3TLYA

Microcin c7 self immunity protein mccf active site mutant s118a/n220a/k247a in the apo state
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
335
structure length
335
Chain Sequence
b'PLLAAPLAVGDTIGFFSSSAPATVTAKNRFFRGVEFLQRKGFKLVSGKLTGKTDFYRSGTIKERAQEFNELVYNPDITCIMSTIGGDNSNSLLPFLDYDAIIANPKIIIGYADTTALLAGIYAKTGLITFYGPALIPSFGEHPPLVDITYESFIKILTRKQSGIYTYTLPEKWSDESINWNENKILRPKKLYKNNCAFYGSGKVEGRVIGGNLATLTGIWGSEWMPEIRNGDILFIEDSRASIATVERLFSMLKLNRVFDKVSAIILGKHELFDCAGSKRRPYEVLTEVLDGKQIPVLDGFDCSHTHPMLTLPLGVKLAIDFDNKNISITEQYLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MccF
publication title Structure and function of a serine carboxypeptidase adapted for degradation of the protein synthesis antibiotic microcin C7.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 117
structure length 335
sequence length 335
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02016 Peptidase_S66 LD-carboxypeptidase N-terminal domain
A PF17676 Peptidase_S66C LD-carboxypeptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Class I glutamine amidotransferase-like 3tlyA01
3.50.30.60 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 LD-carboxypeptidase A C-terminal domain-like 3tlyA02
5F9MA 4MJXA 3TLGB 3GJZA 4IIYA 2AUMA 4H1HA 3U1BA 5F1YA 4MI1A 4E94A 4INJA 4EYSA 2AUNA 1ZRSA 3G23A 3TLCA 5K99A 3SR3A 5F5XA 3TLGA 3TLYA 4JVOA 5FD8A 3TLAA 5JYBA 3TLEA 3TLBA 3TYXA 4E5SA 1ZL0A 4IIXA 3T5MA 3TLZA
chains in the Genus database with same CATH superfamily
1FS4A 1ORRA 1TADA 1JG2A 3O8QA 1TM2A 3PIIA 3PUHA 4JK3A 5H70A 2PWAA 4BZPA 4JI7B 2XWBF 4CCWA 4R1MA 4XVRA 8ADHA 2VDLB 5EP1A 1XRRA 1ORVA 3OE5A 1G8JA 2V7WA 3F5FA 4JBIA 2D0IA 3SS9X 2ET6A 2ZYWX 4BATA 4EAAA 4HDCA 1WVIA 4E88A 1DRWA 3B1YA 4HNGA 3UMMA 3UHAA 4B3FX 3HVHA 1C9MA 3UMSA 3X1MA 2H08A 2V55B 2XMCA 3AYZB 3K1ZA 2VEDA 1KAHA 2G5PA 3KPUA 1GV0A 4GDFA 5CLFA 3ZS9A 5HF9A 2D8AA 1X2EA 1RTTA 4GI2A 1F9EA 2OSBA 2QM3A 4LQDA 1H2BA 1UKBA 3MAJA 4NYIQ 1A1VA 1P1HA 1AN0A 1ECGA 1JMYA 2R48A 4UFNA 3QPBA 1OXKB 3C3EA 4QJ5A 4RGQA 4FI3F 2FF5A 3ONDA 3IURA 4GPBA 4RPLA 4BBAA 3A25A 2BBOA 2QR2A 1UFVA 2RGDA 3L0IB 4KQ9A 4DPLA 1TJ4A 1QU2A 4O0LA 3N07A 5JBNA 1KETA 4YHBA 4TXHA 1GXSB 3LX4A 4HB3A 2VHZA 3MQ4A 3O93A 3KDPA 2IHYA 1U04A 1ZA2A 3NTLA 5SY6A 4UHHA 3FNQA 4RH3A 3V8RA 3EZ6A 2PKXA 4DJAA 1VPTA 1QE5A 3P52A 2IQ5A 1RLJA 2YNMC 3GLUA 4JDUA 4MJLA 2GXUA 2WINI 3P9CA 4WCFC 4CV3A 1J00A 1ND5A 4KYIB 1J2EA 4J49A 1T0UA 1JDSA 2GYVA 4RGYA 1FDIA 2PZMA 4K6MA 1B41A 4R84A 3RYTC 1UBCA 2P9GA 4P53A 3WYDA 4PYQA 3TDMA 4RTSA 5EEHA 4AC9A 4QOGA 3N74A 3UPUA 2KYRA 3CUUA 2DFVA 2RHWA 1VSQA 3F97A 4WESA 4MYRA 2ZM5A 2Q1SA 3KQWA 4EF4A 4C9AA 2J3IA 4U7GA 1BVHA 1YRYE 1LDGA 5GJVC 4ZMSA 1NE7A 2Y0DA 3AUJB 4MQEB 2X42A 1T9BA 1QP0A 4LNHA 5THKA 3G9UA 3HCEA 4GOMD 2JLCA 1DUVG 3AIMA 4X41A 1F3LA 3K5HA 2RE8A 4MPRA 2YC2C 3Q1KA 1BW9A 1GT91 1SOAA 3PDIA 4YBZA 1NF2A 1S2NA 1OF1A 2GPSA 2QLMA 3O1HB 5BR7A 3B3FA 1YZUA 3CVUA 3BGDA 3HNPA 4BFSA 2GSDA 4A03A 1C1DB 5FQNA 4DIBA 1H5QA 3PNLA 5FL3A 3VPCA 2Z2XA 3TNYA 1IK6A 4Q3AA 3KHTA 3NV9A 1QZUA 4Z7QB 1JDUA 1DDGA 4NY1A 5EWLB 1QK3A 3ANXA 3VV3A 3I09A 1DT5A 3BTUA 3NT4A 1XVUA 1B6SA 1RRVA 1ZUNB 3SYRA 3UOAB 3KJZA 4MW5A 6PFKA 1VLLA 4GL2A 1NASA 1J8YF 2C3UA 2RGCA 2ZB4A 4R8LA 4ZWNA 3OE7A 1WF6A 4KMMA 5LZ4A 1M1XB 3IBYA 4WK0B 2Y71A 1RM5A 4I50A 1QZXA 2TMYA 1AIPA 3OTIA 4L7VA 1TTQB 5T41A 3NOQA 2FW1A 4Q7EA 3ZPXA 4AUEA 1W0KA 3A1FA 1ZFNA 2FDXA 4F9FA 1KYIA 1WTCA 3THOA 5BOSA 3FTCA 4E4TA 5KB3A 3EMKA 2XUHA 3G0IA 3N0VA 4MRAA 4GOXA 5IM4A 5F1YA 2C5EA 2GVDC 4EFNA 1Z5VA 2K2WA 2QNIA 3JRWA 3V80A 1E4EA 1WD5A 2QP3A 3OPMA 4B5KA 1HI9A 2VWPA 4PZEA 3TNJA 2P7IA 2HQOA 4AN4A 1T9DA 2I7DA 4TMKA 4Z8XA 4OHXA 4DMLA 4RA6B 1MABB 1TJ5A 3MTJA 3ROFA 3AEKB 4CQMD 5CCXA 4YAGA 2NMVA 3ZCVA 2AN9A 2REOA 3LC1O 1ADYA 2HRDA 4ZOQI 4LF6B 3IPLA 1NNUA 2OZLA 3L7CA 3RU9A 2EKZA 1EWQA 3FZNA 5PGMA 1XTBA 3E1SA 4LYJA 5DVZA 2G1AA 2DUMA 5A3SA 5KTMA 1BQ3A 4FHCA 4HXFB 3SJZA 1PS0A 2CHVA 3TK1A 1GWNA 1NUSA 1UPUA 3DM5A 3HO8A 1L4KA 2H54A 5D3KA 3OIUA 3ANNA 1MCZA 1JA1A 2Q3MA 1QDUA 1BRMA 1VLJA 2P65A 4FYKA 4X6UA 4RXMA 1CEXA 3DE5X 2EJTA 5K51A 5T57A 3SKYA 4MQFA 2AFRA 5AM4A 1VHWA 2O2CA 3FSGD 1E7QA 2BBTA 3R7WB 3E48A 4Y67A 2I6SA 5FEUA 5CLHA 4EY8A 5IVHA 1MIHA 1BWPA 4LNAA 1AHPA 1MQAA 2C5FA 2IUTA 3OM0A 3RFUA 3H9BA 4IH4A 1G6HA 3IMEA 1M5TA 1IWOA 2NZ2A 2XVAA 1B8NA 4LRYA 1N2ZA 3X1WA 4R1UA 1XPUA 1MA3A 3NHBA 1E2JA 4TMYA 3MRTA 2GBFA 1L7PA 1UDCA 3JYPA 1EX9A 9LDBA 4NG4A 3H04A 4HLNA 2ETVA 3NGMA 3UK2A 4MV1A 2E4WA 2JAXA 3RS4A 1J7KA 5CFMA 3FFXA 3OESA 3L6EA 5A4IS 4B6OA 2AXNA 3OLCX 2VNJA 3HKCB 3PTLA 3UEOA 3WQRA 3JAKB 4U00A 4E21A 1V48A 4XIYA 4BFTA 1CS0A 1C0KA 2IF0A 2XNSA 4UNPA 4KNWA 4IV8A 4KB5A 2DE0X 3E3AA 1M8GA 4O4LB 1SO8A 4NDAA 2PA0A 3T3GA 1KMNA 3GUYA 3JQ8B 3BI1A 1TO2E 4RTPA 3N2KB 2J3KA 1SBQA 1CR6A 4D5GA 3X1ZA 1IOZA 4I5DA 4Y2YA 1YRLA 5L9AA 2EJVA 4JEMA 5A3VA 3TL2A 4Q93A 1SMKA 1ISMA 1EE2A 3U1BA 4P4LA 1EUDB 3ZWNA 1HF3A 1KZYC 3OT4A 1U9CA 1NUQA 5LCXA 7ABPA 4BFWA 3S9LA 4DQ0A 2X8JB 1VJRA 4R5MA 2X0EA 5D51S 4DRXA 4NTZA 5CDGA 4AROA 1TFRA 4N5HX 3HRIA 3L82B 4KYUA 1XEXB 1TF5A 4XGRA 5CR9A 2PVVA 2I1LA 5FPHA 3GEGA 3RROA 1DBQA 4S04A 3A2LA 3RT1A 1UT8A 2BUCA 