3TLYA

Microcin c7 self immunity protein mccf active site mutant s118a/n220a/k247a in the apo state
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
335
structure length
335
Chain Sequence
PLLAAPLAVGDTIGFFSSSAPATVTAKNRFFRGVEFLQRKGFKLVSGKLTGKTDFYRSGTIKERAQEFNELVYNPDITCIMSTIGGDNSNSLLPFLDYDAIIANPKIIIGYADTTALLAGIYAKTGLITFYGPALIPSFGEHPPLVDITYESFIKILTRKQSGIYTYTLPEKWSDESINWNENKILRPKKLYKNNCAFYGSGKVEGRVIGGNLATLTGIWGSEWMPEIRNGDILFIEDSRASIATVERLFSMLKLNRVFDKVSAIILGKHELFDCAGSKRRPYEVLTEVLDGKQIPVLDGFDCSHTHPMLTLPLGVKLAIDFDNKNISITEQYLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MccF
publication title Structure and function of a serine carboxypeptidase adapted for degradation of the protein synthesis antibiotic microcin C7.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 117
structure length 335
sequence length 335
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02016 Peptidase_S66 LD-carboxypeptidase N-terminal domain
A PF17676 Peptidase_S66C LD-carboxypeptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Class I glutamine amidotransferase-like 3tlyA01
3.50.30.60 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 LD-carboxypeptidase A C-terminal domain-like 3tlyA02
3TLYA 5JYBA 3TLAA 3TYXA 3SR3A 3T5MA 3TLZA 4INJA 4JVOA 5F1YA 3TLBA 4EYSA 3TLGB 4E94A 5K99A 5FD8A 4H1HA 4IIXA 3U1BA 4E5SA 4IIYA 4MI1A 3G23A 2AUNA 1ZRSA 3TLEA 3TLCA 1ZL0A 3GJZA 5F5XA 2AUMA 5F9MA 3TLGA 4MJXA
chains in the Genus database with same CATH superfamily
3G9UA 4KUEA 4RVGA 3UJPA 2XKJE 1UFQA 2X7HA 3ZGLA 4F5DA 3ZNPA 4Q7QA 3WQHA 2ZJAA 1CEEA 1I0LA 4CL3A 4PGGA 4ZAWA 3O0DA 3H99A 4HC4A 421PA 2NNWB 1QLWA 2X3UA 3HWX1 2BONA 3T3DA 1BDMA 4P4GA 4QOJA 1ZN2A 2N9UA 4EABA 2XCTB 1VKHA 4ZT7A 3GA5A 2WSIA 3C5WP 5CT6A 2FMUA 2UYGA 2D0DA 2V1UA 3MAGA 3HE3A 4MJ3A 4P44A 1SOWA 2N1BA 2XKBA 4CODB 1F1JA 4F9GA 3MWLA 3P5BA 1K4MA 4RD4A 3DL7A 4Q1BA 4Q24A 3BS4A 3UATA 2OR3A 2VJLA 3AC0A 3EAQA 2VYVD 4XZ3A 3EVBA 4TS9A 3JWIA 1JXQA 3Q7RA 3Q7PA 4UDNA 4QTUB 1LLUA 4XX0B 3JQRA 4IOLA 4H16A 1KDZA 3KXIA 1OBVA 1NVKA 1FFBA 4B45A 4CUKA 5FFFA 5EXTA 2WTAA 1WEKA 2QVYX 2NTJA 4CLXA 5HKKA 3D4BA 1R0WA 3JYQA 3R7FA 3F9RA 1XZ8A 1YH3A 3EVGA 2UVDA 5H68A 4K05A 1XZQA 4MAMA 3ZYZA 1P2FA 4JB2A 1GG2A 2OCLA 1R12A 4GYWA 4JUFA 5EUQB 5J4HA 1IFXA 3SR0A 4AO8A 2X1VA 4HVCA 1X7HA 4L5YA 1DEOA 3RNOA 4GMFA 2WAXA 1MOZA 3OKFA 4KIJA 2VQDA 3BD9A 4I5GA 4OP2A 1KRWA 3QFFA 2NO5A 3P26A 2I7VA 2A9PA 1WDKA 3NV9A 1N5RA 3SS9X 4HN4B 2NXCA 4ADSG 2XGGA 4UTPA 4EY8A 2VT7A 3UJNA 3PFBA 4I5IA 5FORA 1Z8FA 3UCFA 1SC3A 1TU4A 4ZCQA 2GWHA 2CXHA 2ET6A 2H06A 3NHMA 2XUJA 3QITA 4MW9A 1ADFA 3WFZA 1ZGCA 4E1AA 5IH7A 1CY1A 2FTKE 5FOXA 2WIFA 4IGIA 3PDIA 1OFUX 3K8YA 2CFRA 5JO9A 2BKVA 4YXFA 3KKQA 2YXLA 4JROA 3WHPA 1SUWA 2WPDD 3F4BA 4LECA 5COBA 4E5KA 4YI3A 4YJDA 5ED4A 5I9BA 4YUAA 4L4SA 2Z2JA 4GBMA 4OH1A 5DCLA 2Q07A 3M49A 5C7YA 2F1JA 2CVOA 1PL8A 5DGDA 2A3RA 2EF0A 4IM7A 4QBIA 4O2BA 4RQUA 5KOJB 2NOAA 1YRBA 4BP1A 3DLCA 2WP8J 3EGWA 3IAXA 4MQMA 3NGLA 1AU9A 3P45A 5HS4A 1BW9A 1KQOA 2OCDA 4CLDA 1E63A 4DJEC 3C5HA 3JV7A 3MJTA 5EUCA 1G21E 2O3JA 3BXEA 2FUCA 1JH8A 3NI2A 4KO4S 4UD2A 4XLZA 1UFOA 4QDXA 4D4LA 4DXAA 4B84A 1I9CA 4RZHA 2ZETA 3V6MA 2X4LA 2K7ZA 3IE2A 5CP8A 3WDMA 4WZBA 1G8GA 4HSGA 4JHLA 4YRDA 3F46A 1QORA 3HN2A 1EM8B 1JLKA 2ZJ3A 4U4AA 2C00A 4FGUA 1E3TA 1G4AE 5KVAA 3B7PA 3LC2O 1PNTA 2YRWA 3EW7A 3PDIB 3NDIA 5JI3E 3K4IA 3HB4X 2XOKD 2OVFA 1JA0A 1KIMA 3C4VA 3M6MD 2P4SA 2XYGA 1WUIS 2BIFA 4G5XA 3SE0A 3LTNC 5THXA 5EEGA 1GZVA 1RQ7A 2NU6A 4EX7A 1V8FA 3GBPA 3GLGA 1QZUA 4PQGA 2DJIA 3OWHA 3ZGXA 3R5FA 1M72A 2OXEA 5I7HA 4O2BB 1EQAA 5HIMA 4MQLA 1PLKA 4EKEA 5JR3A 3OZFA 2YRFA 1ITZA 4XASA 5LNK6 3I2FA 3HU3A 1CEQA 3JQ9A 3TZBA 2B82A 1BW9B 1L4BA 1WXDA 4XVHA 1DPFA 1WEHA 3EUWA 5FL3A 3I12A 4DFDA 1HOTA 4U3JA 3AM4A 4JUDX 1NT4A 1F8YA 1GA6A 1G20E 3GDFA 2WP0A 5CB4F 2H85A 3B1WA 1YRLA 3AFIA 1GRCA 4ZYLA 3AEZA 4BJHB 1PGQA 2ZK7A 2EXXA 2VZ9A 1E18A 5ECGC 3OJOA 4LS3A 3E0QA 4WZBB 5IN5A 1UDCA 4LJYA 3RVRA 1M1ZA 2GVDC 4I5FA 1QIEA 3F6RA 5L7TA 2V96A 4F06A 3AVUA 2ZIGA 3S40A 1ZC4A 3CVYA 4UE2A 4D3SA 1SHUX 3ETJA 4I1SA 1CQIB 2K87A 1WF6A 3A1DA 3AXSA 4ZOQI 5CYGA 4O63O 3ZK8A 3FETA 3L7OA 3P0HA 4EUHA 2NU6B 3AESA 3GLGB 1ZQ1A 4GX0A 2XYRA 3PQ7A 2AW5A 1KS2A 2BE9A 3SBXA 4KR2A 2FLWA 1EHCA 3CEAA 2O57A 2YZNA 5T57A 2C97A 3FTNA 4UOEA 1A5BB 4MQBA 4Q15A 4RVNA 1E1LA 5I9SA 5CA0B 5KTKA 1RJDA 2CL5A 2X7JA 2PE5A 1RI2A 3JZMA 3VH4A 2XR1A 2ZROA 2G06A 2P5TB 4ZQBA 3GIWA 3MMNA 3WLPA 3ZDXB 2RH9B 3ORFA 2HU2A 4GDFA 2AHOA 1DE4C 3F49S 2G88A 2QTNA 3LTEA 5B53A 2BCJQ 3WQBA 3HY3A 3HVJA 3N2ZB 3RS5A 1K92A 2EC5A 2QN2A 2Y2UA 3QKSA 4GYYA 1Y5NA 1C0KA 1OX5A 2L0XA 3PEEA 4R98A 3W6UA 3X1KA 3DM9B 3MW8A 1C7ZA 4GI7A 4OG2A 3W5DA 4NGPA 3WIDA 4C43A 4CQMA 5JH7F 2C9OA 4KREA 2E6KA 1A8UA 5I8PA 3KL2A 5CLHA 3U37A 2IPOA 4BB5A 4UTRA 2E89A 3OJXA 1L3BA 4MUJA 4QWWA 1JU3A 1D8TA 4J76A 1UZAA 4WJZA 4WEOA 2Q7XA 1JBKA 3ZPXA 3MUFA 2J7PD 3QMVA 1CUUA 2HW8A 4J0GA 4AJOA 3QQPA 2WJHA 3NC4A 1PR9A 2IVZA 4B3MB 4EG8A 1IN7A 2AZTA 5HDQA 3EA5A 2C5BA 1H9CA 4P4EA 1NURA 3KEQA 4ZMRA 4B34A 4G84A 4L3VA 5AOBA 4EGAA 4J0DA 4O02B 4H1WA 4MWZA 1CRQA 2GJKA 4OI4A 2YH2A 3S2EA 4DKJA 2NXNA 2OHGA 4IGEA 