4C9VA

Xenopus rnf43 ectodomain in complex with xenopus rspo2 fu1-fu2
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
148
structure length
125
Chain Sequence
VKALIRVTPLNLTLEGLFARVAEISPAEGRLLQFHPLSLCNTKPGFISIVKLETPCLSLANKARLAGERGAHAVLFDITNDRGALQQLQQPAGINQPVVLIWGPDAEKLMDVVNKNKEALVKIEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb
source organism Xenopus (silurana) tropicalis
molecule tags Signaling protein
molecule keywords RNF43
total genus 29
structure length 125
sequence length 148
ec nomenclature
pdb deposition date 2013-10-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4c9vA00
1WVMA 4JYWA 2PVVA 1DE4C 3FF3A 2C6PA 5F09A 2EK9A 4MCRA 4C99A 3BI0A 3I6SA 4KNGE 4MCSA 4C8TA 2EK8A 4C86A 4NGRA 2C6CA 4YN3A 4P4IA 3FEDA 4CDKA 3BHXA 2CIJA 3ICUA 1Z8LA 4C8PA 4C84A 2C6GA 4LQGA 4OC5A 3SJXA 2OOTA 4NGSA 4P4BA 2XEJA 4X3RA 4NGMA 3EIFA 4NGNA 4C8CA 4JZ0A 4C8AA 4TJVA 4C9AA 4OC1A 4NGPA 4CDJA 1Y9ZA 3IIBA 4OC3A 3D7FA 2XEIA 4P45A 4MCQA 4P4DA 4TWEA 2PVWA 1V6CA 3SJEA 3FECA 2JBJA 4C9RA 4W9YA 4TJXA 3VTAA 3RBUA 3SJFA 3S9MA 5D29A 4C9VA 4C8FA 2XEGA 3BXMA 4MCPA 4C9EA 4P4EA 4C8UA 4OMEA 5ELYA 4C85A 4NGQA 4NGTA 3S9NA 4P44A 4P4JA 4OC2A 2XEFA 3FEEA 3D7HA 3KASA 3D7GA 3IWWA 1CX8A 2OR4A 3SJGA 3I74A 4P4FA 4C9UA 4OC0A 3S9LA 1XF1A 4OC4A 3BI1A 5IB9A 3D7DA 2JBKA
chains in the Genus database with same CATH superfamily
1WVMA 4JYWA 2PVVA 2EZCA 1DE4C 3FF3A 2C6PA 1CE8B 5F09A 4CO9A 2D0OA 4INJA 3TYXA 2B0AA 2EK9A 1VI4A 5JYBA 3K4IA 4MCRA 3TLZA 4C99A 4COBA 3KRVA 2C5QA 4COGA 2YJTA 3BI0A 2R82A 3I6SA 4KNGE 4MCSA 2EK8A 3TLBA 3TLCA 4C86A 4C8TA 4NGRA 2C6CA 3NOJA 2E28A 3GJZA 1C30B 1VBHA 3K9TA 3T5MA 3T0TA 4YN3A 4P4IA 1ZL0A 3FEDA 4CDKA 3BHXA 3EZBA 4E94A 2MP0A 1DIKA 2CIJA 3ICUA 1Z8LA 3EZAA 4C8PA 4C84A 3T07A 2C6GA 4IIYA 4CZ1A 2HWGA 5F9MA 2PCNA 4LQGA 4OC5A 2AUNA 3TLYA 3SJXA 2OOTA 4NGSA 4P4BA 2XEJA 4X3RA 3T05A 2D0PA 3C8OA 3EIFA 1KEEB 4NGNA 4NGMA 4C8CA 5IR2A 4MJXA 1EZAA 5FD8A 1JDEA 4JZ0A 5K99A 4C8AA 2DIKA 4TJVA 2AUMA 4C9AA 4OC1A 2HI6A 4IIXA 5F5XA 3TLEA 4M8DA 4NGPA 1T36B 1NXJA 1GGOA 1Y9ZA 3IIBA 4J0NA 4CDJA 4OC3A 3D7FA 4EYSA 2XEIA 1J3LA 4P45A 4MCQA 4JVOA 1M6VB 1CS0B 4P4DA 2HROA 4TWEA 2PVWA 1V6CA 3SJEA 3FECA 1KC7A 2JBJA 4C9RA 4W9YA 4TJXA 3VTAA 3RBUA 3SJFA 1ZYMA 3S9MA 5D29A 4C9VA 4C8FA 2XEGA 3BXMA 3EZEA 1Q5XA 1VBGA 4MCPA 4H1HA 1NBWA 4C9EA 1BXRB 2GP4A 4P4EA 4C8UA 4OMEA 5ELYA 4C85A 4NGQA 2YJVA 4NGTA 3S9NA 2FM4A 4P44A 4P4JA 4OC2A 2XEFA 3FEEA 3TLAA 3D7HA 2X0SA 3SR3A 4E5SA 3KASA 3D7GA 3IWWA 1CX8A 2OR4A 3SJGA 3G23A 1R61A 3TLGB 5JVLA 3I74A 4P4FA 2EZAA 4C9UA 1ZRSA 2EZBA 1EZBA 4OC0A 1A9XB 1JDBC 1KBLA 3S9LA 3U1BA 1C3OB 1XF1A 2OLSA 4OC4A 3BI1A 3TLGA 5F1YA 4MI1A 5IB9A 3D7DA 2JBKA
