4C8FA

Mouse znrf3 ectodomain crystal form iv
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
151
structure length
137
Chain Sequence
ETAFVEVVLFESSPSGDYTTHTTGLTGRFSRAGAMLSAEGEIVQMYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
publication title Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb
source organism Mus musculus
total genus 32
structure length 137
sequence length 151
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4c8fA00
4OC2A 4C8TA 3SJEA 4MCRA 2JBKA 4C9EA 1WVMA 3IIBA 3FECA 3S9LA 2PVVA 1V6CA 3S9NA 4NGQA 4P4BA 3D7FA 4C9AA 3BHXA 4C9RA 3FEEA 4C84A 4C8AA 4C99A 1XF1A 2XEJA 3IWWA 4YN3A 3D7HA 3BI0A 4C8PA 3SJXA 3ICUA 4JYWA 4C8UA 4LQGA 5IB9A 3RBUA 4MCPA 3SJGA 1CX8A 4C8FA 4NGMA 2PVWA 1Y9ZA 4P4FA 3FEDA 4NGRA 4W9YA 4X3RA 3VTAA 3S9MA 4C9UA 4NGPA 2CIJA 3D7DA 4C86A 2C6CA 1DE4C 4TWEA 4OMEA 4C8CA 4NGSA 3I74A 4P4DA 5ELYA 5D29A 1Z8LA 2EK9A 2XEFA 4C85A 3EIFA 2JBJA 4C9VA 3KASA 4TJVA 3BXMA 2C6PA 4OC0A 4CDKA 4CDJA 4P44A 4P4JA 4P4IA 4TJXA 2EK8A 4NGNA 2C6GA 4P4EA 3I6SA 4OC4A 2XEGA 4P45A 3FF3A 4JZ0A 4OC1A 3BI1A 2OOTA 2XEIA 3D7GA 4OC5A 4KNGE 4MCSA 5F09A 3SJFA 4NGTA 4MCQA 4OC3A 2OR4A
chains in the Genus database with same CATH superfamily
4OC2A 4C8TA 1T36B 1CS0B 5JVLA 2DIKA 1A9XB 3TLZA 5JYBA 2EZAA 3SJEA 1DIKA 3G23A 2JBKA 4MCRA 5IR2A 4H1HA 4EYSA 4C9EA 1J3LA 1WVMA 3IIBA 3T05A 3FECA 3TLCA 3T0TA 3S9LA 2PVVA 1V6CA 3S9NA 1NBWA 4NGQA 4P4BA 3D7FA 4C9AA 3BHXA 1GGOA 3EZAA 3EZBA 4OC3A 4C9RA 3TLBA 3FEEA 4C84A 1EZBA 4C8AA 5F9MA 2OLSA 4C99A 1XF1A 5K99A 3SR3A 2AUMA 2XEJA 3IWWA 4YN3A 1KBLA 3K4IA 2HWGA 3D7HA 3BI0A 2YJVA 1NXJA 2D0OA 4C8PA 3SJXA 3ICUA 4JYWA 4C8UA 1VBHA 5IB9A 3RBUA 4MCPA 1C30B 2X0SA 3SJGA 4MI1A 1CX8A 4C8FA 4NGMA 1Y9ZA 2PVWA 3EZEA 4P4FA 1ZRSA 3FEDA 4NGRA 4W9YA 4COGA 2AUNA 2C5QA 4X3RA 1VBGA 3U1BA 4IIYA 5FD8A 3VTAA 3S9MA 4C9UA 4NGPA 2CIJA 2D0PA 1BXRB 3D7DA 4C86A 2C6CA 1DE4C 4TWEA 3NOJA 3C8OA 4INJA 4JVOA 4OMEA 1JDEA 3TLGB 4C8CA 2YJTA 4NGSA 3I74A 4COBA 4P4DA 3TLGA 4E5SA 5ELYA 2MP0A 3K9TA 5D29A 1Z8LA 2EK9A 4CZ1A 2XEFA 4C85A 1Q5XA 2HROA 3EIFA 1R61A 2JBJA 4C9VA 5F5XA 1VI4A 2GP4A 3KASA 4CO9A 4TJVA 2R82A 3BXMA 1ZYMA 2C6PA 1KEEB 4J0NA 5F1YA 4OC0A 4CDKA 1KC7A 1JDBC 4CDJA 4IIXA 4P44A 4P4JA 3TLYA 4E94A 3TYXA 4MJXA 4P4IA 4TJXA 2EK8A 2FM4A 2C6GA 4NGNA 4P4EA 3TLEA 3I6SA 4OC4A 2XEGA 4M8DA 3GJZA 4P45A 3FF3A 1CE8B 2EZCA 4JZ0A 4OC1A 2PCNA 2E28A 3BI1A 2EZBA 2OOTA 1ZL0A 2XEIA 3D7GA 4OC5A 4KNGE 4MCSA 5F09A 1C3OB 3TLAA 3SJFA 3T07A 4NGTA 1M6VB 3T5MA 2HI6A 4MCQA 3KRVA 1EZAA 4LQGA 2B0AA 2OR4A