4BMCA 1U8FO 3Q3VA 1D6JA 2I65A 4PXAA 3LRTA 1YB5A 3BQNB 3JD2A 1J8QA 1C7IA 1C8VB 2XDWA 3A31A 5FEMA 3PGA1 3B7GA 2YXBA 5DWDA 2WYOA 3AW9A 4CQMB 5LMNB 1VM6A 4W9MC 3I30X 1H0RA 1K6MA 3CHYA 1WZIA 2ZSDA 4HMOA 3B8HA 2VTBA 2BKEA 4M7PA 3UAWA 1NFQA 4DY4A 1QE0A 4D9HA 1KOJA 4IDFA 1MC4A 3FNEA 1ZK4A 2WWWA 4RCYA 3RDPA 3OWOA 1TZCA 5AUNB 1CD5A 2IHZA 4WOKA 1RKVA 4EF5A 3PVSA 4EELA 5HA5A 3DQPA 4GC9A 5BNZA 2E21A 2FPIA 1Y1KE 1G8YA 2GB4A 2V5VA 2K5UA 1EDZA 5CFMA 2O8VA 3T5DA 3H6HA 3UOGA 4N9WA 1RLOA 1IN4A 1CLUA 2PDAA 1D1QA 1LH0A 3AHJA 3DGEC 5ILGA 1Q7RA 4JHXA 4W9NA 3DOHA 1NVMB 5JLJA 4GR9A 5BN3A 4NCIA 1E0JA 5KBYA 3KKZA 3ECCA 1ND6A 2CMGA 2J3MA 1JMVA 3IC5A 3T07A 4Z8XA 4ITVA 5CG1A 1RMYA 1SBQA 2WIKA 3WNCA 4HH0A 5EXEA 4DCPA 1IBCA 3ADKA 5JU6A 2AQKA 5IAEA 3ZIAD 4ZDKA 2HMWA 1F7VA 3NJ8A 4GR5A 4C9AA 2VTBB 4G0YA 4MIKA 3H0CA 4OQNA 2F1OA 2DBVO 4NG4A 4XGRA 2C3OA 1EVQA 3Q10A 1GTSA 4TYPA 4Q6WA 4IPTA 4BMZA 3SIXA 4CU2A 1GZ4A 4D1YA 4NNPA 2GD1O 4YRZA 3ITEA 4FMPA 1C3VA 3LXXA 1JQEA 2FPIB 3AUYA 5G4LA 5JJLA 1MT3A 5ALXA 4PYKA 1ZNWA 2PQ0A 2ZJ2A 1T8TA 2GEJA 2GN9A 3HG7A 4R68A 4ZVTA 4CF3A 1LV7A 4ECAA 3N8NA 3E9YA 4BO8A 5H3HA 2Y6UA 1QIKA 5JCOC 1GGOA 1N0HA 1NBME 2F3PA 2IYQA 3CLSD 2QN9A 3OURA 5BN3B 5ICMA 2Y1CA 3FTEA 5LQKA 5A5FA 1GT91 3QLUA 5ADHA 3PDWA 1N33B 2JHPA 2W6OA 4M37A 4JXJA 4ZJUA 1JIUA 3EFOA 3QFTA 1C7JA 4C7XA 3BF7A 1RPTA 3E3OA 3DWEX 4OPMA 4RXUA 4UEKA 3DWIA 3TOVA 3WAKA 2AUNA 1JVNA 2JL1A 1DB3A 2QG9A 2WHXA 4Y98A 4ZALA 4DV5B 2WDPA 3BE4A 3DFUA 1CJUC 1OWPA 2WF9A 1AKRA 4O0MA 2QN6A 3U9LA 1U3FA 3PT5A 4RY9A 3C3MA 4ZI5A 3DJFA 5EXSA 1EJ0A 4PS0A 2X0DA 1DAPA 3GLUA 4AX4A 6LDHA 4N8EA 1LZLA 1UXGA 3FLEA 1NF2A 4LOHA 1VJCA 1XQVA 4IXMA 1JG2A 1C14A 4P31A 3SF0A 1IPEA 1XPJA 1XGKA 1UPBA 3QKIA 2YZGA 4ARVA 4FDVA 5KNDA 4S04A 2PS0A 3LGAA 1GXSB 3DHVA 3P9YA 1NVBA 3DZDA 4M46A 4ZODA 3T9FA 3WLRA 1DXHA 1VJTA 4X1KA 4BRSA 3PPVA 4TQGA 1U5CA 4LYYA 2R6HA 1W52X 1F0PA 3EZ7A 1JTFA 3W8DA 5T6MA 1LJUA 4EJMA 1NAIA 1H1TA 3QVUA 2QSJA 3SD7A 2C61A 2FG7C 1CUZA 4O2RA 5ALOA 4C05A 1KE1A 3BBPA 3DC2A 5AVJA 1MJGA 3TI9A 2PY6A 2ZRPA 3EFOB 3RASA 1GYQA 3TL2A 3TQOA 4CWAA 2V59A 4N8DA 1NMXA 3V4FA 3E4CA 3N2YA 4MVJM 4PNZA 3UJ3X 4C8CA 1Q91A 1QFZA 3K96A 3SJ7A 2IIPA 3TOSA 3WK6A 3ZS9A 1AUQA 4AQDA 3QPWA 4BFTA 1XZLA 5FWDA 1TRHA 5ALUA 2H29A 5DNEA 2EW2A 2YVQA 4DCNA 5KCZA 1NW9B 3C5EA 2GEBA 3R7LA 3OIWA 5DNWA 1LZKA 3Q4GA 4WN9A 4A1FA 3V7NA 4OI0A 4OV6B 5NULA 4H7HA 4L6AA 4LKOA 5K3FA 3NC0C 4QELA 1GUAA 3C6KA 3KHUA 2W90A 3ITNA 3ND7A 1IWPB 2PHZA 4FW9A 4KR7A 3MPOA 4PX5A 2WF7A 5JSFA 4LDZA 4X1KB 4DOMA 3KELA 3ODGA 5DBFA 2JANA 4ER7A 3HKEA 4DC1A 5KWIA 3B53X 5KKCA 3Q2IA 3CVVA 2B0AA 4WUVA 4B73A 1OI7A 1RM5A 1BWSA 2ZRGA 1H5UA 1E1KA 2IKSA 1PD0A 3AM5A 3DXFA 1U2PA 3GOQA 3LPCA 4QECA 5AKZA 1N2CA 5BOSB 1JU9A 3QPDA 3MCUA 1ZW1A 1E5XA 2YWXA 4EBBA 1M2FA 4E7OA 1HM5A 1JNYA 1P31A 1YZLA 4IMRA 3AR6A 1FFYA 2BFEB 3DNMA 2JW5A 1O9GA 2J6HA 4FFDA 2X1LA 1F0YA 2Q4EA 5JXJA 4NKRA 3TCNA 1PS9A 3WKEA 3I53A 5C5DA 1VL6A 3X3HA 2PXAA 3I9V6 1M1UA 3WX0A 4Z4HA 1C8BA 4GZ6A 3OX3A 3W2TA 2H65A 4M1ZA 1I2BA 1M6YA 1TEVA 2JFXA 2Q5HA 2R97A 3P4YA 4XGQA 4EB3A 821PA 1SUCA 1UJ4A 3G2JA 1YJ5A 4WXYB 1JFRA 2PL5A 4WN9B 5KO2A 3HCDA 4DJJA 2PPVA 2OBYA 5K3FB 1W8IA 4PO3X 4JS0A 4EY4A 1ZH0A 2FR0A 1DCMA 1C9YA 3W0LB 1NXPA 2G25A 4LNHA 4QLOA 4RZQA 1I24A 4UEOA 1CERA 3RARA 3E3NA 4ZHQA 5HQTA 3SQLA 1BFDA 3Q8MA 4KRFA 4ZANA 1TXGA 3RE1A 1UP4A 2O5VA 4YRFA 5ALEA 1P81A 3IKMB 3B36A 3HPQA 1BHQ1 3EFBA 3OLXA 5CFNA 2HAEA 4OBBA 1N2CB 3MOIA 2JK1A 3D1JA 1UR5A 5BORA 1SBYA 1CR6A 2R6R1 1L3IA 1UMCA 2CL6X 2D0OB 3BL8A 3UK0A 3OC6A 5DHFA 1N3LA 4B4WA 1RRKA 1T2AA 2NXEA 3ML1A 4OXXA 4A2WA 4C9BA 4KQXA 1I7DA 2Q3DA 4Z53A 2Z6QA 1AK2A 4R54A 1E77A 3RQIA 5LLTA 4V03A 1BA3A 2A5JA 2XVYA 3QXHA 4U2FA 1KHTA 3UXHA 3JY6A 3ZN2A 1DBPA 4KQWA 4WQMA 2NO0A 4JI6B 3DW1X 4FBGA 3WL4A 3AV0B 2VSXA 3OP1A 2FN3A 3ZBUA 1O9BA 1OZAA 4LJ5A 1JIIA 1L5YA 5IASA 1DKMA 4LZPA 3H9EO 2YC2C 2QJRA 1P0IA 3K0SA 1YTUA 1SVWA 3K1YA 1JYFA 4PRKA 5AWFC 1T2UA 2YCLA 2YFYA 4NYIR 3PWSA 4GPEA 4ZHQB 1Z2PX 4DIFA 1CQXA 4KHZA 3JW8A 1PDWA 2NW6A 2WV9A 4ZT2A 4HXGA 3T7AA 5LWHA 4PLPA 4MI3A 3FAZA 3GEEA 3QKRA 1I3MA 1L5OA 1UMCB 2I62A 3LUBA 3N0XA 3ETHA 4UXJA 2AOWA 3AP2A 4DLTA 4MR7B 2VXCA 2BRUC 1E94E 1TUGA 4BMPB 3DKRA 5K3BA 1WTAA 2P5SA 2WUWE 4Q9DA 1A04A 1HQCA 3PC3A 1M1YE 1DQNA 3JQ8A 2BMWA 4XIJA 2XCOA 3AZQA 2QRHA 1GCGA 1HTBA 3HU2A 3L05A 3A25A 4EX6A 5K8UA 3SVZA 3C70A 3L6OO 3TW8A 2H4WA 4WCFC 3MOSA 2PXHA 1WCWA 2G9ZA 2ZB4A 3G2OA 3K92A 4CQMD 3GVIA 2GNOA 5A4MS 2RCNA 1KWGA 3TQCA 5JZ9A 1JIJA 4QQNA 3ASYA 4HS4A 1HYHA 3GVCA 1SBZA 2XWJI 1FDRA 4QAQA 3CLTC 2ID7A 1K97A 3ABOB 2LIPA 4QOFA 1OAKA 3DXYA 4G4JA 4QDUA 5KU1A 2TYSB 3IRUA 4AKHA 4EZIA 2CIJA 2WWRA 3KLNA 4QYMA 4N82A 2R8RA 1VLMA 5K9ZA 3QKRB 4IHKA 2V7UA 1N2JA 1M5UA 4P7FA 1JUDA 1OU4A 1XD2B 1CUCA 1NU8A 2FNAA 3QBDA 4GOMD 4KWTA 1W1WA 3LY9A 1SU6A 1NRWA 1ODKA 3OLCX 4B4KA 2GCGA 5F3DA 3KQHA 1U0BB 4R9RA 2CD7A 1H0KA 1TTPB 3JQ8B 4LRQA 3HFSA 4Q9IA 4E5UA 1KGSA 3L02A 4OMCA 1EFUA 1HLDA 3L9XA 3A0RB 3COJA 3ICOA 4LYGA 1P77A 5CCDA 4HRYA 5EWJA 3H87A 4YCMA 2DXIA 4I19A 2VTKA 3LVRE 4MVWA 3SM3A 3TW8B 4I1PA 5IAGA 3KPJA 2IYXA 4G63A 4ZVPA 2HJWA 2R5NA 4B4VA 3EEOA 1E99A 2PJDA 3PIDA 1RCTE 2VA8A 3NHRA 5A3RA 1ORIA 