4C9VA

Xenopus rnf43 ectodomain in complex with xenopus rspo2 fu1-fu2
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
148
structure length
125
Chain Sequence
b'VKALIRVTPLNLTLEGLFARVAEISPAEGRLLQFHPLSLCNTKPGFISIVKLETPCLSLANKARLAGERGAHAVLFDITNDRGALQQLQQPAGINQPVVLIWGPDAEKLMDVVNKNKEALVKIEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNF43
publication title Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb
source organism Xenopus (silurana) tropicalis
molecule tags Signaling protein
total genus 29
structure length 125
sequence length 148
ec nomenclature
pdb deposition date 2013-10-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4c9vA00
2EK9A 2XEGA 4C8UA 4OC3A 4C9UA 1Y9ZA 3SJXA 3S9NA 4C8PA 3EIFA 2XEJA 1V6CA 4P4DA 4NGNA 2EK8A 2XEFA 3FEDA 3SJEA 4C8AA 4C8FA 4NGRA 4MCPA 2JBJA 4X3RA 4OC2A 4C99A 4KNGE 2JBKA 4C8CA 4NGQA 4NGSA 3D7GA 4CDKA 4C9RA 4C85A 4OMEA 4MCRA 2C6GA 3SJFA 4W9YA 4CDJA 4LQGA 3D7DA 4TWEA 1WVMA 2C6CA 4NGPA 4C9EA 5ELYA 4C84A 4OC5A 4C9VA 4P4BA 4YN3A 4C8TA 2PVWA 3FEEA 4P45A 1DE4C 2C6PA 4NGTA 5F09A 3I74A 3FECA 2OR4A 2XEIA 3I6SA 5D29A 3BHXA 3D7FA 4P4JA 1Z8LA 1XF1A 3ICUA 4OC4A 4P4EA 3VTAA 2PVVA 4P4FA 4TJVA 4OC1A 4MCQA 4C9AA 4P44A 3D7HA 4JZ0A 3FF3A 5IB9A 1CX8A 4OC0A 4JYWA 2OOTA 3RBUA 3BI0A 4C86A 3KASA 3BXMA 4P4IA 3IIBA 4NGMA 2CIJA 3IWWA 3BI1A 4MCSA 4TJXA 3S9MA 3SJGA 3S9LA
chains in the Genus database with same CATH superfamily
4INJA 1JDEA 2D0PA 2EZAA 5FD8A 2EK9A 2XEGA 4MJXA 4C8UA 2E28A 4OC3A 1GGOA 3TLZA 4C9UA 4EYSA 1Y9ZA 3SJXA 3TLAA 3S9NA 4C8PA 3EIFA 4E94A 2XEJA 1V6CA 4P4DA 1R61A 4NGNA 1T36B 2EK8A 2XEFA 3FEDA 1EZBA 5F9MA 4J0NA 3SJEA 1EZAA 4C8AA 4C8FA 4NGRA 4MCPA 2JBJA 4X3RA 4COGA 4OC2A 4C99A 4KNGE 1KBLA 2JBKA 4MI1A 4C8CA 4NGQA 4NGSA 2MP0A 3D7GA 4CDKA 4C9RA 1KEEB 1VBHA 4C85A 4OMEA 4IIYA 3EZBA 4MCRA 2C6GA 2FM4A 3NOJA 3SJFA 2YJVA 3T5MA 3TLGA 4W9YA 2DIKA 4CDJA 4LQGA 3D7DA 4TWEA 5F1YA 1WVMA 3TLCA 2C6CA 4CO9A 4IIXA 4NGPA 1CE8B 4C9EA 5ELYA 2EZBA 4C84A 1NXJA 1C30B 4OC5A 4C9VA 3C8OA 2X0SA 1Q5XA 4P4BA 1M6VB 2AUNA 4YN3A 2PCNA 4C8TA 2B0AA 2PVWA 3FEEA 4M8DA 4P45A 3T05A 3TLGB 1VI4A 3GJZA 4CZ1A 4E5SA 5JVLA 1DE4C 2C6PA 2OLSA 1NBWA 4NGTA 2AUMA 3TLBA 3G23A 5F09A 1J3LA 3SR3A 3TYXA 3EZAA 3I74A 1JDBC 5K99A 3T07A 1CS0B 3T0TA 1ZYMA 3FECA 2OR4A 3S9LA 1VBGA 1ZRSA 2YJTA 2HWGA 2XEIA 3I6SA 5D29A 3K4IA 3EZEA 1DIKA 3BHXA 3D7FA 4P4JA 1Z8LA 1XF1A 3ICUA 3U1BA 3SJGA 4OC4A 4P4EA 4H1HA 3TLEA 3VTAA 1KC7A 2PVVA 4P4FA 4TJVA 5JYBA 4OC1A 4MCQA 3TLYA 5F5XA 4C9AA 4P44A 3D7HA 4JZ0A 3FF3A 5IB9A 1CX8A 1ZL0A 4OC0A 1C3OB 2C5QA 4JYWA 2OOTA 3KRVA 3RBUA 5IR2A 4JVOA 3BI0A 4C86A 2EZCA 3KASA 2D0OA 3BXMA 4P4IA 3IIBA 2HROA 1A9XB 1BXRB 4NGMA 3K9TA 2CIJA 3IWWA 3BI1A 4MCSA 4COBA 2HI6A 4TJXA 3S9MA 2R82A 2GP4A
