3TLYA

Microcin c7 self immunity protein mccf active site mutant s118a/n220a/k247a in the apo state
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
335
structure length
335
Chain Sequence
PLLAAPLAVGDTIGFFSSSAPATVTAKNRFFRGVEFLQRKGFKLVSGKLTGKTDFYRSGTIKERAQEFNELVYNPDITCIMSTIGGDNSNSLLPFLDYDAIIANPKIIIGYADTTALLAGIYAKTGLITFYGPALIPSFGEHPPLVDITYESFIKILTRKQSGIYTYTLPEKWSDESINWNENKILRPKKLYKNNCAFYGSGKVEGRVIGGNLATLTGIWGSEWMPEIRNGDILFIEDSRASIATVERLFSMLKLNRVFDKVSAIILGKHELFDCAGSKRRPYEVLTEVLDGKQIPVLDGFDCSHTHPMLTLPLGVKLAIDFDNKNISITEQYLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords MccF
publication title Structure and function of a serine carboxypeptidase adapted for degradation of the protein synthesis antibiotic microcin C7.
pubmed doi rcsb
source organism Escherichia coli
total genus 117
structure length 335
sequence length 335
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02016 Peptidase_S66 LD-carboxypeptidase N-terminal domain
A PF17676 Peptidase_S66C LD-carboxypeptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Class I glutamine amidotransferase-like 3tlyA01
3.50.30.60 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 LD-carboxypeptidase A C-terminal domain-like 3tlyA02
4E94A 3TLAA 5FD8A 3U1BA 3TYXA 5JYBA 4IIXA 1ZL0A 4H1HA 3TLGB 4IIYA 4MJXA 2AUNA 5F5XA 3TLCA 4E5SA 1ZRSA 3T5MA 4INJA 3TLYA 4EYSA 3GJZA 5F1YA 3TLGA 3SR3A 5K99A 3TLEA 5F9MA 3TLZA 4JVOA 3G23A 4MI1A 3TLBA 2AUMA
chains in the Genus database with same CATH superfamily
5BT9A 3EE6A 4FVTA 2H4WA 3ZLVA 2Y1DA 4DCCA 1DDIA 3V7YA 1P74A 3QE4A 3KOUA 2Z5GA 1R9GA 4BP8A 2WM8A 3OCZA 1OILA 4KL8S 1YJ5A 4BIIA 1EM6A 5HOQA 3PYLA 4PSVA 1SUAA 3D6MA 2O3RA 4L3VA 3RUPA 2YOHA 3R7DA 3SI7A 4D0NA 1LK7A 4ZHQA 3WKAA 2IP1A 2F8TA 1DQNA 2JEZA 5AM2A 1J1ZA 2ZB7A 3CEJA 4I1YA 1U3TA 3FDZB 2VCHA 1LLUA 2VSXA 2XOKA 4E5KA 4TQUS 1U2DA 2RBGA 2TMYA 1M75A 2JVIA 3DEFA 3AU8A 121PA 4RMGA 2HHJA 1TJ5A 4IDBA 3CUEF 1N2OA 3M4JA 2KS6A 4WCVA 3AINA 2FLWA 3GRVA 1XMSA 2BMEA 1K9SA 4IJQA 1CE8B 4A2CA 1W35A 2EP8A 1U5CA 2P78A 3G6KA 3I5AA 4H6PA 2P4HX 4OKIA 5CH3A 1NXJA 4CQLB 2JKYA 2ON6A 4QOGA 3DQZA 4DJEC 2WM3A 4MAAA 1REQA 3ZJTA 4ENVA 1IOZA 1DMSA 1QDLB 2L0XA 1F1BA 3IA7A 4UDYX 5F64A 2PVCA 2GASA 4C03A 5C1BA 3UW1A 1ETUA 4PBTA 5CJ2A 1GR0A 3C74A 4MRMA 1DBRA 1ZU5A 2ECKA 3JPYA 4HYQA 5EIHA 4AWXA 2HLNA 1FS4A 2V96A 5IAGA 1R6XA 2D5LA 2H8GA 2B30A 3HZOA 1I4TD 1PFUA 2KBFA 4GS5A 1ZU4A 2NADA 3R41A 1KJ8A 1Y48E 2VLBA 4FFRA 3ZV6A 1D6SA 1K7CA 1GSIA 1U7OA 2F1OA 2E4AA 1W5TA 3KB1A 3P9XA 1SHTX 2FMKA 2CXTA 2XUHA 1F1JA 2EWVA 2ATVA 2NIPA 3MYRA 3T3MB 3V34A 2GEVA 1CUFA 2YZGA 2QQGA 3FHCB 4N0PA 3RYFB 2QZJA 1QZUA 1XNHA 1IHXA 2COUA 1XZLA 3L6RA 4OC0A 3Q3EA 1WD7A 5BNFA 4JUDX 5KOYA 4FQ8A 4P4IA 4MUAA 1ZWLA 1M34B 3EQ2A 4GMKA 5HDBB 2OFWA 2H7VA 2YWFA 1JKXA 3NHPA 1HE5A 1BQEA 1Y3AA 2JHPA 3FNBA 1IDN1 1P2SA 4UJ5A 1DEHA 2NLOA 1EZ1A 2UVPA 2QN2A 3ITNA 1AH2A 2WIJA 3MT0A 3NDBB 3VYTB 4EA8A 4DUZB 1EFHA 5B53A 2HF8A 4RPJA 5A04A 3BWVA 3E3NA 1MA0A 1IVYA 2A78A 3LHFA 3TSZA 1UFVA 4NPAA 3UUFA 4B6FA 2VF7A 3AESB 2CVZA 2QPOA 3DTYA 3PQ8A 5CVDA 3ZY6A 2D2IA 2AQKA 4G9GA 4KK3A 3I34X 3VBCA 3U4CA 3E61A 4EW2A 1F8YA 1MQ8B 2O5RA 3A3KA 4WMLA 5CUQA 3Q3CA 4ZPJA 4DDVA 5BWMA 1NVWQ 3AR7A 1C4KA 1LBIA 4CHGA 5JSHA 3PKJA 1VYTA 3KD2A 3QU7A 5EVCA 5D2CA 4Z4HA 1GRNA 2PVPA 5JANA 1BKDR 3EXG1 5JCJD 2C2OA 1E3SA 3D4BA 4C7OB 1G8KA 2BRUA 2W4MA 4RKQA 1GZ6A 1P0CA 4C6SA 2H85A 4J7AA 1OMOA 3C15C 2VL7A 4FN4A 4PC7A 4Z9BA 5DWVA 1QS0B 1KBOA 1NXPA 1MG5A 3H9JA 4K9LA 3LIIA 2BGWA 3EZFA 1ZH8A 1T8UA 1YA6A 1QHFA 1O1YA 1BU5A 1OPRA 1XDDA 2DPHA 2WUDA 2Y1XA 4GI3A 3DMTA 4YA6A 4KPUA 5D3QA 5G4KB 4XE5A 3V4OA 1L0BA 2Y76A 5DLEA 3QE9Y 1XZIA 1H66A 4FGJA 1FQOA 3FBWA 1YU9A 2CHFA 1WUKS 3KO8A 4EJFA 1C80A 2I3ZA 2FW1A 3BJZA 4DLXA 2FFQA 4IMIB 1VMEA 1WXQA 3UAXA 3D1VA 3NWJA 5IUJC 3V8PA 1ZPDA 3WIOA 2PQ0A 3KBOA 3PF9A 1SXPA 4UXIA 4PLPA 4C06A 5B2ZA 3A11A 2XTJA 1RQ7A 5GOTA 2GXAA 1F4PA 4HN4B 5LUAA 4I0WB 3P2JA 4HAIA 3B1ZA 3RYCA 1KEWA 4C1NA 5DO9A 2RHMA 1P6XA 1V8OA 4J76A 4B4KA 4UAJA 3IV9A 2VP5A 2YHIA 1I4WA 3O1HB 4YAGA 2O8NA 2XNJA 1NONA 1Q19A 3AHEA 2AI3A 4IVRA 3U44B 4WLOA 3B9QA 3M2TA 3L8YA 3Q6NA 5DI3A 1CLEA 4LYFA 1DRKA 2BP7B 3TTSA 1ACJA 1VFNA 1GG2A 4HYEA 3W2IA 3NUZA 3WDMA 5HUHA 1RJ9A 3AQIA 1WXXA 3CBGA 2WHRA 3SGLA 1I3NA 2B4QA 3ZZ1A 4GRDA 5HJ7A 1D4FA 1QK5A 2W98A 1RJGA 1KZ7B 2G4LA 1AG9A 3ABZA 3EMVA 3UT5A 2QX8A 4F2WA 1YC5A 4ENWA 4ZVUA 1RXEA 4A92A 5JCOC 1RI5A 3TYXA 3RJ5A 1ZA2A 2WSLA 2DHDA 2FGJA 4JOSA 5JAOA 1B41A 3QPUA 5JISA 3IMGA 2G06A 1G63A 3R5XA 2YVQA 3IQIX 4M99A 1EFCA 4EUKA 2VK2A 2HV9A 1RE1A 4RZQA 3RSOA 1SQGA 2X3FA 2WNIA 1YDEA 1JXOA 1Z5UA 1P73A 1X7GA 1ADYA 2D0PB 3CIFA 3A25A 3HJHA 3I42A 4IIJF 2DWOA 2WJGA 1B43A 4KFSA 5HDQA 3ZI0A 1YC2A 1P0MA 4P33A 3T3PB 1KP9A 1TF2A 2YYAA 3UFBA 4ER5A 1Y8QB 5JO0A 1NRIA 2ZI5A 3T35A 4B83A 2GFQA 3UJ7A 2C0PA 1YS2X 3CONA 3W04A 4MLDA 2RKWA 2WWTA 3GNLA 1F48A 1RLJA 2PJDA 3JYHA 4MP6A 4RKYA 4WA7A 5CA1B 5AVQA 3C7TA 2PSFA 4YPVA 3COPA 4BB9A 4MS1B 1JR6A 1E58A 1SGWA 1TNDA 1ZD3A 2CXUA 3WP1B 3WLPA 1HG1A 1FFSA 2LIVA 2WDPA 4FHGA 3KR9A 3MAAC 4PYKA 4JYAB 4RXUA 2O59A 3BMCB 3VH4A 3WK5A 1IEQA 4KB5A 1SURA 4MS3A 3A37A 2FI1A 5BMVB 