4AICA 3ED1A 2WUGA 2ZBEA 4C7OA 2NZUG 3LQRA 4XAQA 3AJ9A 3K7EA 2OGUA 2JASA 2EYQA 2WIAA 5EXPA 3HCBA 5KYUA 4QPDA 4ER5A 4L07A 5CX1B 1IQ0A 4X1YB 1MG0A 4CMEC 1YQGA 5EJGA 2WP8J 3H86A 4LK2A 4F2HA 1KJJA 4OC3A 4GQAA 2ID7A 4PAQA 2R1VA 3DLAA 4HJRA 3QXCA 2R47A 1GSOA 1K5HA 2ADOA 1USUA 3Q5GA 2GN9A 2GZSA 4J4HA 4MUGA 1NWHA 1HKHA 1AC5A 1LZKA 3QU9A 4GSKA 1V5FA 4NNOA 4QUGA 4RJ2A 5ALGA 4E5MA 4JC8A 3NHJA 2HREA 3RVNA 5A3QA 1M8PA 2BTQA 4PG6A 1KO4A 2RH8A 1A69A 3TLAA 1FFXA 3ZUPA 4AWXA 3SJ7A 5KCZA 1FVHA 2Q5IA 1P33A 4EM6A 1I01A 1QIJA 1R0RE 1EJ2A 1HE5A 1TUGA 3OCVA 1HZZC 1XJQA 3AVUA 1E9CA 1KL7A 2WT9A 5EKUA 2JB9A 1M9NA 1R27A 2ZWAA 4FSXA 1OZAA 1S02A 4PWZA 4UM5A 3N0XA 4YUWA 3TCKA 2VJAA 1KO7A 1X38A 1E3DA 3B6IA 3OOWA 4IDGA 4MUXA 3RVMA 4YRIA 4D43A 5FLEX 3E9CA 5EPOA 1A4RA 2Z2ZA 1TE2A 4IILA 4E4RA 4WEOA 4ESHA 3AYXB 3DP9A 3ECSA 1D2NA 1VHDA 3IBSA 5HQTA 4OI2A 4CV2A 5HUQA 5DM1A 1UC5B 2XBMA 3I01M 1QFXA 1SH7A 4BPRA 3RTDA 4QUAA 1E94E 3WJ2A 2IZ5A 5AP9A 2P77A 5IU6A 2BFAA 5FD8A 2PL1A 3NO4A 3CKLA 5TQ2B 5KSOA 5DEOA 1KEWA 4E0BA 3N6RA 4FUQA 4ZCSA 5K45A 1II9A 3PPWA 1QC5B 1H4TA 2XNDD 3NVMB 5C0OE 5DI9A 5KYKA 2IXTA 3ZK8A 1Q44A 4H6WA 2IX3A 1BGWA 4DSTA 1Y3IA 2H1SA 1P1IA 1DKOA 2ZJOA 1K7XB 4GM0A 3RSSA 3R75A 2DUWA 3CF0A 5LBIA 5KSZA 1MOZA 2G1UA 2R1TA 2EJBA 3MB8A 3TBHA 1IHXA 1FLVA 3B8HA 1IY9A 4MVYA 1WDWB 2AS0A 3NIDB 4H15A 2PR7A 1IQPA 5FA6A 3B8EA 1FX1A 1ZU4A 2FVXA 2X9NA 3I4CA 1KVRA 3EN0A 3F6PA 3Q2IA 5SYMA 4ADSG 4AKEA 3BGSA 3ZE7A 5YASA 1U7ZA 2NN3C 3DPUA 3M34A 4FGZA 5IAGA 4ZV7A 4RX1A 3DLIA 4IFEA 5BV1A 1IDN1 3GCDA 3MGGA 2B82A 4PIPA 3GMDA 5TC4A 1M8KA 3FUTA 4ZYVA 2E1RA 3HP7A 4Q6WA 5K1ZA 4RD3A 4C3ZA 4PG8A 4E6EA 1SCQA 3K70D 1C1XA 4LQGA 3MTIA 4ZVUA 2PK3A 5A3RA 1RMQA 3B7PA 3ZGOA 3UUEA 3HN6A 3O74A 4S12A 1GZUA 1DJPA 4MIEA 1DFIA 4Q4AB 3N5KA 2G71A 2A67A 5A4AA 2FMHA 4B82A 4FCCA 3H5TA 4GE0A 3LX5A 4JYPA 3EXHC 5LLDA 5B36A 3OTGA 5G53C 1D2HA 1XQYA 2ABWA 4JI4B 2FW7A 1NP3A 2YY7A 5AM2A 1V8BA 4YRFA 4Z4FA 1J56A 1FRVA 4XIFA 2QPTA 4FYMA 4ZAYA 2PSSA 1AV6A 4O3FA 2CDAA 4JYMA 2PRIA 1HE3A 2O14A 2QTBA 4DLXA 1V3QE 3QVXA 4JQZA 1H4QA 2YWHA 4N0PA 2Q7OE 1D09A 3CRMA 1JT2A 5AI8A 3SHTA 4CEIA 3BFVA 2QIPA 1C3OB 4R8SA 5DT9A 5DWQA 5FO1A 1SU7A 3N8GA 1NHWA 4CEHA 3FSEA 4ETIA 5FBRB 3BTOA 4D4JA 1X1BA 2Q62A 3AR4A 3WGOA 3I5XA 5IJ0A 3QVVA 1N1DA 1J2JA 3JYLA 1EFVA 4DJEC 2GVNA 1QUFA 4DR6B 2V98A 4TL9A 1LPAB 1C9NA 3KOMA 1LX6A 2YNMA 3NAMA 2J9FA 4PGGA 3HZRA 2OBMA 3P0IA 2QU7A 1NXSA 4C07A 3PLNA 2B9EA 2DHEA 3OCXA 2G9NA 3HY4A 3ST7A 4BKOA 3S44A 5B6JA 3OICA 4KR6A 1N6RA 2P3SA 4PLVA 4S1TA 1F3OA 2D0DA 2PX6A 3KG2A 4MR7B 2Q4RA 4C9EA 1JPNA 2YQZA 1FLNA 5AVXA 2Z1DA 3JV7A 4P34A 2IFTA 1KAQA 5E6RA 3B38A 4CFYA 4DUZB 4MRVA 3K2EA 3BGVA 1Z29A 3NEAA 5GTDA 3KQKA 2LR0A 1JFRA 4G9GA 4K9OA 5LYJF 1MX9A 3TNFA 1SBNE 5FWXA 1ISSA 3GPLA 4JP1A 1NVKA 5A7GA 4FDAA 4LZZA 3KXIA 1DTEA 1FUEA 5CIQA 4NS4A 2Y3IA 1KI3A 4MQ5A 1WUTA 3GYBA 3DHWC 4RTOA 3DE7X 3NTQA 2BC9A 4AZ0B 5DBFA 4EBFA 5IFKA 2IP2A 1OFUX 3JAWB 3L4KA 1HNWB 2WM2A 4TTQA 4B4DA 4KQGA 4NYMQ 1P2SA 1YQ9A 2FKAA 4OUKX 1JSZA 2LZ0A 2O9JA 1YI8A 2H4YA 3IQIX 1SCKA 2QPAA 2GS9A 2W98A 3ACBA 3UWOA 5G1PA 5K3EA 1QO7A 2K7FA 4IDEA 3NVDA 3BB3A 1QJ4A 2N42A 2X23A 4RANA 4ETMA 3OETA 4KITB 4KJXA 1DINA 1Q91A 2JCGA 5KIAA 3FKQA 5EN4A 2J3MA 2I76A 4C20A 1YCGA 2Y1GA 3LUGA 3RREA 1XDBA 3B5JA 4L9WA 1FTSA 4B47A 1GPLA 4LJ5A 4PX3A 3V4ZA 1BRTA 1KDRA 1BA2A 1HEIA 1RM3A 1ULBA 4YROA 1MJGA 2OC9A 1TMOA 2W48A 3COZA 3PFFA 3JATA 3GVCA 3LXUX 2NO6A 2FRXA 2ZAOA 4ND7A 4KIJA 3AM4A 3KZCA 4W8OA 3GRVA 4KXVA 4ETNA 3W3AA 2FPLA 13PKA 1ATIA 1EZ1A 1R4ZA 2EU8A 3IJ5A 2I1QA 2PKYX 4MX8A 3GJQA 2GA9A 3C1UA 1JE0A 3KQQA 4RKRA 4ZC1A 3HCWA 4JODA 2H57A 3LDHA 4FFVA 1IZYA 1OXBB 1XQXA 1JJFA 1WZCA 1HQDA 2X3YA 4QBTA 2IELA 2JH9A 4P8RA 3M3PA 3AT1A 5CX4A 1FZTA 1YB4A 1VTKA 1GZDA 2E0IA 3PKZA 5HS4A 2HR1A 5LC1A 4ON9A 1SBTA 4RMIA 2B8JA 3NUGA 3OCUA 1O95D 6REQA 1WXHA 2CLIB 5EWJB 1WEHA 1Z2PX 3C3DA 3M8KA 4IUCS 3HP4A 1DC8A 5ERGB 1DAGA 3DTVD 3GJ7A 3IAXA 2GILA 4CIWA 5BV2P 3I5MA 3IP5A 2ASEA 2VT3A 2EWWA 4YRQA 5IDQA 3PZBA 2V65A 2X7JA 5FWYB 4HK4A 3FY4A 4Q82A 3QU7A 1NV8A 1Y7HA 1YJ8A 2C3YA 3EISA 4MS1B 5EZYB 3UKOA 4O4JB 4X1KA 1XA4A 2QMOA 5DK4A 4MV9A 1A9PA 4DCCA 3GT7A 5CK4A 3DOFA 5AUPB 3BILA 4J0KA 1C50A 3TMAA 2XEJA 4P44A 1DHRA 2HA0A 3L05A 5CBPA 1D4FA 4EUSA 5KYYB 2FWAA 3E3MA 2VPYA 4GBGA 3HXLA 1E7WA 4MB0A 5T5QA 4BX0A 5JECA 3OHMA 1HUQA 1A0OA 4KQ6A 1OYYA 4OHFA 2I3AA 3KJNA 5H4HA 5BR8B 2R1ZA 2EJCA 4HDMB 5JADA 4MHOA 2GT1A 1M34A 1R0CA 4JZKA 2JJ1D 3PKJA 4JXZA 1OX5A 3CEAA 1EXNA 1W88B 1UMDB 1MRZA 3KR1A 1X8XA 1PHPA 4X64B 1IBRA 2G9QA 1SZPA 3RJMA 4YAOA 4EF6A 1ZH0A 1W30A 3RAJA 5GADl 1YBMA 1BMDA 5AT1A 1FYEA 1H1LA 5LMUB 5CXQA 3N7UA 2BR4A 3MCZA 1VZ2A 1M6VB 1Q12A 3LQ2A 5KKCA 4R2MA 4IQ8A 5FNVB 2OQVA 2GZ1A 1D6JA 1B0UA 1HPLA 3QUCA 2AUTA 2Q3HA 3VO2A 3AY3A 1L7MA 4LYDA 4D2IA 3F3YA 2VJOA 3QVTA 3TI7A 4CMHA 4CT0A 1Z62A 2XF8A 5DV9A 3G7UA 4L5YA 3EJWA 2QMEA 3HV2A 3JYNA 4G1CA 4R01A 5JJ5A 1I3NA 1H69A 1XVLA 5LQAA 2JC3A 1YUBA 1LB1B 4ZHQA 1WRBA 3JQRA 3AF3A 3SVLA 3DC7A 4Q9NA 4JFAA 2IL1A 3IAM6 2NM0A 4MVCA 1JI3A 1N57A 2GPAA 1ZHHA 2P2YA 1ZWLA 4HQKA 3O3NB 4N76A 4EQZA 4JYAB 5JIBA 5HZMA 2ZIUB 4BLPA 4EW2A 5BSWA 5F64A 2A0YA 5FOUA 2EZ4A 3CRZA 1ECCA 