3N70A 4NS1A 3RI3A 2I6UA 4QJ3A 3MB5A 2EKDA 3ZWWA 1DX9A 2XE4A 2B8WA 4XWWA 2VAXA 2FUG1 3GYGA 2SNIE 3ONEA 5CIWA 3LFUA 3AL3A 1PR3A 2ASEA 3Q7TA 4ENSA 1FVXA 1A8IA 4QXRA 3W5HA 1RABA 3LY8A 3L0ZA 1B1AA 1U02A 5LQAA 2LUOA 2ZUUA 5LQJA 3I9FA 4ZV4A 3AM1A 2A1UA 5EQJB 3UPUA 1RAAA 3E9EA 1VSTA 4LV6A 3VSEA 2G5GX 4R2IA 3WWEA 1FK8A 4MCQA 5K3CA 4MW2A 2C6GA 1XTTA 2PIDA 1DQZA 3S3TA 3H1EA 3UMFA 3GCGA 2G82A 2GWRA 1BVYF 3ADOA 4RSHA 1YU6A 3JVEA 4B6RA 5ALSA 1VGRA 5A02A 3MGCA 1NKSA 2CUTA 3E82A 4GF5A 4IMIB 2GK4A 5EWJB 4B09A 3QIVA 4Q4HA 4G5FA 1UM9A 5F1PA 1V35A 4CM8A 3MA0A 2O1SA 4HKTA 1ZCBA 2IF0A 1UH5A 1GGJA 2ZXFA 4KRXA 1ZNXA 4I55F 3KVYA 2FXVA 1MQSA 4BB0A 2Q5CA 4OREX 2CUKA 1RYNA 1F0NA 1ZM3A 1T5DX 4EYOA 2J30A 1GOTA 2GDJA 1W59A 4NJMA 4TZTA 2G1AA 4IIGA 4WFIA 1ONPA 3AIKA 1YVUA 3LC1O 5IVDA 2DH6A 1NASA 4UBMA 2XTAA 4D98A 2XMDA 2XSZD 4IHJF 2IRWA 4CF4A 4CG2A 1E9AA 4I5EA 2J3EA 4CIWA 1QE3A 1QIIA 3CRW1 4BUZA 3FSJX 3FUCA 4DIEA 1XXHE 3R9WA 1X7YA 1ZGGA 2A1UB 2OO5C 1XDZA 2YASA 3KWFA 5E4YA 2FPRA 3SIRA 3WQRA 4LGVA 4B2IA 4B44A 2ZCVA 1D2HA 4AJ1A 4OL0A 3L1IA 4CLRA 1GZ7A 1I4WA 2G17A 2O2YA 3DFMA 1ABBA 3HFJA 3R6TA 3KEGA 3L07A 3QEAZ 4K9PA 1M2KA 2EZUA 1V16A 2SKDA 5A5GA 3RBAA 5L7WA 4NZMA 4FQ7A 1LS1A 1P33A 3PC8C 3VHLB 1UINA 4HEA6 1UM9B 4Q4HB 1TJ5A 1MTOA 1TUBA 1DKNA 2MYUA 3L7YA 2OYRA 3CZ9A 2R8OA 2FDCA 1FFWA 2QK4A 3MUOA 4GSYA 1XKTA 4XD2A 4Z86A 1URPA 1FBNA 3C24A 3EIOA 2PGXA 4I4NA 3HJTA 3QE0A 3S2UA 4BX0A 1ECGA 3HQ4O 4FX2A 4IOJA 2NPFA 3UFBA 2B1QA 3RUDA 1DKQA 1G2IA 5DNUA 3BMXA 3ESDA 3UTDA 3CWCA 4NEHB 2CJYA 1MIOA 4B33A 1A5ZA 1E4VA 1PTJC 2GETA 2V7QD 3STVA 2IV2X 4BMVA 1KKLA 3MQ4A 2JH3A 1HRDA 3EHEA 4BKUA 3NATA 3I2IA 4UC0A 2FEXA 3ZHCA 5SYNA 4TSFA 2BH9A 4OATA 1VZ3A 3UV3A 3KKEA 4BWFB 5G40A 4DXHA 3ED1A 4L9AA 4YRQA 1X7YB 4Y6SA 5TEVA 1QGUB 1V5IA 1OJ7A 2VL7A 1QG6A 3EDYA 3QE2A 5F33A 3ID6C 1KMQA 1P5FA 2WYVA 2AD5A 3D4LA 3LUKA 2EIHA 3VKVA 1ZUIA 1QH9A 4KE8A 4RD0A 1XZEA 2BGLA 3IX7A 1V5GA 3PWZA 4BTLA 2AA3A 1JE1A 1V16B 3A36A 2B3TA 3T4PA 1K0FA 2PX4A 2ZE8A 1ZGZA 4R51A 2J87A 3HZOA 5JPIA 3KB1A 1TUBB 4QPPA 3C43A 3TM5A 4OCZA 3VHXA 4CM4A 3L7KA 1SPXA 2JCGA 1SCIA 3IE1A 3HCBA 3REFA 4C2BA 4GT1A 2GBGA 4JB0A 4OHKA 2R62A 5LZ8A 2XBMA 3BA6A 3LCJA 5IVKA 3C48A 3T1OA 1H8HA 1MIOB 4KMMA 1STOA 1RYZA 3HNRA 4I9NA 3G2NA 4J1TC 2QDXA 3L7NA 3X1YA 5JRDS 4A10A 4LMAA 1OPRA 4XQ9A 3PEVA 4KLRA 5ALRA 1OH5A 2JFHA 2VVTA 1H9AA 2GM4A 1BEUB 3LF2A 2VHYA 3JYLA 3CSSA 4RHYA 4AO7A 4M98A 4N0PA 1C81A 3O4FA 3EVCA 3HB7A 4MB6A 2X9GA 4OJMX 1YKSA 2RC5A 2FKNA 3BIOA 3PVCA 4OA8A 3N2NA 1TZJA 3CLHA 1SBCA 3AUUA 1IWBB 5FA5A 2PD6A 1Y1TA 1H6CA 1Z4KA 2AT1A 3EMKA 4MRRA 5I9TA 4Y7CA 5CDSA 5LIRA 3V1UA 5JSQA 5P21A 1JHYA 2GTIA 3AEYA 5BV8A 2GHQA 4B79A 3O2NA 1VYTA 1O08A 2FCAA 2YQ5A 5GINE 2ZJZA 1RS0A 4MO9A 4MR9A 4PYQA 4DMCA 3U40A 2Q45A 2MSWA 4R1PA 4DEYA 2HA6A 3VHXB 3SHWA 1PV1A 4B17A 3C45A 2OVBA 3BHIA 5F78A 3UUGA 1KAEA 5ITVA 2FUEA 4JL6A 4AP9A 1QANA 1TZMA 2GP4A 1GYPA 2ZUEA 1ZJ5A 2QT0A 1WXFA 2R6AA 4FS8A 2YKGA 3O90A 1GL3A 3QEJA 4RTOA 4OHPA 1U6IA 2X4DA 1GEEA 2CZQA 3LS2A 4UAJA 2G63A 3TVDA 2Z95A 2FQWA 1JR3E 1W2WB 1U28C 1GQ2A 1VLLA 3EOBI 3R24A 1K68A 4H6VA 3NNSA 2RHRA 3NHZA 3UWMA 4YQFA 2QB5A 2VI5A 4FNMA 4HFJA 1V39A 4IIVA 1U3WA 3AHGA 3F47A 3O9ZA 5DIFA 1KDVA 3VZDA 2OKGA 5FEUA 1A2BA 2ZRQA 5FUMA 2EBHX 1G20A 4XVUA 2IEZA 1SOMA 3DDCA 5DN6D 1ZM9A 3TRHA 3O4IA 3LLMA 5T3YA 621PA 2KLBA 2NVOA 2NZJA 4JXXA 3URKA 2H7VA 1KK3A 3K30A 1QVRA 4OY3A 1V11A 1B41A 1L7MA 2ZB8A 4MR9B 3UOAB 3CEMA 1OKKA 4OQMA 1RBQA 4FKZA 2XDQA 1D1TA 5EJ2A 3CT4A 2OQRA 4PSCA 3TQIA 5JBIA 4WBNF 4HAIA 5K99A 1PNRA 3P20A 1ZGHA 5HZMA 2XMBA 3QSGA 3WOHA 3WWZA 5D1NA 4XH9B 5C18A 5G02A 4IRUB 3EYAA 3JVVA 1A9TA 2H48A 4B74A 1DX6A 2I33A 4G8DA 3B6ZA 1QSGA 1QC5A 1FVHA 4D6YA 2CXSA 4PRLA 1CFJA 4R9VA 4QGBA 4LJ7A 1VZ2A 4E4YA 1DNPA 5JG7A 1AMOA 3C1TA 1EUDA 4BQOA 1DIBA 4K9LA 3K9LA 2Y1FA 3NR2A 4KYIB 1HSOA 1U1GA 3SC4A 5CB6A 7ADHA 1NI3A 1P2VA 5D1HA 5J4KA 5FTJA 4NECA 2UXCB 1G20B 3F78A 3HJNA 5D6OA 4EPXA 5ELYA 4ARIA 2C4MA 3D8BA 4EVQA 1CY0A 2FPXA 1LNZA 3CUSA 4YAUA 4KPFC 3HCAA 3ESZA 4ZTBA 3SZRA 1JQ3A 3HCWA 3QEMA 1V11B 4K6OA 1ZRMA 1ONOA 1UFVA 3T8YA 2QRVA 4HT3B 4TZ0A 3F3MA 3SOZA 2KB0A 3BIFA 3NTQA 1G1AA 3ZU5A 4TQUS 1CEYA 3I8SA 2ETXA 2B8JA 4QU8A 3PDHA 4R01A 4MA5A 3VPGA 3NEAA 3MMSA 3C8MA 1CSEE 5AXBA 3TLGA 1JHXA 1K4KA 4A9AA 4CNBA 5AW1A 1QU3A 4QVKA 5EKTA 3DF7A 3EF1A 3UPDA 1Z6GA 1T9GS 1A7AA 2WU4A 3ZDRA 3E3AA 1UKBA 2OG2A 1WB9A 4YAOA 1ZVJA 1H2WA 1NVAA 3JZAA 4UMDA 1TK3A 4OQDA 3WZMA 2GPBA 4HCJA 4ZVOA 4X64B 4J0NA 4PGAA 3JPWA 4RKEA 4X1OA 3LHDA 3GAAA 4Y1EA 1EUDB 4D3XA 1NW5A 3IIBA 2P69A 1WMSA 2W5UA 3O1LA 1ZESA 3Q85A 5HE9A 3TQSA 5I01A 3IUMA 1OXKB 2P2SA 5EWLA 4QHYA 4WXEA 1MEEA 4I2NA 1R8QA 1CZNA 1PKEA 4XIIA 4AJ9A 3PWKA 4QGFA 3WNZA 2I2WA 3KPWA 3C87A 3I1IA 5CFPA 5JS1A 4UUMA 3UT5A 3OP4A 3KKOA 3P27A 1W76A 3UICA 3C41J 2B4TO 4U9IS 4D5EA 4ZYWA 1P72A 1V25A 4HLCA 1ZAYA 2GEKA 1VMDA 3KZCA 3QEMB 2NVBA 5ALTA 2WD8A 2ZLBA 3R7AA 3UAZA 2QRVB 1PS0A 1DO2A 2VF5X 2H4ZA 1X94A 4GRIA 1VG0B 3AUJB 4ZJZA 1C3LA 3QG5A 4LPSA 3TLMA 3MT8A 2PZAA 3NHPA 2ISCA 4ZPXA 5JVDB 3ZQKA 3S8EA 1U0OC 3ZWYA 3EUEA 4JMLA 3TLGB 2EATA 1CVLA 1EMDA 1FQOA 2CFSA 4EJ6A 1RZRA 4MICA 2P2YA 4KGDA 3DMDA 2B94A 3NHKA 3UV7A 