3T7EA 4NZNA 2CBXA 3SQOA 4HC4A 4DABA 3OKPA 3W1WA 2P2NA 3R3SA 1VJ1A 1DQSA 1SD1A 4US1R 5HIJA 5F1KA 4MVJM 5JBNA 3R9IA 4F5EA 3IAUA 4LYEA 4QHSA 4BYMA 2DFLA 3WWZA 5EXSA 3QENA 4KMRA 1J0DA 3DO5A 5K4HA 3TDKA 1ODIA 2W2KA 3PDJA 4MQMA 5E3HA 2BHTA 4EO7A 2Y1OA 1KAOA 1JYFA 3M6VA 5T41A 3FUVA 3KZ1E 2QVBA 1MNQA 1KZ1A 2XNKA 4BN5A 3A3OA 3DFKA 3F6CA 5E7JA 2BGNA 3SF8A 3SM9A 1CIPA 5DI9A 1X38A 1P75A 3PJGA 3LC1O 1AF7A 2ECOA 1U2GC 2Y4OA 1HE4A 4PBSA 4TQGA 4FR5A 3R7NA 4C78A 2H0AA 1UK6A 1ZCBA 3B1VA 3F6EX 3FBTA 4GO1A 3MWGA 4NEHB 1J2EA 4PN3A 5CXQA 1FRZA 2E21A 4OQEA 5C80A 2XQJA 1VL5A 1P7ZA 3RT7A 3ISJA 3PIIA 5AMXA 3A26A 4EM6A 2A0FA 4MVJD 3ZDFA 5JJIA 3DAFA 4PE5B 1G8YA 3ZWQA 1E32A 5DDIP 4D4GA 1NUHA 1BFUA 3L9XA 4LY9A 1K3TA 1U7UA 2HMAA 4J6EA 1RPNA 5B7PA 5JNRA 1T0IA 3B1FA 3K1ZA 1IG3A 2GPAA 3GJ7A 3HKDB 2XH8A 3A2LA 3F6BX 4NH4A 2BLLA 4BMPB 4ZYZA 2IBTA 2O2YA 2OR3A 3QI7A 3BC1A 1NR7A 5M5BA 4GM0A 3K9CA 4FT2A 3CUVA 3O6VA 2ZKLA 1FPQA 3IALA 4G1VA 4N5NA 3MIIA 2PNJA 4X7PA 5F73A 1SXHA 1TA9A 5CM8B 3DOCA 4HGOA 3QXHA 4TXLA 3BRQA 1F12A 5TQ0A 1Q20A 5AM0A 5AVWA 2ZE8A 3FCCA 2F48A 3MSXA 2DERA 3HU2A 2VH2A 4MULA 3F4BA 1ANKA 1JPVA 4GVXA 1R8SA 2QDXA 3ENWA 2WFZA 3OI7A 4BBJA 2AN4A 5DISB 3WL3A 1DOAA 1AV7A 1E9EA 4XYGA 3L7OA 4LRUA 3DPSA 5DMHA 2GRAA 2YW2A 4R2JA 2OZLA 3T7KA 1Z35A 4Z9XA 4IFIA 2GK3A 5HFNA 1A5SB 3MEQA 1GV0A 2ZUWA 3B3FA 3NIDB 4RQAA 1G5IA 1KAMA 3DNPA 2Q4BA 4W8GA 4A1OA 1JHXA 2ZUTA 1T9AA 1FRQA 2DOKA 3RR2A 2VKTA 4TUYB 5AW6A 2RGEA 4NBSA 1U99A 4M1SA 2BEUB 5IFKA 2NTNA 1GCGA 4M76B 2EZUA 2ASEA 2O4UX 3IRVA 3G8AA 4G67A 2GFIA 3BMNB 2YIJA 5AK6A 4TJVA 2V59A 1AK1A 2YTZA 1KY5A 1SA0A 3NHMA 5JXWA 4XSHA 1PZGA 2ZLBA 5T4HA 3UCXA 1T91A 2G3YA 1ECJA 4J07A 1T4GA 3H8WA 1KEVA 1TYCA 1VMDA 3U16A 2FEOA 4CWAA 2ZAOA 1JHYA 2FTKE 3E6AA 4XX1A 4PZUA 3ROKA 3T99A 3GFRA 4P4GA 4B74A 4GT1A 4DDWA 3W79A 1P0IA 4ZVNA 1UBHS 2GRUA 2OHXA 4J0KA 4KFCA 3MZ0A 3AG5A 4LK2A 3WWEA 4BV2A 2I8AA 3V8MA 2XUJA 3NBFA 3O4IA 1NVEA 4MEAA 3PRJA 2EX0A 1WCYA 4OXNA 4QQNA 4AC9A 5FADA 5I9SA 4DF3A 1YB7A 4WXEA 4OLFA 3I2YX 4TLEA 1SRRA 2QKYA 4N01A 1BE1A 2NTJA 2CYBA 1ZQ9A 1QB7A 1W2GA 5LP6C 5IKEA 4KWIA 2GM9A 5G2OA 4YV2A 1CS0A 1KEPA 4JEHA 1FFWA 5PNTA 5DHSA 5CCEA 3G0CA 3G1TA 3KJHA 2IX3A 2QI9F 4GMXA 2RC6A 3KDAA 4JLAA 5LMNB 3KX2A 2DQKA 1GZ4A 2VQ3A 1CBUA 2GZRA 1GA4A 1I1QB 2ZIXA 1MOQA 1WEHA 2ZIAA 3LUJA 4OM7A 3TK1A 2PL9A 5LDGA 2WT4A 2ZPAA 4NU8X 1RMTA 1EXWA 4TV8F 1W19A 3WZLA 5IVHA 3RTDA 2JVKA 4WPGA 1MD9A 1UBJS 3V4SA 4FIZA 4J29A 1NASA 2LCQA 3CXRA 1A9TA 3LXUX 4OB7A 5ALEA 2JLVA 4KIGA 1U1FA 3H11B 1X70A 2I5PO 1ESMA 2N75A 3D4PA 3K8QA 1G5FA 3QLJA 1OY1A 3R6WA 1IOLA 3W5VA 2VVTA 4DCUA 3IULA 4GKBA 3X1DA 3GLFE 4JP2A 2PPVA 1UPXA 2ZG6A 4O2AA 4OXYA 4X1IA 3V2IA 4QDZA 3V8EA 1P3JA 1U0HC 4GSYA 1G8FA 2Z3VA 3COSA 3MQFA 4MUEA 1G5RA 3UQYS 2PPLA 1C0IA 4YJFB 1XQ6A 3S81A 3DZJA 2R4TA 3RABA 5ES4B 1CIVA 3OUZA 3Q15C 5AICA 1AZLA 2Z5VA 3N74A 3KP1A 2ZYHA 4IIHA 4MXDA 4Q21A 3UJHA 2D8MA 2VNAA 4X20A 2Z5LA 2HUPA 1G20E 3EC7A 4ME6A 4LQ4A 4Y98A 4U02A 1PR6A 5A06A 3E3OA 1YGYA 4Y9RA 4IDQA 3VMMA 2ZTHA 1IUNA 5KYYB 3M82A 4QOIA 3VPGA 2IV7A 3ZQKA 2PVSA 2GYUA 3U61B 3GZNB 4I14A 4AN4A 1CERA 1R88A 1M6YA 4WN3A 2FPMA 2FUG1 2GN9A 1MDBA 2QL5A 3KS9A 3KQPA 4QPNA 3UIEA 4B8ZA 5B3LA 4NGPA 1JVBA 2IU4A 3M6IA 1OB5A 2Q5QA 3ICEA 2NU6B 3AF4A 4B17A 1I6MA 3CH7A 2AD1A 1F2UA 3L4JA 1JQLB 4E4TA 4DV0B 2AW5A 1HYQA 3NDPA 3D3WA 4EFLA 1TO1E 1VJ5A 3AUKA 3T0FA 1I7NA 4F4IA 1M9NA 3HDQA 1BW9A 1MFPA 1FIUA 2COEA 4RMJA 4S0ZA 1H2WA 1UM9A 2LKDA 3B3GA 3LQRA 4XGNA 2Y71A 3K96A 4OL9A 3OE1A 1APBA 4C4TA 3DMYA 1RI1A 4HB0A 2WPNA 2FX2A 1N1GA 4QFBA 2CNKA 2VXBA 4H2DA 4ZOEA 4ZJUA 5CFQA 5JOQA 2SICE 3KT3A 1KZYC 4EO9A 1B0ZA 3H2HA 3HCAA 1AGXA 3IAAA 3H8SA 2UVQA 2RCNA 2I3GA 1FJHA 2ZBDA 5DV9A 3WLIA 4Q5IA 2FMUA 4YJGA 5EP1A 3P5BA 2ZXFA 5IP5A 5EG5A 1HDYA 4CT5A 3TXYA 4RKRA 3DMFA 1UOEA 3TRKA 1OZ0A 4M1KA 2HBZA 5ENVA 1WTCA 4RE6A 4BEWA 1V9CA 3WKEA 4AWBA 3IP5A 4E5VA 4DMRA 4Y2HA 4LOKA 1JHUA 1XAJA 1GY8A 2OYSA 1TAQA 3KJXA 1BS9A 1EK0A 1E98A 5JDIA 3COYA 1NN3A 5M2QA 1OLSA 2XUAA 3FWHA 3BMXA 2WP8J 4MW5A 4UREA 5ICGA 5CLIA 2R65A 2RHGB 4JY7A 4M9QA 1LWOA 3EF1A 2Y0DA 3NGMA 2RH8A 4W9NC 1AKVA 1MIHA 1QV6A 3PZRA 4H16A 4NG5A 2KWIA 1JIUA 1F8FA 1SIWA 3BIWA 3I0ZA 3SC2A 3W78A 4YCNA 5AD1A 1L1EA 1BX1A 4BP3A 1X19A 3EYWA 3GJYA 1M6NA 5JSZB 3AEUA 4KFUA 1Z6QA 3KVOA 4ZD6A 4V0LA 1GPH1 2RKOA 3DKKA 2XKAA 2SNIE 1OUMA 1AC5A 1SHLA 5CAEB 3IR7A 4U2BA 4DTIA 1Y6ZA 4EPVA 1FCJA 4GGPA 3LKVA 4PHHA 4CCYB 3QLEA 4FOTA 3JQAA 1D0SA 3CSUA 1ZHHA 3DOFA 2Y0PA 5L51A 1WUIS 3T5PA 1Q21A 1Y7LA 3H2ZA 2JD1A 1R64A 1UEIA 1KEKA 3QEAZ 1BAPA 3ACCA 1I9GA 4IILA 1XD9A 1Z0DA 1U8FO 3K20A 1YCHA 2WG2A 4X7BA 5HEKA 2UXCB 1MVOA 4EJSC 4GDMA 4HI0E 5TXGA 3RU2A 1TXGA 3TR6A 5FBVB 4E12A 3IEIA 1E1QD 4A8HA 4E33A 1OC2A 4MCJA 4YMHA 1N0UA 3ANSA 3FVWA 3HO6A 2KLHA 3SSNA 3UGKA 4A6EA 1CUJA 4R05A 1Q1GA 1MP0A 3DF7A 2RK3A 3FYDA 4D3SA 3D4LA 1JAZA 2AE1A 2OILA 3G68A 1UMKA 3GF4A 4XQGA 2XDQA 3QKSB 1H4QA 2I3DA 3D7LA 4WNAA 4EB8A 5AK0A 3TFWA 3W3ZB 1NXVA 4HRVA 1YR1A 4M9UA 1M33A 3QJ5A 3BKXA 3UGJA 3RYHA 1WB5A 1ZVKA 3M1AA 4C7JA 3DUFB 3LFHA 4DCGA 5K01A 1OZFA 1QNFA 3KK0A 5JRDS 2ZSFA 3UO8B 4JB8A 4RDCA 5GONB 5FXMA 3VBEA 2VKQA 2HC9A 2G9NA 1XZKA 1WW2A 2JGLA 3E15A 3ODGA 