chains in the Genus database with same CATH topology
2EK9A 2XEGA 4C8UA 4OC3A 4C9UA 1Y9ZA 3SJXA 3S9NA 4C8PA 3EIFA 2XEJA 1V6CA 4P4DA 4NGNA 2EK8A 2XEFA 3FEDA 3SJEA 4C8AA 4C8FA 4NGRA 4MCPA 2JBJA 4X3RA 4OC2A 4C99A 4KNGE 2JBKA 4C8CA 4NGQA 4NGSA 3D7GA 4CDKA 4C9RA 4C85A 4OMEA 4MCRA 2C6GA 3SJFA 4W9YA 4CDJA 4LQGA 3D7DA 4TWEA 1WVMA 2C6CA 4NGPA 4C9EA 5ELYA 4C84A 4OC5A 4C9VA 4P4BA 4YN3A 4C8TA 2PVWA 3FEEA 4P45A 1DE4C 2C6PA 4NGTA 5F09A 3I74A 3S9LA 3FECA 2OR4A 2XEIA 3I6SA 5D29A 3BHXA 3D7FA 4P4JA 1Z8LA 1XF1A 3ICUA 4OC4A 4P4EA 3VTAA 2PVVA 4P4FA 4TJVA 4OC1A 4MCQA 4C9AA 4P44A 3D7HA 4JZ0A 3FF3A 5IB9A 1CX8A 4OC0A 4JYWA 2C5QA 2OOTA 3RBUA 5IR2A 3BI0A 4C86A 3KASA 3BXMA 4P4IA 3IIBA 4NGMA 3K9TA 2CIJA 3IWWA 3BI1A 4MCSA 4TJXA 3S9MA 3SJGA 2GP4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EK9 A;  2XEG A;  4C8U A;  4OC3 A;  4C9U A;  1Y9Z A;  3SJX A;  3S9N A;  4C8P A;  3EIF A;  2XEJ A;  1V6C A;  4P4D A;  4NGN A;  2EK8 A;  2XEF A;  3FED A;  3SJE A;  4C8A A;  4C8F A;  4NGR A;  4MCP A;  2JBJ A;  4X3R A;  4OC2 A;  4C99 A;  4KNG E;  2JBK A;  4C8C A;  4NGQ A;  4NGS A;  3D7G A;  4CDK A;  4C9R A;  4C85 A;  4OME A;  4MCR A;  2C6G A;  3SJF A;  4W9Y A;  4CDJ A;  4LQG A;  3D7D A;  4TWE A;  1WVM A;  2C6C A;  4NGP A;  4C9E A;  5ELY A;  4C84 A;  4OC5 A;  4C9V A;  4P4B A;  4YN3 A;  4C8T A;  2PVW A;  3FEE A;  4P45 A;  1DE4 C;  2C6P A;  4NGT A;  5F09 A;  3I74 A;  3FEC A;  2OR4 A;  2XEI A;  3I6S A;  5D29 A;  3BHX A;  3D7F A;  4P4J A;  1Z8L A;  1XF1 A;  3ICU A;  4OC4 A;  4P4E A;  3VTA A;  2PVV A;  4P4F A;  4TJV A;  4OC1 A;  4MCQ A;  4C9A A;  4P44 A;  3D7H A;  4JZ0 A;  3FF3 A;  5IB9 A;  1CX8 A;  4OC0 A;  4JYW A;  2OOT A;  3RBU A;  3BI0 A;  4C86 A;  3KAS A;  3BXM A;  4P4I A;  3IIB A;  4NGM A;  2CIJ A;  3IWW A;  3BI1 A;  4MCS A;  4TJX A;  3S9M A;  3SJG A;  3S9L A; 
#chains in the Genus database with same CATH topology
 4INJ A;  1JDE A;  2D0P A;  2EZA A;  5FD8 A;  2EK9 A;  2XEG A;  4MJX A;  4C8U A;  2E28 A;  4OC3 A;  1GGO A;  3TLZ A;  4C9U A;  4EYS A;  1Y9Z A;  3SJX A;  3TLA A;  3S9N A;  4C8P A;  3EIF A;  4E94 A;  2XEJ A;  1V6C A;  4P4D A;  1R61 A;  4NGN A;  1T36 B;  2EK8 A;  2XEF A;  3FED A;  1EZB A;  5F9M A;  4J0N A;  3SJE A;  1EZA A;  4C8A A;  4C8F A;  4NGR A;  4MCP A;  2JBJ A;  4X3R A;  4COG A;  4OC2 A;  4C99 A;  4KNG E;  1KBL A;  2JBK A;  4MI1 A;  4C8C A;  4NGQ A;  4NGS A;  2MP0 A;  3D7G A;  4CDK A;  4C9R A;  1KEE B;  1VBH