4C9VA

Xenopus rnf43 ectodomain in complex with xenopus rspo2 fu1-fu2
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
148
structure length
125
Chain Sequence
VKALIRVTPLNLTLEGLFARVAEISPAEGRLLQFHPLSLCNTKPGFISIVKLETPCLSLANKARLAGERGAHAVLFDITNDRGALQQLQQPAGINQPVVLIWGPDAEKLMDVVNKNKEALVKIEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNF43
publication title Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb
source organism Xenopus (silurana) tropicalis
molecule tags Signaling protein
total genus 29
structure length 125
sequence length 148
ec nomenclature
pdb deposition date 2013-10-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4c9vA00
2OR4A 2XEGA 2PVVA 3SJFA 4C8AA 4OC0A 1V6CA 3I6SA 4C8UA 4OC2A 3IIBA 4MCQA 3D7GA 2XEFA 4MCSA 3BI1A 3BI0A 3KASA 3D7DA 3S9LA 2EK9A 3FF3A 4C8PA 1Z8LA 4YN3A 2JBJA 4X3RA 4JYWA 3SJEA 5D29A 4C99A 4P4BA 3S9NA 5ELYA 1CX8A 3D7HA 3FEEA 4P4EA 2OOTA 2C6PA 3I74A 4LQGA 4C9RA 3S9MA 4NGTA 3BHXA 3BXMA 4NGMA 4TWEA 4NGSA 4C86A 2XEJA 4NGRA 1WVMA 2C6GA 2C6CA 4C9VA 4C8TA 4W9YA 2CIJA 1Y9ZA 3EIFA 4TJVA 4C85A 5IB9A 3IWWA 4C8CA 3FECA 5F09A 2EK8A 4KNGE 4P4IA 4NGNA 4CDJA 4C9AA 1DE4C 3ICUA 4P45A 4NGPA 4MCRA 4C9EA 1XF1A 4C8FA 4C84A 3FEDA 2JBKA 2PVWA 3D7FA 4OC1A 4C9UA 4OC5A 4CDKA 3SJXA 2XEIA 4P4DA 4P44A 4P4JA 4NGQA 3SJGA 4JZ0A 4MCPA 4TJXA 3RBUA 4OMEA 4OC3A 4OC4A 4P4FA 3VTAA
chains in the Genus database with same CATH superfamily
1NXJA 2OR4A 2XEGA 4MJXA 2PVVA 2D0OA 3SJFA 4C8AA 3TLCA 4OC0A 1V6CA 5FD8A 4E94A 3I6SA 4C8UA 1ZYMA 4H1HA 4OC2A 3IIBA 5F5XA 4MCQA 2D0PA 2HI6A 3D7GA 2EZAA 5IR2A 2XEFA 4COGA 3EZEA 4MCSA 3BI1A 3TLGA 3TLYA 3BI0A 3EZAA 1DIKA 3D7DA 3KASA 1VBHA 3SR3A 3T05A 1R61A 3S9LA 2EK9A 3FF3A 1CE8B 4C8PA 1Z8LA 3T07A 4YN3A 2JBJA 1ZL0A 4X3RA 1T36B 4JYWA 3SJEA 5D29A 3TLEA 1VI4A 4C99A 2FM4A 1Q5XA 4P4BA 4E5SA 2E28A 1NBWA 4COBA 3S9NA 5ELYA 1CX8A 3D7HA 3FEEA 4P4EA 2OOTA 1KC7A 2C6PA 4IIXA 3I74A 2AUMA 2C5QA 3NOJA 1EZAA 4LQGA 1KBLA 3U1BA 3KRVA 4C9RA 2PCNA 3S9MA 4NGTA 3BHXA 4CZ1A 2DIKA 3BXMA 4NGMA 4TWEA 4NGSA 4C86A 3EZBA 2XEJA 2OLSA 4NGRA 1WVMA 2C6GA 3GJZA 1JDBC 5JVLA 2C6CA 4C9VA 5F1YA 4C8TA 4W9YA 2CIJA 1Y9ZA 1VBGA 2R82A 3EIFA 4TJVA 4C85A 5IB9A 3IWWA 5JYBA 3G23A 4C8CA 1GGOA 2AUNA 3FECA 1CS0B 3TLBA 2EK8A 5F09A 4KNGE 4P4IA 4NGNA 4CDJA 4C9AA 1DE4C 3ICUA 5F9MA 4P45A 4INJA 1M6VB 4NGPA 3C8OA 4MCRA 1A9XB 1ZRSA 4C9EA 1C3OB 1XF1A 3TLAA 4C8FA 4C84A 1J3LA 2B0AA 3FEDA 2EZBA 2HROA 4IIYA 2JBKA 1BXRB 4M8DA 4CO9A 2PVWA 3TLGB 2GP4A 3T0TA 4EYSA 3D7FA 4OC1A 2YJVA 4C9UA 4OC5A 4CDKA 4J0NA 2YJTA 1KEEB 5K99A 2HWGA 3K9TA 3SJXA 2XEIA 3TLZA 1JDEA 2EZCA 1C30B 4JVOA 3TYXA 4MI1A 4P4DA 4NGQA 4P44A 4P4JA 3SJGA 2X0SA 4JZ0A 4MCPA 4TJXA 3RBUA 4OMEA 4OC3A 3T5MA 1EZBA 4OC4A 4P4FA 3K4IA 3VTAA 2MP0A
