4C9VA

Xenopus rnf43 ectodomain in complex with xenopus rspo2 fu1-fu2
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
148
structure length
125
Chain Sequence
VKALIRVTPLNLTLEGLFARVAEISPAEGRLLQFHPLSLCNTKPGFISIVKLETPCLSLANKARLAGERGAHAVLFDITNDRGALQQLQQPAGINQPVVLIWGPDAEKLMDVVNKNKEALVKIEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNF43
publication title Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb
source organism Xenopus (silurana) tropicalis
molecule tags Signaling protein
total genus 29
structure length 125
sequence length 148
ec nomenclature
pdb deposition date 2013-10-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4c9vA00
5F09A 4C8TA 3IWWA 4JYWA 4OC3A 3BI0A 4P4DA 4C9UA 4C8AA 4MCQA 3SJEA 4C9RA 4CDJA 4MCPA 4P45A 4P4EA 3ICUA 4P4IA 3FECA 4NGMA 2XEFA 3BHXA 2OR4A 1V6CA 4C9VA 2C6CA 3EIFA 3SJXA 2PVVA 3S9MA 1XF1A 4NGNA 2JBJA 4NGRA 3RBUA 4P4JA 1Z8LA 2C6PA 4TJVA 4TWEA 2JBKA 2PVWA 3BI1A 2EK9A 2XEGA 3SJFA 4C9EA 4X3RA 4P44A 4TJXA 4W9YA 3S9LA 4P4FA 4C84A 1WVMA 4OC1A 2XEJA 4C8PA 1Y9ZA 4KNGE 3D7DA 4MCRA 3I6SA 5IB9A 4C99A 4C86A 4OC2A 3FF3A 4LQGA 4P4BA 4NGTA 3IIBA 3D7HA 5D29A 2EK8A 4JZ0A 3KASA 3VTAA 1CX8A 4C85A 4NGPA 3I74A 5ELYA 4C8FA 4CDKA 3S9NA 4YN3A 4OC4A 3SJGA 4OC5A 4OMEA 2OOTA 4MCSA 2CIJA 3FEDA 2XEIA 3D7FA 4C8CA 4NGSA 3BXMA 3D7GA 1DE4C 4OC0A 4C9AA 4NGQA 4C8UA 2C6GA 3FEEA
chains in the Genus database with same CATH superfamily
5F09A 4C8TA 1T36B 3IWWA 4JYWA 1ZRSA 4OC3A 3BI0A 5FD8A 4P4DA 4C9UA 4C8AA 4MCQA 3SJEA 4C9RA 4CDJA 4MCPA 4P45A 4P4EA 3TLGA 1KBLA 4COGA 3ICUA 4P4IA 3FECA 2EZBA 4NGMA 1NBWA 5F9MA 2XEFA 2X0SA 3BHXA 2OR4A 1V6CA 2GP4A 2R82A 1C30B 5IR2A 4C9VA 1ZL0A 2B0AA 2C6CA 3EIFA 5F5XA 3SJXA 1KC7A 5JVLA 1DIKA 2PVVA 5K99A 3S9MA 1XF1A 3EZEA 4NGNA 4CO9A 1VBHA 2JBJA 4NGRA 3RBUA 4P4JA 4COBA 3G23A 1R61A 3T05A 1KEEB 1Z8LA 2C6PA 3K9TA 4E94A 4TJVA 4TWEA 3TLBA 2YJVA 2JBKA 1C3OB 2PVWA 3BI1A 2D0PA 3C8OA 2EK9A 3TLZA 2XEGA 1GGOA 2PCNA 3SJFA 2YJTA 4C9EA 1Q5XA 4MI1A 4X3RA 1JDBC 4P44A 4TJXA 2MP0A 1J3LA 3K4IA 1ZYMA 3GJZA 4W9YA 3T0TA 3S9LA 4P4FA 4CZ1A 4C84A 2OLSA 1VI4A 1WVMA 4OC1A 3TLEA 2C5QA 2XEJA 4C8PA 3KRVA 1BXRB 1Y9ZA 4IIXA 4KNGE 3U1BA 5JYBA 2D0OA 3D7DA 3I6SA 4J0NA 4MCRA 2HI6A 5IB9A 4C99A 2EZAA 4JVOA 1EZBA 2HROA 4C86A 4OC2A 3FF3A 4LQGA 4P4BA 4NGTA 4E5SA 1CS0B 4EYSA 3SR3A 3IIBA 3D7HA 5D29A 2HWGA 2AUNA 2EK8A 4JZ0A 3KASA 1JDEA 1NXJA 3VTAA 2EZCA 1CX8A 1M6VB 3EZAA 4C85A 4NGPA 3I74A 5ELYA 4C8FA 4CDKA 3T07A 3S9NA 4YN3A 4OC4A 1CE8B 3SJGA 1VBGA 4OC5A 4MJXA 3TLCA 1EZAA 4OMEA 2OOTA 3TYXA 2AUMA 2E28A 4IIYA 1A9XB 3EZBA 4MCSA 2CIJA 3FEDA 2XEIA 3D7FA 4C8CA 2FM4A 4NGSA 3TLAA 3NOJA 3BXMA 3D7GA 1DE4C 4M8DA 3TLYA 4H1HA 4OC0A 4C9AA 4NGQA 3T5MA 2DIKA 5F1YA 4C8UA 2C6GA 3TLGB 4INJA 3FEEA