A;  4C85 A;  4OME A;  4IIY A;  3EZB A;  4MCR A;  2C6G A;  2FM4 A;  3NOJ A;  3SJF A;  2YJV A;  3T5M A;  3TLG A;  4W9Y A;  2DIK A;  4CDJ A;  4LQG A;  3D7D A;  4TWE A;  5F1Y A;  1WVM A;  3TLC A;  2C6C A;  4CO9 A;  4IIX A;  4NGP A;  1CE8 B;  4C9E A;  5ELY A;  2EZB A;  4C84 A;  1NXJ A;  1C30 B;  4OC5 A;  4C9V A;  3C8O A;  2X0S A;  1Q5X A;  4P4B A;  1M6V B;  2AUN A;  4YN3 A;  2PCN A;  4C8T A;  2B0A A;  2PVW A;  3FEE A;  4M8D A;  4P45 A;  3T05 A;  3TLG B;  1VI4 A;  3GJZ A;  4CZ1 A;  4E5S A;  5JVL A;  1DE4 C;  2C6P A;  2OLS A;  1NBW A;  4NGT A;  2AUM A;  3TLB A;  3G23 A;  5F09 A;  1J3L A;  3SR3 A;  3TYX A;  3EZA A;  3I74 A;  1JDB C;  5K99 A;  3T07 A;  1CS0 B;  3T0T A;  1ZYM A;  3FEC A;  2OR4 A;  3S9L A;  1VBG A;  1ZRS A;  2YJT A;  2HWG A;  2XEI A;  3I6S A;  5D29 A;  3K4I A;  3EZE A;  1DIK A;  3BHX A;  3D7F A;  4P4J A;  1Z8L A;  1XF1 A;  3ICU A;  3U1B A;  3SJG A;  4OC4 A;  4P4E A;  4H1H A;  3TLE A;  3VTA A;  1KC7 A;  2PVV A;  4P4F A;  4TJV A;  5JYB A;  4OC1 A;  4MCQ A;  3TLY A;  5F5X A;  4C9A A;  4P44 A;  3D7H A;  4JZ0 A;  3FF3 A;  5IB9 A;  1CX8 A;  1ZL0 A;  4OC0 A;  1C3O B;  2C5Q A;  4JYW A;  2OOT A;  3KRV A;  3RBU A;  5IR2 A;  4JVO A;  3BI0 A;  4C86 A;  2EZC A;  3KAS A;  2D0O A;  3BXM A;  4P4I A;  3IIB A;  2HRO A;  1A9X B;  1BXR B;  4NGM A;  3K9T A;  2CIJ A;  3IWW A;  3BI1 A;  4MCS A;  4COB A;  2HI6 A;  4TJX A;  3S9M A;  2R82 A;  2GP4 A; 
#chains in the Genus database with same CATH homology
 2EK9 A;  2XEG A;  4C8U A;  4OC3 A;  4C9U A;  1Y9Z A;  3SJX A;  3S9N A;  4C8P A;  3EIF A;  2XEJ A;  1V6C A;  4P4D A;  4NGN A;  2EK8 A;  2XEF A;  3FED A;  3SJE A;  4C8A A;  4C8F A;  4NGR A;  4MCP A;  2JBJ A;  4X3R A;  4OC2 A;  4C99 A;  4KNG E;  2JBK A;  4C8C A;  4NGQ A;  4NGS A;  3D7G A;  4CDK A;  4C9R A;  4C85 A;  4OME A;  4MCR A;  2C6G A;  3SJF A;  4W9Y A;  4CDJ A;  4LQG A;  3D7D A;  4TWE A;  1WVM A;  2C6C A;  4NGP A;  4C9E A;  5ELY A;  4C84 A;  4OC5 A;  4C9V A;  4P4B A;  4YN3 A;  4C8T A;  2PVW A;  3FEE A;  4P45 A;  1DE4 C;  2C6P A;  4NGT A;  5F09 A;  3I74 A;  3S9L A;  3FEC A;  2OR4 A;  2XEI A;  3I6S A;  5D29 A;  3BHX A;  3D7F A;  4P4J A;  1Z8L A;  1XF1 A;  3ICU A;  4OC4 A;  4P4E A;  3VTA A;  2PVV A;  4P4F A;  4TJV A;  4OC1 A;  4MCQ A;  4C9A A;  4P44 A;  3D7H A;  4JZ0 A;  3FF3 A;  5IB9 A;  1CX8 A;  4OC0 A;  4JYW A;  2C5Q A;  2OOT A;  3RBU A;  5IR2 A;  3BI0 A;  4C86 A;  3KAS A;  3BXM A;  4P4I A;  3IIB A;  4NGM A;  3K9T A;  2CIJ A;  3IWW A;  3BI1 A;  4MCS A;  4TJX A;  3S9M A;  3SJG A;  2GP4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...