4C8FA

Mouse znrf3 ectodomain crystal form iv
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
151
structure length
137
Chain Sequence
ETAFVEVVLFESSPSGDYTTHTTGLTGRFSRAGAMLSAEGEIVQMYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
total genus 32
structure length 137
sequence length 151
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4c8fA00
2JBKA 4C9AA 3BHXA 3IWWA 4TWEA 4P4JA 4C99A 4P4DA 4CDJA 2C6CA 4NGNA 4C84A 2EK8A 4C8CA 2EK9A 2JBJA 4P4BA 2XEGA 4NGQA 3FEEA 3SJXA 2C6PA 4OC4A 3S9LA 1XF1A 4C9RA 1DE4C 4C9VA 3ICUA 4KNGE 4NGTA 4OC5A 4OC1A 4C8FA 1Y9ZA 4C8AA 4OC0A 4NGMA 3S9NA 3FF3A 3SJGA 2OOTA 4OC2A 4JYWA 5IB9A 4MCQA 4OC3A 2XEJA 4P44A 5ELYA 3SJFA 4LQGA 1CX8A 4W9YA 4C8TA 4TJVA 4JZ0A 3FEDA 5D29A 3D7HA 4C9UA 4MCRA 4NGRA 3BXMA 4P4EA 4MCSA 3RBUA 3D7FA 1Z8LA 4MCPA 2OR4A 4C9EA 4C85A 1WVMA 3FECA 3I74A 4C86A 2C6GA 4X3RA 3IIBA 3BI1A 3BI0A 3VTAA 4NGPA 4YN3A 4CDKA 2PVWA 2XEFA 3EIFA 4OMEA 3KASA 3D7GA 4C8PA 4NGSA 4P4FA 5F09A 1V6CA 4TJXA 3SJEA 2CIJA 3S9MA 4C8UA 4P45A 4P4IA 3I6SA 2PVVA 2XEIA 3D7DA
chains in the Genus database with same CATH superfamily
2JBKA 2EZBA 4C9AA 3BHXA 3IWWA 4TWEA 4P4JA 2DIKA 4COBA 4C99A 4P4DA 4CDJA 2C6CA 4NGNA 1NXJA 2EK8A 4C84A 2EK9A 1VBGA 4C8CA 1VI4A 2AUNA 4J0NA 2JBJA 1JDBC 3T05A 5FD8A 2HI6A 3TLAA 3K9TA 4P4BA 3TLGB 1J3LA 3EZAA 1M6VB 2XEGA 4CZ1A 3U1BA 1C30B 4NGQA 3FEEA 5JVLA 4COGA 3SJXA 2C6PA 4OC4A 1EZBA 3S9LA 2D0OA 4EYSA 1XF1A 4C9RA 1DE4C 4M8DA 4C9VA 3ICUA 4KNGE 4NGTA 4OC5A 4OC1A 4INJA 1Y9ZA 3SR3A 4C8AA 4OC0A 4C8FA 1EZAA 4NGMA 3T07A 3S9NA 2AUMA 2X0SA 1R61A 5K99A 4E94A 3FF3A 3TLZA 3SJGA 2OOTA 2D0PA 4OC2A 4JYWA 3EZBA 3GJZA 4JVOA 5IB9A 4MCQA 1ZRSA 2OLSA 4OC3A 2XEJA 2B0AA 4P44A 5ELYA 3TLYA 4IIYA 3SJFA 4CO9A 1CS0B 4LQGA 1CX8A 4W9YA 4MI1A 1BXRB 2HROA 4TJVA 3T0TA 4JZ0A 3TLCA 4C8TA 3FEDA 5D29A 3D7HA 4C9UA 4MCRA 4NGRA 3BXMA 1KC7A 4P4EA 2YJTA 2PCNA 4MCSA 3RBUA 1JDEA 1Q5XA 3D7FA 1Z8LA 4MCPA 3TLEA 1VBHA 5F1YA 1ZYMA 2OR4A 4H1HA 4C9EA 4C85A 1WVMA 3FECA 3I74A 5IR2A 4C86A 2C6GA 4X3RA 2EZAA 3TLGA 3IIBA 4E5SA 3BI1A 5F5XA 3NOJA 3T5MA 1T36B 3BI0A 3K4IA 3VTAA 4NGPA 1DIKA 1GGOA 5F9MA 4YN3A 3KRVA 1NBWA 3TLBA 4CDKA 2PVWA 2XEFA 2YJVA 1CE8B 3EIFA 4OMEA 3KASA 3D7GA 4MJXA 2HWGA 4C8PA 1ZL0A 4NGSA 3G23A 4P4FA 5F09A 1V6CA 4IIXA 4TJXA 3SJEA 2CIJA 3S9MA 4C8UA 4P45A 4P4IA 2EZCA 3I6SA 3C8OA 3TYXA 5JYBA 2PVVA 1KEEB 2GP4A 2XEIA 1A9XB 2FM4A 1C3OB 2C5QA 2R82A 2E28A 2MP0A 3D7DA 3EZEA 1KBLA
chains in the Genus database with same CATH topology