chains in the Genus database with same CATH topology
4OC2A 4C8TA 3SJEA 4MCRA 2JBKA 5IR2A 4C9EA 1WVMA 3IIBA 3FECA 3S9LA 2PVVA 1V6CA 3S9NA 4NGQA 4P4BA 3D7FA 4C9AA 3BHXA 4C9RA 3FEEA 4C84A 4C8AA 4C99A 1XF1A 2XEJA 3IWWA 4YN3A 3D7HA 3BI0A 4C8PA 3SJXA 3ICUA 4JYWA 4C8UA 4LQGA 5IB9A 3RBUA 4MCPA 3SJGA 1CX8A 4C8FA 4NGMA 1Y9ZA 2PVWA 4P4FA 3FEDA 4NGRA 4W9YA 2C5QA 4X3RA 3VTAA 3S9MA 4C9UA 4NGPA 2CIJA 3D7DA 4C86A 2C6CA 1DE4C 4TWEA 4OMEA 4C8CA 4NGSA 3I74A 4P4DA 5ELYA 3K9TA 5D29A 1Z8LA 2EK9A 2XEFA 4C85A 3EIFA 2JBJA 4C9VA 2GP4A 3KASA 4TJVA 3BXMA 2C6PA 4OC0A 4CDKA 4CDJA 4P44A 4P4JA 4P4IA 4TJXA 2EK8A 4NGNA 2C6GA 4P4EA 3I6SA 4OC4A 2XEGA 4P45A 3FF3A 4JZ0A 4OC1A 3BI1A 2OOTA 2XEIA 3D7GA 4OC5A 4KNGE 4MCSA 5F09A 3SJFA 4NGTA 4MCQA 4OC3A 2OR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OC2 A;  4C8T A;  3SJE A;  4MCR A;  2JBK A;  4C9E A;  1WVM A;  3IIB A;  3FEC A;  3S9L A;  2PVV A;  1V6C A;  3S9N A;  4NGQ A;  4P4B A;  3D7F A;  4C9A A;  3BHX A;  4C9R A;  3FEE A;  4C84 A;  4C8A A;  4C99 A;  1XF1 A;  2XEJ A;  3IWW A;  4YN3 A;  3D7H A;  3BI0 A;  4C8P A;  3SJX A;  3ICU A;  4JYW A;  4C8U A;  4LQG A;  5IB9 A;  3RBU A;  4MCP A;  3SJG A;  1CX8 A;  4C8F A;  4NGM A;  2PVW A;  1Y9Z A;  4P4F A;  3FED A;  4NGR A;  4W9Y A;  4X3R A;  3VTA A;  3S9M A;  4C9U A;  4NGP A;  2CIJ A;  3D7D A;  4C86 A;  2C6C A;  1DE4 C;  4TWE A;  4OME A;  4C8C A;  4NGS A;  3I74 A;  4P4D A;  5ELY A;  5D29 A;  1Z8L A;  2EK9 A;  2XEF A;  4C85 A;  3EIF A;  2JBJ A;  4C9V A;  3KAS A;  4TJV A;  3BXM A;  2C6P A;  4OC0 A;  4CDK A;  4CDJ A;  4P44 A;  4P4J A;  4P4I A;  4TJX A;  2EK8 A;  4NGN A;  2C6G A;  4P4E A;  3I6S A;  4OC4 A;  2XEG A;  4P45 A;  3FF3 A;  4JZ0 A;  4OC1 A;  3BI1 A;  2OOT A;  2XEI A;  3D7G A;  4OC5 A;  4KNG E;  4MCS A;  5F09 A;  3SJF A;  4NGT A;  4MCQ A;  4OC3 A;  2OR4 A; 
#chains in the Genus database with same CATH topology
 4OC2 A;  4C8T A;  1T36 B;  1CS0 B;  5JVL A;  2DIK A;  1A9X B;  3TLZ A;  5JYB A;  2EZA A;  3SJE A;  1DIK A;  3G23 A;  2JBK A;  4MCR A;  5IR2 A;  4H1H A;  4EYS A;  4C9E A;  1J3L A;  1WVM A;  3IIB A;  3T05 A;  3FEC A;  3TLC A;  3T0T A;  3S9L A;  2PVV A;  1V6C A;  3S9N A;  1NBW A;  4NGQ A;  4P4B A;  3D7F A;  4C9A A;  3BHX A;  1GGO A;  3EZA A;  3EZB A;  4OC3 A;  4C9R A;  3TLB A;  3FEE A;  4C84 A;  1EZB A;  4C8A A;  5F9M A;  2OLS A;  4C99 A;  1XF1 A;  5K99 A;  3SR3 A;  2AUM A;  2XEJ A;  3IWW A;  4YN3 A;  1KBL A;  3K4I A;  2HWG A;  3D7H A;  3BI0 A;  2YJV A;  1NXJ A;  2D0O A;  4C8P A;  