4B7XA 2H54A 3H8SA 2C99A 4OAOA 3G0OA 4DIMA 4ZI7A 2Q50A 1J9GA 2HDOA 2W93A 4O2LA 4I4TB 1Q11A 3KQTA 4MITA 3I28A 2ZR9A 1U9YA 2MSEB 3OCUA 5CM8B 4DIOA 1M8PA 2IW3A 1XNQB 2ADOA 2B83A 3LYLA 1GRQA 3E70C 4TLLB 1L9XA 2NYUA 5EWLB 5LDGA 4CCAA 5A5DA 1CUYA 1Q0LA 2V3VA 3LI2A 3OQ1A 3G0BA 2ZITA 4BJ1A 1BD4A 1TLTA 2Q5LA 2EF1A 1QQ7A 1W581 4OUDA 3TKAA 1PIWA 3UT5B 4D9IA 5JQWA 4PPFA 5ENDA 2PZFA 3H65A 4HY3A 2ZAGA 1UQUA 4K6FA 4BDSA 1Z22A 1I1OA 4JSTA 2VWHA 2WTEA 4EA9A 4PPQA 3LT1A 4DQDA 5BOVA 2XNHA 2WNSA 3D7MA 2OFXA 1QNFA 4LVUA 4V2UA 2R48A 1I7LA 2MINA 3H5AA 5TNXA 4G9BA 4GMHA 3P9CA 3RG2A 2IPXA 4WCFB 4FTWA 5K0JA 1IHXA 1T1SA 3FPHA 2OR4A 2WWFA 1R00A 3AH8A 1UBHS 3CLKA 2OBNA 1HG0A 1RYEA 3AHEA 4GFDA 2P6UA 1SC6A 1Z39A 4ZI7B 4W4TA 2DMRA 2WJ3A 2KBEA 4ZJPA 4L50A 3EZXA 2Y1KA 4YBZA 3TNLA 3D7HA 1NJ6A 3I9NA 3KUUA 4FT2A 3RVSA 5CR9A 1LB1B 3KZXA 4G26A 5CPBA 3EGEA 3V4PB 1OX6A 5B7PA 1IZ8A 4ZU6X 3I5YA 3S0JA 1OMOA 2R1VB 3GLHE 4RFSA 4M9UA 4BO6A 2QNBA 3K9QO 3WWPA 3FGZA 4JJKA 2JLYA 3PXAA 2CN1A 3BHJA 4BWYA 3D1VA 3MRSA 3KE8A 1A8HA 2JJ1A 2DM6A 1YFZA 2X9QA 3A6DA 3GJYA 4BXOA 3SYLA 5JI2E 2ZBVA 3RJMA 3MWDB 3BIWA 5GJBA 1RXWA 4REOA 2PZJA 4K6HA 3WLFA 3GFPA 1BX1A 2BJHA 2F3SA 3BWYA 1W4RA 5LU9A 1WMAA 4A23A 3GRPA 3EOAI 2IUUA 4YV2A 3HADA 4JY7A 4M1EA 2QUKA 3QE4A 4R7ZA 3W9SA 1X9HA 1VMIA 3O2QB 2UU9B 1W4AA 2BR4A 4G2TA 5ELLA 4S12A 3DG9A 4J4TA 1B1CA 1C1YA 4K8OA 4ENTA 4AN0A 2IBMA 3TPZA 4LAFA 3FEDA 1VCOA 1ZJJA 2HBRA 3ENKA 4RVUA 3FWHA 5EIFA 3THSA 5H0IA 1AD2A 1RKXA 1HDCA 1WNFA 3D02A 3BAFA 3FCAA 4RY2A 2AMLA 3GH3A 2HY7A 4IV8A 1GILA 2J4CA 1G6Q1 3S44A 1PJ2A 3HI6A 5IVIA 3EGOA 3ZY5A 4RFSB 1DE0A 5CIYA 2H8KA 3RCBA 5I5EA 2DR2A 2RGNA 2J85A 3NGXA 3WJ2A 2ZT5A 3NTUA 4F3YA 3HBMA 1XHFA 4URUR 4B7UA 2C2HA 1KC7A 4JBLA 4TSFD 3BJZA 2DPLA 3RWMB 3LDHA 1Z13A 1JIQA 4BXOB 3K6JA 1U4SA 1UK7A 3CE9A 3H75A 4EITA 1PBTA 1FNSA 2AQHA 2PEYA 2ZU0C 3DMFA 5KNCH 4RKRA 2FLKA 1II8B 3OLQA 5FUVA 1FZQA 1K86A 1NSTA 1OLXA 4FOPA 1DFHA 4U2DA 1R0KA 4MYUA 4U6QA 5DSZA 1OQAA 4CTMA 5GZ3A 3BFKA 3BQMB 4JVMA 4TVBA 3QF7A 3ZLJA 2I4TA 3K9CA 2IPLA 1W93A 3SE7A 3KJFA 1TQHA 1TQ8A 3C3BA 5ICGA 1XCPA 1Z7BA 1NF8A 1NQVA 4QD3A 4R8VA 5F5LA 3ZDEA 1E7YA 1TX4B 1LNSA 2G4CA 3E03A 4P0TA 2BUAA 4II2A 2CY0A 2IH5A 5K0ZA 4EG1A 3U7FB 3P0FA 2YVLA 2ZBUA 4LSGA 3II6X 1NY5A 3ZK9A 1NMEA 2Y3IA 4REQA 4M38A 2AYXA 2GJAA 3AQIA 5FIUA 4IEIA 4P3PA 3U7IA 1GU0A 2W6NA 1X7DA 4EZEA 4XCQA 1YR2A 1SR8A 3UC5A 3ONNA 1Q3KA 1Y34E 4X6LA 3FRHA 1H4VB 2WF6A 2WJWA 1JQDA 2YJ4A 3TECE 5A0TA 4F3CA 2V7GA 1I2AA 1RXYA 4R8RA 4KBFA 1Y9ZA 1SBTA 4AJ4A 3KR1A 3PUYA 4UATA 2RONA 3G85A 4H17A 4NYJQ 2VP5A 1TK9A 5FPSA 1NW3A 3TDMA 1WUTA 2JLBA 3P71T 3C3WA 1NULA 4GPTA 4KC0A 1B0UA 1O95C 1VSBA 3AVWA 2D2VA 2OBLA 2TECE 3U16A 1RDFA 3OH8A 3WGJA 3R5HA 3T54A 1GT6A 1FFSA 5HRCA 3A6GA 1OI3A 2H11A 3PFGA 4CIVA 2FMFA 3GEBA 4K6KA 2QP9X 2VJKA 3GZNA 5DNAA 3T5AA 2QI9F 3ZDQA 4BFVA 4REQB 4J1TA 1Y33E 2AOTA 3GEPA 3G2LA 4P4BA 3U4CA 2H9AA 2VHTA 1RBZA 3FKSA 1YS7A 4G0MA 4P84A 2YVAA 5CTJA 4AMYA 2Y67A 3F8TA 3ZXYA 2JG3A 4MMZB 3UTCA 3LU1A 3SPXA 3ZJVA 1NV8A 3Q3JB 4IEEA 3DEFA 3K0AA 1U0FA 5FNVA 5HILA 2JFBA 4IZHA 5CVJA 4EFMA 2VQ6A 1SVKA 3FFBA 1H2EA 1BEZA 4KXUA 1U7TA 4ZVVA 4OLBA 2PX2A 4YRCA 5IM5A 2HSGA 3EEQA 3M6UA 2OENG 5H82A 1A9OA 2WMYA 1ACJA 2XNJA 2AZDA 2VF2A 3N2LA 3S4YA 4CTNA 4JITA 1ZMTA 3EULA 3G9QA 5A3VA 2QVXX 3WRVA 4CMAA 3EAGA 4URWR 1DZ3A 1JSZA 5E3HA 2ZWIA 1CJSA 4BV9A 5ULLA 2X8LA 3GD7A 3GNTA 3DDOA 4KRYA 2FE1A 4OHWA 1XE3A 3VFDA 4NP6A 5D29A 3L84A 3ZI7A 3S5UA 1F38A 2DUUA 4NZZA 4U7GA 1BJTA 4FFMA 2XRFA 3K0FB 4RFVA 3UO8B 3X2EA 4ZKDA 1JEOA 2NQTA 4L5BA 4RD6A 1U7WA 3K7EA 2J3JA 2XMZA 2P1DA 3T0TA 3WV5A 2AOTB 5HS6A 1KQFA 4NESA 4NENA 3HJGA 2WR8A 2BFMA 3IJ5A 1DDIA 1JQKA 3B20A 5E95A 4MGEA 5M34A 4R1NA 3D7KA 1Q57A 2OFWA 2VKTA 2HXSA 3K0AB 5FNVB 2XUFA 3IHTA 1K08A 3IEPA 1Z8LA 3LO5A 1XZBA 4YN3A 3GJ3A 1R0CA 4CKCA 5KQSA 4DR5B 4WCVA 2YBEA 1W46A 2LE0A 1K27A 4DUPA 4QG7A 3EIQA 3W5VA 4JOQA 3OCXA 5AK3A 3F5QA 1XXLA 1ZWKA 1NJ2A 1UBJS 1T0IA 1ZCZA 2G36A 4KO8A 4FEAA 6GPBA 1C4XA 1ZW6A 4MCAA 5LZ2A 3ZVNA 4WY5A 1KMCA 1CUFA 1E2GA 1JEQA 1A8QA 2JIDA 2ZG6A 4RTSA 2A9VA 2XCLA 3UJ8A 5LMZA 2IEGA 2VUIB 1E7MA 3BXHA 3HO6A 2FG5A 4PZCA 4QVGA 1RMQA 1T6XA 3DMTC 2OO7A 4O1HA 4YYZA 1WUHS 3DLAA 1B73A 4YDHB 3AFGA 5KAPA 4B85A 4M7OA 1E59A 3LT0A 4YJ3B 1SQ5A 2W4IA 1XTRA 5JAIA 3SAJA 1F3OA 3M8KA 4NENB 4BO9A 5IHPA 4EEKA 3AFMA 1ZRNA 2C4WA 2P27A 3EBOA 1DL5A 3EY4A 3IUSA 3HO8A 4R1QA 3DO5A 1U2TA 2E18A 4O6VA 1KQNA 4CZ2A 3K9HA 4HX9A 1O54A 4FC6A 4CKCB 3JRXA 2WSBA 5CFLA 4O4LB 4QPCA 1VIVA 3K4HA 3E84A 1P1HA 2QVLA 3KE9A 3NWOA 1F6WA 1VHDA 1BMQA 2H2GA 3A7EA 2XT6A 3EZ6A 4M22A 1AX9A 4LDQA 4R5MA 4CFZA 1LCIA 3AFOA 3E22A 2O14A 3OSZA 2BI7A 1KZ1A 1BX3A 5EFOA 4FBMA 2P4QA 4C4ZA 1ZXBA 4EAAA 3OHMA 4OXIA 4JOCA 3P19A 2A30A 4LJ8A 1CY4A 3DT6A 1P8AA 1AKQA 1N0IA 1T29A 2GK6A 1E60A 3K5WA 3GRYA 5L7YA 4GXTA 3K70C 2P77A 3AEQA 3W2GA 1LDGA 5ELMA 1E3DA 3QFRA 4LV5B 2QX4A 4HP8A 3BSSA 3T9BA 3ZDZB 1C0EA 3LBFA 3TOCA 2F59A 1PHPA 4IJUA 4C3ZA 2FSUA 1U3DA 3ICPA 4QVIA 2HCTA 2I80A 2ZIUB 4ARZB 4BZQA 4OKIA 1LF5A 4NBLA 3TFQA 3L3BA 4Y7DA 1FQJA 3U4AA 1A9QA 1R9MA 2YS6A 4NIMA 5TGDA 3CLTD 2DOKA 5EJAA 2IBSA 2EHJA 4BBPA 2WW8A 2CXNA 1C4WA 4YQEA 4DYVA 3GH1A 3K31A 1PUJA 