2JBKA 4C9AA 3BHXA 3IWWA 4TWEA 4P4JA 4C99A 4P4DA 4CDJA 2C6CA 4NGNA 4C84A 2EK8A 4C8CA 2EK9A 2JBJA 3K9TA 4P4BA 2XEGA 4NGQA 3FEEA 3SJXA 2C6PA 4OC4A 3S9LA 1XF1A 4C9RA 1DE4C 4C9VA 3ICUA 4KNGE 4NGTA 4OC5A 4OC1A 4C8FA 1Y9ZA 4C8AA 4OC0A 4NGMA 3S9NA 3FF3A 3SJGA 2OOTA 4OC2A 4JYWA 5IB9A 4MCQA 4OC3A 2XEJA 4P44A 5ELYA 3SJFA 4LQGA 1CX8A 4W9YA 4C8TA 4TJVA 4JZ0A 3FEDA 5D29A 3D7HA 4C9UA 4MCRA 4NGRA 3BXMA 4P4EA 4MCSA 3RBUA 3D7FA 1Z8LA 4MCPA 2OR4A 4C9EA 4C85A 1WVMA 3FECA 3I74A 5IR2A 4C86A 2C6GA 4X3RA 3IIBA 3BI1A 3BI0A 3VTAA 4NGPA 4YN3A 4CDKA 2PVWA 2XEFA 3EIFA 4OMEA 3KASA 3D7GA 4C8PA 4NGSA 4P4FA 5F09A 1V6CA 4TJXA 3SJEA 2CIJA 3S9MA 4C8UA 4P45A 4P4IA 3I6SA 2PVVA 2GP4A 2XEIA 2C5QA 3D7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JBK A;  4C9A A;  3BHX A;  3IWW A;  4TWE A;  4P4J A;  4C99 A;  4P4D A;  4CDJ A;  2C6C A;  4NGN A;  4C84 A;  2EK8 A;  4C8C A;  2EK9 A;  2JBJ A;  4P4B A;  2XEG A;  4NGQ A;  3FEE A;  3SJX A;  2C6P A;  4OC4 A;  3S9L A;  1XF1 A;  4C9R A;  1DE4 C;  4C9V A;  3ICU A;  4KNG E;  4NGT A;  4OC5 A;  4OC1 A;  4C8F A;  1Y9Z A;  4C8A A;  4OC0 A;  4NGM A;  3S9N A;  3FF3 A;  3SJG A;  2OOT A;  4OC2 A;  4JYW A;  5IB9 A;  4MCQ A;  4OC3 A;  2XEJ A;  4P44 A;  5ELY A;  3SJF A;  4LQG A;  1CX8 A;  4W9Y A;  4C8T A;  4TJV A;  4JZ0 A;  3FED A;  5D29 A;  3D7H A;  4C9U A;  4MCR A;  4NGR A;  3BXM A;  4P4E A;  4MCS A;  3RBU A;  3D7F A;  1Z8L A;  4MCP A;  2OR4 A;  4C9E A;  4C85 A;  1WVM A;  3FEC A;  3I74 A;  4C86 A;  2C6G A;  4X3R A;  3IIB A;  3BI1 A;  3BI0 A;  3VTA A;  4NGP A;  4YN3 A;  4CDK A;  2PVW A;  2XEF A;  3EIF A;  4OME A;  3KAS A;  3D7G A;  4C8P A;  4NGS A;  4P4F A;  5F09 A;  1V6C A;  4TJX A;  3SJE A;  2CIJ A;  3S9M A;  4C8U A;  4P45 A;  4P4I A;  3I6S A;  2PVV A;  2XEI A;  3D7D A; 
#chains in the Genus database with same CATH topology
 2JBK A;  2EZB A;  4C9A A;  3BHX A;  3IWW A;  4TWE A;  4P4J A;  2DIK A;  4COB A;  4C99 A;  4P4D A;  4CDJ A;  2C6C A;  4NGN A;  1NXJ A;  2EK8 A;  4C84 A;  2EK9 A;  1VBG A;  4C8C A;  1VI4 A;  2AUN A;  4J0N A;  2JBJ A;  1JDB C;  3T05 A;  5FD8 A;  2HI6 A;  3TLA A;  3K9T A;  4P4B A;  3TLG B;  1J3L A;  3EZA A;  1M6V B;  2XEG A;  4CZ1 A;  3U1B A;  1C30 B;  4NGQ A;  3FEE A;  5JVL A;  4COG A;  3SJX A;  2C6P A;  4OC4 A;  1EZB A;  3S9L A;  2D0O A;  4EYS A;  1XF1 A;  4C9R A;  1DE4 C;  4M8D A;  4C9V A;  3ICU A;  4KNG E;  4NGT A;  4OC5 A;  4OC1 A;  4INJ A;  1Y9Z A;  3SR3 A;  4C8A A;  4OC0 A;  4C8F A;  1EZA A;  4NGM A;  3T07 A;  