1VE3A 1EFDN 2PZLA 2VPXA 3QPCA 5D51S 3SQMA 4KFSA 1H1TA 2GN9A 4JSRA 1ID1A 1V41E 4G5YA 5FBWB 5F9FA 3RBUA 2IITA 2BSAA 3B70A 3RFXA 5ARCA 2GK6A 4C4PA 1NBME 2C84A 5DNCA 4FC7A 3DBIA 1IC6A 2X22A 1O58A 4JWKA 3ON5A 1QVAA 1PKEA 1VMDA 2C97A 2R4TA 3GJRA 4ZHQF 2GN1A 3NH6A 5AI5A 1ODSA 1JP7A 1TOAA 3QXJA 1OLXA 2P1RA 2R1ZA 5K3DA 2LTAA 5DHFA 2DG2A 2WHRA 1IM5A 3QVXA 4C8AA 2FCAA 2ZBGA 3RRJA 2D06A 3MCZA 2D7CA 5EGSA 5K6TA 5IAAA 5KTRA 3W4KA 1OXMA 3QXCA 2F9LA 5ALZA 1VLHA 2J33A 3R0ZA 4KIGA 3ZX5A 1T8WA 4DIMA 4QOGA 3RAEC 3JW8A 1S5PA 3OCXA 4ZZ0A 3OF5A 1PYGA 1SVIA 5J4YA 3ZLVA 4KXLA 3RTCA 5HKBA 1YIAA 1XEWX 4CKEB 2C1XA 3E53A 1RXYA 4DBVO 5LR6A 2OGZA 1YCFA 3B1YA 2WKRA 1P45A 3D2CA 3FPCA 4NDAA 5EJ6A 3OMWA 4N49A 1MZPA 2DVMA 2ZB8A 2W48A 1TRHA 1XK7A 2EZ9A 3SR4A 3LP6A 2R97A 2P9CA 1GG9A 2WLTA 1DRKA 5D5QA 4CE6A 4ZIRB 2FUEA 4MIEA 3FUXA 3KR9A 3FPGA 3DLHA 2VBGA 1VSBA 1NVXQ 5ALUA 3ZNPA 2Q3FA 2QYOA 2Y9PB 4PZLA 3TBKA 4EY4A 4TMKA 3CRMA 4FJ0A 3ICUA 2GX6A 5TQVA 3FCSB 3TR0A 3GHYA 4TROA 4BVLA 4C30A 4LXQA 3FW1A 1W0JA 5FPTA 3I8XA 5ILOA 1TECE 1DBSA 2XMBA 4YMWA 3UCXA 5FHQA 3KB2A 4YV1A 2ZI6A 3A2LA 4K40A 2ZZNA 4PIMA 3BE8A 1XDZA 1QAOA 1UK7A 3K9CA 3P9PA 9LDBA 1Q11A 1RXUA 1HFJA 3HI6A 2JJQA 3HU3A 3AR8A 3WS7A 4GC9A 3NBUA 4GLJA 1U3TA 5JPDA 4XYMA 2VT7A 5TPZA 1HKUA 4CF4A 4R7TA 1KEKA 1GRVA 3T7RA 4IZ6A 4OLAA 1B26A 1SHTX 1E18A 2HFKA 5FNVF 4L9RA 2WIGA 4M0EA 4OLHA 5FBQB 1ZC3A 4NGSA 2R8OA 2RHHA 2FEPA 3VJLA 3SK0A 1G7SA 2K87A 3L7AA 2XUDA 2BGKA 1OE0A 4FR5A 1NSFA 1UDCA 2CMKA 1VCHA 2Z2KA 4OQQA 5KZMB 5AJYA 1CEQA 3UMCA 3DSRA 3T35A 3ZKAA 1ZUIA 1TZ2A 1G7TA 3VA7A 3ZD7A 4M7OA 3O4RA 4MWCA 2QZZA 1I1QB 2FV8A 3DCJA 3JVDA 4RXUA 4BNWA 4CV1A 3TQHA 5A3QA 1V8PA 1YAHA 3EVZA 4N39A 4O8ZA 2I2BA 3K9HA 5JCPA 4KC0A 4CDRA 4DPKA 4IOKA 1M1XB 5T3YA 3WIBA 1QIEA 4EYOA 5BW4A 2AZXA 4F93B 4QNNA 3H9UA 3BHJA 2Q6TA 4UZFA 5B2EA 3DHNA 5T4BA 1SWWA 2KSQA 3AGQA 3EGEA 4XX1A 2P75A 4IICA 3SNKA 1X3LA 2P2LA 4HVCA 4D7AA 5KOIA 4OHKA 1DJOA 5LWQA 2XZTA 4IKOA 1COZA 3CCBA 5DT9A 4EITA 4URXR 3GEHA 3E3AA 1UBMS 4R98A 3SS8A 1E1CB 2PUHA 2QP3A 5HF5A 2B9VA 2YXDA 4HNVA 2YW9A 4NY1A 1BGWA 4ARCA 1G8JA 4FYIA 3NWJA 2AN3A 5ERGB 