chains in the Genus database with same CATH topology
2OR4A 2XEGA 2PVVA 3SJFA 4C8AA 4OC0A 1V6CA 3I6SA 4C8UA 4OC2A 3IIBA 4MCQA 3D7GA 5IR2A 2XEFA 4MCSA 3BI1A 3BI0A 3KASA 3D7DA 3S9LA 2EK9A 3FF3A 4C8PA 1Z8LA 4YN3A 2JBJA 4X3RA 4JYWA 3SJEA 5D29A 4C99A 4P4BA 3S9NA 5ELYA 1CX8A 3D7HA 3FEEA 4P4EA 2OOTA 2C6PA 3I74A 2C5QA 4LQGA 4C9RA 3S9MA 4NGTA 3BHXA 3BXMA 4NGMA 4TWEA 4NGSA 4C86A 2XEJA 4NGRA 1WVMA 2C6GA 2C6CA 4C9VA 4C8TA 4W9YA 2CIJA 1Y9ZA 3EIFA 4TJVA 4C85A 5IB9A 3IWWA 4C8CA 3FECA 5F09A 2EK8A 4KNGE 4P4IA 4NGNA 4CDJA 4C9AA 1DE4C 3ICUA 4P45A 4NGPA 4MCRA 4C9EA 1XF1A 4C8FA 4C84A 3FEDA 2JBKA 2PVWA 2GP4A 3D7FA 4OC1A 4C9UA 4OC5A 4CDKA 3K9TA 3SJXA 2XEIA 4P4DA 4NGQA 4P4JA 4P44A 3SJGA 4JZ0A 4MCPA 4TJXA 3RBUA 4OMEA 4OC3A 4OC4A 4P4FA 3VTAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OR4 A;  2XEG A;  2PVV A;  3SJF A;  4C8A A;  4OC0 A;  1V6C A;  3I6S A;  4C8U A;  4OC2 A;  3IIB A;  4MCQ A;  3D7G A;  2XEF A;  4MCS A;  3BI1 A;  3BI0 A;  3KAS A;  3D7D A;  3S9L A;  2EK9 A;  3FF3 A;  4C8P A;  1Z8L A;  4YN3 A;  2JBJ A;  4X3R A;  4JYW A;  3SJE A;  5D29 A;  4C99 A;  4P4B A;  3S9N A;  5ELY A;  1CX8 A;  3D7H A;  3FEE A;  4P4E A;  2OOT A;  2C6P A;  3I74 A;  4LQG A;  4C9R A;  3S9M A;  4NGT A;  3BHX A;  3BXM A;  4NGM A;  4TWE A;  4NGS A;  4C86 A;  2XEJ A;  4NGR A;  1WVM A;  2C6G A;  2C6C A;  4C9V A;  4C8T A;  4W9Y A;  2CIJ A;  1Y9Z A;  3EIF A;  4TJV A;  4C85 A;  5IB9 A;  3IWW A;  4C8C A;  3FEC A;  5F09 A;  2EK8 A;  4KNG E;  4P4I A;  4NGN A;  4CDJ A;  4C9A A;  1DE4 C;  3ICU A;  4P45 A;  4NGP A;  4MCR A;  4C9E A;  1XF1 A;  4C8F A;  4C84 A;  3FED A;  2JBK A;  2PVW A;  3D7F A;  4OC1 A;  4C9U A;  4OC5 A;  4CDK A;  3SJX A;  2XEI A;  4P4D A;  4P44 A;  4P4J A;  4NGQ A;  3SJG A;  4JZ0 A;  4MCP A;  4TJX A;  3RBU A;  4OME A;  4OC3 A;  4OC4 A;  4P4F A;  3VTA A; 
#chains in the Genus database with same CATH topology
 1NXJ A;  2OR4 A;  2XEG A;  4MJX A;  2PVV A;  2D0O A;  3SJF A;  4C8A A;  3TLC A;  4OC0 A;  1V6C A;  5FD8 A;  4E94 A;  3I6S A;  4C8U A;  1ZYM A;  4H1H A;  4OC2 A;  3IIB A;  5F5X A;  4MCQ A;  2D0P A;  2HI6 A;  3D7G A;  2EZA A;  5IR2 A;  2XEF A;  4COG A;  3EZE A;  4MCS A;  3BI1 A;  3TLG A;  3TLY A;  3BI0 A;  3EZA A;  1DIK A;  3D7D A;  3KAS A;  1VBH A;  3SR3 A;  3T05 A;  1R61 A;  3S9L A;  2EK9 A;  3FF3 A;  1CE8 B;  4C8P A;  1Z8L A;  3T07 A;  4YN3 A;  2JBJ A;  1ZL0 A;  4X3R A;  1T36 B;  4JYW A;  3SJE A;  5D29 A;  3TLE A;  