5A4KA 3D6TB 2BEKA 1EZBA 4XUEA 2WJ4A 4TVSA 2WMDA 1KAMA 1KK0A 2HJVA 1U9JA 1NSTA 1W96A 2ATCA 2EFGA 3PGMA 4PSKA 3R0ZA 4ZT3A 5GONA 3RVRA 1PV2A 1QWSA 2Y4OA 2EC5A 4ZA2A 3RSOA 1QKIA 1TT5B 1JA0A 2ZCVA 4G4SP 3NJRA 1EESA 5CCEA 2C1EA 5BN1A 2BGRA 5DYTA 3P9KA 1WCXA 1EA7A 1MGOA 3WL8A 3C3CA 1KU6A 1MENA 2FNAA 3S3TA 3E61A 2ZUFA 1YBAA 4PZLA 3MTAA 5AI9A 5E6SA 3VBEA 2ODWA 1YC5A 2XNHA 3D7DA 4QLOA 4EFLA 3RSFA 4ED9A 4AX4A 4QTYA 1WUYA 4S3MA 3M6MD 2HOQA 4JLBA 5FOTA 3CRVA 3COJA 3MMPA 3QLEA 4OLHA 4M1OA 1SUFA 3EC1A 4QDUA 5DSTA 4FQ5A 4IDAA 5JS2A 4UHEA 1KF0A 4OYRA 3MUFA 4EPRA 4F86A 2DFPA 3IALA 3F6EX 5LYYA 2O5EA 1X1QA 1DBSA 1T1RA 2A9VA 2C8LA 2Q2QA 4L5AA 4QPJC 1IATA 2QA5A 4GKVA 5DLEA 5K3DA 1EUQA 3WB9A 5A2QA 4CT5A 3RW9A 4PFQA 3HA5A 4UVDA 5JO0A 4EHNA 3KLBA 3N5CA 1BHSA 1U8TA 2NQ8A 2ZEJA 3OLYA 4ESEA 1FVXA 4Z49A 4WZ6A 4BO9A 5EMHA 3QTLA 1WOYA 1EJ0A 1J06A 2JCSA 2R7LA 4NK4A 1YI1A 1R6DA 4K8RB 4D3YA 2HIHA 1OGJA 2VOJA 4UBLA 1PD1A 2NU9A 2DHRA 2BEJA 4FDUA 3B1KA 3SJAA 2XE4A 4YIKA 1KO5A 3CBGA 3CJRA 5D3QA 3GEBA 3QOWA 4RMNA 1E6UA 5KQPA 3ID6C 1HMPA 1PQYA 4AQYB 3FWZA 2IC5A 4YJ3B 1H3NA 2SKCA 1YVRA 2BFPA 2XTAA 3O03A 2XUZA 4X90A 5G40A 3W5JA 1O6BA 1KTVA 1Q7CA 3O9VA 5CDTA 2WUWE 3FOZA 1ZVKA 2A5FA 3GZNA 2B35A 3OCZA 4ZCLA 5LYJA 2QTMA 3UA4A 3CMMA 4AECA 1QF6A 3WGJA 1VPDA 3S68A 4HAYA 4D8TA 2F9LA 4UDXX 4US1R 1ZP6A 3EQ8A 3UZUA 1PLKA 6LDHA 3H5OA 4ND8B 4RXUA 5B1EA 1HORA 3D6HA 1FP2A 3WLIA 1H2EA 4B7XA 4ALMA 5I9TA 4L95C 1DG9A 4OXXA 1ONPA 3LBHA 3EGCA 3O0DA 4EPYA 5G2OA 4Y30A 1BQ4A 4WZAB 3D6JA 1UXGA 2CXXA 4FFSA 4D92A 2F67A 2XCQA 4LKRA 4GC9A 1LQ2A 4LY6A 4V0QA 3FWPA 4L2IB 3K9WA 2PT9A 2QTNA 3A4MA 3NTVA 5T4HA 4F4JA 3UXYA 5H8WA 2BH9A 1PNRA 4IIJA 5IJWA 3A6PC 1Q7TA 2KLHA 1QCCA 3QKIA 4R1NA 1E2MA 3F6SA 4CIAA 5DTJA 2WYIA 1Z4QA 2JJ2A 4I66A 2OY0A 3OZRA 1UM9A 4QYXA 3TDKA 3VKHA 1FMTA 4L3VA 4NU6A 4JVNA 4JT9A 3PCXA 4KXWA 3U4HA 3V2IA 4D4IA 1YB2A 5KTKA 1JFTA 3PE6A 5BWBA 1JIIA 3IAHA 2YL2A 1BCRB 4U2BA 3VR6D 4B8WA 1Q0SA 2OM2A 3EXHA 5CEFA 1T9AA 1KKLA 2IIBA 2LNDA 3EVEA 3DZJA 1CQJB 1RC0A 4Y1FA 1TC2A 1KXJA 4UEJA 4E5DA 5HXAA 1JHDA 2RGRA 4R05A 1SCNE 2XDYA 1C8LA 4K3VA 5FOXA 3PQ6A 2VDNB 3DKIA 4FCVA 3VHRA 2ZYAA 4KR3A 2P3LA 1QHYA 3FJ1A 3O2JA 3KQHA 2F7SA 3UJHA 1X74A 2QDKA 2ZRFA 1TF7A 5BORA 2HU5A 4YJHB 1OFVA 2GZHA 3L6DA 5K0EA 2ID9A 2DTEA 2QRUA 4UNIA 4QFMA 3U56A 3P20A 2IU0A 1Z8DA 3QLVA 3U4DA 4DV0B 4P0QB 3ETEA 3QBEA 2G8NA 2PGNA 3KIPA 1G5PA 4UMVA 1S2GA 1I10A 4RHXA 3KELA 5T8KA 1ATZA 1KH3A 1PLJA 2FR0A 3AXSA 3LBNA 3TYXA 4BO7A 1MX5A 3E23A 1QNFA 2O52A 2DHCA 4G8BA 4J4BA 2WKPA 2DPLA 1GXSA 3IODA 4E2WA 1W46A 6YASA 2IHTA 5TGZA 2P75A 3A1EA 4URUR 4ZREA 3U48A 3WIEA 4B3MB 2LPMA 4M36A 2QQGA 2CMKA 2W22A 2MSKA 1O5IA 2RFLA 2BMJA 3CM0A 9LDTA 4D25A 1K4YA 3KLPX 1H2ZA 3I3OA 5F21A 3LLUA 2BLNA 2DF8A 1Z0UA 5JH7B 1W48A 1I4LD 3RF6A 3NX4A 1PJLA 2J32A 1LPSA 1A8PA 4HWKA 3V48A 4EPWA 1JHRA 4NV3A 1EWRA 1EXMA 1PUJA 3BKXA 3R8XA 1C0LA 4AKIA 1V9CA 1P39A 2BGKA 3P9XA 4J03A 3ITEA 4MQEA 3W5BA 5I6DA 4PEVA 1J8VA 4C87A 2IXGA 4YQYA 2Y6UA 3E7WA 1E4OA 3L8GA 4MRRA 5KQRA 1Q1NA 4G9EA 4XYBA 2P11A 5CNKA 5LWQA 3GVIA 3GJ0A 1VL8A 4RYLA 4YP7A 4HH4A 1N8SA 4GX2A 1DX9A 3U80A 4D96A 1YFZA 3A4VA 4D4HA 3O1IC 1D2CA 1D6MA 2B1RA 2G40A 3C3KA 4F97A 2C03A 2IDMA 4BO4A 1M6WA 1REQB 3EK2A 3L8FA 3TDNA 2PX4A 2RK6A 3I01A 4OKNA 3L8EA 3UCXA 4B40A 1G6OA 4GLOA 3K70C 2IPOA 3EH1A 1C1DA 4GMDA 3WISA 2X6TA 4DJTA 5B3AA 2COUA 4DFDA 1KEEB 4NZPA 2UZIR 4C29A 1P91A 1DO2A 1SKQA 4LYGA 5DNVA 3LQ1A 4KPGA 5EWLA 2YYSA 1LH0A 4TLBA 1MPXA 3ZNNA 4BLWA 5KC8A 1ZUNA 5AVUA 1LDMA 2NXWA 1CQZA 4MJXA 3HZHA 2IEIA 1S9DA 2V7GA 3ABIA 3ICUA 5CIWA 3GA0A 4XR9A 1FYFA 5T4FA 4X5OA 5FI5A 4BBZA 3WBFA 1LNSA 4AXBA 4X97A 4YUVA 5JOQA 3MWKA 1DEOA 5J40A 4C7MA 4Q39A 1W93A 1E3LA 4GR4A 3SQLA 3WK6A 3ZZTA 2FFRA 4XJTA 3V46A 5DB4A 4D7AA 3BTVA 1FNDA 1C4OA 1AQLA 1GPUA 4MS3B 4KQ1A 4HDKB 3KUXA 2WTXA 3DMYA 2H7YA 4V02A 1U3VA 3AJAA 4QPNA 2Z95A 1W73A 4CKCB 5JI3E 4Z7OB 5IZCC 3OEED 3SM9A 3OSZA 4DGQA 1U0BB 4E7OA 4H9GA 4QG7A 4QQRA 3MN1A 4R40A 1BFDA 3A9SA 3BXEA 3QEOA 1Q0LA 1UMCA 3GT3A 3RB8A 4RA6A 1MABA 3FCSB 2HRCA 3AEKA 1WMAA 1Y6FA 2CHFA 2NXCA 5LWHA 1I7SB 1NTRA 3QY9A 4WTOA 2APJA 4QDJA 1ECJA 4C7XA 2C2BA 3OJXA 3NWPA 5GJBA 1ZMRA 5CA1B 1SAYA 2HMUA 2YJNA 2Y99A 4Q9HA 3L5OA 4YMIA 1M1YE 4G1MB 4L7QA 3VR5D 3FKSD 4K05A 2O3JA 3UW3A 2NNWB 4XRGA 1WSDA 2OFWA 4DPKA 1U0TA 2QJTA 3BMCA 5LUAA 1U3UA 3NJ4A 1FFSA 2FPIB 5EIWA 1U8EA 2EW1A 3Q8XB 5F51A 3QIVA 4EDFA 4CV0A 2NADA 3C5WP 4JJ8A 2Q41A 1EZZA 4BN5A 3KTOA 1KP3A 4BGDA 1APBA 1J42A 2Q6KA 3A1DA 2VF8A 1XN1A 1UWKA 1PUXA 2XQJA 4X6XA 4Z8YA 2WKWA 2OORC 1JLHA 4IW3B 1I2MA 3EODA 3O7MA 3TMYA 1U1CA 1HX7A 4G4JA 5D01A 4JC5A 5DT2A 4BNTA 1C8BA 3WYAA 1PIWA 1L7XA 1CE8B 4NBKA 1Q14A 4X6YA 4P7JA 1Z0ZA 5CRIA 4KQXA 3MJDA 5JMPA 3VI4B 3EVBA 5EZQA 1CFJA 5ADWA 3ZWAA 1NNSA 4WK2B 1QYDA 2Y68A 3ZHVA 1N2SA 1DCTA 2AEEA 3HKCA 1T4BA 1NWCA 5TEWA 1NY6A 3JAKA 3MTEA 3SHWA 5AVYA 3L0DA 3QU5A 2YN4A 3TW8B 4A36A 4CLHA 2QWXA 3LWNA 4N3BA 5HZKA 4BLTA 1ENPA 2J0QA 4M38A 1C4XA 1ZIXA 3CXUA 3HE3A 3VKUA 3S4YA 2QTRA 3JQ8A 4EUKA 4OL9A 5JXWA 1HLGA 3VJLA 2WPDA 3W8FA 2OAEA 1PL8A 2OL4A 2RI6A 4P5EA 4PICA 3N2KA 3PFNA 3O4JA 2BFBB 3BAZA 1E2KA 2Q28A 4E2FA 3LUCA 1ONBA 3E3NA 2R6DA 4CM5A 4EG8A 