3SJX A;  3ICU A;  4JYW A;  4C8U A;  1VBH A;  5IB9 A;  3RBU A;  4MCP A;  1C30 B;  2X0S A;  3SJG A;  4MI1 A;  1CX8 A;  4C8F A;  4NGM A;  1Y9Z A;  2PVW A;  3EZE A;  4P4F A;  1ZRS A;  3FED A;  4NGR A;  4W9Y A;  4COG A;  2AUN A;  2C5Q A;  4X3R A;  1VBG A;  3U1B A;  4IIY A;  5FD8 A;  3VTA A;  3S9M A;  4C9U A;  4NGP A;  2CIJ A;  2D0P A;  1BXR B;  3D7D A;  4C86 A;  2C6C A;  1DE4 C;  4TWE A;  3NOJ A;  3C8O A;  4INJ A;  4JVO A;  4OME A;  1JDE A;  3TLG B;  4C8C A;  2YJT A;  4NGS A;  3I74 A;  4COB A;  4P4D A;  3TLG A;  4E5S A;  5ELY A;  2MP0 A;  3K9T A;  5D29 A;  1Z8L A;  2EK9 A;  4CZ1 A;  2XEF A;  4C85 A;  1Q5X A;  2HRO A;  3EIF A;  1R61 A;  2JBJ A;  4C9V A;  5F5X A;  1VI4 A;  2GP4 A;  3KAS A;  4CO9 A;  4TJV A;  2R82 A;  3BXM A;  1ZYM A;  2C6P A;  1KEE B;  4J0N A;  5F1Y A;  4OC0 A;  4CDK A;  1KC7 A;  1JDB C;  4CDJ A;  4IIX A;  4P44 A;  4P4J A;  3TLY A;  4E94 A;  3TYX A;  4MJX A;  4P4I A;  4TJX A;  2EK8 A;  2FM4 A;  2C6G A;  4NGN A;  4P4E A;  3TLE A;  3I6S A;  4OC4 A;  2XEG A;  4M8D A;  3GJZ A;  4P45 A;  3FF3 A;  1CE8 B;  2EZC A;  4JZ0 A;  4OC1 A;  2PCN A;  2E28 A;  3BI1 A;  2EZB A;  2OOT A;  1ZL0 A;  2XEI A;  3D7G A;  4OC5 A;  4KNG E;  4MCS A;  5F09 A;  1C3O B;  3TLA A;  3SJF A;  3T07 A;  4NGT A;  1M6V B;  3T5M A;  2HI6 A;  4MCQ A;  3KRV A;  1EZA A;  4LQG A;  2B0A A;  2OR4 A; 
#chains in the Genus database with same CATH homology
 4OC2 A;  4C8T A;  3SJE A;  4MCR A;  2JBK A;  5IR2 A;  4C9E A;  1WVM A;  3IIB A;  3FEC A;  3S9L A;  2PVV A;  1V6C A;  3S9N A;  4NGQ A;  4P4B A;  3D7F A;  4C9A A;  3BHX A;  4C9R A;  3FEE A;  4C84 A;  4C8A A;  4C99 A;  1XF1 A;  2XEJ A;  3IWW A;  4YN3 A;  3D7H A;  3BI0 A;  4C8P A;  3SJX A;  3ICU A;  4JYW A;  4C8U A;  4LQG A;  5IB9 A;  3RBU A;  4MCP A;  3SJG A;  1CX8 A;  4C8F A;  4NGM A;  1Y9Z A;  2PVW A;  4P4F A;  3FED A;  4NGR A;  4W9Y A;  2C5Q A;  4X3R A;  3VTA A;  3S9M A;  4C9U A;  4NGP A;  2CIJ A;  3D7D A;  4C86 A;  2C6C A;  1DE4 C;  4TWE A;  4OME A;  4C8C A;  4NGS A;  3I74 A;  4P4D A;  5ELY A;  3K9T A;  5D29 A;  1Z8L A;  2EK9 A;  2XEF A;  4C85 A;  3EIF A;  2JBJ A;  4C9V A;  2GP4 A;  3KAS A;  4TJV A;  3BXM A;  2C6P A;  4OC0 A;  4CDK A;  4CDJ A;  4P44 A;  4P4J A;  4P4I A;  4TJX A;  2EK8 A;  4NGN A;  2C6G A;  4P4E A;  3I6S A;  4OC4 A;  2XEG A;  4P45 A;  3FF3 A;  4JZ0 A;  4OC1 A;  3BI1 A;  2OOT A;  2XEI A;  3D7G A;  4OC5 A;  4KNG E;  4MCS A;  5F09 A;  3SJF A;  4NGT A;  4MCQ A;  4OC3 A;  2OR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...