1VI4 A;  4C99 A;  2FM4 A;  1Q5X A;  4P4B A;  4E5S A;  2E28 A;  1NBW A;  4COB A;  3S9N A;  5ELY A;  1CX8 A;  3D7H A;  3FEE A;  4P4E A;  2OOT A;  1KC7 A;  2C6P A;  4IIX A;  3I74 A;  2AUM A;  2C5Q A;  3NOJ A;  1EZA A;  4LQG A;  1KBL A;  3U1B A;  3KRV A;  4C9R A;  2PCN A;  3S9M A;  4NGT A;  3BHX A;  4CZ1 A;  2DIK A;  3BXM A;  4NGM A;  4TWE A;  4NGS A;  4C86 A;  3EZB A;  2XEJ A;  2OLS A;  4NGR A;  1WVM A;  2C6G A;  3GJZ A;  1JDB C;  5JVL A;  2C6C A;  4C9V A;  5F1Y A;  4C8T A;  4W9Y A;  2CIJ A;  1Y9Z A;  1VBG A;  2R82 A;  3EIF A;  4TJV A;  4C85 A;  5IB9 A;  3IWW A;  5JYB A;  3G23 A;  4C8C A;  1GGO A;  2AUN A;  3FEC A;  1CS0 B;  3TLB A;  2EK8 A;  5F09 A;  4KNG E;  4P4I A;  4NGN A;  4CDJ A;  4C9A A;  1DE4 C;  3ICU A;  5F9M A;  4P45 A;  4INJ A;  1M6V B;  4NGP A;  3C8O A;  4MCR A;  1A9X B;  1ZRS A;  4C9E A;  1C3O B;  1XF1 A;  3TLA A;  4C8F A;  4C84 A;  1J3L A;  2B0A A;  3FED A;  2EZB A;  2HRO A;  4IIY A;  2JBK A;  1BXR B;  4M8D A;  4CO9 A;  2PVW A;  3TLG B;  2GP4 A;  3T0T A;  4EYS A;  3D7F A;  4OC1 A;  2YJV A;  4C9U A;  4OC5 A;  4CDK A;  4J0N A;  2YJT A;  1KEE B;  5K99 A;  2HWG A;  3K9T A;  3SJX A;  2XEI A;  3TLZ A;  1JDE A;  2EZC A;  1C30 B;  4JVO A;  3TYX A;  4MI1 A;  4P4D A;  4NGQ A;  4P44 A;  4P4J A;  3SJG A;  2X0S A;  4JZ0 A;  4MCP A;  4TJX A;  3RBU A;  4OME A;  4OC3 A;  3T5M A;  1EZB A;  4OC4 A;  4P4F A;  3K4I A;  3VTA A;  2MP0 A; 
#chains in the Genus database with same CATH homology
 2OR4 A;  2XEG A;  2PVV A;  3SJF A;  4C8A A;  4OC0 A;  1V6C A;  3I6S A;  4C8U A;  4OC2 A;  3IIB A;  4MCQ A;  3D7G A;  5IR2 A;  2XEF A;  4MCS A;  3BI1 A;  3BI0 A;  3KAS A;  3D7D A;  3S9L A;  2EK9 A;  3FF3 A;  4C8P A;  1Z8L A;  4YN3 A;  2JBJ A;  4X3R A;  4JYW A;  3SJE A;  5D29 A;  4C99 A;  4P4B A;  3S9N A;  5ELY A;  1CX8 A;  3D7H A;  3FEE A;  4P4E A;  2OOT A;  2C6P A;  3I74 A;  2C5Q A;  4LQG A;  4C9R A;  3S9M A;  4NGT A;  3BHX A;  3BXM A;  4NGM A;  4TWE A;  4NGS A;  4C86 A;  2XEJ A;  4NGR A;  1WVM A;  2C6G A;  2C6C A;  4C9V A;  4C8T A;  4W9Y A;  2CIJ A;  1Y9Z A;  3EIF A;  4TJV A;  4C85 A;  5IB9 A;  3IWW A;  4C8C A;  3FEC A;  5F09 A;  2EK8 A;  4KNG E;  4P4I A;  4NGN A;  4CDJ A;  4C9A A;  1DE4 C;  3ICU A;  4P45 A;  4NGP A;  4MCR A;  4C9E A;  1XF1 A;  4C8F A;  4C84 A;  3FED A;  2JBK A;  2PVW A;  2GP4 A;  3D7F A;  4OC1 A;  4C9U A;  4OC5 A;  4CDK A;  3K9T A;  3SJX A;  2XEI A;  4P4D A;  4NGQ A;  4P4J A;  4P44 A;  3SJG A;  4JZ0 A;  4MCP A;  4TJX A;  3RBU A;  4OME A;  4OC3 A;  4OC4 A;  4P4F A;  3VTA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...