2VNSA 3CLHA 3D54D 2OYCA 3KB6A 4XM2A 3HZZA 1Z37A 3B5JA 4GYJA 2ZFUA 3UZUA 4E09A 5LIPA 2BFCA 4K9NA 1JHMA 3ZCUA 1T5BA 3ZDAA 2GEDA 3FNGA 3NIBA 4IF6A 3RHFA 5F3WB 1VBMA 3OPYB 1KL7A 4KMOA 3AX6A 4DLTA 1CRPA 2PGNA 1NIJA 4X95A 2VDJA 1V11B 3AB3A 3PC8C 1IK6A 2FPPB 3OU6A 3MTEA 5AJWA 4JI8B 1PNVA 5LQAA 2D62A 2Y0EA 1LKZA 1OFUX 2ILVA 3EARA 1KC1A 1KJNA 3TQOA 2PK3A 2VNJA 1JI0A 2XVAA 3HMQA 3KZMA 4I66A 4CV0A 4CFSA 1ODLA 4U3JB 1FXUA 2HA6A 4KWCA 4FGZA 4NICA 3IKTA 1GJRA 2EWMA 3DDNA 3B7GA 3AETB 3DMHA 4QGBA 5LXTB 2ZR7A 4XVCA 5F5XA 5M34A 3KLOA 1XGKA 2XMPA 3BMQB 2V7QD 3AFGA 1LPNA 3VX3A 2QRQA 2WSBA 5DW3A 4BLRA 3WRYC 4ZCPA 1Y9ZA 2AXNA 1DC5A 5J5VA 1UDBA 3ZOZA 2J5KA 2EX4A 1NN0A 1P8JA 3HJGA 1A9OA 3IESA 3KOXA 1BJTA 3O95A 3P71T 4I4CA 4QUEA 1WP9A 4TM7A 3HCRA 1F06A 2KX7A 2OK7A 1BWPA 3U3XA 1P7PA 4WEOA 2BM1A 1TC1A 2JLQA 5DCWA 2YYZA 3DR3A 4P08A 4IWNA 4OX9Y 2R11A 1Z2AA 2ZJ7A 1UR5A 1E3DA 3TZKA 4D79A 2J4FA 1V3VA 4QDUA 3D2BA 4PTZA 4PQEA 1U8YA 2CVOA 1DJQA 3LXXA 4EG5A 1J2UA 4MCAA 1J7KA 1KNQA 4H0NA 3VHLB 1PFQA 4L16A 4ZRDA 4DUPA 1SK8A 5A9RA 1IQPA 1U2SA 1XDWA 3CKMA 4WZAA 2NXJA 5K0FA 1QHIA 2DPGA 2WJ4A 2YN2A 3EQ7A 1WDWB 1T6ZA 3Q8MA 4Q9JA 4RHFA 1C9YA 4HGQA 4ZT3A 4ZAZA 5D5PA 4ON9A 1H5UA 2P8SA 2Q4EA 1Q77A 4HATA 2FZVA 4TL6A 4UVDA 2IPNA 2V9ZA 3SLKA 3UN1A 4Q6WA 1NLUA 1O54A 1BEZA 1EHYA 1JDBB 4RLSA 4U9HS 5KSOA 2GP4A 2FJUA 1LZLA 2E48A 2QZPA 4WY8A 4XDHA 4DZTA 3NHBA 2Q6TA 4G4SP 5DBIA 2C4UA 3NM6B 4LE0A 3VUEA 2WAXA 4MTLA 2V7WA 4DIOA 1B1AA 3NDIA 2IELA 1Q0QA 4EW1A 2DUJA 5JUWA 1V6SA 3USCS 1JIJA 3OMWA 2ST1A 1C9NA 2V7GA 3SC3A 1X6VA 5KWVA 3KZVA 2CFOA 4F12A 5EY5B 4A6PA 2DBRA 2PRZA 2FK7A 4EX7A 1E9VA 1HRDA 1RAEA 3NANA 2VHUA 4HUQB 2LDXA 2AH5A 2DPLA 2HRCA 4KG7A 2AN9A 4AXXA 4AJJA 1E79A 1PFKA 5G0WA 4YJHA 3NBYC 1JDNA 5ITSA 5AHWA 4NCJA 1ZXLA 2NZJA 1BWSA 5MFPA 3F4KA 1IHUA 2FOXA 3E8SA 1TTHA 5L3VA 5K7SA 1MW9X 2I9KA 2P2GA 1RAIA 3S4YA 3AY0A 4MR9B 3ZCQA 1ZOIA 4RZ3A 2I3AA 2PYZA 1P44A 4TRJA 2O7RA 4YCCA 5IC6A 4ZEMA 4AJ1A 5T57A 2QXUA 2CEKA 3OOHA 1JLLA 1NI4A 1G19A 2WM9B 4IKEA 4RJIA 5EPUA 1CB0A 1FF9A 1SKBA 3D3EA 3DPIA 4JJFA 1OBVA 1KVSA 1W5EA 4JSTA 4DC0A 4NU5A 1ISIA 2D1FA 4D3DA 2L19A 3AB7A 4JP8A 5HS6A 1LEHA 2YINC 4MV5A 3ZVRA 2AK2A 5ALTA 3EFHA 1E1KA 2DTEA 4QNRA 4R9UC 1V26A 2J9XB 1ZONA 1QKKA 1D3AA 3NNNA 4MPPA 1ORRA 2WJPA 3VU9A 3C4VA 1ZOSA 4WN9A 3ECCA 3AUUA 1MIOA 1U7PA 2ISCA 1OX4A 1PUXA 2NSHA 4OXIA 3N2YA 2I33A 3CH4B 4RZSA 2UYCA 1QFXA 1FX0A 5EZ6B 1P2FA 4FNMA 4EMUA 2EDAA 3UK2A 4WLFA 3TOCA 1VJGA 2YMPA 3D1LA 4XKJA 1NF8A 2ONYA 3IMKA 1BHSA 1D6JA 1NOIA 3ZXXA 4JYWA 3WGOA 4AMUA 2I99A 4ZCIA 1H6BA 4QUIA 2W5UA 3EGDA 2LIPA 3NG1A 5KVSA 5C3UA 2WAMA 2FXIA 4X60A 4YALA 1EFTA 2O1EA 4YACA 2QN6A 4BMXA 1KAQA 2HDOA 2VZ0A 1YJ8A 4E46A 1WSBA 2GS9A 2ODQA 3L8GA 4DMUB 1TTPB 1JR3A 1EXNA 2R8OA 4GF5A 2DC1A 3ZS9A 1WPXA 2CNWD 4Y0VA 2JLCA 4TS4A 3ESCA 1YCDA 3D64A 1FFAA 1T6NA 4U0KA 4QPCA 4EL5A 1MX1A 1L3IA 1WZCA 2Q1WA 3DAOA 3ZNNA 4I5IA 3TZEA 4MWEA 3IUYA 4O4JB 4UPDA 4P84A 4UMFA 4EARA 2FSFA 4RORA 1YRLA 1E9AA 1KYQA 3FHTA 2E6UX 3R3JA 2ZIFA 3PR2B 4C6TB 2QL7A 1QHSA 4MCHA 5CA0F 2NSJA 3LVBA 4RIHA 4COOA 1TT5B 2AJCA 3JWJA 2C82A 1T1SA 2I8LA 4IXDA 2R1VA 3LLVA 4CLHA 4ZYYA 5DLPA 5H83A 2YJTA 4QDXA 1EUDA 2FVYA 2PD6A 2BFWA 2J3DA 2CLOB 5CA1F 4QULA 5ENZA 5LQCA 2ZJ5A 4YBZA 1L7DA 3WV4A 1VE9A 3K3PA 2AG5A 4KGDA 1O58A 5DTIA 2FE4A 3TOZA 4AM8A 1MC8A 3N87A 3AERA 3P4UA 1LK5A 1JHDA 3HXTA 3O4RA 5FQOA 2AXQA 2H1RA 3DZIA 3GEPA 2BHLA 2HBYA 3KJGA 3OFNA 3PHGA 3OO0A 3L41A 4R1LA 4UEKA 4XVHA 3GELA 5FT9A 4WFJA 3AKEA 4P4DA 1YHYA 5BO5A 2HEIA 1HRKA 3MHPA 4ZVVA 1ZH6A 2BE7A 3UMVA 3IUSA 5BMVF 3WJ2A 4Q4AB 4KOEC 1KAHA 1D09A 2AZMA 4DPMA 4OLAA 3EVCA 1GYPA 3LKZA 2XYPA 4QLOA 2ZVPX 1I4LD 3G7NA 5A7GA 2XYHA 4PHFA 3DEKA 1ZK4A 2JAWA 3TSYA 1XL1A 3D9QX 4P9NA 4BO5A 4WOCA 2E6KA 3MTGA 2FDXA 2HDNB 1FS5A 4OYHA 4UPVA 1CEYA 3I9V6 3MB5A 2O52A 4NQRA 4XFJA 1EUQA 4LJAA 4GEKA 1P0FA 1R0CA 4ZAXA 5KNCD 1IBKB 4MDHA 4FOSA 4RKEA 1JLSA 1BQ4A 1BMTA 2ZRAA 3D6UA 3GG9A 4Y1RA 4QL3A 2LUOA 2C4HA 4RD2A 5LNK1 3NDJA 1F6WA 3CX8A 1ZRMA 2FN9A 4MQ4A 4N3GA 1UBFA 1G60A 1Z4KA 4OHBA 3F0TA 3GT3A 2I2XB 5JTUA 1UCFA 4OUDA 4UM9B 2FFBA 3DKVA 4NY1A 4BNHA 5SZJA 4QGFA 3OCYA 1I7PA 3Q12A 4PPNA 4WLVA 4QJBA 1FNCA 1RAGA 4RKFA 3BZWA 4MR8A 1E2HA 1Q2XA 4LC0A 1ISJA 5F35A 1RIFA 9ABPA 4NAUA 5EN4A 4GLJA 4M8LA 2ZBPA 1GRQA 1UBEA 3GRRA 5CH5A 2OBBA 3EC1A 5U4XA 2HIAA 3K0CA 5HPYB 2PVWA 3WO1A 2W2MA 4PIVA 4CG1A 3LP6A 2CL5A 4GAEA 2XEDA 1EVEA 2YV2A 3G59A 4RLHA 1ISFA 4YRPA 4CLRA 5ECWA 3I74A 1TM7E 2OPBA 1DRUA 3LU1A 2HJGA 5EZSA 2XGOA 4KQJA 2ZYIA 5EZYA 1FMJA 1UJBA 4KE7A 3IEXA 4BFWA 4E5MA 2QTRA 4I55A 4MS4A 3RIGA 1LRLA 3SHOA 4LYHA 1N8NA 4F84A 4ZJYA 4KHPB 3FMVA 4TMYA 1G21B 2B37A 3AHIA 4N5DA 3I61A 3K30A 3FPFA 4P3OA 4DLSA 2HJSA 2XVYA 1NOKA 5AI6A 4YAEA 5DHUA 5IEBA 4ZKDA 2W90A 1QQAA 4CU5A 4B2IA 4YY3B 1P9WA 3V48A 1XNQB 1PS8A 3HC7A 1CVIA 3INNA 1QRRA 4ZO7A 2RC5A 4U7JA 3V7FA 5JXJA 3D0QA 3ROTA 4AI6A 3BA6A 2GK7A 5K9ZA 4KTVE 1E7SA 2WFMA 3U6KA 4KI0A 4GPIB 4Q1CA 5ARCA 3UGQA 1TO2E 2HDWA 1TKCA 4IOKA 3SHFA 3N7AA 1I24A 3EIHA 4X1KA 2W70A 5JCZA 2IYNA 4P4NA 4ZAYA 3A4YA 1YH3A 3B5EA 3SYLA 3NXSA 3X1YA 3LV8A 1B2RA 2HQOA 4LNHA 4QKQA 4OC4A 3FE2A 3EWIA 2ODBA 4OUKX 2I67A 3BL6A 5EYPB 4YIHA 1V9SA 