4C9VA

Xenopus rnf43 ectodomain in complex with xenopus rspo2 fu1-fu2
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
148
structure length
125
Chain Sequence
VKALIRVTPLNLTLEGLFARVAEISPAEGRLLQFHPLSLCNTKPGFISIVKLETPCLSLANKARLAGERGAHAVLFDITNDRGALQQLQQPAGINQPVVLIWGPDAEKLMDVVNKNKEALVKIEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb
source organism Xenopus (silurana) tropicalis
molecule tags Signaling protein
molecule keywords RNF43
total genus 29
structure length 125
sequence length 148
ec nomenclature
pdb deposition date 2013-10-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4c9vA00
2XEGA 3D7FA 3SJGA 4C9AA 2XEFA 5ELYA 4TJVA 4C9RA 4CDJA 2OOTA 1WVMA 4P4DA 5IB9A 4LQGA 3S9NA 4X3RA 4KNGE 3IWWA 3FEDA 4NGNA 2PVWA 4CDKA 2XEIA 4C8TA 4OC0A 4C9EA 3I6SA 4P4FA 1V6CA 4C8UA 4MCQA 4W9YA 4C8FA 4NGTA 4OC4A 3EIFA 2C6CA 3BI1A 4C99A 4P4JA 2C6GA 2PVVA 3SJXA 4OC1A 2C6PA 1XF1A 2OR4A 3KASA 4NGQA 5F09A 4NGMA 1Y9ZA 3BHXA 3FECA 3FF3A 4C86A 2JBJA 3FEEA 4P4BA 4C85A 4JYWA 4NGRA 4OC2A 4C8CA 1DE4C 3S9MA 4P4IA 3S9LA 3ICUA 2XEJA 4C8PA 2EK8A 4TJXA 4NGSA 3SJFA 4P45A 2JBKA 3D7DA 4C84A 4P44A 3IIBA 3VTAA 4OC5A 5D29A 4C8AA 4OMEA 4C9VA 3BI0A 3RBUA 1CX8A 4C9UA 4YN3A 3BXMA 2CIJA 2EK9A 3SJEA 4OC3A 3I74A 4TWEA 4P4EA 4NGPA 4MCPA 3D7HA 4MCRA 4MCSA 3D7GA 4JZ0A 1Z8LA
chains in the Genus database with same CATH superfamily
2EZCA 3G23A 2XEGA 3D7FA 3SJGA 4CO9A 1KBLA 4C9AA 1Q5XA 3TLZA 1BXRB 2XEFA 5ELYA 3TLBA 4TJVA 1KEEB 4C9RA 4CDJA 2R82A 2OOTA 4E5SA 4J0NA 1NXJA 1WVMA 4P4DA 1GGOA 1EZAA 1CE8B 5IB9A 2OLSA 4LQGA 3S9NA 4IIXA 1NBWA 1CS0B 2PCNA 4X3RA 2E28A 4KNGE 3IWWA 3FEDA 4NGNA 2FM4A 3EZEA 2PVWA 3TLGA 4CDKA 2XEIA 4IIYA 2HWGA 2YJTA 1EZBA 4C8TA 4OC0A 4C9EA 3TLGB 3I6SA 4P4FA 1V6CA 1C30B 5K99A 4C8UA 4MCQA 1ZRSA 4W9YA 4COGA 4C8FA 1ZL0A 3C8OA 3K9TA 4NGTA 4E94A 4OC4A 3T07A 3EIFA 5F1YA 1J3LA 2C6CA 3BI1A 5JYBA 2GP4A 3U1BA 2D0PA 2MP0A 4C99A 5IR2A 4P4JA 2C6GA 3SR3A 3TYXA 2PVVA 3T5MA 3SJXA 1T36B 4OC1A 3NOJA 2C6PA 1XF1A 3T05A 4COBA 2OR4A 3KASA 4JVOA 4NGQA 3T0TA 5F09A 4NGMA 5F5XA 1Y9ZA 3BHXA 1DIKA 1VBGA 3FECA 3FF3A 4C86A 5FD8A 2JBJA 1JDBC 3FEEA 4EYSA 2YJVA 4P4BA 4C85A 4JYWA 4NGRA 4OC2A 4C8CA 5JVLA 1DE4C 1R61A 3S9MA 4P4IA 3S9LA 3ICUA 2XEJA 4C8PA 2EK8A 4TJXA 4M8DA 4NGSA 3SJFA 4P45A 3GJZA 2AUMA 2JBKA 3D7DA 2AUNA 4C84A 2B0AA 4P44A 3IIBA 3VTAA 4OC5A 4MI1A 4H1HA 1C3OB 3TLYA 2HI6A 5D29A 3TLAA 4C8AA 1VBHA 2C5QA 3EZBA 4OMEA 4C9VA 5F9MA 3BI0A 1VI4A 2HROA 4MJXA 3RBUA 2EZBA 3EZAA 1CX8A 1M6VB 2DIKA 2X0SA 4C9UA 4YN3A 3TLCA 3BXMA 3TLEA 3K4IA 2CIJA 2EK9A 1KC7A 3SJEA 1ZYMA 2D0OA 4OC3A 4CZ1A 2EZAA 3I74A 3KRVA 4TWEA 4P4EA 4NGPA 4MCPA 1A9XB 3D7HA 4INJA 4MCRA 4MCSA 1JDEA 3D7GA 4JZ0A 1Z8LA