chains in the Genus database with same CATH topology
1WVMA 4JYWA 2PVVA 1DE4C 3FF3A 2C6PA 5F09A 2EK9A 4MCRA 4C99A 2C5QA 3BI0A 3I6SA 4KNGE 4MCSA 4C8TA 2EK8A 4C86A 4NGRA 2C6CA 3K9TA 4YN3A 4P4IA 3FEDA 4CDKA 3BHXA 2CIJA 3ICUA 1Z8LA 4C8PA 4C84A 2C6GA 4LQGA 4OC5A 3SJXA 2OOTA 4NGSA 4P4BA 2XEJA 4X3RA 4NGMA 3EIFA 4NGNA 4C8CA 5IR2A 4JZ0A 4C8AA 4TJVA 4C9AA 4OC1A 4NGPA 4CDJA 1Y9ZA 3IIBA 4OC3A 3D7FA 2XEIA 4P45A 4MCQA 4P4DA 4TWEA 2PVWA 1V6CA 3SJEA 3FECA 2JBJA 4C9RA 4W9YA 4TJXA 3VTAA 3RBUA 3SJFA 3S9MA 5D29A 4C9VA 4C8FA 2XEGA 3BXMA 4MCPA 4C9EA 2GP4A 4P4EA 4C8UA 4OMEA 5ELYA 4C85A 4NGQA 4NGTA 3S9NA 4P44A 4P4JA 4OC2A 2XEFA 3FEEA 3D7HA 3KASA 3D7GA 3IWWA 1CX8A 2OR4A 3SJGA 3I74A 4P4FA 4C9UA 4OC0A 3S9LA 1XF1A 4OC4A 3BI1A 5IB9A 3D7DA 2JBKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WVM A;  4JYW A;  2PVV A;  1DE4 C;  3FF3 A;  2C6P A;  5F09 A;  2EK9 A;  4MCR A;  4C99 A;  3BI0 A;  3I6S A;  4KNG E;  4MCS A;  4C8T A;  2EK8 A;  4C86 A;  4NGR A;  2C6C A;  4YN3 A;  4P4I A;  3FED A;  4CDK A;  3BHX A;  2CIJ A;  3ICU A;  1Z8L A;  4C8P A;  4C84 A;  2C6G A;  4LQG A;  4OC5 A;  3SJX A;  2OOT A;  4NGS A;  4P4B A;  2XEJ A;  4X3R A;  4NGM A;  3EIF A;  4NGN A;  4C8C A;  4JZ0 A;  4C8A A;  4TJV A;  4C9A A;  4OC1 A;  4NGP A;  4CDJ A;  1Y9Z A;  3IIB A;  4OC3 A;  3D7F A;  2XEI A;  4P45 A;  4MCQ A;  4P4D A;  4TWE A;  2PVW A;  1V6C A;  3SJE A;  3FEC A;  2JBJ A;  4C9R A;  4W9Y A;  4TJX A;  3VTA A;  3RBU A;  3SJF A;  3S9M A;  5D29 A;  4C9V A;  4C8F A;  2XEG A;  3BXM A;  4MCP A;  4C9E A;  4P4E A;  4C8U A;  4OME A;  5ELY A;  4C85 A;  4NGQ A;  4NGT A;  3S9N A;  4P44 A;  4P4J A;  4OC2 A;  2XEF A;  3FEE A;  3D7H A;  3KAS A;  3D7G A;  3IWW A;  1CX8 A;  2OR4 A;  3SJG A;  3I74 A;  4P4F A;  4C9U A;  4OC0 A;  3S9L A;  1XF1 A;  4OC4 A;  3BI1 A;  5IB9 A;  3D7D A;  2JBK A; 
#chains in the Genus database with same CATH topology
 1WVM A;  4JYW A;  2PVV A;  2EZC A;  1DE4 C;  3FF3 A;  2C6P A;  1CE8 B;  5F09 A;  4CO9 A;  2D0O A;  4INJ A;  3TYX A;  2B0A A;  2EK9 A;  1VI4 A;  5JYB A;  3K4I A;  4MCR A;  3TLZ A;  4C99 A;  4COB A;  3KRV A;  2C5Q A;  4COG A;  2YJT A;  3BI0 A;  2R82 A;  3I6S A;  4KNG E;  4MCS A;  2EK8 A;  3TLB A;  3TLC A;  4C86 A;  4C8T A;  4NGR A;  2C6C A;  3NOJ A;  2E28 A;  3GJZ A;  1C30 B;  1VBH A;  3K9T A;  3T5M A;  3T0T A;  4YN3 A;  4P4I A;  1ZL0 A;  3FED A;  4CDK A;  3BHX A;  3EZB A;  4E94 A;  2MP0 A;  1DIK A;  2CIJ A;  3ICU A;  1Z8L A;  3EZA