4MHTA 3D81A 1HQDA 1O4WA 3IS3A 3CW8X 2EATA 3N2NA 1DC7A 2QAJA 5JQGF 2X5OA 2XDAA 5C4GB 5A3QA 4R51A 4YRCA 3JR7A 2ZWPA 4A0SA 1KS2A 2ZJOA 3WYGA 1ULTA 1WB9A 1S2OA 4EMBA 4HEQA 4MPDA 5LA6A 1J06A 5EJ2A 3CRQA 1E9CA 4V02A 4JODA 3Q88A 1JHZA 4EGCB 1T5SA 4RF4A 2A9JA 1JB9A 3B8HA 3WBJA 3GZJA 1IN6A 3C8ZA 3LT2A 4GE3A 2IEYA 1EFRD 4ND8B 4XFKA 3WYCA 2VAVA 1I1HA 2GN4A 2W22A 1TK3A 3DV2A 3OWXA 2WB4A 4OTZA 2H1FA 1TF5A 1T0BA 1OXTA 3LCJA 4L07A 1SOWA 1IM5A 1NW5A 4D8WA 5KOIA 3RSCA 1KYZA 2A5JA 4R69A 2W83A 2R6GA 4Q7EA 1LPAB 4CTNA 2G9ZA 3VR0A 2FWPA 3CZ9A 4RFLA 4URZR 3UFXA 3RIEA 2JLZA 4NBUA 5BNWA 3HB0A 2YWEA 1IPHA 4F5WA 3O74A 3OP4A 1S9HA 1YKFA 2FRXA 2QYSA 1MC5A 3FVTA 4NENA 4JI1B 1AB6A 3ZQUA 1VMIA 1K4KA 4HLQB 2OFXA 4TKUA 4W5HA 1OLXA 1PK8A 3DE1X 3PE4A 1L5RA 5HCNA 5KPDA 5LMCA 3BGDA 4OA5A 4ARUA 4N0EA 1V1JA 1MT3A 3D4IA 2GXSA 4G89A 3ZLJA 1X1CA 3UMYA 1UZUA 1YCGA 5REQB 3HV2A 1FP7A 4OH7A 3OEWA 1ZW1A 1PYDA 3I01A 4LBZA 1QF7A 3OWHA 5DK6A 4AO8A 4RMIA 4F8YA 3FB4A 2A7XA 3AR6A 2AEEA 4O25A 1E3LA 1UK8A 1ZK3A 3EXHB 4UVGA 1GVNB 5IJAA 1U3CA 3T7RA 2B5WA 3A31A 3T4PA 4DEYA 2OECA 4F86A 4N7JA 1CY8A 5CX1B 3K5PA 3N75A 1E6CA 4KJZA 1X7HA 1LRJA 3EGIA 4HWTA 4CM8B 3VNAA 4Z0PA 3F6RA 3PNBA 3WMEA 4EPRA 2WK1A 1KQ3A 3IQGX 2FCRA 2O7QA 1VMAA 3S2ZA 2AC2A 5EJ4A 5LYJF 1A4UA 1SCDA 1BD3A 1TCCA 5FF9A 1PUJA 3EEOA 5EHXA 4C86A 3C6ZA 4AKSA 5CVJA 1T1EA 2AFIA 1JIQA 1AB5A 1K8XB 4MR7A 1YBMA 4LBVA 4M1OA 1MZPA 4PC3A 4EATA 5IYZF 3GA7A 1NUTA 1OBHA 1NT4A 1B74A 4MB0A 5AXDA 3GLRA 1C29B 1VHLA 2YKGA 2MIIA 2V1UA 3O92A 5DX0A 5EXXA 1ZM9A 5F2EA 2VHWA 1M7HA 1SU7A 3M4XA 3T9AA 4KITB 1VLQA 3R9KA 3TI7A 4MPJA 2QUAA 4L75A 5DB4A 1TX4B 2FX5A 2J46A 3W7BA 2WSIA 3IR5A 3R3HA 1EP1B 3GVXA 2CXXA 5KJ1A 3NNSA 4G4IA 2C8KA 3QVWA 4NU6A 3F74A 4FMDB 2HD4A 1S2NA 4IGKA 4QO8A 5JPIA 5L6MB 2A86A 2OP0A 4LISA 2YVAA 3D6AA 1HQCA 5FV7A 5L3ZA 3LPMA 3ZHQA 1Y6JA 5DOVA 3LBIA 2ZRFA 5CTJA 4J0IA 5KNDH 3AY7A 4CFZA 4KO1S 4OG2A 2QP3A 1YIOA 2CVPA 4EVSA 5CYFA 3QOWA 2ZSAA 3OCVA 1LZKA 4OFBA 1U28C 3MOIA 3O3OB 3ZWMA 2VTVA 3BGWA 3NO4A 5HM6A 3FDXA 4EHJA 1LTQA 2FFAA 1K0UA 2PHZA 4RTLA 2J6HA 3PHBE 1Z8NA 3WE7A 1PT8A 1ZYMA 4BOYA 5A9SA 3KEFA 4Q01A 3BCRA 3H42B 5T8KC 4EW6A 3AZOA 3IC5A 5JG7A 2EL9A 2O5CA 2AI2A 2E7ZA 2R66A 2CFTA 2XUGA 2PH5A 4PSUA 1RZUA 3WGNA 4AIIA 4O2BA 4L9RA 2QWXA 3ZXIA 2AR0A 2AMYA 2V8BA 2VAXA 2PL3A 2QSJA 4HFMA 4MV7A 1PEDA 1L5FA 3QITA 5A9TA 1O8BA 1NUSA 2AJTA 4V1CB 1SXJA 2VP2A 2P2SA 4DA8A 1M6HA 1VCIA 3PDIB 2JBJA 4ER3A 1UINA 4H27A 3NS7A 5TS2A 3A06A 3PC4A 4MW9A 2Y1CA 1E5LA 2RB4A 4IGAA 4WRRA 3W8EA 5KOJB 1EX1A 5JZOA 4IIBA 4LF5B 2O19A 4F0JA 3GZ4A 1L8LA 4F9EA 3AZPA 4KWTA 1V0JA 2XA2A 4FTWA 3H17A 4EQ6B 3HJBA 1B1CA 1U3FA 3TZLA 8LDHA 2DBVO 1DINA 4Z53A 3W05A 2XYQA 1ZQ1A 3SNKA 4G09A 3EZ7A 4A8JB 3I6QA 2QMHA 1A98A 1RYBA 2I2AA 4LPKA 5FL7A 1X77A 1ARZA 4MLPA 4DV6B 1T6BY 3DHVA 1ICIA 2AN5A 2QM7A 3BWDD 3OT5A 3GFPA 3RCBA 3R6DA 5E4YA 3O90A 2XKJE 3VH2A 5BWBA 4IJMA 3NIFB 4EI9A 2I4LA 4E3ZA 1E1CA 1QZTA 1YL7A 4WKCA 2AFHB 3H5NA 4OAQA 5F9MA 5FWXB 1AMUA 2MU1A 1COWD 4B3MB 2ZU6A 5KHAA 5BOSB 4RSHA 2FOIA 4QX6A 2VJYA 2B82A 3E7DA 2IUTA 3QWIA 2AUMA 3L4SO 4KRGA 3UW3A 2C6PA 1ZLXA 4K6GA 3ZU5A 3NBQA 1XKTA 3VNUA 3CSDA 4ZZ2A 1PK7A 3DBLA 5H7XA 2OZEA 4H3VA 1PZEA 1VPLA 2FF7A 5JSFA 1NUAA 3F6YA 2J1LA 3WYAA 2QSUA 1BEEA 4N7MA 4LK3A 4WJZA 1T8RA 2Z58A 1G2IA 4NULA 3QVGB 4EYEA 1N0IA 2SCUB 3DXYA 1KKLA 3OEHD 3V7UA 5EA2A 5AESA 1EEXB 4BX9A 5ALOA 4J9UE 1Y7TA 3WGKA 4CR7A 1KO4A 3FGPA 5AOAA 3IP3A 4M60A 2NUPB 4JYBA 2Q3JA 1B6RA 1J0XO 1TD9A 4X0EA 3WMGA 4EO4A 4ER0A 4EOGA 2D13A 3OURA 3DTVB 4US2R 1MB9A 3PPIA 1N9GA 5DXFA 3QSGA 3RKSA 5LN1A 2RHJA 1E5TA 3ZW8A 1KYWA 5GONF 1G38A 4U7DA 4ENPA 2DETA 2D8AA 3M5WA 4MVWA 3RV3A 4X71A 1LUAA 2QM0A 3RSHA 1G4HA 5KU1A 1GEEA 1J9EA 1ZC3A 2A1TR 4QUDA 2PQMA 2I29A 1CY1A 1GZUA 3PCRB 4B3IA 5LLDA 1JHPA 3F9CA 3OZTA 3CKKA 2C31A 2GKGA 2BSQA 2HR1A 4DB4A 1BEUB 1VJTA 2ZSBA 1JDPA 3NTVA 4PZEA 3DOEA 1EUCA 1MRSA 1W7AA 2F55A 1UDCA 1YRQA 3IVMA 5FI0B 4N76A 4A0GA 2EZCA 2QT0A 3AUAA 1NGSA 2LVBA 4LOJA 3HBNA 1CFJA 4XGQA 4EWLA 1CJSA 1CUHA 3L46A 2CMFA 4WBNF 3T61A 2QE7D 4Q93A 2Z6UA 1N7JA 4MA4A 2VDRB 1U90A 5JHGB 4US0R 4GR4A 1M5UA 1GTG1 2JFQA 4O1IA 3PA8A 421PA 2EU8A 2JJQA 4P7GA 4NGSA 1GU7A 2WKRA 2FLVA 3TZQA 1KZ6A 4QU8A 3FHOA 3KQTA 2LW7A 2JIPA 3FUCA 1GTVA 3PUWA 3AW8A 4XIYA 1SBYA 16PKA 2VJMB 1K7FB 1E1DA 1ZEMA 3I9KA 2C7VA 3NYWA 2YW9A 4MYTA 3X1JA 4L8WB 3WYDA 4MWZA 2JLSA 4LY0A 4MKIA 5TGZA 4DRXB 3K9TA 3PQCA 2B1JA 3Q7SA 4GLFA 1EE2A 3AIKA 5IMSA 2AQ8A 1J0CA 5B57C 5IJWA 4X62B 3TNDA 2HMYB 1TFUA 2XUIA 3H5IA 3CLUD 3L0DA 5DSXA 3KTAA 1K08A 1XP5A 3A6LA 1U8CB 2OZKA 4HWGA 3RJZA 1OFUA 2GWHA 2J85A 2VBGA 4HB3A 3KYIB 5LYYA 1ZHFA 3WGJA 2V65A 1BCRA 4N1AA 4ZODA 2OB1A 2ZUDA 1EA5A 3LQ2A 5BN5B 1FFCA 4TSFD 1VHQA 4RM2A 1VIDA 1PAUA 3C48A 3JYQA 1QPGA 2Y1LA 2HFJA 3ZE7A 2CBZA 1RBYA 2J6CA 1N2CE 3IIMA 1KRWA 1RJWA 1T36A 4RQBA 1SO8A 2H4XA 1PP4A 1C3LA 3LWBA 4Q6BA 3F90A 3SEZA 4DWWA 4OIMA 4JI4B 2CFSA 3U7QB 4BRWA 1Y7HA 2CMDA 5L3RA 1NAIA 2O2JA 4KQGA 2EARA 2FUEA 3A1NA 4WX2B 5JZVA 3BAZA 4M37A 3IXQA 1PLKA 2CFIA 3C6BA 4LAFA 2J45A 2EJCA 4Q3EA 2H1OA 2W2TA 1WW8A 1UMCB 3BCSA 3URMA 4DQUA 1NBWB 2JFZA 1ABBA 1P2UA 5BSUA 1TYBE 2CVHA 4WESA 1W0JA 3G17A 1HFWA 1NZDA 2C92A 