1GPKA 1PHRA 1QHYA 1KZ4A 2VQ3A 3IDQA 4EG4A 3E22B 2GJ9A 1YFLA 1VKRA 4IZIA 2CE7A 1LBSA 1V4VA 3OPVA 2REOA 5KX5A 1EFRD 2X3YA 1Y6QA 1O4WA 2R3SA 1JA1A 4TVSA 1XVVA 3MS2A 4DV7B 3QOFA 4G23A 3P4XA 5ALYA 4Z9FA 3IT0A 1PX2A 2H6EA 1VBNA 2O3SA 1DIAA 1E2IA 4IIDA 1UJNA 1E3EA 2VPTA 4IS3A 1QIJA 4UPVA 4CV2A 5BV1A 3GD5A 5DK6A 4ZARA 2IS6A 2NT4A 5CPFA 4ZYXA 1WPRA 3L1KA 3KLBA 3NEYA 3UMVA 3N5KA 1HYQA 4IUYA 1ONBA 3OFVA 2OORA 1JEEA 1T36A 1RAGA 1WXHA 1DRWA 5I3CA 5JC1A 4D8UA 3H1BA 4AJJA 2HF2A 1ISRA 1B15A 1QOQB 3JVIA 3QA9A 5EJGA 5G4KA 4BKQA 1AN0A 3CIOA 2A0XA 1O2DA 5FA8A 4QTZA 1GPJA 3UCXA 3T5BA 5F2OA 1MNQA 2FPUA 5A4FS 2WUFA 1EFAA 3WGZA 3DAFA 4NBSA 2YUIA 2HR1A 4MUMA 1NBMD 1T9CA 5CH8A 1LKZA 1PFKA 4AUKA 3MT9A 3MF4A 1PR4A 4WWHA 2DCUA 4KCGA 4FJ2A 5DBIA 3EHDA 5KX5B 1HLFA 3GPIA 1P6UA 3WLSA 4C20A 2ZWMA 3JQPA 2YWDA 5KEIA 3JVDA 1QVAA 4MVYA 1JLMA 1PSZA 1WY5A 1TGVA 4MV1A 3ZHSA 1T0UA 4HGQA 1ZJYA 1G2QA 2WKQA 3F5FA 1FU8A 3C4QA 2IOFA 4FD3A 4HK4A 4UU8A 2PT5A 3GHYA 1QP7A 1CHNA 1QDLB 3K5PA 3EVNA 4WN3A 1U1EA 5FB3A 3WK4A 2YWGA 4UM8B 5DHTA 4YCSA 4RTLA 3V4RA 3I9V1 2HK8A 3NH9A 3HV2A 1Z4QA 4QHSA 3AX6A 4ZZ0A 1T36B 1LBTA 3MCTA 4BKMA 5ICSA 3FECA 1DKUA 2C31A 3M4JA 3HA3A 4MIYA 2BZSA 4Q7EA 1ZL2A 1XXHB 1AZSC 4YECA 3Q12A 5G4KB 3TPCA 3DLBA 1YCGA 4M53A 1U0EA 2F3TA 2R4UA 3MD0A 3OLWA 3PUHA 4NBWA 3R9XA 4PGHA 1BFKA 1HLGA 4IJWA 3T34A 3D7DA 1SNYA 1WOYA 5KNCA 1JJBA 1X3LA 3RSSA 3EWNA 1Y82A 4B3XA 1OXMA 3DVLA 2GEVA 1XMIA 2EFDB 5F5NA 4FZJA 5EIHA 3UF0A 4JI2B 2CWDA 3CONA 5IB9A 1PKXA 3ZDAA 1NTOA 5KYVA 1WU8A 2BEUA 5AI9A 4I08A 4DMKA 5LQUA 4J4HA 1U3VA 2FN7A 4EBFA 3SXUB 5TIIA 1YVPA 1IM8A 3KSDO 3M4NA 3K0HA 3MLAA 1L4YA 3A6ZA 5KOIA 5JMOA 4LQLA 1ORWA 5EMHA 3AKZA 4RM2A 5DNCA 4HL6A 1XO1A 5B4UA 4ID3A 2J3IA 4ECEA 1LNQA 4C04A 3QXSA 4RLSA 4FNAA 3GB9A 5HK9A 3SX0A 4MW0A 3U5TA 2FM4A 3HYCA 1H6AA 4FOLA 4FSXA 2V8OA 3O3CA 4DCVA 3R9XB 4NU0A 1YD7A 4BO5A 4PZPA 3C3AA 3F9IA 2ZTVA 2RGBA 4KTTE 1N4AA 5KWEA 5HG0A 1KAOA 3HBNA 3A11A 3WFIA 4KUGA 2JIQA 2ZT8A 1V8BA 3HUTA 2ATVA 3O47A 4R2JA 4D56A 221PA 4YRGA 1MA3A 1OIXA 2ZQZA 4FOTA 4PCLA 5BNTA 3EZ2A 2G6TA 4RMGA 1L7DA 4LTNA 2OQVA 1MH9A 3LKZA 1R50A 4KAAA 4DSOA 5EJ7A 4GH5A 4RL6A 4ER0A 2BEUB 2BWJA 5FX2A 9ATCA 1I6LA 4PCUA 3EVFA 3OM9A 4D99A 3CX8A 4ND6A 3WK9A 1AHPA 3S81A 1SHLA 3BSFA 2XYVA 1Z7EA 1JR3A 3G2IA 2XCIA 4WPGA 3WGLA 5F23A 2OZLA 3UBTA 1KEUA 5ITZB 1CZUA 2QVZX 2BW0A 2E6UX 3P0EA 4BDTA 2BBWA 2XEXA 3COPA 1XZAA 4XFKA 5A7HA 3E0XA 2HPHA 4B8YA 3FPJA 4X61A 3GQBB 2YJVA 4LXQA 3N8GA 3A6JA 2VNIA 1PDOA 5LIPA 2GTHA 3R3JA 3I8XA 3IAHA 4DRXA 4RK1A 4P0QB 5SY6A 4F4JA 5CURA 3W8NA 1O5IA 5EINA 4GEKA 5AVVA 2B1RA 2UYOA 3OKAA 4LSZA 4ETMA 3PJFA 4W63A 1U7XA 5L9AA 4C4SA 3R8XA 2QJTA 3SBEA 1VCNA 4EG7A 2RHCA 3E58A 3MCZA 1ZH4A 2IA5A 4EHDA 4IDCA 3GA7A 2HI0A 4UHEA 1RC8A 3ZDCA 2QTWB 4EY7A 3HXQA 3MJVA 2GXQA 2V58A 1YMUA 5DT2A 4LOIA 2H4HA 1SEPA 2ZYGA 3D6JA 2DBZA 2OZLB 3QGMA 1U4OA 2HRQA 2JVIA 3JWGA 4IDOA 2GS9A 1G8SA 5CT4A 4FWTA 1VMEA 3R9IA 5H9VA 1WD7A 5EAIA 1AF7A 4RWZA 3ZTYA 3QVGA 1ZD8A 5CHYA 3H5NA 1KDPA 5L3RA 1AZLA 1OAOC 4HB3A 1HNNA 1Y48E 4BFSA 4B6QA 4BRZA 2VLBA 2JEYA 2QAGC 1BFUA 1HT0A 4NJOA 1DAGA 1WY7A 2BDEA 3RSFA 2C29D 3DPSA 2OUKA 5C8ZA 2AK3A 3MWFA 4LZAA 2QE7D 3EEFA 1SG6A 4GEGA 4N5LA 1GQYA 4DRXB 3I61A 4JNCA 4MR8A 3N8KA 4NH4A 2Q3LA 2YIJA 4GQBA 4BVBA 1OC4A 1Y9JA 4GVLA 3NJ4A 5JXIA 5KJCA 3O8CA 2W2LA 1TVEA 2HA2A 3QVOA 1M0TA 2EARA 2QLTA 4XYBA 3ZE6A 2DWPA 2GMWA 1V71A 2WSSD 1ODTC 1P80A 1MJNA 3WGOA 3AF0A 2GCOA 3QU7A 3WZLA 4Z7NB 1YASA 2XUZA 1TMKA 2V8BA 2ZVPX 3EZ9A 4TV8A 2QRGA 5KSYA 4J9VA 2RD2A 4BECA 5HQ3B 3L7LA 4C0HA 1B16A 3G1TA 1UZLA 3C5VA 3NNNA 3QOXA 4HQRA 4J9UE 1FJ2A 4D9KA 3WYDA 4D02A 4RU1A 4BQNA 3V7FA 2GZ2A 4P6VF 1YE3A 4CM5A 1TT7A 4NCXA 1YULA 3QVGB 1EINA 4N76A 4KZKA 4DCUA 1BOFA 4LHWA 1ZM2A 2DKNA 1EX6A 2NO7A 4OXYA 4UW9A 5BSRA 4CLOB 2GPTA 3A9VA 2CJWB 4HYQA 1JDZA 1YQTA 1I4OA 2NO6A 4XUDA 1V5WA 1XX6A 2YQ4A 4PG7A 3CCFA 2RI1A 4F72A 1VHWA 1SOUA 1EIZA 4MR8B 1CUDA 4Q3CA 1R88A 3UB4A 3F6SA 2E7ZA 3CZAA 3K3PA 4HS9A 4MCIA 2HLNA 5DYNA 4LJRA 4Q1DA 1ZA1A 3LE8A 4QHTA 1CB7A 5DLEA 1V1RA 3N0TA 1ZZEA 5J2TB 3FPGA 1UBRS 3HCRA 3W4KA 3UWDA 4A1OA 1Q1GA 3GUHA 3ONDA 4MV5A 2NP6A 3NAZA 2JJYA 1DBIA 1O0CA 2OXCA 2GCOB 3DQQA 2DHDA 1LUAA 3EZNA 2J67A 2Z09A 4UBNA 2ZUCA 4A5OA 2TMGA 3HDGA 4DLXA 2HTFA 3QVWA 1ZD1A 2ANBA 1VBKA 4QNMA 3N6VA 4YYEA 1HNZB 1JXAA 3IVRA 3KSMA 5E9QA 3TR5A 3KETA 4UOQA 4HEA1 2AKEA 4LRXA 1FP1D 1UT5A 1XDBA 2VZEA 3PNMA 1O96A 1U2QA 2VJBA 4PY2A 1TLLA 1MJGM 4XYEA 1RQGA 4Q18A 3UMGA 4KQKA 3OFSA 1EG2A 2Q3FA 5B36A 4E7PA 2QW1A 1VLHA 5INTA 3UJBA 4BTVA 1T2EA 1IG0A 4QBGB 1EVZA 1IHDA 2F00A 4YP9A 5K3EA 5A2GA 1IY0A 2VK2A 4MP8A 3OUTA 4DDVA 3I2YX 1CDZA 1V1RB 1QK5A 2A9QA 4UD6A 3R2JA 1EK2A 3KYJB 3DMHA 3G9TA 1GCIA 3GJ4A 4H3HB 4MCPA 5TARA 2C7GA 1ENZA 3NX4A 4CJXA 4CV0A 5L4NA 4IYJA 5IK2A 1D07A 3WXBA 5BQ3A 1XYGA 1QHSA 1SRQA 3HDVA 2NUBA 4QUGA 3VTAA 5CYFA 5SZHB 5IJZA 2HX1A 2NM0A 2FX2A 1N8SA 3AONB 4KLAA 2WIGA 4RKFA 3WLOA 2A9RA 2W6MA 3O38A 3WGYA 1VRWA 5BMOA 1N34B 4MQ5A 3VA7A 5KWJA 1KGDA 1JWAB 3DEYX 1O96B 4ZYYA 2CLCX 3CNLA 4TXLA 4G5HA 3EQ9A 4WX2B 3RO7A 3VJKA 1MHPA 1U31A 3EE6A 3U5ZB 1YB2A 2AFRA 2YHUA 1NZFA 2WUEA 3PFIA 2P0EA 4GXQA 3OU7A 3HM9A 5D86A 5FOUA 3LQQA 4NV0A 