3RAGA 2ZYTX 3OFNA 2ECKA 2XMPA 2IZZA 3D4LA 3WWZA 3RSCA 4NIMA 1HTBA 4HNHA 4NJOA 2QK4A 3H4TA 1EUDA 4NBSA 4OP2A 3FDXA 4IDQA 2CLDX 4BCCA 1E0KA 3WSWA 1DZ3A 5JUWA 1ZD9A 1NJ6A 1S2DA 4LHEA 2X8JA 2GNAA 4ITUA 3F73A 1RW4A 1GEEA 1U1EA 1XQWA 1XEXA 3VPHA 5AW2A 5JMTA 2DULA 2HCFA 4QYTA 1BWQA 3VVLA 3W3ZB 1QIHA 2O1EA 3NHAA 5IC6A 5I51A 1O95C 2JL1A 3VM6A 3QOXA 4O1IA 4PG5A 2GB4A 2A0WA 4LOAA 5ER6A 2X5OA 4LE1A 1GG9A 1QONA 1FYDA 3QPVA 1BXRB 3T9EA 1L8LA 4W8HA 3TLXA 1F7VA 1H1TA 1DGQA 4RESA 4HADA 3WO0A 3W34A 3LCUA 2WF5A 3PNSA 2QGNA 5CX1A 1VHJA 1ZAKA 4LDRA 4X1YA 1O2DA 3PC6A 4UBOA 1QH0A 3FMGA 2ZTMA 3DBOB 4BX3A 1DC7A 3ZVKA 5L3QB 1COWD 3KJIA 1QR6A 3TAXA 1I7PA 4KPYA 2CWWA 5CB4A 3H2YA 1ID8A 3FSGA 5BN3B 2FW6A 3R3JA 4W1QA 5IDVA 2O2YA 2BFEA 2XE6A 3X1KA 2UZ4A 2R4UA 5DCLA 2VI5A 3R0QA 4QJ3A 1YTUA 3B9BA 3QHQA 1MPTA 3PUWA 1DIGA 4YR7A 1L7BA 4S35A 1B23P 5EZYF 1X3LA 3AP1A 1KEPA 1YHZA 4BRWA 1JSLA 5INTA 3CLRD 1GFWA 2GYUA 3VSBA 3B2NA 1PSDA 1NG1A 4A0FA 1Y34E 3IXQA 2AX4A 2J59A 5F5NA 2FSIA 3WK9A 1HDOA 2XF2A 2FCRA 3ZOZA 1GLGA 1LKZA 5IUJC 3I9NA 2IYWA 1G63A 4HR7A 5K3FB 2R2AA 4HAWA 3DZBA 4EHHA 2ADMA 4TRRA 3GGDA 1WP4A 3DGEC 5LP1A 2GJAA 1ZYUA 2ZG6A 5ITZB 3KQSA 1DI0A 1SB9A 4UE6A 5I9SA 3DBRB 1XRPA 2MR5A 4Z0PA 4A6EA 4EWLA 4GMGA 5TQ2A 1KY2A 3G2JA 3EIXA 2CCGA 4I9HA 2EARA 1ZCJA 1J8MF 2B0CA 1QC5A 2VP4A 1P80A 1EVLA 2H48A 1DCMA 1LPPA 3R77A 4RF5A 1TKCA 5JI2E 5DEIA 1M2JA 1KI2A 5FNVF 3A6HA 2XHEA 1JKMA 2WFAA 3TBKA 4RFLA 4LOIA 3U9TA 4MYSA 1PR1A 5DXAA 1UXJA 1WLYA 1Z25A 2H59A 1EVYA 3LRTA 1XDSA 3Q7EA 3QTTA 2A33A 2YJGA 4FEEA 3WFJA 5EJMA 1HFKA 1GQSA 1HETA 5TQ0B 2C5BA 4IVPA 1MVNA 1JU4A 2NVOA 4J8PA 3NORA 1NQOA 4M1WA 3UMFA 4A5OA 1FW6A 4I1VA 1P31A 5F9MA 1IU9A 1P4SA 1YVDA 2I4RA 3FVTA 4DCVA 1GUDA 1I51A 1J33A 4PM4A 3F8SA 1C4KA 1U6KA 1R0ZA 1SBHA 1VFNA 1Z8FA 2ZSFA 3EPRA 3QMVA 3VZPA 2H1OA 5ESRA 1YRAA 4KRFA 5FWDA 4ZQBA 2VBFA 2H4WA 3UM9A 4WIAA 1SPXA 4B0PA 5HP4A 1WM1A 2JLBA 4B09A 3KVRA 1Z5WA 2PCNA 4IINA 5LUBA 4LYAA 3QVWA 5LNK6 5L6LB 1SEPA 2H51A 4Y6PA 2RKBA 1TUEA 3FNIA 4Q4AA 5IN5A 3A6FA 3OWOA 2VYVD 5CH5A 4PE5B 1M8FA 5B6IA 2LWIA 4OMFG 3AM1A 1VCIA 2X6QA 2Q9AA 1TMYA 1YR8A 1X70A 4QELA 1R74A 1SN7A 2NO7A 1YB1A 4E33A 1XEAA 3K9NA 3MWDB 3P0RA 5ELLA 2PXAA 5JRDS 4FQ7A 3WSTA 3PJRA 3B9QA 2FSSA 3R23A 2WU1A 1M7HA 1RSZA 3ISJA 4QLBA 3OKFA 3N75A 3SNHA 1PHRA 2GFHA 1UBMS 1E4YA 4U0KA 1RKVA 5IKXA 2IS1A 2C4NA 4KH0A 2QLLA 3OWXA 2GAJA 3GNLA 1SK9A 3K9CA 2CN1A 3SDZA 3LWDA 1JJAA 3F9IA 3X1YA 4U2EA 4B80A 1JYEA 1C3OA 2BZGA 2VTKA 3K8YA 1IG0A 3TTYA 1RQPA 3E2PA 4HP8A 5EFOA 1E9EA 1XZLA 3CTPA 2WAAA 4CHTA 4IIHA 1QBKC 1XA0A 3JWPA 1MMFB 2GJ4A 3ZE8A 5K0ZA 4UNNA 1G64A 1SQSA 1VDZA 4WY2A 3FG9A 3VH4A 2WP0A 2XMSA 1BDMA 3K32A 3KC2A 4CKWB 1DAKA 1A04A 4P4UA 3WNVA 1J0CA 1WP9A 4Z2YA 5BPFA 5L3VA 4I8DA 1XU7A 1FQWA 4KDFA 5BW8A 4KP7A 4DSZA 5KOHA 4G0PA 4MR7A 2W37A 3TZLA 4C43A 3Q9NA 4F4UA 5JASA 5HMLA 2D1FA 2ZSIA 1QAMA 5AHKA 2UU9B 4OSEA 3BWCA 2JFVA 4Z9XA 2EBFX 2XV1A 5JCZA 3OQMA 3RV4A 3IEKA 2Z2KA 3R6TA 4WY8A 1Z16A 1XL0A 3P0EA 5EHXA 4BNIA 2XR1A 3RC8A 3LZCA 5A3JA 4WW0A 3TSZA 5MF6A 3RT7A 4BIIA 1FTGA 2YIJA 1WJGA 3BXGA 2OUIA 3VOAA 3ZGYA 1WL8A 2CZQA 1IOWA 2DT5A 2UDPA 4IGKA 4B46A 10MHA 4AZ0A 2IYVA 2ATEA 3NNDA 1RE1A 4FD3A 3JAWA 3BFPA 3S28A 3PF9A 1H2HA 2GN8A 5HQJA 4ARUA 5EIAA 4C9RA 1QORA 1Q15A 4RF4A 2J3EA 1O57A 4OGGA 2Q27A 4TL7A 2EK8A 5AVKA 1WPXA 2HDNB 2HLDA 1X7XB 1E2QA 1WPQA 4TXLA 2J5RA 3CKMA 3GK3A 4AURA 4EW1A 1KQOA 1JBQA 1X1RA 4KO3S 3ZCQA 5JPIA 1QIIA 2JBJA 5CHEA 3Q9SA 4F1WA 3KAPA 4OHMA 3DJYA 1Z5ZA 3A9VA 1BYIA 2XUKA 3G49A 3AP3A 3PE3A 3NYRA 5BT9A 3VR3D 3GLFB 5CGQB 1TCBA 3DT9A 2X2PA 3LFHA 1K08A 2XYHA 4IVNA 3QUQA 2D5IA 5BYKA 3AFOA 4KSBA 3NETA 4WFJA 2I8CA 2PFSA 2YS6A 2ZYGA 4QFDA 3NBYC 2OB1A 4ZQEA 5LLSA 4MVJI 4TKMA 2ZRDA 1FDOA 1U3TA 4G36A 1CQPA 1N6HA 1B2RA 3BJIC 2UYHA 2VWQA 4DDKA 3R3WA 3UMJA 2QLBA 2FSGA 4X44A 4EJ2A 2ECFA 3VX4A 2CFIA 3NP7A 4TLLB 4NLLA 3TKLA 1FXWA 2VDPB 1CC1S 2W2XA 3C4QA 4B3TB 2P4QA 1YR9A 4HAXA 4KGZA 2OHHA 2BMDA 4JC0A 5C35A 2EAUA 2KSQA 1C1HA 1E62A 2D5BA 3IDSA 5CLJA 3ZHTA 4NI5A 1SKUA 1TGVA 4DABA 4Z1MD 1CUVA 3R3YA 1RDFA 2YUIA 1ZVJA 4ZOEA 3H0KA 1P8JA 3V9PA 3KB1A 3CH7A 1XCPA 1WXEA 4CLDA 2VFAA 4BNJA 5EWJA 4EJFA 4JNCA 4QHSA 1SG6A 1JMKC 1RAGA 2D13A 3NXSA 4O2AB 5TJHA 3FNHA 1QHXA 3KHUA 1K3FA 2D2IA 3D8SA 4HZGA 3VTAA 1CZKA 5G02A 4QSHA 1T3SA 3QF7A 2IYLD 1AHHA 2PSHA 2BCGY 4WQMA 5FWYA 1AS2A 2Q45A 5TB5A 2XUGA 2BFOA 5EZYA 2GAOA 2E4UA 2ZIVB 4KXLA 4LXTA 4MS1A 4O4JA 1NQVA 1JDTA 2CHGA 2X58A 4ESVA 2R85A 2PRSA 2JHPA 3H1BA 1ZO8A 2DUJA 2VZ0A 3H9CA 1JR6A 1DIOB 1I24A 1O6ZA 2F3TA 3USCS 1N6KA 1NVVR 1ONSA 1BN6A 2BTOA 2HMVA 5ECWA 3W9SA 5KYYA 4OI1A 5IJXA 1Q7BA 3H65A 8AT1A 1Z5PA 4O4HB 1ENYA 3WJ1A 3I5YA 2D7DA 2JHAA 2VTEA 4JI6B 2PCJA 3L0YA 2OORA 4RQBA 1ULTA 4FYJA 5AOVA 1W1WA 3L1KA 1RADA 1UEIA 1VKHA 4HDMA 1UFOA 1TVKA 3U2QA 3S40A 1JAZA 3ZW9A 5AW8A 5CJPA 5FIUA 3TZEA 2XCLA 4C3OB 1UMDA 1UOOA 1QNLA 2ZXFA 5LDHA 1S4MA 3BORA 4IS3A 3LTNC 1QLWA 4G1BA 4OHKA 4R9VA 1XKQA 3TE7A 4N65A 1CF4A 1M6VA 2J9XB 3W4IA 4FFRA 5FNVA 2B8TA 4Q7QA 2NPOA 1FTWA 3DDNA 3O73A 3OPNA 3BWDD 1KSGA 2MYNA 2CV2A 4B4OA 2J87A 3RS5A 3MCWA 3FROA 1U81A 1JQDA 3DZ8A 5A71A 1RXIA 2E5LB 1LDBA 3DFMA 2DQKA 4LA4A 4BBJA 4IDDA 3AF6A 5DH9A 