3BERA 1H8HD 4OB8A 1OLOA 3KKLA 3KDPA 1TZKA 3KPUA 3IVXA 3IIIA 4L7QA 1TECE 1SKYB 5EKSA 1W0KD 2P9EA 3B70A 1S01A 4CV2A 1IC6A 2BR3A 2PD4A 2IS6A 1JU4A 3ER9A 3G5MA 1LC0A 5FL3A 1ADGA 3DC2A 4MV9A 1K8QA 2CEAA 5GV7A 4XJXA 1JG3A 2V5UA 2EP7A 5HIKA 4R1UA 1HL3A 4QELA 2EFYA 2GZSA 2JAPA 1BMFD 4AICA 3CLVA 1US8B 4MZDA 1AA9A 1C4OA 2FEKA 4DT1A 5F7OA 4QOHA 2ZYSA 3FOEC 1O7JA 2Q6LA 1U0LA 5L4NA 4QGGA 4NI5A 3WYBA 3MGKA 3QPWA 3RS4A 4CXMA 10MHA 1X74A 3L06A 2JNWA 4C22A 1YQQA 1E20A 1XG5A 2IPLA 3LZDA 2E5FA 3AJ8A 1NW6A 2DFPA 2P65A 3ELBA 4RY0A 1UBRS 3PQEA 5JH7F 2OBLA 3ELUA 1HT0A 4PPFA 2BGMA 3B6IA 1NJ2A 2CCJA 3ELWA 1KR2A 2HW8A 1MPTA 4F4JA 4HBZA 1H8EA 2P62A 1FLVA 4MI3A 5AJTA 3A9TA 3ZLBA 5F2NA 3N5KA 4CLEA 3H5WA 4BVEA 4E1BA 4PW0A 5A2GA 2VJAA 1WHSB 2FP4A 3TM5A 1P31A 3COZA 3OFVA 3JASB 1RP7A 4ZQHA 1UEXC 3N59A 3UUGA 1X39A 1K86A 1WXEA 1F4LA 2YQZA 3LIPA 4KGXA 5ELMA 3OAAD 1ORVA 3L1KA 3O4JA 2XE6A 4X63A 3JQCA 4P5EA 4LFAB 1RYMA 3LM8A 4FZVA 5KX5A 1IEVA 1YIDA 2BOVA 3OPVA 4OQPA 2WOOA 3E5NA 3N2KB 2H65A 3ULKA 2CZQA 2HQSA 5C1DA 2NO9A 1AKTA 4HQNA 3UGTA 4BGDA 1XT6A 4ZDJA 3N8GA 3FA2A 1XQXA 3S28A 3KKPA 3PXBA 1U0EA 4B75A 721PA 1Y3CE 2QAIA 3SDBA 4RADA 5CNKA 1DHRA 1ESDA 4HKTA 4FFOA 4DY6A 5L3QA 4LF7B 2F8SA 1O8CA 1A9XB 2EC5A 1OBCA 1RYFA 2WUEA 2ENWA 1B26A 1OWNA 3DYIA 3HJFA 3L6CA 5JLAA 1AF4A 4EENA 4UM7A 1P7WA 4OHXA 3G23A 3EH2A 5A62A 2EXXA 3F78A 4PNZA 1SKQA 4IY1A 2WD9A 3AY6A 3LBNA 4A36A 3IKMB 5E6RB 2QBYA 2BFPA 4PZYA 1TCVA 3T7CA 4MCQA 1S8NA 2AG6A 2ARKA 2WTAA 4JB3A 3DZ8A 3FRJA 4QTXA 5DHRA 3ZV4A 1XN1A 4IICA 1U0RA 1KKMA 2BUAA 3IFSA 4D25A 3O31A 1XDUA 2O0LA 2OLJA 5FA8A 4D80A 2ZGVA 1CY4A 4V38A 4FFBA 1YBVA 2WG0A 3N28A 1PGOA 4C7VA 1HDOA 3ZLUA 3KOWA 1KU0A 1YE3A 5M29A 2PT6A 4M6WB 4EG7A 3FZGA 1D2NA 1I2MA 4NF2A 4NMXB 5B7QA 2XDWA 1RI2A 4MGYR 2P5SA 1K75A 4YB8A 2ZTLA 5FIUA 4AQYB 1V3QE 2V97A 4XQ0A 1A82A 2IIPA 4TTSA 2YY6A 3R8CA 3F8SA 3ZZNA 1OGYA 4IDNA 2H0QA 5HQ3B 4WQMA 4REQB 5JNVA 3PTLA 1C8VB 3QELA 2FCAA 2VDVE 1YASA 3EASA 3U4AA 1VPEA 2FJ0A 2Q1XA 3I9JA 3PVZA 4EEZA 5KOHA 3GJ5A 4I6EA 4D9MA 2HMTA 4EZBA 3L0PA 1UZNA 1V5GA 2FAXA 2G9RA 2HBQA 3QTLA 3PLRA 5FOVA 5FEUA 3LNTA 4M0EA 5HKAA 2VYCA 1RYNA 1WXHA 4B85A 1OYVA 1VDZA 5ICEA 5FJJA 3KJQA 3OHPA 1P7YA 5IM5A 4L8YA 2QZZA 1KOFA 5DGDA 1IXSB 1DAMA 1HEUA 4G23A 3PXUA 4NPHA 5HQJA 4TKVA 3PEUA 3TTWA 4B2PA 3FTDA 2GKSA 3H13A 5LFAA 2YJVA 4RABA 2ZRKA 3QWHA 1X42A 5CDUA 2V7VA 1M1UA 4PWYA 5JZBA 3H9BA 3EYAA 3N8IA 2I4RA 4EBBA 5IJ9A 2O0KA 4L3OA 1SR8A 2GK4A 5FLEX 1VBNA 1CQXA 4GD3Q 5ELXA 1XYGA 2OXFA 1SU4A 4G41A 3O83A 1C7FA 1CQJA 3QEJA 1FTQA 3C3EA 3JSXA 1REQB 3VR3A 3L04A 2ZI6A 3LBFA 1BX0A 3KPVA 4KQ9A 1F6DA 3SKYA 2A9VA 1JSCA 2OE2A 2ZB4A 1Q12A 4GWLA 1SU6A 4C14A 1CR1A 1NW7A 4JBWA 4R1QA 2BVNA 4L4RA 4ZXFA 5FD8A 2WUVA 4R1TA 1KPGA 4TROA 2GCPA 1XTKA 3P2YA 3PFHA 1BVUA 1U4SA 4MRMB 3LPCA 5A4FS 1XMQB 1FXWA 1QK4A 3PICA 2QRMA 1L4NA 4J1TA 4LOHA 4LCEA 3KVVA 4N47A 4O5AA 5BYJA 5D01A 5LZ4A 1SCUA 2DR0A 4KDCA 2WBLC 1KZ4A 1V47A 2AOWA 2FKNA 1AUXA 1L4BA 2HZBA 3B3JA 4ZC1A 4GWGA 4Q3LA 4EKYA 1JEEA 3R6GA 3SYKA 3RLFA 2XW6A 1GM5A 1O94D 4HGPA 3TW6A 1U98A 2HQBA 3CRNA 5EXDA 2H1IA 3BGIA 3CUTA 1R4NA 4NV1A 3OETA 3L0YA 1EVLA 3TIGA 1U9ZA 5CK5A 1PBNA 3V9AA 2EK8A 4TS1A 3KKQA 1X1QA 1DG9A 4DR3B 1GKLA 2W0MA 3CUWA 2ACVA 2GEJA 2O7SA 4J03A 5JD6A 3ISVA 1GL6A 4D9JA 2UVPB 2ZRCA 1BKSB 1JYSA 3L6UA 4TZKA 1TQDA 3T52A 2MSEB 2OHJA 1VLZA 5EUBA 4MK4A 4E21A 3ZYCA 4B6SA 3M81A 4BWYA 5JNUA 5KSZA 5E9QA 1NX9A 4BVGA 3QY0A 5C1PA 2MDTA 1E9BA 4QVGA 2IA5A 4KQKA 5JMWA 4U9IS 2WTMA 5BW4A 3NORA 2QDKA 4YUXA 1CQPA 2ENUA 1UZLA 4QU0A 1TYZA 2FY8A 4PLZA 4ID9A 4MICA 1FYWA 2E89A 2B99A 2XR1A 3NM4A 2YJGA 4DR7B 1I4EB 5CVEA 1ELOA 4I6GA 4XB1A 2E4ZA 1IFXA 3IL2A 1H9CA 1JP7A 4UBKA 3PC2A 4M8IA 3L8DA 4TVKA 3OTIA 4F2PA 1MNAA 1XLTC 4P98A 3B7WA 1W47A 2PY6A 1O9HA 3LFTA 1A7JA 4LF9B 1CZUA 4MKFA 1NP3A 1TF7A 5KYTA 4G07A 4GX2A 3GDHA 1I7DA 2Z43A 1GILA 4FWIB 4O29A 4LQLA 3GLIE 1GP2A 1U0FA 1USUA 2H1SA 3SJAA 4CLDA 2R7LA 4TWZA 5E1MA 2JAOA 4JBHA 2DIKA 1KMHA 4I8XA 1DI0A 3KSBC 4DVGA 3SE7A 2C7OA 1XDZA 4KPUB 1I4OA 3FI9A 3RARA 2XMBA 2N1MA 3URKA 1JDTA 1LDGA 2I6XA 1ZNZA 4I5DA 1L4HA 1L4EA 3FPLA 3IE1A 3DLTA 4NQZA 2D2XA 4C2BA 2NVBA 5F2OA 1LS1A 3D31A 5D51S 4ZICA 3IQEA 1NQVA 5E4FA 3E8XA 1RBQA 4NHEA 4DV7B 2NO5A 1H23A 4HBGA 4BX3A 5TQVA 1OXVA 1WTAA 1ODJA 4L4UA 5C51B 4RTPA 1XELA 3ITEA 1F2TA 4HFJA 3MJCA 2IE0A 4A0HA 1TJNA 5GP1A 5EMNA 3E3AA 3RYCB 1YS4A 4I9HA 1NM5C 4HXEB 4OGFA 5BQ3A 2YHIB 4L28A 4AJLA 2YHSA 1BHO1 1SBHA 2P35A 3H8JA 2JH8A 4XWYA 4P5PA 4EY4A 1D1QA 3DYVA 1F0NA 3IAM6 2I4IA 4Z8YA 4IWXA 5JS2A 4FP9A 3DFMA 1GU0A 1ZGGA 2RGAA 2WTNA 3ILSA 4LHVA 3ISTA 4I7EA 5DI3B 3VAAA 4DHWA 4N40A 2VZ8A 3ZBQA 5FV4A 1FMTA 2VPQA 3EIXA 3I09A 2XKKA 3G0GA 1MXFA 1WCV1 1GGHA 3GDWA 5GVRA 5E1BA 4A5SA 2GM4A 4C9EA 3VNVA 4LC9A 3NOQA 7MHTA 2HDHA 3H5VA 4LZNA 2FZKA 4XCQA 3UT5B 3ZHXA 5ILGA 1BGWA 2VJCA 1UWKA 2XCRB 1VIMA 3QXJA 1L4YA 1QLWA 1J0EA 1B8OA 3G0BA 4Z6KA 3KL2A 4UFPA 2DFKB 4QLAA 3DH0A 3JRWA 4UNNA 3A6FA 5DASA 1PZFA 2G4VA 2E37A 2QXTA 1JEOA 3KR2A 5FKJA 3K09A 5K8JB 1NSFA 4EVIA 3DONA 2QW8A 5FUWA 5LQSA 1TMOA 1ZL2A 2B3TA 1GGKA 2PL5A 3FYTA 3N6RA 3ZN2A 3F47A 3RC7A 1G3RA 1RU3A 1KDPA 5B36A 1OGJA 4J91A 2NXWA 2F7SA 3DVAA 1FZQA 1XZQA 