1X0VA 4KXVA 3TW0A 1OD6A 1DT3A 1E2HA 3A1EA 3WYEA 1NVVQ 3FWKA 3WIUA 3N7UA 2FJPA 1UF9A 2AJLI 2P9JA 3WJ1A 5L4SA 3A4MA 1C2YA 2OB1A 3W4JA 2YJTA 2Q28A 4M8NE 1M5TA 3M6AA 5GZ6A 1GEGA 2XWBF 3RFFA 1NG9A 5DFAA 1OTHA 3LF1A 5DNDA 3ZVLA 1JECA 3KKKA 5IHXA 3OQ6A 1N8TA 5IF3A 3AB3A 5HM6A 4WBXC 4L9SA 5I3ZA 1NMZA 5EIBC 4Z49A 5HR5A 1J2UA 4PSAA 1P45A 5LBTA 3D0KA 1ZGJA 1RM3A 2AC2A 4DCSA 3GMDA 3PICA 1NN5A 1P0MA 2X0RA 1G5PA 2SKCA 1AUOA 3Q15C 1XA3A 1OFGA 2C59A 4YASA 4I4LA 4UVGA 4QEZA 1W2GA 1T8YA 3ADDA 4C9EA 2FWRA 4QUJA 2A5FA 2HMAA 2COEA 3EMDA 4GI5A 4JN6B 4PR3A 1E3IA 3B1KA 3TS1A 1VIAA 3QV1A 5AR1A 3I4LA 1EE9A 2DR3A 2ZVJA 2I6TA 2C9CA 4FONA 4PS1A 3L4BC 2XB2A 2CBZA 3CUWA 2D06A 3G8AA 5DPMA 4QLAA 1WSAA 4QYIA 4C7JA 4TTSA 2PGLA 4RVDA 4WK4B 1JXMA 4FYMA 1N2EA 1YHYA 3EC1A 3D7NA 5EPOA 1SJ9A 4BNWA 3Q1KA 1TJYA 3ON5A 1DX4A 4MZXA 1U1IA 3SX2A 4LGCA 3IVCA 1KJ9A 4GLBA 2DHCA 3H5VA 2ZAMA 5D87A 3ER8A 1EHIA 3FUUA 4RKWA 2PZBA 1GDDA 2ZYVX 4UFPA 3D3KA 3E9DA 1V3TA 3LHKA 4URXR 1DQSA 1BX0A 4FHEA 5BV0A 3UJ9A 1E1QA 2OQIA 4KJXA 3FROA 3BHMA 3TNYA 1MABA 4D6PA 1DU4A 2R7MA 3A4TA 4G0ZA 3V5NA 2IIQA 1WCYA 1SKYB 4ZZ2A 4A8JC 5LP6A 2NUPA 1I3LA 1D6MA 1X1AA 3GXOA 5CW1A 1H94A 4E5NA 1BOOA 2R79A 2Z5LA 3AYXB 4NV1A 4RK4A 4J6FA 2G0TA 4G41A 4HB2A 4Q3EA 1XCJA 2GRJA 5JS6A 1E9EA 1YI1A 1VE7A 2DFTA 3T7KA 2SICE 3T1HB 4J16A 1UC4B 2ORWA 1R5JA 3FPCA 2O1XA 2CKMA 2X0JA 5E6UA 1C3XA 5JAHA 1KJYA 3P1JA 1NBIA 1MR3F 4QYIB 5DMXA 3U7GA 1DQPA 5B3KA 5I7RA 2R47A 3CX6A 3VO2A 2BSAA 3U9TA 1HFWA 3MWGA 4WH0A 2MWMA 4PYMA 4LWZA 4RTJA 1Z26A 4EFLA 2NT3A 4POAA 3RVKA 1HGXA 1M8GA 1QO7A 4RVFA 1DKPA 2QQFA 3A3NA 3LBHA 2PLAA 2IS1A 2PMCA 2KM1A 2D1FA 4K26A 5CT5A 5BRAA 2AG8A 1R37A 1I3OA 1LFAA 2AN4A 2RAPA 3BDIA 2QTVB 1F8UA 4AG3A 3B1JA 5LP6B 4V0LA 2DFNA 2AMFA 2Z5FA 1UBEA 2ZM6B 3G5LA 2YYYA 2Z2YA 1ETHA 3NFRA 1JR3D 3DCNA 1L1FA 1P29A 4O29A 3DYBA 3KZNA 1P8JA 3ZHYA 2B4KA 2DLCX 1XZGA 1A4IA 1BIFA 1Q0ZA 1XROA 2HM7A 3RVJA 5EE0A 5JAPA 2CMHA 1SUSA 2EL9A 4GGMX 1UJBA 4LZZA 5SYMA 3WV4A 4BRWA 3DAPA 1RWPA 2GPYA 5E6UB 2ZWPA 4GZLA 2HT1A 1ZVQA 2OY0A 4AUMA 3JWHA 1L0BA 1JT2A 3MS7A 5SZKB 3OJLA 1EFHA 4ZWNA 5T4HA 2EV9A 4NDAA 1PE0A 3A9RA 3C97A 3JQGA 4K6GA 1XRLA 3DEHA 4Q4LA 2Z30A 4UDOA 5K3AA 4A6XA 2WWVD 3DTVA 1CTQA 2AC7A 5CDGA 4V0KA 5IDQA 1ZR4A 2QTZA 5I5GA 3SJEA 4TTIA 3IO3A 3M1AA 4LYHA 4LV8B 1OWMA 4KK4A 3IBYA 4WBNA 4Q9AA 1I1QB 1SG9A 2GDZA 3L06A 2B1IA 1WXGA 3G2HA 4BZWA 4E5YA 3I2JA 1ZCAA 2JFFA 4MX8A 1O95D 1KXJA 4QWMA 4EAQA 2ON6A 4HUTA 1XWWA 4B48A 4NVRA 2X4IA 3IELA 3BZBA 5JBQA 1HUQA 2MYNA 3QFHA 4INJA 3S5JA 5IU6A 3QPCA 3T1VA 2HJRA 4PPGA 2PBZA 2NV6A 1C8KA 2O2EA 3LPDA 2CNLA 3JQBA 2Y4NA 2BCEA 5DU2A 1S89A 3EG5A 2FPGA 3I62A 5JAMA 2XZPA 2R4TA 3O03A 2C2WA 1ZGAA 1L9KA 3ZE1B 3FTPA 4QYWA 1C7RA 3TLCA 1M7HA 1VHLA 5EIAA 1FTQA 4Q1FA 4REMA 5ICCA 1ZQ9A 3LKBA 4EZBA 4L72A 3JQGB 2BM9A 5K6RA 5KYXB 3ZNNA 1U2DC 3KQOA 3OC0A 4E3ZA 3IMCA 2XUQA 2W2LD 3DTVB 4I8IA 2ECQA 4LJ6A 1KQPA 1Q5PA 2QV0A 1ZLYA 1RHJA 4OQYA 1X8KA 4RPCA 1R16A 3ZQUA 2EX0A 1C7FA 2DUNA 2H1VA 3COSA 4E2YA 5JC8A 2G40A 4UXIA 1P0FA 4MRNA 2P35A 2R44A 3GC6A 3DE0X 3R5JA 2W6PA 2ORVA 3FZEA 3MTAA 4MUIA 2X3FA 2P6NA 1VJ1A 1SA0A 3QBTA 4FMCB 2IDMA 3QEOA 4DXDA 5JEEA 2QX7A 2WHQA 1MB2A 4CCWA 1ZOSA 3A14A 3B13B 4G5YA 3V7YA 4F3NA 1UQTA 1THMA 1XRQA 1MGPA 1U2ZA 1G8JA 2B34A 2PA3A 1QUFA 2WJ4A 4R40A 5DLDA 4PZLA 2OYSA 1ZMRA 1XRPA 2VR1A 3AZPA 2AJBA 3TX2A 4CHGA 4EARA 5CDTA 5TVGA 1I94B 2CMFA 3B70A 4KWHA 2FPGB 2D5IA 4XSHA 3STHA 4NK4A 1VYVA 3O75A 2Q5EA 3MXOA 4RHXA 5LLDA 1TVKA 2O07A 1HE1C 1Z6XA 2DUJA 1LEHA 4GLFA 5BNWA 1THZA 4C01A 1SZJG 1VLQA 4LA4A 4EOGA 5HFNA 5J2UA 5FL7D 4Y8VA 2IHTA 2LDBA 5FD8A 1T3HA 1PWHA 3CEJA 1MX1A 4PSUA 3WLLA 3OTGA 4LMRA 3VR5D 2B1GA 2ACVA 5K8CA 4GO1A 3AY3A 2RG7A 3NBMA 2YHIA 3Q8XB 5JXGA 5FTWA 5LKRA 3SQWA 1PV4A 1YZQA 1KQ3A 1OIWA 3OD5A 4RY8A 5LDHA 4GZ5A 4RDCA 3BUSA 5BR4A 1NQAO 5L95A 4Y18A 3EASA 5F64A 4Y0NA 1XPOA 3UGJA 2XUKA 5KYWB 1E3MA 1B2RA 3FHOA 2AR7A 4LF8B 2NZXA 1QK3A 2KS6A 4L74A 3DL4A 3AVVA 3WGTA 1LPPA 1K06A 2P5UA 3NYRA 3R8FA 4TMXA 4DREA 4QFCA 2WTNA 3KIPA 3FSEA 2H5LA 1SOAA 3MWJA 4JNKA 4IJKA 4F2DA 1SUIA 4MW6A 4Q19A 5EHGA 2YFQA 3MAJA 2HA5A 3K5HA 1TVKB 2BMVA 4HYYA 4TGLA 5DF1A 4Z9YA 4C2UA 2GSWA 4I8XA 2WYWA 5E2BA 2FYTA 1ZD2P 1OLOA 5DTEA 4PO9A 5EIWA 1PZGA 3SJFA 2PSJA 1TM2A 5J2UB 3MJHA 4J3NA 4XXHA 2IEIA 4C76A 3OJCA 1Z25A 2NMVA 3L2OB 2C82A 3BERA 3CMCO 3ZKAA 3LQKA 5B12A 4B76A 1X7WA 3FNGA 4UHDA 1P1JA 4DGQA 4JENA 5C5EA 3CUKA 1G2OA 4R31A 1KWKA 4DV2B 2YHIB 2H7CA 3CPEA 4HDOB 1JALA 1J49A 2PZGA 1TM1E 3FBGA 3WRXC 5M2QA 5GM2A 4PIVA 4P92A 4MP3A 1EH5A 3ICWA 2VT6A 4NMXB 3VOAA 1KI1A 3RVQA 4AYXA 2YW2A 1I5RA 1B6SA 2ZIAA 1LK5A 3KQMA 2OLJA 3RFVA 4RWEA 3SSOA 1POXA 1TM7E 2CNNA 3A1FA 4MRAA 1YA4A 1FSZA 2YJ6A 1UOOA 1Z0IA 3IA2A 3WLMA 2D0PA 3LGSA 3WYCA 3S1LA 3WB9A 1ZOPA 3AHFA 2CEAA 4RPJA 5BUZA 4EGJA 1GQSA 4HAVA 4R8KA 1N8KA 1VKZA 3HEAA 5KAMA 1GGEA 1J22A 1Q1BA 1HR0B 3FPSA 1FYEA 3EQ8A 1VOTA 2PAFA 3KC2A 2J0SA 1Z2NX 1E7WA 1SXJA 3DMPA 3NOJA 1U5BB 3ESRA 1PO7A 1TW3A 2PRKA 4HWTA 5REQA 3H8VA 4B83A 1U8XX 3PXXA 3BYZA 2ERCA 1IHPA 3LH5A 1C0IA 4FC7A 1S8FA 3KJQA 4KQEA 4G8CA 1VMKA 5J9FA 1X7WB 2PL9A 5AJXA 3L6RA 1FTSA 2QM7A 3Q7IA 3U49A 4CQJA 1LVGA 3NHUA 2F7SA 2C77A 3A2MA 