chains in the Genus database with same CATH topology
2XEGA 3D7FA 3SJGA 4C9AA 2XEFA 5ELYA 4TJVA 4C9RA 4CDJA 2OOTA 1WVMA 4P4DA 5IB9A 4LQGA 3S9NA 4X3RA 4KNGE 3IWWA 3FEDA 4NGNA 2PVWA 4CDKA 2XEIA 4C8TA 4OC0A 4C9EA 3I6SA 4P4FA 1V6CA 4C8UA 4MCQA 4W9YA 4C8FA 4NGTA 3K9TA 4OC4A 3EIFA 2C6CA 3BI1A 2GP4A 4C99A 5IR2A 4P4JA 2C6GA 2PVVA 3SJXA 4OC1A 2C6PA 1XF1A 2OR4A 3KASA 4NGQA 5F09A 4NGMA 1Y9ZA 3BHXA 3FECA 3FF3A 4C86A 2JBJA 3FEEA 4P4BA 4C85A 4JYWA 4NGRA 4OC2A 4C8CA 1DE4C 3S9MA 4P4IA 3S9LA 3ICUA 2XEJA 4C8PA 2EK8A 4TJXA 4NGSA 3SJFA 4P45A 2JBKA 3D7DA 4C84A 4P44A 3IIBA 3VTAA 4OC5A 5D29A 4C8AA 2C5QA 4OMEA 4C9VA 3BI0A 3RBUA 1CX8A 4C9UA 4YN3A 3BXMA 2CIJA 2EK9A 3SJEA 4OC3A 3I74A 4TWEA 4P4EA 4NGPA 4MCPA 3D7HA 4MCRA 4MCSA 3D7GA 4JZ0A 1Z8LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XEG A;  3D7F A;  3SJG A;  4C9A A;  2XEF A;  5ELY A;  4TJV A;  4C9R A;  4CDJ A;  2OOT A;  1WVM A;  4P4D A;  5IB9 A;  4LQG A;  3S9N A;  4X3R A;  4KNG E;  3IWW A;  3FED A;  4NGN A;  2PVW A;  4CDK A;  2XEI A;  4C8T A;  4OC0 A;  4C9E A;  3I6S A;  4P4F A;  1V6C A;  4C8U A;  4MCQ A;  4W9Y A;  4C8F A;  4NGT A;  4OC4 A;  3EIF A;  2C6C A;  3BI1 A;  4C99 A;  4P4J A;  2C6G A;  2PVV A;  3SJX A;  4OC1 A;  2C6P A;  1XF1 A;  2OR4 A;  3KAS A;  4NGQ A;  5F09 A;  4NGM A;  1Y9Z A;  3BHX A;  3FEC A;  3FF3 A;  4C86 A;  2JBJ A;  3FEE A;  4P4B A;  4C85 A;  4JYW A;  4NGR A;  4OC2 A;  4C8C A;  1DE4 C;  3S9M A;  4P4I A;  3S9L A;  3ICU A;  2XEJ A;  4C8P A;  2EK8 A;  4TJX A;  4NGS A;  3SJF A;  4P45 A;  2JBK A;  3D7D A;  4C84 A;  4P44 A;  3IIB A;  3VTA A;  4OC5 A;  5D29 A;  4C8A A;  4OME A;  4C9V A;  3BI0 A;  3RBU A;  1CX8 A;  4C9U A;  4YN3 A;  3BXM A;  2CIJ A;  2EK9 A;  3SJE A;  4OC3 A;  3I74 A;  4TWE A;  4P4E A;  4NGP A;  4MCP A;  3D7H A;  4MCR A;  4MCS A;  3D7G A;  4JZ0 A;  1Z8L A; 
#chains in the Genus database with same CATH topology
 2EZC A;  3G23 A;  2XEG A;  3D7F A;  3SJG A;  4CO9 A;  1KBL A;  4C9A A;  1Q5X A;  3TLZ A;  1BXR B;  2XEF A;  5ELY A;  3TLB A;  4TJV A;  1KEE B;  4C9R A;  4CDJ A;  2R82 A;  2OOT A;  4E5S A;  4J0N A;  1NXJ A;  1WVM A;  4P4D A;  1GGO A;  1EZA A;  1CE8 B;  5IB9 A;  2OLS A;  4LQG A;  3S9N A;  4IIX A;  1NBW A;  1CS0 B;  2PCN A;  4X3R A;  2E28 A;  4KNG E;  3IWW A;  3FED A;  4NGN A;  2FM4 A;  3EZE A;  2PVW A;  3TLG A;  4CDK A;  2XEI A;  4IIY A;  2HWG A;  2YJT A;  1EZB A;  4C8T A;  4OC0 A;  4C9E A;  3TLG B;  3I6S A;  4P4F A;  1V6C A;  1C30 