3ANNA 1EUYA 4LF4B 4IXMA 2I22A 1JQAA 3O8OA 3ZD9A 4ALJA 1RVDA 1YVEI 2OCKA 3JTMA 4FMDF 4OAPA 1I7SB 4TT3D 1DT5A 1TM4E 4HPWA 4BNMA 4JLOA 4UUQA 2I7VA 4CMCA 4MCIA 1GGMA 4Z7JA 4R9RA 1SVIA 4FI3C 1COZA 4B3CA 5BQXA 2IH4A 5ALMA 4AJOA 4BPBA 5J58A 5K4GA 1XTUA 1MQAA 4GNRA 1OI7A 3K31A 4COBA 3ER6A 5DNDA 3RASA 4PLCA 3AI2A 4CV3A 1ONPA 4ZZ1A 2QMUA 1Z8HA 2HU2A 5EJ7A 5CVVA 2XB6A 4P3XA 1PJ8A 4PIPA 3VKVA 3PV0A 4DRYA 3RHZA 4I1VA 5LIRA 3WK9A 3KWJA 4MS3B 3PIDA 1M8JA 5DN9A 3SHTA 3L2OB 1DG3A 1UBTS 4TTQA 5DTEA 5ARBA 1TJYA 4OQFA 3W5SA 4CIXA 1NQWA 5DKFA 4URFA 4ENTA 3F7OA 2ZRMA 4M55A 4FR2A 4UXJA 2TSYB 3CR8A 1VI6A 4JLNA 2XYRA 4ZCQA 1AMNA 1N6PA 3YASA 2AZ4A 4RYDA 5FH9A 1SQSA 2A5LA 1ZICA 2WTEA 3LCVB 4FGSA 5FNVF 1W36D 3PX2A 3O73A 3DO6A 3A4TA 2IGTA 1FUYB 3L5KA 2FUKA 1OA1A 2W2KB 1Z82A 4PFKA 4YDRA 3WRXC 2IU3A 4BFXA 1IM8A 2BHNA 4S1NA 3UJPA 3CUKA 3HYTA 1RLOA 1NBOA 5EFZA 3M5CA 1Z6GA 3SF8B 1HTBA 1E8DA 3U0VA 4OJTA 2Y3IA 3O2NA 1TKAA 3STTA 1EJ0A 2Q3FA 1USVA 3A8TA 4L8VA 3VVBA 4CPDA 3ZBTA 2YXBA 3NHWA 5FOTA 3RS7A 1C3OA 1M8KA 1RRMA 3EZXA 3KQMA 4MINA 1LH0A 4G8DA 5KKAA 3RU3A 3G0IA 3LY7A 3ZXSA 4LOLA 1OAOC 1RD4A 3QKIA 3ZGOA 3AQ4A 2V0GA 4KN8A 1Z39A 3IV6A 1DKQA 2OHOA 1GG5A 3OTGA 4DYDA 1AQNA 3NKFA 1K92A 1U0NA 4ZZIA 1DAIA 5JYDA 1N6RA 2IIQA 4FSHA 2I62A 4MW4A 2PGLA 4B3TB 2RGNC 4ZAGA 2FPIA 2G7MC 1U3WA 3AIOA 1TVKA 3LT5A 1FW6A 2JI4A 2VQSA 2HQRA 2BCGY 2BISA 1KXJA 4NV0A 4FCTA 2VDNB 3I8XA 3U39A 1CYEA 4X9XA 5JYEA 5E9WA 3VC1A 4MYDA 1CY2A 1ABEA 3DMDA 1N2BA 1FUUA 4AQDA 1SEVA 4CMJA 3A2KA 2YJ4A 3HACA 2P5YA 1KMIY 5TQ0B 3C70A 2A84A 4PXSA 3HVUA 5C1OA 1UJ2A 1WU8A 2WMYA 2P77A 4HADA 4XAQA 1XMPA 4NS1A 5ICMA 3WI7A 4YUVA 1FK8A 1H0KA 2PFKA 1I3OA 3CPEA 2R00A 1WAMA 1XROA 2FNAA 2UDPA 2ZYDA 3CG0A 3G88A 3TMYA 3ZV5A 5B3JA 1MJGA 4CI9A 2A3NA 3QEMA 1JHQA 3V6LA 1RBZA 3ZCPA 1WIWA 5KNDA 2H4HA 4M1MA 1T34A 1YR6A 3I6SA 2OZLB 4ILKA 4KTTE 4UM9D 1LPMA 4ROTA 1EVKA 1OYOA 5ALNA 3SVTA 1WUJS 3AGPA 3CPJB 2IHKA 3BF8A 4UTPA 2E28A 3KU1A 4YHBA 1H93A 1KZ9A 2O7VA 2F3PA 4BKUA 3KE8A 1A5ZA 1N9KA 4ZOQI 3RVNA 5JXIA 1VG1A 4ZTBA 4LXUA 4Z0TA 1H2YA 1RRGA 3CLUC 3DP7A 4BJHB 5I9NA 5AOVA 3NIWA 4RSMA 1GIAA 4ER7A 2R25B 4ERNA 5IM4F 2KI5A 4XSVA 1SA0B 1MJFA 5B6PA 3RW9A 1W49A 1CR4A 5D1NA 1KFEB 2Y8EA 3GJZA 4JP5A 1WUYA 2GAOA 3I30X 1KMCA 1M0TA 3QVXA 3FTPA 3CVXA 4QICA 3DKIA 2HGZA 4E51A 4I8DA 2H9AA 3QFRA 3U48A 5JVLA 2I7CA 1N6OA 5AKXA 3LTNC 2VJBA 3CE6A 3BIOA 1K8ZB 3GGDA 3HV0A 4FDMA 1UUFA 4JJ8A 4PBRA 4A6XA 4KH0A 4GGOA 2I6FA 1VIAA 2CN1A 1C3EA 2FMFA 3EXG2 3Q72A 4LGMA 3SX4A 4D46A 1H3FA 5D8DA 3A3YA 1PN3A 2QTNA 5SZKB 1P9OA 3PGXA 4BRUA 2O8CA 5K0GA 4JMLA 1OKKD 5FTWA 5B58C 4YP0A 4RY8A 4YLYA 2OD7A 4A5OA 1XZAA 3AF6A 2GM5A 1NXQA 2YCBA 4N7BA 4BIMA 4MO9A 5JAQA 5JALA 1CS0B 1SCAA 5BUCA 3DD1A 3NRBA 4J94A 4M9RA 5DK4A 1NBEA 4KQCA 5HKKD 2A4KA 5EMKA 2PYDA 2O1WA 2CUTA 2XVXA 4Y7CA 3SDZA 5K09A 1JEYA 4FBMA 5IUKC 4FSDA 3OEED 2ZIXB 2ID7A 1WXGA 4B6QA 1ML3A 1UPFA 2LCFA 2R8EA 2Q9AA 1Y33E 5DGTA 3E81A 4BLOA 3I4CA 1QH1A 3AO0B 3QH4A 4R2IA 3N58A 2JKZA 3ZIAA 2FPXA 3AP1A 3WWOA 2QLFA 3WMWA 3U4HA 4ZPXA 1ZIDA 1QO0A 3D43A 2Q49A 3CF6R 2F3SA 2WJ3A 3PU6A 3ZNQA 1MB3A 4AYXA 1IBMB 2Q5FA 4HQLA 1NBHA 1YZNA 1PL0A 5E4JA 1R9NA 4FQ5A 1A0OA 4P4LA 1AKWA 1P2TA 4BWFB 5BRAA 2GJ8A 1Q7EA 4QUHA 1QTIA 2PLRA 3RK1A 2PRJA 5ILOA 3INTA 3W3AD 4O2AB 2WWXA 4X1IB 4RIGA 1F6BA 4B3HA 1MU0A 5ICCA 4DR5B 3TLAA 3QXXA 1K6JA 5JVDB 4GU5A 1OX6A 2O2IA 5K8UA 2PGJA 1WXWA 3DEHA 1YU6A 3K1JA 4JV5B 1XTBA 2AK3A 3H75A 3V4FA 2D6FA 5L45A 2VBFA 4BCDA 4G81A 4X20B 3FCEA 4Y67A 5KIAA 3L84A 3T5MA 1X80A 3EDQA 2ZYAA 1Z0KA 1KI9A 1BXGA 2WU8A 3CR7A 4QRDA 4NFLA 4KE8A 3K8OE 1GEGA 2GJ9A 1L1FA 2C54A 1RVV1 4PLGA 4NONA 2XNDD 3GLFA 1A2QA 1WQ1R 1M2GA 4RYLA 4ZAWA 1KMNA 2PSJA 1QK3A 1V2GA 3ELDA 3QXCA 1F2UB 3AK4A 2ODEA 2B6HA 3PDUA 4O4LF 5ALFA 4JC0A 4YCJA 3D3WB 5B4UA 4CBVA 2Z2YA 5COBA 3LBHA 2UYQA 3E7WA 2IYAA 4RD1A 1DAGA 1BW9B 3SZLA 3WB2A 2R85A 3UVEA 5FUQA 1QUEA 3U7EB 3B1KA 5F77A 1TUGA 4L5IA 4Q82A 2D5AA 1FP1D 2UZ0A 1SMKA 2NZXA 2YVKA 3BORA 4BY9E 1USIA 2GBPA 1CFZA 5K2MA 1JI3A 1X9IA 1ZAKA 3OEYA 3JWGA 3ZKAA 1V8DA 3KWMA 1XEWY 3ADBA 2B1RA 2DTDA 2NTVA 4L8GA 1V9LA 2H8KA 4BFYA 3PITA 1Q11A 4JQZA 4YJGB 2YJZA 4NYJQ 3SZUA 5DN6D 3BQ9A 3PNVA 2PYIA 4NAHA 2O6HA 5JYBA 3HMKA 4INOA 2JASA 3UC9A 1JJVA 4CF6A 4E2ZA 3ICQB 2FETA 4GKVA 7GPBA 4IDPA 1NHWA 1QAQA 4LRTB 3R8XA 1TKBA 3WWPA 1T0UA 4CM4A 1AKQA 3G5LA 3IHLA 1A71A 4IZIA 2C5HA 4BNNA 4GLBA 3JX9A 5EXEA 2WSSA 3DLPX 2FEXA 1Q3HA 2P6UA 5L8VA 1WMFA 1OLSB 3PNOA 1RSZA 5LZ8A 4JA2A 5CDTA 1C0KA 2CDCA 3EWSA 2VHZA 1GTZA 1IWPB 1SFRA 4RGQA 4HGNA 4DCJA 3FPGA 3LYAA 2P5UA 4JOQA 2P90A 1U7XA 3WVNA 4JI3B 1N36B 4PLVA 3SC2B 3NBMA 5I3CA 1RWXA 4FMBB 4M9ZA 4KLNA 3RGWS 1YK1A 1AUPA 2I6UA 4EP1A 3B8EA 5K3BA 4EKGA 2PUAA 2DT8A 3AEUB 2JLAA 1MH1A 2A88A 4CV1A 1HY3A 2ZSIA 1RZVA 2NUBA 4M83A 1YCFA 3R7LA 1C7IA 4B3XA 1HKUA 4RK6A 4JENA 3L7JA 3JQAB 4U4AA 3VHQA 1SIOA 2NNWB 4JT4A 2Y99A 1LF0A 4N5IX 1L5KA 1E9FA 3TRDA 4EFNA 3QMWA 2O2GA 3SR4A 5DYNA 1M1ZA 1XKLA 3P9IA 3S2YA 1SAYA 4H59A 3OQIA 3JZAA 4RV5A 4CODB 1SY7A 1RP1A 5EHNA 1KTIA 2H63A 1PQ4A 2G07A 5TQJA 1Q7CA 4FX5A 4YO8A 4AF8A 2O4CA 4D96A 1LB1B 1NJSA 3ND9A 2HSZA 2QGFA 1A1VA 1ITZA 1HYGA 1BZYA 1RPTA 2F2TA 2Y1EA 4WXMA 4E1AA 1LS6A 