1WY5A 1DV1A 2E3JA 1T8RA 3RVBA 1T25A 2NO9A 1XAGA 4Q15A 4A27A 4WLUA 1TYDE 3FPEA 1YD7A 1KYVA 3R5FA 1QOZA 1L5ZA 5BSUA 3FPBA 3FF1A 1GGOA 3WQQA 4RPHA 2QIOA 3A9TA 1SG0A 1KVQA 3COYA 4OIMA 3W6UA 3T5MA 4AS3A 1L4UA 2BGGA 1Y81A 4HMOA 1GAQA 1QTIA 1ULSA 2EX0A 4RKYA 3D64A 1DPGA 1GRCA 4G86A 1PT9A 4RTNA 4RA9B 3GLTA 3OJEA 3QVSA 1PZEA 4MA4A 1P29A 4UHJA 2NGRA 2Q6LA 2QRVB 3H6HA 5AK6A 3OJOA 1F0PA 4BLRA 4IV0A 2Q5LA 1OU0A 2PGJA 4ZOBA 4D74A 4K6HA 2GPBA 2GK4A 1SUCA 4ZN6A 1TT5A 3BCUA 3CUKA 1J49A 4RWEA 1C7ZA 4OD0A 4H0NA 3P45A 2VNIA 3K1AB 1E18A 5L3SA 3IKJA 4NJEB 1PUIA 4MKXA 4WMLA 1XD8A 4E5KA 3LUHA 4A8JB 3OTWA 1VL5A 3KKEA 5BO5A 1SXPA 3DVQX 1P62B 4NPAA 1KVSA 4I4LA 3L1IA 1JW9B 4MDHA 3RIEA 4BP1A 4QU8A 3FHOA 1R4NB 5ILOA 2O2DA 3NFRA 4R7GA 1BVUA 1F1BA 1I3LA 1AUQA 1M3SA 1HOXA 1NXXA 4UREA 3WGMA 4YT2A 1NE2A 1VBMA 3QFRA 4JOQA 4MUBA 5HILA 3TZKA 3ZD8A 3GBSA 4R3WA 5EYPB 4TOIA 1PDOA 2H63A 3GG2A 3UICA 4IYRA 2D1SA 4DV2B 2NTJA 3HVRA 4DZTA 5K8UA 3DUFB 4ZQGA 2OCYC 2JF0A 4JQCA 2ZPTX 4GOKA 1T5BA 1X92A 3AZOA 1AQJA 1ZD5A 2EQBA 4PQFA 2YX1A 4P5DA 3V00A 4DUGA 4TMXA 3S55A 3IIJA 1RYZA 3PEWA 1FVFA 1I94B 1GZ4A 1RYEA 2VEOA 3E8XA 4TZTA 3C1OA 1BVRA 4YJKA 1N33B 1CRLA 1FIUA 121PA 2GEBA 4D9FA 1NM5A 4TVKA 1VQ1A 4EHKA 5CYGA 2Z04A 4EMBA 1GG2A 3QK7A 5CD9A 4AT1A 2NACA 3UPTA 2HSZA 5DBOA 3AKDA 1I6KA 3GCGA 3G9ZA 3HKDB 4D97A 2O2JA 1RYHA 5B7PA 2C20A 3OCWA 2A94A 3KBBA 3PDHA 3BAFA 1QP4A 3IKVA 4LHYA 4F93B 1IOLA 2PTGA 1NJ1A 3A3NA 4ZKEA 2DWCA 4ND8A 2EIXA 5BURA 2WIJA 5BMOA 5JVDF 4I08A 3VR4D 4LJ6A 4FFNA 5DYYA 4RTLA 4FOOA 1DIKA 1IN8A 4P54A 4GLJA 3IAFA 2X3UA 4HYEA 3CG0A 4P22A 3EW7A 1GCOA 4YRCA 3ESAA 4ROTA 4WZAA 3VH3A 3AUXA 3HZZA 4BB6A 2C4MA 2BY4A 4ZQHA 2ISCA 1NBHA 1YVEI 4HATA 3AVPA 3DCIA 4L2IA 3L1UA 3ZTYA 4ZI7B 5K6AA 5DHFA 1JVSA 2GCOB 1ZS9A 5GQSA 1M0TA 4CG0A 2PJRA 3L3BA 3BCSA 2J3LA 2YXDA 4G5YA 5EQFA 9GPBA 2XYQA 4I5FA 1TB4A 1XZFA 4PZCA 4BKRA 2P0EA 1FRQA 2C7BA 4CIXA 1YMUA 4DBZA 3FPHA 1YK1A 1EFLA 1LU9A 2ZJ2A 3FUWA 4TL6A 4JLOA 1EFHA 2VZ8A 2EDCA 4EGFA 1OE0A 1WXDA 2IVFA 4YPFA 1OTYA 1RWKA 2Z2JA 1UM8A 1PL6A 2OFOA 3AZPA 1TQ2A 5DSXA 5I7VA 3NQ41 2FX3A 3W8EA 1BCRA 3F47A 5IKEA 4OBEA 3ASVA 3LPCA 3NKFA 1UINA 2ENWA 4HGRA 3SVZA 3WGHA 3THWB 2DY0A 1J2TA 2WVAA 1TZKA 3FYUB 4M0MA 5CLQA 3TCNA 3WGGA 3OZEA 3FHCB 3WAJA 3BIJA 2VK4A 4P4FA 2V7QD 6Q21A 2W0MA 2PBFA 3QFSA 4IP0A 2TRSB 2BGMA 4XB1A 2PIDA 2HF9A 3B85A 3IA7A 4KE8A 4YJHA 2JGNA 4UUPA 3LY9A 4IHJF 5FOWA 5AXBA 1SHTX 3VC1A 3UTDA 2RHRA 1NAIA 2WU4A 3IP8A 2FQXA 3CLRC 4V0MA 1CY8A 1RXSA 3UT5A 1JI0A 4B6EA 4F5ZA 4X00A 5KO2A 1LD3A 1PK9A 5IEBA 3OZTA 1RRGA 3PXCX 2ZW9A 3N39C 2VHJA 4QJBA 4KVAA 4PO1A 1T2NA 4R0VA 4CCAA 2LDBA 3PRJA 3DLHA 3LUPA 3NIWA 2HNBA 2WJ6A 3LNCA 1KC1A 4BLUA 2OCKA 1CR1A 1SD1A 2C2XA 5H59A 3TLCA 4YAEA 2I9KA 2O7SA 4GSLA 2QJFA 3U0BA 1WR8A 2HA6A 3W05A 3W2EA 3SWWA 1S96A 5JZMA 3HU3A 5DLPA 3FWHA 1WUJS 3WO1A 5BR1A 3AEQB 4MI9A 1IEQA 2XRZA 1ZCZA 2EFCB 3O91A 4JQSA 3UJPA 1KI7A 3M9XA 4DXHA 4FT2A 3IOYA 2O8VA 2UZ3A 2DSNA 3GHYA 3BMQB 3N8DA 1CK4A 1XZCA 4R0NA 1VIAA 4GICA 4OGKA 4X9XA 2BKUA 5JH7A 2JIZD 1GZSA 1B3RA 2DBYA 1Y9EA 3HUEA 4M0FA 1OI4A 1ZAYA 2ZI5A 1NDHA 2Q6TA 5LU9A 3BQ9A 4NGRA 3JVEA 2X0IA 4MTCA 2IXEA 2X0NA 4WXEA 3BUSA 3KEOA 3USES 1KAOA 5FUXA 5EZ6B 2FHPA 1ZIDA 1BEUB 2V74B 2HGSA 1T3LA 2Y1WA 3BGIA 3CB2A 2GBLA 4V2UA 3X2FA 5D5QA 2O1WA 3AQIA 4WOKA 1UBTS 4CODB 3MYRA 2VUUA 2JGMA 4QARA 1HNZB 3ISVA 1GJRA 2OK7A 1FTYA 2GXQA 3KJEA 3PU6A 4UCWA 2ICAA 5ENVA 4JBXA 1REQA 1GIAA 1CD5A 1ISIA 1V7PC 3O4HA 3DHYA 4FZ3A 4HNSA 2RGEA 3OF3A 4HWRA 4NCXA 3LIIA 3I4LA 3VR6A 3WAGA 1O0SA 2HHHB 5JMWA 2AKEA 2BJVA 3RRZA 3C16C 1V71A 2QL7A 2HM7A 2OHFA 4OHBA 2P9TA 3SXUB 1KEEA 4KR2A 4JP3A 4UTNA 4QNNA 2ATXA 4NYJR 5DYNA 3QFHA 4JOBA 1PGQA 1L5GB 2Q7DA 1N2JA 2B4AA 1IONA 4QGFA 1Q11A 2IOYA 3V9AA 4MKFA 9ABPA 4GZ3A 5K0SA 1QVZA 3CONA 2XY4A 4PQRA 4PYKA 3ZU6A 4EHIA 5KEIA 4D3ZA 1YK0A 1SVSA 2Q6OA 1UPBA 1FFDA 3UGQA 2X0FA 4NZNA 4U6QA 3FHJA 5D00A 3ICQB 1XTUA 1ECBA 1YVUA 3T61A 2EKPA 4GSYA 3K0SA 4P84A 4MS3A 4FM9A 5HGJA 2QN7A 4HDKA 1XLTC 1VE3A 4MDEA 1Z28A 1IUOA 3CIOA 1CLUA 4CKCA 2VSOA 1YCDA 2QUJA 5K4HA 2ODAA 3HCNA 4QX6A 3W79A 2F55A 4C5BA 5IH3A 4ACBA 5D7NA 3DV9A 1OPXA 1BEZA 3SSMA 2CMFA 5K7SA 4ZO9A 4N3NA 1BU8A 3UANA 3N28A 4AMYA 1YS4A 3L41A 4DQUA 2PGLA 2ZPUA 2JA1A 2YJZA 3OPQA 3U9LA 3KHSA 4A73A 4FCTA 5I48A 1TMGE 5AJVB 4JBLA 4QDXA 2HDOA 4JOCA 4D41A 1DB3A 2VA9A 5CA1A 4EFMA 4QRIA 1C30B 4YCDA 4MO9A 3HU1A 2AR9A 4BQSA 3CCFA 1QYXA 3QBDA 4URFA 5EE0A 2PTHA 4WDRA 5GPBA 4DMUB 4B1FA 5LQDA 3OE4A 1QV9A 2WLTA 1H8ED 3AUKA 2WMYA 4EA7A 5C51B 5G0SA 1V8PA 4FE4A 3IT0A 2FPIA 3JD2A 3OQBA 2LIVA 3LFTA 3BMNB 2QAGC 4KBFA 5JDCC 2KBEA 1ZIYA 3H99A 4UTZA 2A9KA 1Q0PA 4IO1A 4Q01A 4XKJA 1MZVA 4ZU6X 4TQAA 1N4DA 2M6SA 2XSZA 4HTAA 5CB4B 2CXTA 3U3ZA 3V7WA 2D59A 2EF0A 4XLZA 1G16A 4HAZA 3SLKA 5B55A 3T9CA 2P41A 4B32A 2I55A 5ICGA 1DBPA 4OPMA 1EJBA 3L4BC 4RZXA 3WXBA 1NZFA 3KSZO 1NDUA 3P4YA 1CE8A 1ZGGA 2DKNA 3R3SA 4IZIA 5D2CA 1KDVA 3E8MA 5IVKA 1MRSA 1AQUA 4HRXA 3WGTA 3ZTTA 1OFGA 1KRHA 2EHJA 2ZB3A 4L4SA 2OK8A 3CNEA 4Y8VA 5AJWA 5BSKA 5I8PA 5KTOA 4NCBA 1U0NA 2AI2A 4AKGA 3HRKA 3PSAA 2MR6A 5E7JA 4UC0A 4FZRA 3L40A 5DMXA 4IX1A 1C0PA 2QN2A 2X4GA 2Z4TA 3JQFC 4JY7A 4XD7D 1RRFA 3TW8A 4BHTA 