3S9N A;  2AUM A;  2X0S A;  1R61 A;  5K99 A;  4E94 A;  3FF3 A;  3TLZ A;  3SJG A;  2OOT A;  2D0P A;  4OC2 A;  4JYW A;  3EZB A;  3GJZ A;  4JVO A;  5IB9 A;  4MCQ A;  1ZRS A;  2OLS A;  4OC3 A;  2XEJ A;  2B0A A;  4P44 A;  5ELY A;  3TLY A;  4IIY A;  3SJF A;  4CO9 A;  1CS0 B;  4LQG A;  1CX8 A;  4W9Y A;  4MI1 A;  1BXR B;  2HRO A;  4TJV A;  3T0T A;  4JZ0 A;  3TLC A;  4C8T A;  3FED A;  5D29 A;  3D7H A;  4C9U A;  4MCR A;  4NGR A;  3BXM A;  1KC7 A;  4P4E A;  2YJT A;  2PCN A;  4MCS A;  3RBU A;  1JDE A;  1Q5X A;  3D7F A;  1Z8L A;  4MCP A;  3TLE A;  1VBH A;  5F1Y A;  1ZYM A;  2OR4 A;  4H1H A;  4C9E A;  4C85 A;  1WVM A;  3FEC A;  3I74 A;  5IR2 A;  4C86 A;  2C6G A;  4X3R A;  2EZA A;  3TLG A;  3IIB A;  4E5S A;  3BI1 A;  5F5X A;  3NOJ A;  3T5M A;  1T36 B;  3BI0 A;  3K4I A;  3VTA A;  4NGP A;  1DIK A;  1GGO A;  5F9M A;  4YN3 A;  3KRV A;  1NBW A;  3TLB A;  4CDK A;  2PVW A;  2XEF A;  2YJV A;  1CE8 B;  3EIF A;  4OME A;  3KAS A;  3D7G A;  4MJX A;  2HWG A;  4C8P A;  1ZL0 A;  4NGS A;  3G23 A;  4P4F A;  5F09 A;  1V6C A;  4IIX A;  4TJX A;  3SJE A;  2CIJ A;  3S9M A;  4C8U A;  4P45 A;  4P4I A;  2EZC A;  3I6S A;  3C8O A;  3TYX A;  5JYB A;  2PVV A;  1KEE B;  2GP4 A;  2XEI A;  1A9X B;  2FM4 A;  1C3O B;  2C5Q A;  2R82 A;  2E28 A;  2MP0 A;  3D7D A;  3EZE A;  1KBL A; 
#chains in the Genus database with same CATH homology
 2JBK A;  4C9A A;  3BHX A;  3IWW A;  4TWE A;  4P4J A;  4C99 A;  4P4D A;  4CDJ A;  2C6C A;  4NGN A;  4C84 A;  2EK8 A;  4C8C A;  2EK9 A;  2JBJ A;  3K9T A;  4P4B A;  2XEG A;  4NGQ A;  3FEE A;  3SJX A;  2C6P A;  4OC4 A;  3S9L A;  1XF1 A;  4C9R A;  1DE4 C;  4C9V A;  3ICU A;  4KNG E;  4NGT A;  4OC5 A;  4OC1 A;  4C8F A;  1Y9Z A;  4C8A A;  4OC0 A;  4NGM A;  3S9N A;  3FF3 A;  3SJG A;  2OOT A;  4OC2 A;  4JYW A;  5IB9 A;  4MCQ A;  4OC3 A;  2XEJ A;  4P44 A;  5ELY A;  3SJF A;  4LQG A;  1CX8 A;  4W9Y A;  4C8T A;  4TJV A;  4JZ0 A;  3FED A;  5D29 A;  3D7H A;  4C9U A;  4MCR A;  4NGR A;  3BXM A;  4P4E A;  4MCS A;  3RBU A;  3D7F A;  1Z8L A;  4MCP A;  2OR4 A;  4C9E A;  4C85 A;  1WVM A;  3FEC A;  3I74 A;  5IR2 A;  4C86 A;  2C6G A;  4X3R A;  3IIB A;  3BI1 A;  3BI0 A;  3VTA A;  4NGP A;  4YN3 A;  4CDK A;  2PVW A;  2XEF A;  3EIF A;  4OME A;  3KAS A;  3D7G A;  4C8P A;  4NGS A;  4P4F A;  5F09 A;  1V6C A;  4TJX A;  3SJE A;  2CIJ A;  3S9M A;  4C8U A;  4P45 A;  4P4I A;  3I6S A;  2PVV A;  2GP4 A;  2XEI A;  2C5Q A;  3D7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...