1NZDA 3AVXA 4Y2RA 3WL4A 4F4CA 4AI6A 4W6QA 1WCIA 4DMKA 1CR4A 5AK5A 1X7XA 4EJFA 4LMBA 2J9FA 4I50F 3HY4A 3ADOA 4GH5A 3GFSA 2BHNA 4NICA 4M8KA 1N5OX 3X1WA 4BVAA 4UOZA 5LMNB 3I09A 4CFZA 3OPMA 1D1PA 1FX1A 3RARA 5E8JA 1WETA 4DIEA 2FLKA 3M4YA 3CF4G 3N2EA 2OVFA 4NZZA 1YNOA 3A37A 3RIXA 2XZDA 3ZU2A 4IUYA 1TPZA 4GOMD 3RSSA 1NPTO 3K0AB 3UANA 4ZQGA 2ISQA 3JX9A 4CCAA 1CERA 2WABA 3PC6A 1XRMA 2G25A 4JLJA 2A5YB 4NHEA 3QQPA 4AO8A 4N18A 5F2EA 4CL0A 1LV8A 4OF4A 4FP9A 2DR3A 3CO5A 4BMYA 2O5EA 4X71A 3BVPA 3N87A 4EL5A 2PYIA 3PDCA 3MMZA 4DREA 2QTLA 4FDTA 2WFZA 4RD1A 3L92A 4CPDA 2GFQA 1IB6A 4YNBA 2DLCX 1Y7LA 2C7OA 4DR4B 5E3JA 5AW1A 5KVSA 1RW4A 3CY6A 1N0WA 3OWXA 1LPAB 4J03A 4TV8F 5EY5B 1Q1NA 2V03A 4FDVA 3SZRA 2WHXA 2HJWA 3CH6A 4NYIR 4WKOA 3B7GA 1M74A 2PTGA 2Y8EA 3NJ8A 4JCOA 4NOJA 3HFSA 3JQFA 4RH3A 5AJUA 2Q2VA 4TVBA 4H4EA 1CUYA 2QN1A 5SYMA 1BEZA 4AJKA 4L2IA 2XNKA 4MKHA 1E89A 2GPTA 1HYHA 3WJ1A 4IKPA 4QDJA 5T4EA 1QF6A 2DY1A 1FTNA 3F5SA 2EBFX 3SQOA 5A9RA 1OXKB 3IDOA 1YB6A 4G01B 2R6GA 3G0DA 1HE2A 2EFCB 4XYEA 3E48A 1V9CA 2NQ8A 4C0HA 1PNQA 4XWTA 3R74A 2HCFA 1QGUA 3BSFA 2GYYA 1XN1A 1JQAA 4IF4A 5HVNA 1I10A 1XF1A 1Y4UA 4D9KA 1OCEA 1YDFA 2CBZA 3IP7A 5IK2A 4US2R 3I8SA 4LHSA 3B7PA 2GYUA 1FY2A 3E8XA 1P8AA 4X62B 1WF6A 4E30A 4CDKA 2OT3B 2PL3A 3I45A 5CA1F 2AG1A 3OC0A 4NJEA 4OYRA 3TJRA 1AMNA 1AF4A 2OO5C 3FLAA 3VU3A 5JT1A 5JH7F 2XVMA 4RF2A 1LEHA 1VECA 4J07A 3BAFA 2ZIZA 2OQRA 4XIYA 5EKDA 5EXEA 1QBKC 2FR1A 1T4GA 2QMOA 2R7NA 4M0UA 3CLHA 3ELBA 2JFVA 3KOUA 1X7DA 1L5GB 3CNBA 2IYLD 1MV5A 1ZIOA 4Z0HO 2P62A 1H1DA 1SNYA 2ECOA 3PQFA 4QECA 2OFFA 4R83A 4C9RA 1RT9A 1U8TA 3UMMA 2BDTA 4INOA 4HVTA 5FA5A 1N6NA 5EFOA 4PVDA 1BE1A 1QYDA 3LGXA 1BG6A 2CD9A 2R48A 4V2UA 1LVGA 3HCWA 2IHVA 1O9GA 3TO5A 2DBVO 4DUGA 1AGXA 1QV7A 3FOEC 1L5FA 3TQQA 4TLAA 4KN5A 4C06A 2QX8A 1CUCA 3IR6A 4Y2QA 3FHTA 3I04A 2HQOA 1IVYA 1KO8A 1PUJA 3C8MA 4KQKA 2I6SA 4ZCPA 5BYBA 2Y05A 5CBKA 1S2NA 1DP4A 4FFRA 5B6PA 2FPXA 1T2DA 2JHGA 4N3NA 1JG6A 5FT9A 1RVV1 3CVWA 1ZJWA 2NO7A 4XLTA 4WH0A 1WZEA 1YU6A 3W8NA 1PT8A 3P0IA 4IMJB 2NP6A 3SE0A 3W3AH 5K45A 1KMIY 2WUWE 5ESRA 5D3MB 4RGYA 4OCZA 4L9WA 3SQDA