2F8SA 2RARA 4DVGA 1IXKA 1X1TA 1E0SA 2OO7A 1ONNA 4NBWA 3UENA 3QFCA 3AZQA 5CH8A 1Z9BA 1N0VC 1LV8A 4J1QA 3ZJ4A 5FBZA 1SVMA 4LYFA 2DVMA 4FB5A 5HFJA 5GP1A 5BUQA 2A57A 2FJPA 4YJDA 2BFBA 4E03A 3KJQA 5HPYB 4P9NA 3RASA 3W7AA 3DWFA 3EMVA 3V2HA 3F5MA 3VV2A 3ZV5A 1XNHA 2F00A 1CULC 4TJVA 5T7BA 1H2WA 1TU0A 1HA3A 1ZSVA 3GFBA 1G21B 1OXUA 3EXFB 1W581 3KO8A 3FBTA 1IL0A 2CDNA 1XCJA 1E3MA 2GLXA 5FORA 2VXOA 1O94D 3O92A 2O48X 1EGMB 2OWEA 1UT5A 3CLTD 2PVCA 4QU5A 3BCHA 1BSVA 1II0A 3ANSA 4A2QA 2WIGA 4EELA 2MOKA 4BX9A 4FR0A 2XZPA 3U3RA 1T4DA 1IY2A 2CBXA 5HIKA 5K03A 4CU5A 4HX9A 2C6GA 1ORIA 1W1IA 4J9VA 3VZBA 2JBAB 3D7FA 2R8OA 3SBDA 5JPDA 4FWTA 3HKEB 4L9SA 4WNYA 3RRMA 4AJJA 3UW1A 1U0FA 1I13A 2C98A 2I22A 3AR9A 4PVDA 4X60A 2O8FB 4ZV9A 4EECA 1BXRA 1VSUA 2BHSA 3C45A 4LDPA 3K4IA 3GJSA 3LBIA 3W8DA 3BDIA 5FBVB 5KTSA 2PAFA 2ZRHA 2H1CA 3DDCA 3WOVA 4C05A 3P1JA 4QSMA 5AJUA 1EQUA 2CF6A 3DAPA 2QT9A 2ZI6A 1A88A 5MFPA 4JHLA 4R2XA 3EW9A 1V3TA 3H1FA 4NBNA 2JNWA 1NP7A 1PKEA 2H1IA 3LC0A 1G8PA 1PJSA 2ODEA 3T4PA 4BFCA 5BN3A 5TMDA 3IRVA 3K53A 4P86A 1E8MA 1RKBA 3VYWA 4WACA 1Z13A 2ERCA 2XUFA 3MJRA 1NU8A 4JBGA 1L5QA 5JC1A 2R8EA 2K6GA 5CVJA 1WB5A 1AGNA 1M67A 1N92A 2VAWA 4CDKA 3A31A 3OCCA 4XCQA 1Z22A 1T2VA 5CFQA 2YWGA 3V32A 2EGGA 5HE9A 3EHDA 5LSAA 1LI7A 4OBXA 1QVWA 4ZFNA 4LWQA 4R81A 1QS0A 4BNLA 3K71B 3JVIA 3TL6A 2JGAA 3JQPA 4HEA1 2YV2A 2NP7A 2QEQA 1XPRA 1JIQA 1PWEA 4FE3A 4QTUB 5HKBA 5J43A 4V0LA 1UZNA 3C3BA 3LHSA 1ZNQO 3C3AA 3NEJA 4LZOA 5AM3A 2XRFA 1WQ3A 2PUWA 5ITZA 2EZUA 1V1MB 2UYOA 2WG0A 3C8HA 3D8TA 1N8TA 3DBRA 2BR3A 4DG5A 3I9JA 3GAAA 2NW6A 4N40A 1GLVA 2PKQP 3FLEA 4MQMA 2NSHA 4HQ0A 4L16A 1NBOA 4C85A 2WVGA 3CN9A 1U28C 1TYZA 3BEDA 1QSGA 3ONVA 2HK6A 2I2WA 4XM1A 3JRXA 1T91A 1CEEA 1I33A 4DUYB 2O0HA 4IDFA 2OE2A 2MT9A 3GU3A 3JALA 5FV4A 1H6AA 1L8OA 1W76A 5CNMA 4KWTA 1E89A 3FR8A 3PRKE 3FTDA 3DAGA 5TQ0A 4FS8A 3L0ZA 1Z82A 3Q2KA 5TRTA 4ND2A 2IT1A 1XP8A 3DOIA 5IF9A 4L75A 2HJRA 5JJLA 1W0JA 2Q9BA 4CF6A 2K5UA 2XWQA 3HP1A 1E3QA 4PZYA 1EI9A 4RY0A 3FPAA 2F43B 1IK4A 2OCPA 2KX7A 2XBUA 4CKBB 4K9SA 2IUSA 3PXDA 1H5UA 4TRNA 4BC0A 2KE5A 4KXFB 4EHAA 1T2AA 1OYWA 4OK6A 4V0RA 2GPYA 4Q7JB 3VZCA 4Z0NA 3FW1A 4JWTA 2BONA 5ALVA 5AI0A 1L4LA 3PC2A 5FWNA 4K28A 3CEJA 4TWZA 3NPMA 2ZGVA 4W5WA 4JGBA 3ZDBA 1Y82A 4AY6A 2ZRJA 3TI9A 4B2LA 4D99A 3ZHZA 3ZHBA 1COWA 2CVPA 2J67A 4NAUA 3JYQA 1WCV1 2GK3A 4WBSA 1KJZA 3I62A 4Z9YA 4B3BA 7MHTA 3NBXX 3FI9A 4EG6A 4Y2XA 5ALSA 5JSZB 1Y3BE 2KI5A 3FM9A 3G6KA 3NTUA 3IGFA 1E8DA 1JYSA 2NVUB 3HJAA 3MWDA 2WWVD 4F3RA 1BROA 1DO0A 2VF4X 1FMLA 3ICWA 4HXGA 4IG4A 1PJ3A 4YCLA 3DHNA 4DY6A 4UCFA 2IEYA 4W9NA 4F12A 1A9ZA 4JIMA 4ME6A 4MUKA 1AKRA 2PMWB 2EG9A 1DRJA 1MW9X 1XX6A 1BMFD 3DOHA 3CZQA 2XUJA 3KWMA 2NV6A 4KK4A 2WUVA 2B9VA 4WT7A 4DMGA 3OZFA 4QRDA 5TVGA 2PGXA 2ZE6A 3WLSA 3VR5H 4H35A 5E1BA 5G0VA 3H9UA 3VZQA 5HF5A 3RS2A 3B1FA 2IYEA 1XFAA 3RC9A 5IX8A 2YDXA 1JWBB 1WMSA 3VMMA 4LOHA 5LZ9A 2IOHA 2GVZC 3CKYA 4ILEA 4TKVB 3LDAA 1HDRA 3WK8A 4J0FA 3T34A 1UC9A 4M86A 3ZLJA 4KXMA 1COZA 5BXYA 2W6QA 4JSYA 4DDUA 1DXOA 4CKWA 2OT3B 5DHAA 3DYIA 2BRUA 1U31A 1UBOS 4QYIB 4BGUA 4R0MA 1BYUA 5GGYA 5B53A 4WOPA 5EIHA 4AKSA 1FSZA 2WHXA 5B37A 3FOBA 4YREA 4N3CA 1GA4A 3D7GA 2YZKA 2WF9A 1YQDA 5D87A 2AN4A 1JEAA 1QYCA 3BGOS 4UD6A 3UVEA 3ZIAA 4A8PA 2OCIA 1THMA 4C0KA 4KZKA 3O9MA 3JR7A 4GEKA 3OIWA 4ZZ1A 5K2MA 1ZMXA 2ZBVA 4BO2A 4C1NA 4CR6A 3AOGA 4RL4A 4DHEA 2HV8A 2I6UA 4BQFA 3OECA 3P5BA 4AKTA 4F2PA 1VL0A 3N6XA 4HPXB 1PDWA 1HTTA 2YV5A 1UXKA 3LXMA 4KUHA 4QOFA 5MDHA 5I9MA 5A03A 1C3LA 1T3HA 2G25A 4JR1A 3U61B 3UFBA 1H2XA 2XQIA 1N77A 1XVAA 3A9CA 3NBFA 3UC5A 1ZR4A 1G5TA 1IPFA 3OUTA 1Y7IA 4ICIA 4QGBA 1DUIA 1TK3A 2JFUA 5K09A 3K0KA 3EHEA 4MQ6A 2QG6A 1N5OX 4DLVA 5MFZA 1X7XA 1ISRA 5IWAB 4ZI7F 1POXA 2WSBA 4JJZA 3KOWA 4G3XA 1UXOA 1WSBA 3SE0A 3BEOA 3VNVA 1IQRA 4K03A 4A0HA 4Y2UA 2ZFUA 5A9TA 2WSMA 3RUDA 3HN2A 3GLFA 4MNTA 1Y37A 2XXJA 5KTRA 1RQLA 3F0TA 5DK6A 1C3VA 3BHMA 1WPGA 2FPRA 1J24A 1DNPA 2X1HA 5FLXA 3W90A 9MHTA 4Q3DA 4XGNA 2ZUSA 4MAFA 4TKLA 3G2LA 5FNZA 3ZJTA 3ENWA 3SIPA 2VP9A 2DLDA 4GLLA 4D9IA 1P5RA 1QDEA 1W0CA 3QPWA 5E38A 5BXQC 3FNEA 2PEYA 1MAHA 3E05A 3NAQA 2Y1FA 1SC9A 1FFGA 4FXPA 3SEZA 1OXMA 1YA4A 2HPZA 3JU3A 5EUCA 4ASUA 2G76A 2VPIA 4C08A 1N5KA 5K20A 3ZHOA 1YBVA 4KMOA 3ZXSA 3D9QX 3DG9A 2LDXA 3E1KA 4EA9A 2DQSA 4O3MA 3AONB 1A2QA 3LE8A 3IEUA 2FOIA 5F1PA 2EKLA 1OHHD 5I7UA 1ZH4A 1TO6A 1YJAA 2Q1XA 4LRTB 1JZSA 4LTDA 2VCYA 4YYZA 6ABPA 1PNOA 2BZ0A 4LQCA 1PX0A 1U2RA 2W83A 3I1YA 5EJEA 2E1PA 1CNFA 1ISJA 2Q1YA 1RXEA 4RMGA 3LUKA 1MAVA 3L4SO 3PQDA 1S9HA 5FCDA 3GDFA 4H59A 4ER7A 1AXEA 2QLJA 2VDMB 4O2AA 9ATCA 3U4QB 4N7BA 4YRMA 1UK8A 3GZ4A 1WKCA 1PJRA 2YMLA 2DPMA 3HUUA 3MTQA 3SJUA 3CEHA 1DC4A 1WMEA 1WX1A 2RI1A 4LK3A 3Q8LA 1KYQA 1CDOA 1T10A 4DQDA 2XNKA 3HBNA 1E1LA 1OBFO 3C1AA 2NAPA 3E7XA 4PZPA 2BF7A 3JQ9A 1YAHA 1XNJA 3LCVB 3KTAB 2DUNA 3IEIA 3F74A 3WHPA 4GP9A 4HGQA 2ZRNA 2VPPA 3CIFA 3FX2A 2XZDA 4ZYXA 4Z7JA 1U7UA 4YXWD 1QZTA 3B60A 4LV5B 2A0KA 1MZPA 2AEJA 4TWEA 4YV7A 3ETJA 3LGXA 1NVFA 4HB2A 4O4HA 3Q8MA 1Y63A 2EFEB 4K3UA 1J8QA 2CXSA 1QPGA 4INPA 4MCIA 2AOUB 5HJ2A 5T67A 2QRPA 4PSCA 1FSSA 1NI4B 3H8JA 4B7CA 1U2ZA 4MUJA 1LTQA 2P2SA 2P9JA 2CL0X 5AYVA 2UAGA 