chains in the Genus database with same CATH topology
5F09A 4C8TA 3IWWA 4JYWA 4OC3A 3BI0A 4P4DA 4C9UA 4C8AA 4MCQA 3SJEA 4C9RA 4CDJA 4MCPA 4P45A 4P4EA 3ICUA 4P4IA 3FECA 4NGMA 2XEFA 3BHXA 2OR4A 1V6CA 2GP4A 5IR2A 4C9VA 2C6CA 3EIFA 3SJXA 2PVVA 3S9MA 1XF1A 4NGNA 2JBJA 4NGRA 3RBUA 4P4JA 1Z8LA 2C6PA 3K9TA 4TJVA 4TWEA 2JBKA 2PVWA 3BI1A 2EK9A 2XEGA 3SJFA 4C9EA 4X3RA 4P44A 4TJXA 4W9YA 3S9LA 4P4FA 4C84A 1WVMA 4OC1A 2C5QA 2XEJA 4C8PA 1Y9ZA 4KNGE 3D7DA 4MCRA 3I6SA 5IB9A 4C99A 4C86A 4OC2A 3FF3A 4LQGA 4P4BA 4NGTA 3IIBA 3D7HA 5D29A 2EK8A 4JZ0A 3KASA 3VTAA 1CX8A 4C85A 4NGPA 3I74A 5ELYA 4C8FA 4CDKA 3S9NA 4YN3A 4OC4A 3SJGA 4OC5A 4OMEA 2OOTA 4MCSA 2CIJA 3FEDA 2XEIA 3D7FA 4C8CA 4NGSA 3BXMA 3D7GA 1DE4C 4OC0A 4C9AA 4NGQA 4C8UA 2C6GA 3FEEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F09 A;  4C8T A;  3IWW A;  4JYW A;  4OC3 A;  3BI0 A;  4P4D A;  4C9U A;  4C8A A;  4MCQ A;  3SJE A;  4C9R A;  4CDJ A;  4MCP A;  4P45 A;  4P4E A;  3ICU A;  4P4I A;  3FEC A;  4NGM A;  2XEF A;  3BHX A;  2OR4 A;  1V6C A;  4C9V A;  2C6C A;  3EIF A;  3SJX A;  2PVV A;  3S9M A;  1XF1 A;  4NGN A;  2JBJ A;  4NGR A;  3RBU A;  4P4J A;  1Z8L A;  2C6P A;  4TJV A;  4TWE A;  2JBK A;  2PVW A;  3BI1 A;  2EK9 A;  2XEG A;  3SJF A;  4C9E A;  4X3R A;  4P44 A;  4TJX A;  4W9Y A;  3S9L A;  4P4F A;  4C84 A;  1WVM A;  4OC1 A;  2XEJ A;  4C8P A;  1Y9Z A;  4KNG E;  3D7D A;  4MCR A;  3I6S A;  5IB9 A;  4C99 A;  4C86 A;  4OC2 A;  3FF3 A;  4LQG A;  4P4B A;  4NGT A;  3IIB A;  3D7H A;  5D29 A;  2EK8 A;  4JZ0 A;  3KAS A;  3VTA A;  1CX8 A;  4C85 A;  4NGP A;  3I74 A;  5ELY A;  4C8F A;  4CDK A;  3S9N A;  4YN3 A;  4OC4 A;  3SJG A;  4OC5 A;  4OME A;  2OOT A;  4MCS A;  2CIJ A;  3FED A;  2XEI A;  3D7F A;  4C8C A;  4NGS A;  3BXM A;  3D7G A;  1DE4 C;  4OC0 A;  4C9A A;  4NGQ A;  4C8U A;  2C6G A;  3FEE A; 
#chains in the Genus database with same CATH topology
 5F09 A;  4C8T A;  1T36 B;  3IWW A;  4JYW A;  1ZRS A;  4OC3 A;  3BI0 A;  5FD8 A;  4P4D A;  4C9U A;  4C8A A;  4MCQ A;  3SJE A;  4C9R A;  4CDJ A;  4MCP A;  4P45 A;  4P4E A;  3TLG A;  1KBL A;  4COG A;  3ICU A;  4P4I A;  3FEC A;  2EZB A;  4NGM A;  1NBW A;  5F9M A;  2XEF A;  2X0S A;  3BHX A;  2OR4 A;  1V6C A;  2GP4 A;  2R82 A;  1C30 B;  5IR2 A;  4C9V A;  1ZL0 A;  2B0A A;  2C6C A;  3EIF A;  5F5X A;  3SJX A;  1KC7 A;  5JVL A;  1DIK A;  2PVV A;  5K99 A;  3S9M A;  1XF1 A;  3EZE A;  4NGN A;  4CO9 A;  1VBH A;  2JBJ A;  4NGR A;  