1KJJA 1V0JA 4FFVA 3E5HA 3HU5A 2BGTA 3PXDA 4I6EA 1JEDA 2Z3VA 4M0CA 4M0KA 1JHDA 4H3KB 4MV0A 1NV9A 4JI7B 4QU9A 1Y8RA 1VKJA 4WJLA 2QQGA 1FZTA 4QUIA 1PTKA 2LCFA 3Q88A 2PT9A 1RWNA 4TWAA 5DV9A 3UK1A 1JVSA 5HE8A 1JL3A 2C1ZA 1I0IA 5EJ6A 5JROA 4GNKA 1U04A 2FSPA 1U94A 2XITA 4R05A 4ETWA 4G4IA 2HHHB 3DB1A 3GUCA 4FOSA 5C51B 4UFOA 3JTEA 4WNIA 4DM4A 3IPXA 4LF7B 3JQFC 4N01A 4WNAB 4G09A 1KFBB 2DT5A 4H4DA 1QTNA 4ND3A 1Z5PA 3DDHA 2EQBA 1J1IA 2YWRA 3T7CA 3RHFA 2OCBA 5IM4A 4N7RA 3IFSA 2Q99A 1SIOA 4IX9A 2XYHA 1SXJB 1ZOIA 1P5ZB 4CIXA 4Y2XA 3PEWA 5REQB 1V5FA 1M2JA 3GDGA 1E2UA 3GFRA 3K15A 3KXPA 3Q87B 1JP7A 1FSGA 4GECA 1L7XA 4I46A 1H2BA 3W3AD 1EB8A 2R60A 2CNKA 2EKZA 1QAOA 2ZOSA 3DUWA 4EPWA 1YR7A 2ZUDA 1E2BA 3GDHA 1IY1A 1YDWA 3NBZC 2FWPA 1EK1A 1ZM7A 2HF7A 2WAAA 1EDEA 4O2AF 3SJCA 4IY1A 3H1FA 1JILA 1P3Y1 3GLFE 4NGQA 2BZ1A 3IHLA 4ILEA 4I1UA 1XRNA 2I7XA 3A37A 3AZOA 5IT9A 4DG5A 2IKQA 4JCCA 1BS2A 1L5WA 1ANKA 1BH2A 3A1SA 3H0EA 4QQRA 5T64A 1UOEA 4PG8A 2HWWA 1EWTA 5LWQA 3OFNA 1TPYA 1KSHA 3G89A 3REQB 3LLCA 3OESA 1JHMA 4A26A 2VHQA 2WHPA 2IZ7A 4H7PA 4Q1AA 3LHIA 3VVCA 1ZH2A 2FRXA 2ZU6A 7YASA 1SQ0A 5HPYB 3T41A 5FPQA 1K8RA 2OTCA 3UV6A 2XXAA 3GPBA 3L7AA 3F5MA 4HAWA 4ZOLA 3T5GA 4OEHA 4OQXA 5A5EA 2DPXA 4C0BA 4DWVA 5JZBA 1I51A 1P4GA 1ZCFA 1WBBA 1R6VA 2WT4A 4YAGA 2VP9A 2UXBB 3RWBA 5HX7A 2VHCA 3RUPA 4CKWA 1TC2A 3KTOA 4EIWA 1EVIA 1VPWA 3IESA 5C37A 1GFWA 2JLUA 4Q4AA 3GRCA 1YBMA 1P39A 1GSOA 2BTOA 3BI1A 2HBQA 3QVXA 2P75A 4EG5A 4H6XA 3HEMA 5ECDA 2H2IA 5EHQA 3SEAA 1VPVA 5IZCA 1JB1A 1DV2A 4YPFA 3F6BX 4WVLA 2RG1A 1VTKA 3D2BA 4AQYB 3MBIA 3KLOA 3KBBA 5FOSA 1WNTA 3T95A 1Z29A 4NXNB 4K28A 1GRVA 3A10A 2XUDA 1NUQA 1XZCA 4TWRA 1NJSA 1TB4A 2C04A 2E5WA 4A36A 5AT1A 5A0VA 1CIVA 2C20A 1GDHA 5CITA 1W7AA 3TGPA 3IBFA 1J3LA 3VOBA 3RSHA 4X9XA 4TJVA 3OPXA 2WHPB 2GVZC 2Q4OA 2Y6VA 3WMXA 3D7RA 5H16A 1OZHA 5LYJF 1CIJA 2BFAA 3MJEA 3WKAA 1GAEO 3WJAA 3RV4A 1AQ6A 1V3VA 2FJ0A 1YXMA 2XXAB 4DABA 3SMQA 5JV5A 3R23A 4ZOLB 2FX3A 2OZPA 3AJAA 3RV3A 3NBUA 4IGAA 1L7RA 3KG2A 2R6ZA 2VWGA 4EK9A 3B1XA 4UMFA 4COKA 2GLTA 2FFJA 1BXGA 3ZJUA 3O6VA 3UXMA 3VU0A 3EXG1 3IEKA 2ZJ5A 2HDNB 4Q4AB 1RBYA 5E6RA 9LDBA 3AVTA 5B6PA 1FTYA 3ILXA 5C52B 1UC5B 3HABA 3BGDA 4KNWA 4ACAA 2HOQA 2NZWA 4N7JA 1L5RA 3OWXA 2CCJA 1AK9A 1AB5A 1U65A 3V80A 4LOAA 3L93A 1PJCA 4M7RA 3IL2A 1EZAA 4DDUA 2PH3A 5ICFA 3ZJTA 1IOWA 2CLOB 3ZZMA 3KOOA 4I4IA 1KEKA 2IH2A 2XGJA 4TWBA 1NC1A 4DLBA 1E4OA 1HYEA 1N25A 3RUEA 3SDSA 1IB6A 5BSWA 4GP6A 3ROMA 4LJLA 3JYPA 1WX1A 3KJNA 2D1SA 4HB4A 5G3ZA 4HGYA 3R3XA 5GJWC 1RAHA 3NOVA 4RK7A 5KTPA 3ZIUA 2WJZB 4QXMA 1USGA 3V2HA 2QMOA 4XWKA 4LXHA 4QRDA 5FFNA 3DL0A 5UKDA 3T0GA 2QAJA 5J59A 1U8ZA 4H7IA 3RRZA 2XVXA 3PKIA 2GARA 4C9RA 1W6UA 3BL5A 4PANA 4FYHA 4RADA 4YMTA 2A6PA 3IQDB 4NGRA 3W5JA 2UYCA 3QWFA 3TQHA 1AJEA 5E6RB 3EXFB 2R8XA 4JDPA 5BUCA 3NALA 3FRJA 5JYCA 5LXTA 3Q72A 5ANRB 1W0KA 2UV8A 1GZSA 1ZAKA 4FIDA 4NU8X 4XGKA 5LOVA 3MTIA 1IJEA 3PFNA 3WS7A 4UMEA 2UXDB 2XUOA 1EXWA 3WL7A 3HXTA 4HXYA 3THWA 3OZDA 1KO5A 2GPAA 2E3JA 2WA1A 2WDZA 3AR8A 3TDKA 2O5EA 2R2AA 4RS4A 2HJSA 3H8JA 5AI5A 4GE0A 3T38A 3N58A 4YUZA 2OWEA 1NP6A 2MMCA 3TUJC 2BFPA 4DDTA 3MBKA 1L5FA 3ROKA 4RDXA 2ETVA 4FR2A 5DGCA 2DQYA 2GFQA 4PYNA 5GJVC 1IOZA 5ALPA 5EWMA 5L4LA 3PLNA 1E8MA 2RAUA 4DANA 1BHSA 3BE5A 4DMLA 1LSJA 3L1UA 3W79A 1D0IA 1JVBA 2WHYA 3IB3A 4FFPA 3JQEA 5KQPA 3RB8A 3ERCA 3T7JA 1JG7A 3ORYA 2IXTA 2I8AA 3PXUA 3UYKA 1FUEA 3JYOA 1KYYA 2PKRA 1RRPA 1DKRA 1KI7A 3B3JA 4OHYA 3X1ZA 4QXQA 3DPUA 5CDFE 4TXMA 2BGIA 1H3NA 3CGWA 3F2VA 2W42A 4CDKA 1GSHA 2XZLA 5IJWA 1S5PA 1TK2A 2X1MA 3P9NA 4MKRA 3DVSX 3IMFA 2WRZA 4ESHA 5IMBA 1PT9A 2CZGA 3LSTA 4ZV9A 3THWB 5LD2B 1O6FA 1ESEA 2BGKA 5AK6A 4Z0HO 4WLUA 1M7BA 2HC9A 1V2GA 3BK1A 1G4HA 4UBKA 4Z0NA 1EXMA 1WG8A 2Q7OE 1NMQA 1KYWA 3H5IA 1AUVA 1R4NA 4KODA 2B5VA 2QUJA 2YZ7A 3LVQE 5DW0A 3D7FA 4BAUA 3RU3A 2AK2A 2IWRA 3LQYA 2ZRAA 4BE9A 1L5VA 1QV9A 3UGQA 4FLFA 4E22A 5EWMB 1D2EA 2O1EA 5KDOA 4DA6A 2C2KA 2Z5VA 3USCS 3JSAA 5JCXA 4JBWA 5P8WA 5B1YA 2PUVA 3FUVA 1XLWA 1LX6A 4NPHA 1ZUNA 4MS1A 2WF5A 1O6CA 1Q17A 1NBWA 3EWSA 3L8EA 1A2OA 3CLUD 3NYIA 1VYUA 1T5SA 2A5DA 2V3WA 4C8AA 4UZSA 3MK31 3X44A 3HY6A 3UM9A 5BWCA 5K0GA 3FWNA 4ZO7A 1PVDA 3L7IA 5IAOA 2J0UB 1W96A 2PUJA 1KC1A 4C86A 1XCMA 1YZNA 4AROA 1SCAA 1IBKB 4B75A 3I01A 5T67A 4B0PA 2FXIA 3AI2A 1U7HA 3SZMA 1R7RA 4RF3A 1L7QA 3V1TC 2MSNA 3ILHA 4EGFA 3WP0A 2GESA 3NMUF 2QN1A 3OF2A 5I8ZA 4BMSA 5B58C 4PO8A 5B5SA 4LFAB 2A88A 2D2EA 1NIPA 2AFIE 4NPAA 4G07A 4ZYZA 1UBUS 3TMYA 5HKOA 1VL2A 1D7AA 1MVLA 1R4NB 2Q0XA 4HAYA 3RUAA 2X5XA 5ECWA 2Q5IA 3HUEA 4TL7A 5GONA 3JD3A 3WP1B 1AQJA 2AZXA 1RXIA 1N1MA 4NR0A 2M6KA 3SC2A 5CAEA 3U3JA 3HSSA 1Q0SA 3F4LA 3B1ZA 4NBUA 1NFFA 4TOIA 4IV0A 2X86A 2O7SA 3EDRA 1UCFA 1BE1A 5KUTA 1C4OA 4K9QA 5A04A 4GMKA 4RZIA 1NP3A 1NXSA 3M5DA 2WTUA 1GR1A 3F67A 3IT1A 4M8LA 4MS1B 4F21A 1NBWB 4HF7A 1B2LA 1CF2O 1F3LA 1NBAA 4HMQA 1VI5A 1Q6ZA 1Z7WA 1J33A 4J2HA 1Q1ZA 5KS2A 1G9XA 1CC1S 2DBYA 2ADMA 3IR6A 3IAAA 3R3WA 5ALGA 3AEXA 5MFZA 3VKHA 5CYOA 1W4LA 1B8NA 2HLDA 1TEXA 3M34A 1ECCA 3C3XA 5C8DA 2HCFA 2HNKA 3S29A 1RKBA 2B25A 4LHSA 3ZCQA 2FPSA 4E1VA 3W6NA 3N9IA 1SCUA 4X63A 3LDFA 3LBAA 3DEIA 3U09A 1OHHD 2R66A 2XNKA 5BV2P 3EJWA 