2HKIA 4WNAB 3DS8A 4ZZ3A 3MGGA 4HDRA 2G83A 5SZHB 2DHQA 1BHQ1 1QQTA 1SOUA 2IXEA 3KSRA 3RYHB 3HABA 2BW0A 2WUFA 4ZO9A 1VYUA 3DE2X 3PXEA 5IX8A 5KQGA 3IPXA 1USKA 6PFKA 1FUIA 1V7PC 1EJ6A 3HM9A 1I3LA 2GK6A 3CEPB 5TMDA 2OG2A 3A0RB 3DEIA 2YWCA 3FKSA 2H2WA 3ESRA 3OX4A 3G1UA 4Q34A 2MMCA 3JZIA 1X8LA 1ZFNA 1JEJA 3BXHA 2BFDA 1G8JA 2BFCB 3BWCA 3HP7A 3OF2A 2OXTA 4CM5A 4HX5A 4ZHQF 5GZ1A 2OL4A 5HYVA 3E9QA 3LP8A 4CRWB 1DEKA 4YAWA 1GUFA 1Z7WA 4W1RA 3LO5A 5I7FA 1SOVA 1CZNA 3AR9A 4EY3A 1P60A 2TECE 2DFDA 5E8JA 5HF5A 1XD8A 2C00A 1O94C 4NCXA 6LDHA 3AFMA 1HSOA 3A1SA 4RHEA 3D7RA 3ORFA 4D4MA 4TXNA 3TSAA 5T6BA 4JIGA 2Q7OE 1ECBA 1N6HA 4Q4DA 5EP2A 4XEHA 4BWVA 1TDJA 2IQIA 3GQBA 3SP1A 3AI1A 4NJOA 2XA1A 5ALQA 4H1UA 4B7XA 3HA2A 5J4KA 5UKDA 3U9SA 2A9KA 2Y4NA 4LJYA 3SMVA 1VC2A 3C6QA 2YASA 3HU3A 5B1DA 6GPBA 1SQ5A 3EMBA 1ZUD1 3R5TA 4YLGA 4A8PA 1PJ4A 1J97A 1G18A 1EXDA 2ZUFA 3HSYA 2V9CA 4QNMA 5K6AC 2ORVA 3K1AA 4J0DA 5IKOA 4KR2A 4AROA 5AK5A 2Q5IA 1H6DA 1YDHA 3SSAA 2IP4A 4LSZA 3SFZA 5IHPA 4Q39A 1CZHA 1D8AA 4XCXA 3H4MA 5EUMA 4ZEOA 1UFKA 3V1MA 2R97A 2YCLA 5CT5A 2POQX 3ADPA 2GHRA 4MEBA 4HH1A 4QNNA 3SJ7A 3SOZA 4C4YA 3W5BA 4P0QB 3ZZTA 3ZWNA 4EUSA 2D74A 1R66A 1FPMA 2D1SA 5AHKA 2PKRA 4CM1A 1GLNA 2Q27A 2BMAA 3CTMA 4NDZA 2EFCB 3ND8A 4EYSA 3BG5A 1OJLA 1FSGA 3TD9A 2ZJ0A 4BKPA 2BIFA 5FOQA 2ZR9A 1D1TA 1U3VA 1KQNA 3N0RA 2NT3A 2I8CA 2OMKA 4QIHA 3GW8A 4UHKA 4CF7A 3N2ZB 1L9XA 2OO5C 1AE1A 2WLTA 4RK7A 3VUFA 4K88A 1WMDA 4BO4A 9LDBA 4KBFA 2TRSB 4OLJA 4WZAB 1GPAA 2HU5A 3WLMA 3MRTA 3MBOA 3VTAA 4NU0A 2O0MA 4NNJA 1C0EA 2DECA 3LCRA 2QPLA 3F5QA 2KLBA 4KLAA 3OX3A 1WULS 4K2AA 5A5FA 1U3GA 2NZ8A 2ZB8A 1KOLA 1UODA 1ZD1A 2GF2A 2RI0A 3MQ4A 2C57A 4Q9HA 3T9FA 2I76A 3TQRA 3I6ZA 3VZBA 3ZVMA 1BVHA 1VXOA 4G0XA 3KFVA 4LDPA 3WZ2A 2CNDA 4FZJA 5K3FA 3IBFA 3O84A 2RGYA 4NK5A 4EYOA 4EJ6A 9LDTA 2C3PA 1IB0A 4FC7A 3WK6A 3ETDA 4MYUA 8ABPA 2Z95A 3VOBA 5IDWA 2BWJA 1EH5A 2PS0A 1ZC4A 3B9BA 1NMEA 1MC1A 4Y0AA 1Z0FA 4C3OB 2W6QA 2JHFA 3GARA 3HA3A 4W9RA 1PG2A 2VYFA 2DEUA 4O4HA 3WB9A 3CKLA 1RKUA 1UC8A 3NWPA 5T7BA 3C5HA 4YJHB 3N5CA 1UJMA 3IB3A 4UU0A 3FCUB 2IV2X 1EAYA 2W2NA 3FPEA 3JQFC 5CGQB 1HZJA 3C4QA 2GPBA 3D2LA 2PL1A 4KBYA 5CH8A 1E64A 5ALKA 1KOJA 3EBPA 2BHSA 3RS5A 4BE4A 4E5UA 2FYTA 4HJXA 3RFFA 2XEIA 1NZJA 1VG0B 4RELA 1B3RA 1AO3A 1EK5A 5AVXA 4D2IA 1RQNA 2QZSA 1JLLB 1NI4B 2AMVA 3K0EA 5CRIA 3WWYA 5DGCA 3RC2A 2X2EA 3E5RA 4IH4A 1ZCAA 3DULA 4W1QA 2GBIA 5KNBD 5GMOA 2DLNA 4TKLA 3PQ4A 1V96A 2RH5A 1U2TA 3WBFA 5JS6A 3EX7C 5CEEA 5TPZD 4K40A 3D8HA 1J49A 3JYPA 4BKRA 2GA9A 4FJ0A 4MMXB 5LSAA 4F72A 1UP7A 5SYAA 1NXXA 3QX8A 1WXFA 4Y9SA 1P5RA 2Q6OA 3PHCA 3WS7A 1XFDA 2VAPA 4Q1FA 3VU9B 4DJTA 5C35A 2DGDA 3VU0A 4WN9B 5EEGA 3GLHE 3BF7A 1MIOB 5FOWA 3NTRA 1OX4B 3ZHOA 5KTTA 4AB1A 1E3TA 2XGGA 4NDAA 2XMSA 3JS5A 1M0EA 2X1MA 2RHCA 1PG5A 1FX0B 3AUTA 3DOJA 4BZXA 3GEHA 2GBCA 3CMCO 3FLBA 3Q5GA 2WIKA 4O8CA 3CZCA 4C3UA 5EWLA 3EQ6A 4CMKA 4CLOA 1D6NA 2VRWA 3WMFA 1X1RA 4P0TA 3F7MA 3EGDB 1R5JA 3NZEA 1LBEA 5EE0A 5JRZA 5J4YA 3KAKA 3TCNA 4N8DA 2FPOA 1T8WA 4LSWA 3GRFA 4JBNA 3RM3A 5AXCA 4DQKA 3OQOA 3WLOA 3KD3A 1V4BA 1H6AA 3AH8A 4QU5A 3K6KA 2CK3D 2WF9A 1F2DA 1GUYA 2H2GA 4FKZA 3RIXA 4CT0A 1DCKA 4BLPA 1ULHA 5AXBA 4E13A 2LCIA 4IUCS 1CUCA 4HLUC 4CKEA 2EJTA 2D1YA 1VA5A 1C9EA 2H3EA 2JEOA 2ZJ2A 3BEOA 4GP9A 4QXPA 4CM9A 2W6IA 3VQTA 4RETA 2N46A 1W36C 4FIDA 2C95A 5HIMA 2ZSUA 2XMQA 3N76A 3RUEA 3TOVA 3HKEA 3D5EA 2FWIA 1V95A 3E1GA 2ZDQA 6REQA 2R1VB 1Z4OA 4XASA 4BBZA 1I8TA 2CL6X 1VKZA 2N3ZA 1EUDB 2XITA 3MTDA 4JLSA 2ORWA 4MWBA 1J2TA 1D7OA 2H5EA 4LSGA 1NHGA 4ND5A 4ZCTA 1CUWA 1ZJJA 1ZNWA 1XHFA 2Q1SA 4K9RA 2DX7A 4DSZA 1MJNA 3WGMA 1QIEA 1LV7A 2BH9A 2GR9A 1HSZA 1HLPA 3IQDB 4NBRA 3FNRA 1Z9BA 3AERB 5J5CA 1M6VA 1SRQA 3BB1A 3GO4A 4U7HA 4POOA 4DLZA 3QBEA 4FGWA 1OC4A 4E5DA 1DC4A 4GE0A 1WX1A 5IWAB 2M6RA 2F8MA 3BYZA 4ND1A 4NYMQ 4JLMA 1NRWA 4RFSA 3TQSA 3U7FB 2ZYWX 4GH5A 1RMYA 2WEKA 2WJJA 2E82A 1JDSA 3C7KA 2HK8A 1N0VC 3DC7A 1VKOA 3DZDA 2OGWA 4KIJA 3L7NA 3LUAA 4QLBA 3ZDBA 3KTFA 2JHAA 4N7RA 2OHGA 3HR7A 3TWOA 2F3TA 3OZUA 3SEFA 3PNPA 4HWRA 1TCUA 4L0QA 4M22A 4Y1RB 1QUFA 5EJ9A 2OT3B 3TOXA 4I4LA 1JRLA 3HLTA 4C0WA 1RKQA 2Q0SA 3M49A 1E1LA 2C97A 4DLUA 4YEDA 5CA0A 1TYAE 3F5MA 4H18A 2B2XA 4OUDB 3FTQA 5HKLA 2C03A 2NTEA 1IUPA 1UXJA 3OIFA 1J1IA 3LT1A 1JKJA 2Z98A 3S5UA 4CVNA 4V0RA 4MR8B 5EIXA 2OM6A 1U2GA 1DAKA 4DM7A 4X41A 3H5TA 4WH0A 1WOYA 5SYMA 3EVFA 5KAMA 5HOEA 1TIPA 4AL4A 3EEYA 1NSTA 4FC6A 3TE6A 2IGBA 4AJPA 2IOHA 1KI6A 1WNFA 2EV9A 3HR8A 3HYNA 3SBEA 5A6VA 4E07A 2AA3A 3PQ7A 1GD1O 4CLRB 1VZ2A 3F97A 5P8WA 2CLSA 4LTDA 1LLQA 5CLFA 4WK2B 3KWFA 1OYYA 5EZYB 4D82A 3MMSA 2CHEA 4QT4A 4GVLA 2H1HA 5B2FA 4YRFA 4DNXA 4F96A 4I55B 2CE7A 2QRVA 4MS4B 1V4VA 1H2BA 1Z7EA 4LIPD 2IK8A 2PN1A 4PFJA 1KY2A 4XJVA 3RKRA 3FNIA 2JFUA 3DXXA 3SYRA 4E5SA 2IH2A 2NP6A 1AKYA 1L4GA 5HWSA 1W1WA 2H7XA 3N7TA 3N53A 1LD3A 1BVRA 1W73A 4AT1A 1DVRA 3K2BA 4O3MA 4EITA 1I7LA 4LS3A 5BWCA 1QG6A 2HA7A 1LFDB 4I1RA 4MAFA 4NZYA 3S7TA 2ZBUA 3ZJYA 3VVMA 1X0VA 1T3TA 1JH9A 3F3KA 4ZI5A 4JYPA 1FDIA 3I2JA 4X1KB 3QLTA 3MGCA 4IDDA 5TLSA 2W6MA 1PTJC 4HPJB 4MQEA 1JR4A 2YJ5A 3IERA 3M89A 4TMKA 1SB9A 1M8PA 1UMBA 4KVZA 4L8FA 2BT4A 3DYBA 3FLAA 3OJ0A 4F4UA 3GNSA 4ZHSA 