3RBU A;  4P4J A;  4COB A;  3G23 A;  1R61 A;  3T05 A;  1KEE B;  1Z8L A;  2C6P A;  3K9T A;  4E94 A;  4TJV A;  4TWE A;  3TLB A;  2YJV A;  2JBK A;  1C3O B;  2PVW A;  3BI1 A;  2D0P A;  3C8O A;  2EK9 A;  3TLZ A;  2XEG A;  1GGO A;  2PCN A;  3SJF A;  2YJT A;  4C9E A;  1Q5X A;  4MI1 A;  4X3R A;  1JDB C;  4P44 A;  4TJX A;  2MP0 A;  1J3L A;  3K4I A;  1ZYM A;  3GJZ A;  4W9Y A;  3T0T A;  3S9L A;  4P4F A;  4CZ1 A;  4C84 A;  2OLS A;  1VI4 A;  1WVM A;  4OC1 A;  3TLE A;  2C5Q A;  2XEJ A;  4C8P A;  3KRV A;  1BXR B;  1Y9Z A;  4IIX A;  4KNG E;  3U1B A;  5JYB A;  2D0O A;  3D7D A;  3I6S A;  4J0N A;  4MCR A;  2HI6 A;  5IB9 A;  4C99 A;  2EZA A;  4JVO A;  1EZB A;  2HRO A;  4C86 A;  4OC2 A;  3FF3 A;  4LQG A;  4P4B A;  4NGT A;  4E5S A;  1CS0 B;  4EYS A;  3SR3 A;  3IIB A;  3D7H A;  5D29 A;  2HWG A;  2AUN A;  2EK8 A;  4JZ0 A;  3KAS A;  1JDE A;  1NXJ A;  3VTA A;  2EZC A;  1CX8 A;  1M6V B;  3EZA A;  4C85 A;  4NGP A;  3I74 A;  5ELY A;  4C8F A;  4CDK A;  3T07 A;  3S9N A;  4YN3 A;  4OC4 A;  1CE8 B;  3SJG A;  1VBG A;  4OC5 A;  4MJX A;  3TLC A;  1EZA A;  4OME A;  2OOT A;  3TYX A;  2AUM A;  2E28 A;  4IIY A;  1A9X B;  3EZB A;  4MCS A;  2CIJ A;  3FED A;  2XEI A;  3D7F A;  4C8C A;  2FM4 A;  4NGS A;  3TLA A;  3NOJ A;  3BXM A;  3D7G A;  1DE4 C;  4M8D A;  3TLY A;  4H1H A;  4OC0 A;  4C9A A;  4NGQ A;  3T5M A;  2DIK A;  5F1Y A;  4C8U A;  2C6G A;  3TLG B;  4INJ A;  3FEE A; 
#chains in the Genus database with same CATH homology
 5F09 A;  4C8T A;  3IWW A;  4JYW A;  4OC3 A;  3BI0 A;  4P4D A;  4C9U A;  4C8A A;  4MCQ A;  3SJE A;  4C9R A;  4CDJ A;  4MCP A;  4P45 A;  4P4E A;  3ICU A;  4P4I A;  3FEC A;  4NGM A;  2XEF A;  3BHX A;  2OR4 A;  1V6C A;  2GP4 A;  5IR2 A;  4C9V A;  2C6C A;  3EIF A;  3SJX A;  2PVV A;  3S9M A;  1XF1 A;  4NGN A;  2JBJ A;  4NGR A;  3RBU A;  4P4J A;  1Z8L A;  2C6P A;  3K9T A;  4TJV A;  4TWE A;  2JBK A;  2PVW A;  3BI1 A;  2EK9 A;  2XEG A;  3SJF A;  4C9E A;  4X3R A;  4P44 A;  4TJX A;  4W9Y A;  3S9L A;  4P4F A;  4C84 A;  1WVM A;  4OC1 A;  2C5Q A;  2XEJ A;  4C8P A;  1Y9Z A;  4KNG E;  3D7D A;  4MCR A;  3I6S A;  5IB9 A;  4C99 A;  4C86 A;  4OC2 A;  3FF3 A;  4LQG A;  4P4B A;  4NGT A;  3IIB A;  3D7H A;  5D29 A;  2EK8 A;  4JZ0 A;  3KAS A;  3VTA A;  1CX8 A;  4C85 A;  4NGP A;  3I74 A;  5ELY A;  4C8F A;  4CDK A;  3S9N A;  4YN3 A;  4OC4 A;  3SJG A;  4OC5 A;  4OME A;  2OOT A;  4MCS A;  2CIJ A;  3FED A;  2XEI A;  3D7F A;  4C8C A;  4NGS A;  3BXM A;  3D7G A;  1DE4 C;  4OC0 A;  4C9A A;  4NGQ A;  4C8U A;  2C6G A;  3FEE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...