5T3UA 4HGOA 2PRZA 1XZPA 2GBCA 4JL8A 4MWOA 5DW3A 1WUJS 2R87A 3L4EA 4J0FA 1GCUA 1M0SA 2D54A 2Y1XA 3DD5A 1AGXA 3RS0A 3WRXA 4Y2JA 1LTHR 1RW4A 4C7OA 2WFLA 2G5TA 2RB4A 5GONB 5AVQA 4ZFNA 1SULA 3EOZA 2AG5A 4I4CA 3OEHD 1FQKA 2V65A 3QI7A 5FPHA 3SC2B 4EB0A 3ZE7A 4IBOA 1KR2A 2D5LA 3BJRA 4XM0A 2CZCA 3RGWS 3WADA 2H4JA 3PNKA 3DT8A 3HBJA 3ROXA 4YRJA 1H8ED 1KMMA 2C5GA 4EDHA 2A2ZA 3ZWOA 4PPNA 4LXUA 1P7WA 2PN1A 3VAZA 4AMUA 4Y67A 1Y3HA 3R3YA 4NU6A 3EXEA 3U44A 4F8EA 3ETNA 2IYNA 3G6WA 2Z58A 4NMMA 3F90A 5CLQA 2PL1A 4A82A 1C7QA 4OX9B 4HZUB 3FY4A 1G64A 4R1OA 4B9AA 3GUYA 3LP6A 1EVJA 2IIBA 3X0DA 4WKNA 2AYYA 3H84A 3W2HA 1R18A 2BMAA 1SCUB 1XCLA 2WNHA 2P9HA 4KKXB 2C2YA 2VDQB 3UAXA 2QRQA 1PNQA 4A4DA 1JHAA 1P1RA 3JRNA 3KFLA 2A84A 4LQ4A 4YP1A 1FDVA 1R8SA 1GCAA 2C95A 3A9UA 4KOAA 5B1EA 2EIXA 5JXHA 1RKUA 3O8BA 4FP9A 5AICA 5AXAA 2WFLB 1FYXA 1UBNA 4E88A 2ONKA 4C7OB 4CM7A 1HRKA 3NOXA 1P2GA 1QYIA 2QUAA 1Y9DA 2Q9AA 1W88A 3PNVA 4KUHA 3R09A 1OXVA 1JHPA 2CNWA 4LG1A 2WV7A 2RBGA 3MCAA 4K0KB 1A72A 1BXZA 3RSZA 1DCFA 4RESA 2FPOA 1ZWLA 1BDJA 2B78A 1YDMA 5EXPA 4CZ1A 4MGHA 3EZFA 3OFND 4AMVA 3I9KA 2DH5A 5KKAA 4Z4GA 2YRXA 3P52A 3DOIA 2VSYA 3ICVA 1IHYA 4QASA 1DO8A 3JRWA 2Q4RA 3EXEB 2OP1A 1D5WA 2YQZA 3ANXA 3G2MA 4IJVA 3W9UA 1E64A 3UMMA 3LYAA 2JGKA 1VMAA 1Z47A 4GDMA 3OQVA 2ZYRA 2NUTA 2KHZA 3SY8A 1IN5A 4FE4A 2PCNA 4DR3B 1TLFA 2RBKA 2FUNB 4BRUA 2C7BA 2ZWAA 4ALJA 2BCGY 4E5DA 4Q9LA 3FHLA 2E37A 2VIIA 1E3SA 2VNJA 1PFUA 2FPLA 3DE3X 5ALDA 4Z9XA 3WYAA 5BP7A 3C3CA 4UNNA 2OBXA 3FYCA 4NYMR 2QQ5A 2B20A 3H2HA 1SXIA 2OLKA 2PCLA 4XIGS 3KSRA 1E62A 1XU9A 2NYRA 5JD3A 4OHXA 3U0VA 5EUBA 3VO1A 3I3SR 4KJZA 1CZLA 3PUJA 3BRWA 4MUGA 4ZREA 3V8RA 4F60A 2GN0A 1W88B 4D41A 3GLSA 3V1LA 1F4VA 4EW6A 3SHOA 4ZYVA 5J4VA 1YI0A 4TYWA 3OLVA 1Y4AE 1JSXA 1L4GA 1HA3A 1D5CA 2YXPX 3BDVA 4OBEA 5BVGA 4Z3OA 4P33A 2R65A 3H5LA 1P2UA 2R1UA 3AHIA 4IG4A 4KYVA 2FZWA 4CTJA 4P5PA 2NZ8A 4QJ4A 1PJZA 4ZCSA 4G8BA 4X41A 3CXRA 1KBZA 4C9UA 2OP0A 4LHEA 1K6EA 4HBGA 1EFDN 9ABPA 5AVYA 3AB8A 1KNXA 2IGBA 2P9FA 3FMGA 2NUTB 4Q3LA 4NCJA 1EKXA 1SGWA 1IY9A 1JIKA 1YT5A 2WZQA 1JPJA 2XIJA 3FJ1A 3H9UA 2ZE7A 3HHPA 1FSFA 4XEUA 4LJAA 3BMNA 3NM5A 5TGTA 2FEPA 2QRLA 5CA1A 1CK4A 1EP3B 2JJMA 4V02A 4HVAA 2BFWA 4Y1FA 3ZNQA 1PFYA 1K7CA 4JLWA 4Z1OA 4UHCA 5FULA 2D7CA 4Y1RA 3KJZA 2FZ5A 3SYRA 2IYPA 1JJFA 3PKZA 3KTFA 2QLFA 3IR5A 2E4VA 2IOHA 2DTEA 3COWA 3MC1A 4HMPA 1EB9A 1LRKA 1VKNA 1FPMA 4I9FA 4LQCA 1L5LA 2ZRJA 3BMCA 2IGTA 4OQEA 2BPOA 1O77A 2ZWOA 2EW1A 1NRIA 2Q4BA 3FDFA 1WTCA 4OHOA 2Z43A 3MEQA 1XU7A 1Y4DE 2X0EA 2GKGA 1DAKA 3TD2A 1QBGA 4B3BA 2V9ZA 5B64A 4ZOEA 4Y2RA 3P8ZA 3UBMA 2OFFA 3ZBQA 4BC1A 1B0AA 3FZYA 4AS1A 5AHKA 4AP6A 1EPUA 1KVSA 4H77A 4TUYA 5BVGB 1J23A 1SH7A 2VDVE 3DMYA 4PQEA 1BYIA 1QGDA 1TEHA 3A1TA 3PI7A 3EZYA 4N3NA 2CFOA 5SZJA 4BQEA 3CV3A 4HEQA 1GUZA 2HT6A 1N3YA 1DWOA 3VC3A 3BN3A 4RTQA 4C08A 5IXJA 4C84A 4JQCA 3OMXA 3VJLA 2IHBA 3TEMA 1U98A 2F1RA 3U48A 1HDOA 3WTCA 1CJCA 2BHRA 2ID9A 5CA1B 2ZSUA 2IHJA 3BMNB 2ZYIA 3IVGA 1YZVA 1LDEA 1LSOA 1YAHA 3I2HA 5JNLA 1PZXA 2W2QA 4LSMA 1M33A 1P3DA 4Y1RB 2FN4A 1CE8A 2FEKA 1FX0A 4RH0A 2J09A 2PVWA 5DBGA 3N3BC 4M55A 4FFRA 2EWWA 5K0NA 3K4QA 3K1JA 2BMJA 1CU1A 2C5EA 3L8FA 5CT9A 5AHXA 5GGYA 3RUIA 4AY6A 1FS4A 3ZOKA 4AS3A 1VP3A 4DMFA 2FWMX 2IX3A 3TH5A 4FFWA 5E8JA 1J5PA 1HETA 3CVWA 1EGMB 3K2BA 3QZUA 1EA5A 2C1EA 2Q1XA 1ZUD1 2PSSA 1PT5A 4NSNA 1J99A 1N7IA 3UYLA 5GWXA 4O08A 3HU1A 1KPHA 4B40A 3E8XA 2EFCB 3IOBA 3OZ7A 3KB2A 2CF5A 1R6XA 3G9XA 1GGNA 2X9VA 2JDIA 1S6YA 4LYEA 2D1QA 2FEAA 2J08A 2NTYC 2PG3A 2YHSA 2XWSA 1U6JA 3R76A 5DP2A 3NH6A 3R8CA 1FU4A 4C5BA 3U3MA 2HMTA 4ND8A 4Y3UA 2JCXA 3W5BA 1JHRA 2XTZA 3CY6A 4JJZA 3IIIA 3W5UA 1TU3A 2CD9A 3CKLA 4ZO8A 2I9KA 3EXG2 1F8XA 1CE8B 1FX0B 4E4RA 1UPXA 1NQXA 1KK0A 2I8LA 5J4YA 4Y1GA 4ARBA 3AY7A 2QRZA 1LVUA 1OI4A 1NI4B 1L6IA 2IYUA 2WB2A 1R0SA 1RFGE 3IXLA 4GPIB 2J41A 1DXQA 4RANA 2WJVA 3D6AA 3TGWA 2VDWA 3A3OA 3OF3A 1A2KC 2HIAA 2REXB 2RJOA 4EHHA 4L8LA 5ES3A 1Q95A 4ENUA 1QGAA 5A9RA 2F62A 3ROGA 2VPXA 3PF8A 4H0FA 3NP9A 1AOXA 4BQRA 3OECA 3WXMA 5A03A 3VH3A 3ECAA 1HG1A 3H16A 4M3NA 2ZZMA 1JJ7A 3NHJA 1OREA 2XXBA 4OQQA 1RJWA 4Y0VA 1NXWA 1O5TA 1T13A 3ECSA 4X65B 2FOXA 4AJKA 3N2GA 5CLJA 1UM8A 1QVVA 5AYVA 4ND8B 5HIAA 3UMYA 4RJJA 1AM4D 1OA1A 3H2IA 1SBNE 4FMDF 4F45A 1H4TA 4KQIA 3ZXUB 5HWSA 1EX7A 3ANLA 3GGGA 1QF7A 2GZDA 1ZR2A 4JI8B 4G8JA 2BGGA 3T7SA 1BC5A 3PV0A 1ZBQA 1WZUA 4RX1A 5JDIC 1BDHA 3R0JA 1W5FA 3CBGA 1L7VC 5BYKA 1Q21A 5DSXA 3QMMA 4Z6KA 2UZ1B 4U8GA 3LL4A 2HA3A 4ZHQF 5KNBH 2ZE5A 4GZMA 2VDWB 2LTAA 3BREA 3IODA 1QO0A 3V00A 4CDJA 3G8BA 1OW3B 2P2DA 3FI9A 1IVYA 3OM0A 3SYTA 1HFKA 1QGOA 2V4MA 1E6LA 3I9JA 4RNCA 1JFLA 2AUMA 2D1YA 2OAGA 3DBRA 5TMEA 5MDHA 3L18A 1L4EA 4BEWA 1I5EA 2HWUA 3HJRA 3PHHA 4RE5A 2XDAA 3PWTA 1RHQA 2PBFA 4FSHA 1Y3AA 2W6ZA 3VR3D 1IXSB 1PYGA 2JHCA 3TQFA 2X19A 4IFIA 2ASVA 3DZGA 2QE6A 4Q82A 2X0FA 5CEEA 3ZLUA 3U7RA 3KQKA 3FTFA 3NU1A 2MTBA 2UUAB 4MUXA 3FOZA 2WZBA 1QU2A 1KSJA 121PA 1BRMA 4R4JA 4D74A 5ALIA 1XL0A 3EXIA 1HTWA 3K2QA 2FF7A 2IY9A 1DIHA 4QL3A 1HLPA 4TV8F 3AETA 3DZBA 4QYSA 3HKDA 1RRFA 4UM7A 4URYR 4C8FA 3WIOA 1VE6A 2PD4A 2VJYA 5BMVB 1U9IC 1WVIA 2KJQA 2YR0A 4PPYA 3HJBA 4R9UC 4C29A 4ZAXA 1U63A 1F5NA