B;  5K99 A;  4C8U A;  4MCQ A;  1ZRS A;  4W9Y A;  4COG A;  4C8F A;  1ZL0 A;  3C8O A;  3K9T A;  4NGT A;  4E94 A;  4OC4 A;  3T07 A;  3EIF A;  5F1Y A;  1J3L A;  2C6C A;  3BI1 A;  5JYB A;  2GP4 A;  3U1B A;  2D0P A;  2MP0 A;  4C99 A;  5IR2 A;  4P4J A;  2C6G A;  3SR3 A;  3TYX A;  2PVV A;  3T5M A;  3SJX A;  1T36 B;  4OC1 A;  3NOJ A;  2C6P A;  1XF1 A;  3T05 A;  4COB A;  2OR4 A;  3KAS A;  4JVO A;  4NGQ A;  3T0T A;  5F09 A;  4NGM A;  5F5X A;  1Y9Z A;  3BHX A;  1DIK A;  1VBG A;  3FEC A;  3FF3 A;  4C86 A;  5FD8 A;  2JBJ A;  1JDB C;  3FEE A;  4EYS A;  2YJV A;  4P4B A;  4C85 A;  4JYW A;  4NGR A;  4OC2 A;  4C8C A;  5JVL A;  1DE4 C;  1R61 A;  3S9M A;  4P4I A;  3S9L A;  3ICU A;  2XEJ A;  4C8P A;  2EK8 A;  4TJX A;  4M8D A;  4NGS A;  3SJF A;  4P45 A;  3GJZ A;  2AUM A;  2JBK A;  3D7D A;  2AUN A;  4C84 A;  2B0A A;  4P44 A;  3IIB A;  3VTA A;  4OC5 A;  4MI1 A;  4H1H A;  1C3O B;  3TLY A;  2HI6 A;  5D29 A;  3TLA A;  4C8A A;  1VBH A;  2C5Q A;  3EZB A;  4OME A;  4C9V A;  5F9M A;  3BI0 A;  1VI4 A;  2HRO A;  4MJX A;  3RBU A;  2EZB A;  3EZA A;  1CX8 A;  1M6V B;  2DIK A;  2X0S A;  4C9U A;  4YN3 A;  3TLC A;  3BXM A;  3TLE A;  3K4I A;  2CIJ A;  2EK9 A;  1KC7 A;  3SJE A;  1ZYM A;  2D0O A;  4OC3 A;  4CZ1 A;  2EZA A;  3I74 A;  3KRV A;  4TWE A;  4P4E A;  4NGP A;  4MCP A;  1A9X B;  3D7H A;  4INJ A;  4MCR A;  4MCS A;  1JDE A;  3D7G A;  4JZ0 A;  1Z8L A; 
#chains in the Genus database with same CATH homology
 2XEG A;  3D7F A;  3SJG A;  4C9A A;  2XEF A;  5ELY A;  4TJV A;  4C9R A;  4CDJ A;  2OOT A;  1WVM A;  4P4D A;  5IB9 A;  4LQG A;  3S9N A;  4X3R A;  4KNG E;  3IWW A;  3FED A;  4NGN A;  2PVW A;  4CDK A;  2XEI A;  4C8T A;  4OC0 A;  4C9E A;  3I6S A;  4P4F A;  1V6C A;  4C8U A;  4MCQ A;  4W9Y A;  4C8F A;  4NGT A;  3K9T A;  4OC4 A;  3EIF A;  2C6C A;  3BI1 A;  2GP4 A;  4C99 A;  5IR2 A;  4P4J A;  2C6G A;  2PVV A;  3SJX A;  4OC1 A;  2C6P A;  1XF1 A;  2OR4 A;  3KAS A;  4NGQ A;  5F09 A;  4NGM A;  1Y9Z A;  3BHX A;  3FEC A;  3FF3 A;  4C86 A;  2JBJ A;  3FEE A;  4P4B A;  4C85 A;  4JYW A;  4NGR A;  4OC2 A;  4C8C A;  1DE4 C;  3S9M A;  4P4I A;  3S9L A;  3ICU A;  2XEJ A;  4C8P A;  2EK8 A;  4TJX A;  4NGS A;  3SJF A;  4P45 A;  2JBK A;  3D7D A;  4C84 A;  4P44 A;  3IIB A;  3VTA A;  4OC5 A;  5D29 A;  4C8A A;  2C5Q A;  4OME A;  4C9V A;  3BI0 A;  3RBU A;  1CX8 A;  4C9U A;  4YN3 A;  3BXM A;  2CIJ A;  2EK9 A;  3SJE A;  4OC3 A;  3I74 A;  4TWE A;  4P4E A;  4NGP A;  4MCP A;  3D7H A;  4MCR A;  4MCS A;  3D7G A;  4JZ0 A;  1Z8L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...