A;  4C8P A;  4C84 A;  3T07 A;  2C6G A;  4IIY A;  4CZ1 A;  2HWG A;  5F9M A;  2PCN A;  4LQG A;  4OC5 A;  2AUN A;  3TLY A;  3SJX A;  2OOT A;  4NGS A;  4P4B A;  2XEJ A;  4X3R A;  3T05 A;  2D0P A;  3C8O A;  3EIF A;  1KEE B;  4NGN A;  4NGM A;  4C8C A;  5IR2 A;  4MJX A;  1EZA A;  5FD8 A;  1JDE A;  4JZ0 A;  5K99 A;  4C8A A;  2DIK A;  4TJV A;  2AUM A;  4C9A A;  4OC1 A;  2HI6 A;  4IIX A;  5F5X A;  3TLE A;  4M8D A;  4NGP A;  1T36 B;  1NXJ A;  1GGO A;  1Y9Z A;  3IIB A;  4J0N A;  4CDJ A;  4OC3 A;  3D7F A;  4EYS A;  2XEI A;  1J3L A;  4P45 A;  4MCQ A;  4JVO A;  1M6V B;  1CS0 B;  4P4D A;  2HRO A;  4TWE A;  2PVW A;  1V6C A;  3SJE A;  3FEC A;  1KC7 A;  2JBJ A;  4C9R A;  4W9Y A;  4TJX A;  3VTA A;  3RBU A;  3SJF A;  1ZYM A;  3S9M A;  5D29 A;  4C9V A;  4C8F A;  2XEG A;  3BXM A;  3EZE A;  1Q5X A;  1VBG A;  4MCP A;  4H1H A;  1NBW A;  4C9E A;  1BXR B;  2GP4 A;  4P4E A;  4C8U A;  4OME A;  5ELY A;  4C85 A;  4NGQ A;  2YJV A;  4NGT A;  3S9N A;  2FM4 A;  4P44 A;  4P4J A;  4OC2 A;  2XEF A;  3FEE A;  3TLA A;  3D7H A;  2X0S A;  3SR3 A;  4E5S A;  3KAS A;  3D7G A;  3IWW A;  1CX8 A;  2OR4 A;  3SJG A;  3G23 A;  1R61 A;  3TLG B;  5JVL A;  3I74 A;  4P4F A;  2EZA A;  4C9U A;  1ZRS A;  2EZB A;  1EZB A;  4OC0 A;  1A9X B;  1JDB C;  1KBL A;  3S9L A;  3U1B A;  1C3O B;  1XF1 A;  2OLS A;  4OC4 A;  3BI1 A;  3TLG A;  5F1Y A;  4MI1 A;  5IB9 A;  3D7D A;  2JBK A; 
#chains in the Genus database with same CATH homology
 1WVM A;  4JYW A;  2PVV A;  1DE4 C;  3FF3 A;  2C6P A;  5F09 A;  2EK9 A;  4MCR A;  4C99 A;  2C5Q A;  3BI0 A;  3I6S A;  4KNG E;  4MCS A;  4C8T A;  2EK8 A;  4C86 A;  4NGR A;  2C6C A;  3K9T A;  4YN3 A;  4P4I A;  3FED A;  4CDK A;  3BHX A;  2CIJ A;  3ICU A;  1Z8L A;  4C8P A;  4C84 A;  2C6G A;  4LQG A;  4OC5 A;  3SJX A;  2OOT A;  4NGS A;  4P4B A;  2XEJ A;  4X3R A;  4NGM A;  3EIF A;  4NGN A;  4C8C A;  5IR2 A;  4JZ0 A;  4C8A A;  4TJV A;  4C9A A;  4OC1 A;  4NGP A;  4CDJ A;  1Y9Z A;  3IIB A;  4OC3 A;  3D7F A;  2XEI A;  4P45 A;  4MCQ A;  4P4D A;  4TWE A;  2PVW A;  1V6C A;  3SJE A;  3FEC A;  2JBJ A;  4C9R A;  4W9Y A;  4TJX A;  3VTA A;  3RBU A;  3SJF A;  3S9M A;  5D29 A;  4C9V A;  4C8F A;  2XEG A;  3BXM A;  4MCP A;  4C9E A;  2GP4 A;  4P4E A;  4C8U A;  4OME A;  5ELY A;  4C85 A;  4NGQ A;  4NGT A;  3S9N A;  4P44 A;  4P4J A;  4OC2 A;  2XEF A;  3FEE A;  3D7H A;  3KAS A;  3D7G A;  3IWW A;  1CX8 A;  2OR4 A;  3SJG A;  3I74 A;  4P4F A;  4C9U A;  4OC0 A;  3S9L A;  1XF1 A;  4OC4 A;  3BI1 A;  5IB9 A;  3D7D A;  2JBK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...