1V35A 1XF1A 2DTDA 2LD4A 2GBCA 3K9HA 5EG5A 2MINB 3KEQA 3KK0A 2HROA 2VJCA 3LPAA 3IAS1 1J20A 3LHDA 2O59A 2C2ZA 3KZOA 4JS0A 4LDAA 3H1AA 2CVOA 3L7BA 4LXQA 5KSPA 3JQFA 4OKSA 4TQ9A 3QVGB 3AJEA 4ZYWA 4TQUS 4EG4A 4C5AA 4MKGA 1Z6QA 4MZXA 2HQBA 5BWLA 2P6UA 4KPEC 2HWYA 4HO1X 4X3PA 1SOUA 5IT5A 4NGQA 1A8IA 4EK9A 4BAGA 2NO0A 3QJ5A 3TM4A 4DA9A 4AMUA 1ODFA 2KM1A 1AHNA 1EB9A 1X14A 3U16A 3DLPX 1GUYA 1QGUB 4Z4IA 4M76B 1E2GA 5FTNA 4A15A 3WYBA 4PPQA 3OQ6A 1SC4A 3VBCA 1DHTA 1MJ5A 1M2FA 1JEEA 3EIHA 4LBZA 4O2BF 2D2FA 5I5GA 5CVTA 2OOSA 3Q7SA 1N5DA 4LBWA 1XT6A 3RYHB 1U90A 2JD0A 3TRIA 4HH0A 4HSGA 3TW0A 5LKRA 2ROQA 1VMDA 1USGA 3AY6A 1QBGA 2Z83A 1FPMA 1GTG1 1QGAA 3OD1A 4RA9A 1WMFA 3LRXA 2QRVA 4GBJA 3ZZ1A 1LBHA 3UCEA 3VDQA 5DIZA 5CNJA 1RD4A 4OA5A 3DAHA 3KKZA 3EZGA 5DP1A 3C2QA 4GS5A 4YMHA 2FPPB 1Y48E 3HR7A 4D3FA 4MCHA 2AR7A 1NUHA 5JSHA 3ESBA 3BZUA 3K1AA 2XI4A 1MJNA 4NJEA 3ZY5A 3CSUA 4CG2A 4WZBB 4XD2A 4E4YA 5IEJA 3HBMA 4A8JA 1AZLA 1ZM3A 3ZWWA 4LC0A 2IV3A 4YXWA 5KYWB 1U1DA 1VB5A 3T0GA 4FONA 4EMSA 1KKMA 1BE0A 3UAYA 1R4NA 1R3UA 3GQVA 3N2EA 4IQFA 5F4ZA 4NFHA 4ZYZA 4LJLA 5H3HA 1Z2OX 1A5AB 2E5WA 4L8LA 4JQYA 3RARA 4MMYB 5J3JA 3DNMA 3HXMA 2W7TA 1VRCA 2QF7A 5EYPA 3OG9A 4WVLA 3HJUA 4JJ7A 5HFAA 3V1NA 3ZZNA 3CA8A 1C14A 4DHWA 4EL5A 3GVHA 2Q2NA 3A3OA 2WWIA 4FJ2A 4UE3S 2RIPA 5K3BA 2PT5A 3DUFA 3BRCA 5ALEA 2R6ZA 5JR3A 3UGJA 2QVZX 4F06A 3UY4A 1P0FA 1UJ6A 2HD4A 1HTWA 2GPWA 1Q22A 2QMYA 1I14A 1LV7A 4XYMA 3DVRX 3KT0A 2LCIA 2ZLBA 3D8BA 4RHUA 2VH2A 3RVJA 3BIFA 1FLDA 4UD2A 1JKXA 3G5UA 5GZ3A 2HJ9A 5HQ3B 2VP5A 3A0RB 3D2BA 3KPJA 1HH4A 2OGZA 2XVYA 3U3JA 2BSQA 1J0AA 1G4AE 1NYQA 4MUIA 1F38A 2UYCA 4YWJA 5J1TB 4F0JA 1RABA 1Q16A 5EJ6A 4YMWA 1GFSA 1Z3IX 2FZVA 2HXGA 3HKDA 1RI5A 1PWXA 4H7FA 5D8DA 3RG2A 2X14A 1LZLA 4NRDA 3GWGA 5ERYA 3H87A 3OEWA 1CRPA 2H3EA 4TTVA 2HA4A 1ZOOA 4LX0A 4J0IA 5ALOA 3FTEA 2HTFA 1A77A 2P9YA 4JB8A 1P3JA 3CINA 4JGGA 4JUAA 1AO0A 2E49A 4R8MA 4FB4A 4O1MA 5HIJA 721PA 5HK9A 3JWHA 2D0PB 1MB9A 2RBKA 4N5LA 3VOTA 1HLDA 3M1YA 3H1TA 1V39A 3MLBA 4RZ3A 1ZQ1A 2PRYA 3PZRA 2QX4A 3VR0A 5K0BA 2XQGA 3LDGA 1K4MA 4JX9A 5EGSA 2P4HX 2VZLA 1O94C 3E9DA 4PSAA 3CLTC 5G4LA 5BSTA 1U65A 3QX3A 4ZI7A 2ZYHA 7ADHA 3G0DA 4XUGB 2GCOA 3A1UA 2AC4A 4LY9A 2ZK7A 4EH1A 2DCUA 3VSAA 2HIMA 3WXMA 5A5EA 2FMFA 4XYEA 2FZGA 3FNRA 1K88A 4BO0A 1NJGA 3PNOA 4RPJA 4IDBA 3ZX5A 1RP7A 3REFA 3SICE 1E2IA 3EDQA 1AKNA 3C7KA 5EMKA 5EP3A 1GKKA 1E98A 1Z6AA 2SBTA 3IMCA 1JHVA 2DFKB 3ETDA 3QWBA 4Z9AA 5TPWB 2GM9A 3GBPA 4L5IA 2GF2A 5SYNA 4C0SA 2YJ4A 3I6SA 2ZIWB 1EXWA 2IXFA 2PH5A 1WAMA 2NYUA 3DT8A 4P4JA 4M8IA 1NVDA 2WB4A 2VPZA 5DNCA 4WX2B 3OKCA 4IJKA 3THWA 2C61A 5E95A 2A7XA 1X19A 2ZE8A 3B1XA 1WLSA 3FYUA 3I6QA 4PLZA 4TTPA 4TXJA 2DUUA 5CVCA 3CBQA 3KVVA 4BUJA 3H5NA 4N7RA 3JVVA 2C9ZA 3S1LA 4AMGA 2IS4A 1GAWA 2DT8A 1OBVA 4P3YA 3O1JC 1D0SA 1G291 1RXUA 2FWMX 1WV0A 2Q3BA 2VJYA 2L82A 3LRPA 1PQWA 4MW1A 1O5OA 5A7FA 3ICEA 2Y0CA 4M7PA 2FFHA 4ENTA 1BXZA 1X8LA 3DXXA 4HJXA 3C7AA 3AXTA 3EY9A 3D2LA 2YTZA 3Q3CA 4C7VA 2QRGA 3SJCA 3BA6A 2R60A 3EZNA 2VP2A 3GROA 4M98A 4RL6A 1W35A 2O2EA 3H2KA 1L4NA 4WNCA 2PYDA 1VZ3A 4IIEA 4E7PA 2QZ4A 4MYTA 3ZUGA 4B34A 3FKJA 5JWOA 4CEIB 1JHYA 5JNUA 3LX8A 4X8LA 4CETA 5M3BA 1X13A 4PS1A 4OJTA 4UJ3A 5HIMA 1V8DA 1UIRA 1IM8A 4OREX 2BEUB 1JDNA 3JR3A 2QS9A 4WXRA 1YOVB 3I9MA 2PX8A 1YACA 3PNQA 3T3NA 1JH9A 4PLYA 1W2GA 3ZX4A 3AEQA 2F90A 4JLPA 2D4AA 2ISSD 1X42A 1Z0AA 4M6WB 2NZ8A 1CUSA 1XZEA 4BZXA 5FUQA 1F2TB 1QXSA 1DEAA 4LV8B 1LC0A 4R1SA 4RV9A 2C31A 3BMQA 3JXEA 4UU8A 2AE1A 2C2HA 3N2NA 4ZT5A 3VRHA 5DBEX 4KAFA 4TWJA 3CPSA 2V96A 3GB9A 3GEIA 4N0QA 3UUGA 2PLFA 2QZZA 3W6ZA 1YUMA 1K98A 5JXHA 4OHYA 3O4FA 3LUDA 2HPHA 3K31A 4WKNA 3HFRA 5U4XA 5FHRA 2JLQA 5AI4A 3WGUA 5BPHA 2QXUA 2ODBA 1IY8A 4HFJA 3NRJA 1HT3A 1ZK2A 3TLZA 4KO8A 1A9YA 1L8AA 3MMSA 4OH7A 4KTVE 3GELA 4UXIA 2Z1MA 3FCAA 5PNTA 2AC7A 3HXTA 3ADDA 3NBUA 2RGGA 5EOVA 1NDQA 1ODIA 2OILA 2GAIA 4TN5A 4M49A 4AL4A 4Q9LA 5GM1A 4UUBA 3EAFA 2Q3CA 2A8YA 3VJKA 5KQSA 2C92A 5B7NA 4DWVA 2O23A 5I7AA 5C52B 4UOQA 4YLYA 4YCMA 5K8CA 4HOYA 3HWRA 2XQKA 3I92A 1VBNA 2ZJ8A 3IOMA 4I4TB 4DQLA 2R6JA 1ZI6A 2BKLA 1QE0A 2RGWA 1GCGA 1P7YA 3T3EA 4YI5A 5TX7A 2M1XA 3ER9A 1VSBA 1NL3A 4U9UA 3TXXA 4YRKA 1L1FA 3SXJA 1LDEA 5FADA 2N46A 3S81A 3EOAI 3I6YA 1AXGA 1NPYA 2CUTA 4Y2TA 3Q40A 4JSTA 3RVSA 2ZZKA 3QYJA 3TD9A 2DXIA 1ZK0A 3H17A 1UQRA 4I8IA 5E1MA 4ZANA 3R74A 3T5BA 3AOEC 3R6LA 3UOWA 3U4MA 1LK7A 3UK6A 1YB6A 2PD6A 1HV8A 1UOPA 3P9QA 4YONB 1XV5A 1TFUA 3S8YA 2I3DA 3DJFA 2HK7A 3DMNA 1V45E 1QHEA 1S2IA 3EVCA 4D9MA 5HW0A 2OHJA 4YRDA 1J2RA 4UBIA 5A2GA 1SG9A 3RFTA 1JDEA 3HI4A 1IIRA 3CE6A 4Z6KA 1K92A 2BI4A 1YULA 2O7RA 3E5HA 3QNMA 5C7OO 1F8FA 3K6SB 3C6QA 2FRDC 3SNKA 3ZK9A 1K0FA 1OWNA 4H1UA 2X2OA 2P9CA 5JSUA 2YHSA 3CY6A 4M60A 1T6XA 5AKZA 4IKPA 1EFDN 3JQBA 2FEWB 3LVQE 3PI6A 2HX1A 3DV0B 4KAJA 5EVCA 2N0SA 3TIFA 1WBDA 2UYYA 3LMKA 1GQOA 3P32A 5CLIA 1DT3A 3TQFA 5CD1A 1CIVA 2WQ6A 5WRFA 1NVAA 4HGYA 1TQ8A 2JDIA 3MAAC 3N1UA 5EE1A 5FR1A 3SYTA 2D6FA 5JBQA 2GCEA 1I3MA 1C30A 4TLMB 3UXEA 1G0NA 1PQUA 3BTSA 1V43A 2VQDA 1GL9B 2R25B 4KBGA 4JZ0A 4ENRA 1PCXA 1D9ZA 5K8LA 3RDPA 2WJPA 3KE8A 4LTNA 2WW8A 1QLJA 4NE9A 3DLTA 4I1SA 4WBNB 1P75A 1QQ5A 3UK0A 4AJPA 4F4CA 