2AG1A 3EBOA 3KLPX 4GM1A 5ALVA 1SUWA 3L7AA 4GKAA 2FR1A 4JNKA 5A4AA 1FZTA 4LCJA 1YZQA 4OMUA 4HAOA 4G5YA 3ZK8A 3QV1A 4JYCA 2R48A 4J7UA 3Q8WA 1G8AA 1CUXA 1F9AA 1N3IA 1NV8A 3KLNA 5K99A 5KYKA 3E48A 3J7AC 3BVPA 1DKRA 1NT2A 1J22A 2BKUA 3J7TA 5LA6B 1M5RA 3ITDA 4X7MA 4QYSA 5ALWA 3GLQA 4CCWA 3VKUA 2OC9A 2DM6A 4EFMA 3JAKA 4ZOBA 4PLWA 5ESDA 3U56A 2FRDA 4X7RA 4KQXA 3E9DA 5J63A 5IJ0A 4F8EA 4BVFA 3L1VA 3MAGA 5C8ZA 2XRFA 2GJAA 2V74B 1ZVMA 1PHRA 3DBRA 4OYYA 2Q1TA 3ZHBA 4OHRA 4HNSA 2Z04A 2QRPA 1S2IA 3OZAA 1F4VA 4AECA 2Q41A 1NOJA 2XGSA 4K26A 4LX8A 2IF0A 3VR6D 1M2HA 1M76A 1NVFA 2J3IA 1ZN2A 2YWRA 4GI2A 1P2DA 4M49A 4PXYA 3UFXB 2R6FA 1GTMA 4CEJA 2ZU0C 4TVBA 1Z4JA 2WW8A 1YQTA 2IL1A 2C2KA 2RIPA 2VYNA 3PHHA 2FW7A 1QHXA 4OFZA 4PY2A 3T41A 3WAKA 1UOQA 5LP6A 4TKUB 3VYVA 1C8BA 1OLXB 2DCUA 2R6ZA 1Z6AA 4OI2A 2YUIA 4AO6A 3N2GA 2YXPX 3T7AA 2WJAA 4CQMA 1JFFA 2C5GA 4QHYA 1CDDA 1U9IA 4RK5A 3WNQA 5GGYA 1C7ZA 2PBLA 4MQ6A 5HGJA 3WC4A 5EGSA 5JQGA 4NECA 5ITZA 4IIUA 3D7DA 2IOYA 3QOYA 4KO2S 2CT8A 2GZ1A 1AKMA 3ICCA 3I72A 3EXHC 4YRZA 4K0KB 3TLYA 1GQ2A 3F6SA 3JALA 3SFVA 3BXGA 4Q3KA 3JWHA 1CWUA 2BH2A 4L76A 2B69A 1I1OA 1KYXA 4YQYA 2VOEA 1GAWA 4XD2A 1AHIA 4O2AF 3N8NA 2AQHA 3CT6A 1R8QA 2AFIB 4LDJA 7ABPA 4YRTA 3NUQA 4ZU3A 4G4JA 4KEAA 4C0QC 4Z1MD 5ESXA 2VHCA 2I78A 4U8GA 3GBPA 2NACA 1AX9A 2QK4A 1QLHA 2WYUA 3KJFA 2J08A 4BP1A 1U3UA 3CURA 3EPPA 3KHUA 1JILA 4V39A 5EP3A 3X0DA 3ZNOA 2EZ9A 2X1VA 4JI2B 2HNBA 3R3ZA 3ZY3A 1ZGHA 2QD1A 1HOTA 4H7JA 2BKXA 3QY9A 3RFCA 4AUNA 3ET4A 4HN9A 4DZRA 4LYJA 3U40A 4IJVA 4GMFA 2I4NA 3C43A 4GZLA 4PYLA 1SBCA 4RZXA 5AJUA 5JMTA 1J23A 2J59A 4AS2A 1ZINA 3JQ6A 4X6YA 3UOWA 2OORC 3HDTA 1CEEA 4YDQA 5CT8A 3SM3A 4J0NA 1AQIA 4RZ2A 1L5NA 2PFGA 2YWGA 4G1BA 2WHPA 4MV6A 1U0GA 4P34A 4M9CA 4ZAVA 4B0OA 1KO5A 1XXHE 2YJ6A 1PZHA 1AQLA 5ALRA 3FROA 3UB4A 1EXMA 1AA6A 4A16A 1C3VA 4F9GA 5IBRA 3U3RA 4DADA 1QYWA 2UUAB 1JA0A 3AONB 1KK3A 1LSJA 2XQFA 4JR2A 5A9SB 1HX7A 4O2LA 1Z62A 5LYJA 3EAQA 1IULA 1SBZA 4KRXA 4PZPA 1CUIA 1QFYA 5BWOA 3I2FA 4O2BB 1GADO 3R0QA 3RVBA 3AU9A 1FW8A 3L6EA 1ZAYA 1J8MF 1GT91 5IYZA 4F91B 1PNRA 3AFOA 2EKLA 2P9TA 4PQYA 3Q8XB 1SXJB 1VRCA 2G67A 2B35A 2Z30A 3EGEA 3LI2A 2P9JA 5LM3A 1UDRA 1QR2A 1MF7A 1JKIA 4MZXA 1XL0A 2C04A 5FTLA 1U2QA 4C4ZA 4Y6QA 3IE0A 1OF1A 4EL0A 3BE5A 3HPQA 3O21A 4KHZA 1YR2A 4W7IA 3ZWPA 3K9LA 5H3CA 1O6FA 1N5OX 2X5NA 4PNPA 2WUGA 2WKWA 4JZKA 3VOSA 2G28A 5LLSA 1UOPA 4FB4A 2VHQA 3C8MA 3W6OA 1KO7A 1ZR4A 3P0RA 2C7GA 1B4DA 4DR6B 4A8JC 3UV7A 4UNQA 1NNUA 2NZWA 3Q8KA 4NDNE 1G2PA 4EGJA 1JDUA 1GPKA 1P19A 2DY1A 5H0IA 1NVVQ 1BRTA 2RGGA 4IUBS 4PNHA 4C01A 1E1CB 3CMMA 3O91A 4RTRA 3HDGA 5KS2A 4J7XA 2AUNA 4BNKA 3OMLA 1GPNA 1TJ4A 2Q5HA 3K0FA 3S0JA 4BVBA 5FFMA 4A03A 1H4SA 3OO1A 4WEQA 3PEEA 3C8HA 4BLVA 4WFKA 3FY4A 4CMHA 5BSWA 2Q46A 3NWEA 2YQ4A 3IUMA 3WGUA 2WQ7A 4UMVA 3DBLB 1YFKA 1D4OA 1VRVA 2JBHA 2Z2JA 4DA6A 3DP9A 5K6TA 3BCUA 4ND7A 2GVNA 3Q7QA 3R3UA 4QUGA 5FHRA 4BVLA 2Q8PA 2Q0XA 3IT2A 2WU1A 4EY6A 1QV7A 3DEJA 2R47A 3BMOB 2C5AA 4AP9A 2Z08A 4E5YA 2YL2A 2ZM5A 3X1MA 1OXMA 4F4FA 2OHIA 4EJSA 1HTWA 4BB6A 1V5WA 4E11A 1EUZA 2JJ1D 1OPXA 4JQCA 3PWSA 2PT5A 1I13A 4X85A 1J0AA 4BLQA 1OV6A 3OQBA 2L42A 1M83A 3KCNA 1N9GB 1YJQA 3A3NA 1E7MA 1E2BA 3C3XA 1DKMA 3ESQA 1PQPA 2JBWA 4EY5A 3Q9SA 2CXPA 1YE5A 3TD2A 2ZSHA 4CM3A 3C5WP 2VNKA 4B33A 3B13B 5HUJA 2ZAMA 3ZZMA 3OIUA 5IXJA 3QVVA 3CG4A 4YCAA 1IQUA 5E6SA 5NLLA 3G9UA 4BZZA 3KYBA 4YRMA 1PBTA 3ZWAA 1T3HA 4KDRA 2VF2A 3QXSA 1RZRA 4ZQGA 3FSJX 4R9SA 1EUCB 2CXQA 3V7WA 3COJA 4DCOA 4H7HA 3E9ZA 3KTDA 4RH1A 3DBOB 3UWMA 1KHTA 1ZESA 3GDFA 1XNJA 3KR1A 2QRKA 3E35A 1NVGA 1P1IA 2CF5A 2WE8A 3NYRA 3Q1LA 4OI1A 3TOSA 4AP6A 4EDHA 3MCTA 3UAWA 4RJTA 3CNHA 1MGPA 1ZYUA 1L5WA 1FTYA 3F7NA 4L9SA 2VJQA 4DQVA 1PV4A 4B73A 3OJEA 3FR8A 2Q6VA 4K46A 3S2GA 4CMEA 4Z51A 5EIAA 8AT1A 5AOCA 3RWMB 3RRMA 3CZQA 1J7JA 1ZGZA 3PDHA 5J2TF 5HZGA 1C8LA 1FSFA 1OTYA 5IVIA 2QE6A 3FSGD 4XGRA 2ZT7A 4ZT2A 4P2GA 1ID8A 2SKDA 1BN6A 4GFDA 1LPSA 4TTRA 5DHFA 2HRBA 4CIDA 3RUCA 2YHBA 4MQBA 3TR5A 2CJYA 1RQGA 1JXMA 4J9VA 3QIAA 3ND6A 4ZQCB 4M53A 4EPXA 4MRRA 4UTZA 1SIBE 2LP4Y 1II8A 1DXYA 1NR5A 4AKIA 1FTWA 3PGMA 4F1WA 2EP5A 2EKZA 2VP9A 2W4IA 1QDEA 3DL2A 3OSUA 4FS3A 4N4AA 3RTAA 3V80A 3WRYA 1UQRA 1A95A 3KTAB 1DEOA 2NYUA 4IDHA 1RAAA 5AKKA 1ISGA 2BEJA 2IX9A 1IZZA 1CNMA 1IVSA 3ESDA 4DR4B 3G2MA 3SS8A 1BCRB 1VHTA 2JFYA 2ZAGA 3O94A 1GTJ1 1RLTA 3WICA 4D1YA 1RWWA 1LI7A 1PCXA 2BN4A 1E0AA 3UJCA 2D0DA 2R4QA 2PX2A 4G5RA 4RLQA 1Z75A 2HSEA 2EQBA 3IURA 2ONJA 5LQKA 1T36B 3FR7A 4HNVA 3W7VA 1IAVA 4QZVA 3CO5A 4J90A 3RAFC 2O06A 1WBJB 1K88A 3BKWA 5JCJA 2WF6A 4R3WA 3AOEC 3PF8A 1ZKMA 3E8MA 4LJLA 4LQDA 2B9VA 4M7PA 2P3QA 4P4EA 3OA2A 1IWOA 1QC5A 3EZEA 1NULA 3H5OA 4QBKA 4Y9DA 2FWJA 4HSGA 4WESB 4UD6A 3NHYA 4Q9IA 1UEJA 5DHQA 3AF5A 4N6GA 4JI7B 1RYYA 3NHLA 2NVOA 2Z09A 3QYFA 4LZWA 3KUCA 5K8CA 1BFDA 2GPSA 5BYKA 4TQ9A 1U04A 1TTTA 3TO5A 4BDTA 3LF1A 3MIZA 1OU0A 3BSYA 3U1VA 4WOKA 2C3MA 1N5MA 3JD3A 1PX0A 3RWOA 4RTJA 1N2CA 3L0IB 3EA5A 2C4KA 3F73A 1QAOA 4D0RA 3JD1A 3WA7A 3KBBA 3I53A 1LV8A 1DELA 2QPAA 3M7IA 3OM1A 3PNQA 5H16A 1H4VB 1X1DA 1Y3IA 1FSZA 4W82A 4DT1B 3D0OA 4WOBA 3LSYA 1VE6A 4ZVRA 3WSWA 3TRFA 1JVSA 3KQNA 3E9NA 2Q5EA 4TYQA 3WK8A 2JGEA