1YDHA 2BZSA 3BMNA 4FC7A 4XYLA 4ZMBA 1RACA 4I9FA 2VDWB 1R9GA 3G2KA 2IVZA 1E77A 2C3OA 2B34A 2C0QA 4QAJA 3PNPA 4HCJA 2GF0A 1Z47A 4YUYA 3PVSA 1E9RA 1OSNA 1YRQA 2IK8A 4C2TA 2AYZA 4WLFA 2HQRA 3HCCA 2R8PA 4OXKA 3OLWA 4KXYA 3C87A 2NTEA 3C8UA 1PWHA 4NICA 1YZVA 3KWFA 2OV4A 3L8HA 2GGSA 2PH1A 4GPEA 4LN1A 5AKJA 1BIFA 3ROMA 3MJ4A 4MCAA 4UTPA 3VR4H 2XEIA 3DM9B 1NULA 3L84A 4DC1A 1L5HB 1PK8A 3UB3A 2YC4C 4FLFA 2PLRA 1JHPA 4MVJD 2ZIZA 2ZAMA 2VP0A 5F3RA 3R1IA 1DKLA 3K5IA 2WT4A 3HBJA 4IDOA 2JKYA 1JEJA 3L8YA 3AKEA 3I2HA 3NCTA 4RS4A 7AT1A 5FRDA 1LDNA 1R5BA 2D8MA 2IDKA 4R31A 3TZQA 3QUTA 1T8WA 3KUDA 1SU8A 4INAA 2VT2A 2W6ZA 3TO5A 1MA0A 1HE8B 1GL7A 2XW6A 1B6TA 1DAIA 5JISA 3J80A 4RD0A 1SB8A 2WRZA 4KLAA 1T5IA 5JD6A 3NBMA 4F38A 4FYWA 3FCOA 2J0EA 4XZ3A 1VIYA 1G21A 3EXFA 2FPSA 3NDPA 1XIVA 1HDYA 3ZNOA 2RC6A 3U5ZB 1LC3A 2A78A 1Y80A 4KE9A 3AF5A 5DRYA 1R5NA 3OOEA 3AB8A 5HUHA 4M9ZA 4OLBA 4QUDA 4A8HA 5F9FA 1P6UA 3ETLA 4MXDA 5T3UA 2WKRA 2CDBA 4WWHA 1SA0B 4UUMA 4F92B 2PWZA 1U0JA 2JBAA 4BNDB 2IE8A 1WVGA 4P08A 3BXZA 2PXCA 3HKEA 4GRAA 4B4UA 4FX2A 4E1VA 4KHZA 2O8FA 6AT1A 2UVPB 1Q1BA 1ZRSA 2CLHB 2KBFA 4FJ0A 5F7OA 2WA1A 3M9WA 2B4RO 2PLAA 1JQLB 3DMGA 4YP6A 5E1DA 5KC9A 3K8OE 4YB8A 3GDWA 3TIXB 3FJYA 1U7TA 1DJOA 2ZUDA 3C24A 1H8EA 1CNMA 4P92A 3AMVA 1GA1A 2BM8A 4MRMB 3FXAA 1PR2A 3OU6A 4K6KA 1UKVY 4TSFA 1LFAA 2C4HA 5LDGA 3W5HA 4PZDA 4AU1A 1KAEA 3ZI4A 3V97A 1NQ5A 2PMFA 3B6JA 5DOZA 5IS2A 4QJIA 5KVQA 4KI0A 2G17A 2LW7A 1SZCA 3WLAA 2CNKA 1KRWA 3K0BA 1YC2A 1JR3A 4BKUA 2Z8YA 4EKDA 2YVLA 4W5RA 1LPBB 2QUBA 2HSGA 2I67A 1G17A 3E7DA 4JLKA 1CWUA 4IHAA 3VA7A 4OXIA 3KOZA 1CDDA 5H4GA 2BR5A 4RXTA 4LXXA 3QLTA 1VIDA 3ZLVA 1M1NB 3BFXA 2R00C 4GWLA 2I4TA 3OLZA 1JB1A 3QUAA 5KOIA 1A8SA 3N8KA 1ULUA 2C99A 5DDIP 1OA1A 2C2KA 3RKUA 1SWWA 2AA3A 3WI7A 5JZ9A 1WS6A 5JE8A 1ZD4A 3H97A 3PXBA 4LCJA 4EYQA 3PFGA 1K2WA 1XZ8A 3LOQA 5BV0A 4GGPA 2IJGX 1V1MA 2IU4A 4OY3A 1J2UA 1JAIA 3GIWA 4X93A 5FDFA 5M2QA 3CJQA 2EFYA 2AI3A 2FVYA 3GEMA 4QFCA 1PS9A 2WI8A 3S2YA 1CLEA 3IAM1 4CKZA 4G5OA 3ZIUA 1SUBA 4RIFA 2B94A 5UKDA 1Z6ZA 2B69A 4OX9B 1LS6A 2ZVJA 2ZRBA 5KKAA 1D5CA 2B30A 3AQ4A 3ZGVA 3BHXA 3NT5A 1V8OA 1NNEA 5C7IO 3TVYA 1YH3A 1BU5A 3N05A 2PUBA 2BDTA 3B6EA 3MIIA 1TLLA 1LJ8A 5I9BA 4FJ1A 5IXSA 1U8FO 5FBLB 4ZTZB 2CNWD 4NMWA 5CEEA 3AL3A 1L7QA 2OGTA 4RAQA 1XKTA 3D7LA 2FSVC 3V33A 2RK3A 4QEDA 1VCMA 4AP5A 3IIBA 1CY4A 4CQJA 5IVDA 4XSHA 1IHDA 1HQKA 3GEHA 2OP1A 2CLLB 1AHIA 4MLDA 2J7PD 4CLOA 4CKBA 2F43A 3LCRA 4H7KA 4ZO6A 5DN6D 5FTWA 3MGCA 1LXCA 1CV2A 4CGZA 4MKHA 2F1KA 4MAAA 4TYWA 2B6NA 3TFWA 2IZ6A 2VKQA 3HFJA 3QUSA 5E7IA 1OIVA 4G1EB 3R8FA 4G5SA 5E9WA 1JQJC 2C9DA 4YP9A 4CM4B 2YZGA 4DJJA 2IH2A 2PUEA 4EITA 4ER3A 1U1FA 1EFPB 2CJYA 4OQZA 1ZEJA 3CPEA 2G1JA 4OYLA 4UQPA 2ZE5A 4XA8A 5REQB 4AF7A 4PPGA 3ANTA 1M0SA 2CVQA 4H18A 5DLYA 4AF6A 1A2OA 2ZSAA 3RLFA 4U6NA 2TMDA 1K5PA 1ZC3A 1D5WA 2R2GA 4E30A 1K6IA 1XZAA 1KOJA 3ZHUA 4DLYA 5JSZA 5DO9A 2NVUA 2X41A 3O3MB 2JLXA 2FAXA 5DMHA 3JSAA 3PXUA 1VDMA 1YGPA 1H4SA 5ALIA 5KOJB 3CVVA 1OWMA 1ES9A 3CT6A 4DA4A 1RZVA 3W7BA 3ANYB 2J48A 4IXMA 3B36A 3HR4A 4C7BA 1L1EA 4I1OA 5IM5A 3WE7A 1Q77A 4Z9BA 5KNCH 1XJWA 1DE0A 5FUBA 1SJ9A 5JWHA 3ZLUA 3I6MA 3FVVA 5ARBA 1DO8A 3QLJA 4QTZA 1EFRD 3Q6MA 5IDYA 1RBMA 4LBYA 1N8NA 4ZVMA 1GGEA 1TLTA 3ZN2A 2A9FA 3OUZA 4P7GA 4PZAA 1T3TA 4RD2A 1J39A 2GKGA 2P68A 4QUIA 4K9NA 2AX3A 2V7BA 2QVCA 2JZCA 5KAMA 3TRHA 3GH1A 1E1DA 4X65B 4F1KA 2BGIA 3GFRA 1MXHA 2QSYA 2JEYA 1N3BA 3DL0A 4GW3A 3VC3A 2W6MA 4A1FA 4ENQA 4OLAA 4ONEA 4QYIA 1VJGA 1FSGA 3O0TA 2BJWA 4HGPA 3FWYA 3FUCA 2FOXA 2O8CB 2AR0A 4HWOA 2JLAA 1R66A 4U6SA 1GGJA 4KHPB 3FSJX 4AO7A 1L3CA 1LPNA 4NKRA 1XALA 1YFJA 4LC9A 5KPJA 3R0JA 2QLTA 3VKGA 2YXBA 4NCHA 4HVLA 3FTNA 1F06A 3RGWS 5ALLA 1Q95A 1W5TA 2VYCA 4KQHA 1ZONA 1DARA 4HS4A 4X20B 4CL2A 1IFXA 1YUNA 4WK4B 1KFEB 3JZAA 5DULA 1LLQA 3CLVA 4A9AA 1KC7A 2C97A 1L1RA 4HMPA 1YDGA 4LZWA 2J3JA 4LXYA 5ALPA 4J1SA 4S1OA 1JBEA 1FUIA 1BWRA 1LLUA 1M74A 1T43A 2FLKA 3O2NA 4W63A 1H2RS 4WJKB 4RVFA 2Z58A 1RHRA 5F7XA 4M89A 4RCZA 5JO9A 3DEAA 1C7JA 2ZJ5A 2FI1A 1MFPA 1I6MA 2FWBA 1GN8A 2ZUVA 4G1FA 5CDFA 3EBLA 2PSFA 1JIJA 2WKSA 1PLLA 2ZZNA 2V45A 2J5QA 1T8YA 4G4GA 1JR2A 5KQGA 2C9BA 4PZ0A 1NXQA 3A11A 4LHXA 1ZD8A 2WYWA 1GYQA 2E4VA 3JWEA 3RUPA 2C59A 5CPBA 1X0VA 5DCUA 3UPDA 3NWOA 2IY8A 2PGIA 2WJ3A 1XMQB 4RZHA 1VBKA 4WXHA 1N2GA 5C1IA 4BNNA 4F60A 4S05A 3H11B 1HLFA 3RC1A 5EXXA 4V0ME 3RBXA 1XCBA 4KUGA 3AH8A 3KQOA 4FFBB 3PGLA 4GVLA 2D7JA 4L4RA 4ZI5A 2ZS7A 3C5HA 4LYHA 5JSFA 2RCYA 5TDHA 5L4NA 3AL0C 1RC8A 3I2JA 1JAHA 3LY7A 4BNVA 3HDYA 1P9LA 1LJLA 4J90A 3R7FA 3GFFA 3HJTA 4H6XA 3V4FA 2Q0HA 3D3EA 3ENVA 4IOKA 2XWPA 4B73A 1UBSB 1ISPA 5I9LA 5LA6B 3OOJA 3WB2A 4LRSB 3BRQA 2YS7A 4NHEA 5J1SB 3H83A 5GY7A 3ZS8A 3EQ6A 3L6RA 3O3CA 3R4VA 2EJUA 3IUBA 5B1HA 3MBIA 2H9AA 2VSQA 3UC9A 3K09A 1GRRA 4N0DA 3P2JA 4ENVA 5CG2A 5IRCD 3MYYA 4K6GA 2NOAA 4UU7A 5CAEB 4C9BA 4WEQA 2V0GA 4MIKA 3U4QA 4YFVA 2C1XA 2W2VA 1RMTA 3CO5A 1WU8A 1AUVA 1YXMA 221PA 1UJBA 1N6IA 3B70A 3FJOA 1DAPA 2DKFA 3OQHA 2F8MA 3G9XA 4NYIR 5BMVF 4Y9TA 4AJKA 1WULS 3R20A 5F2KA 3ICCA 2QZ9A 1NSYA 4O25A 4GQIA 1AK1A 3KTAA 4HWPA 3RC7A 3ZW8A 1HDEA 1JHAA 2BIFA 1PTJC 3WX0A 1Z45A 4I7EA 1CJTC 2VHXA 2AZTA