4C8FA

Mouse znrf3 ectodomain crystal form iv
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
151
structure length
137
Chain Sequence
ETAFVEVVLFESSPSGDYTTHTTGLTGRFSRAGAMLSAEGEIVQMYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
publication title Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
total genus 32
structure length 137
sequence length 151
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4c8fA00
3RBUA 4C9AA 4LQGA 4MCRA 4CDKA 4C9UA 3S9MA 1Z8LA 5D29A 3D7FA 3IIBA 4C9EA 3S9NA 4C8AA 4JYWA 3FEDA 3BI0A 4C8CA 4C99A 4P45A 1DE4C 1V6CA 4NGPA 4KNGE 3FECA 2OOTA 4NGNA 2XEGA 2XEJA 3D7GA 4P4JA 4NGRA 4TJXA 2PVVA 3SJEA 4OMEA 3FF3A 2C6PA 3ICUA 2XEFA 4C85A 4C86A 2XEIA 4X3RA 2CIJA 2OR4A 3I74A 4OC5A 1Y9ZA 2C6CA 4C84A 4W9YA 3KASA 4C9RA 3D7DA 4NGQA 4MCQA 2EK8A 4P4IA 3D7HA 4NGMA 5F09A 5IB9A 3FEEA 4OC1A 3SJXA 1CX8A 3BHXA 4P4BA 3S9LA 1XF1A 4YN3A 2EK9A 5ELYA 4TWEA 4P4EA 3IWWA 4OC2A 2JBKA 4P4DA 4OC4A 4OC0A 3EIFA 3BXMA 4C8UA 3SJGA 3I6SA 4P44A 2PVWA 4C8TA 3SJFA 2JBJA 2C6GA 4MCSA 4TJVA 4C8FA 4C9VA 4P4FA 1WVMA 4CDJA 4MCPA 4OC3A 3BI1A 4NGSA 4C8PA 4JZ0A 3VTAA 4NGTA
chains in the Genus database with same CATH superfamily
3K4IA 3TLAA 3RBUA 3TYXA 2EZBA 3C8OA 1VBGA 3TLGB 4C9AA 2E28A 1CS0B 4LQGA 4MCRA 3TLBA 4CDKA 2YJVA 4C9UA 2HROA 2C5QA 5F1YA 3S9MA 1Z8LA 5D29A 3T5MA 1M6VB 4M8DA 3D7FA 3IIBA 4C9EA 3S9NA 4C8AA 4MI1A 4JYWA 2EZAA 3FEDA 3BI0A 1GGOA 4C8CA 2X0SA 4C99A 4P45A 3T0TA 4CZ1A 2FM4A 2D0PA 1DE4C 1V6CA 3TLGA 4NGPA 4KNGE 3TLCA 2HWGA 1EZAA 3FECA 4COBA 2OOTA 1NXJA 4NGNA 2XEGA 1KEEB 2XEJA 3D7GA 1DIKA 4CO9A 1C30B 5F5XA 4P4JA 4NGRA 3EZAA 4TJXA 3T07A 1R61A 2PVVA 3TLYA 3SJEA 1VBHA 3KRVA 2AUNA 4OMEA 4J0NA 3FF3A 1KBLA 2C6PA 3ICUA 4INJA 2OLSA 5JYBA 2R82A 2XEFA 1JDEA 4C85A 4C86A 2XEIA 4X3RA 2CIJA 2OR4A 1NBWA 3I74A 1Y9ZA 4OC5A 2C6CA 4C84A 3K9TA 2HI6A 4E5SA 2GP4A 4W9YA 3T05A 3KASA 4C9RA 2PCNA 3D7DA 4NGQA 2MP0A 4EYSA 4COGA 4MCQA 2EK8A 2D0OA 4P4IA 3D7HA 4E94A 1CE8B 4NGMA 5F9MA 5F09A 3GJZA 1A9XB 4IIYA 5IB9A 3FEEA 4MJXA 4OC1A 1ZYMA 3SJXA 1CX8A 3BHXA 5IR2A 1ZL0A 4P4BA 5K99A 1XF1A 3S9LA 1J3LA 2YJTA 3EZEA 4YN3A 2EK9A 5ELYA 4TWEA 4P4EA 1ZRSA 1EZBA 3IWWA 4OC2A 4JVOA 2JBKA 4P4DA 4OC4A 4OC0A 3EIFA 3BXMA 3SR3A 4C8UA 3SJGA 3I6SA 1T36B 3TLEA 1VI4A 4P44A 2PVWA 4C8TA 3SJFA 2JBJA 2C6GA 4MCSA 4TJVA 1JDBC 4C8FA 4C9VA 3G23A 4P4FA 1BXRB 1WVMA 4CDJA 4IIXA 5FD8A 2DIKA 5JVLA 3U1BA 1KC7A 4MCPA 4OC3A 1C3OB 3BI1A 2AUMA 3NOJA 4NGSA 2EZCA 4C8PA 4H1HA 4JZ0A 3VTAA 3TLZA 1Q5XA 2B0AA 4NGTA 3EZBA
chains in the Genus database with same CATH topology
3RBUA 4C9AA 4LQGA 4MCRA 4CDKA 4C9UA 2C5QA 3S9MA 1Z8LA 5D29A 3D7FA 3IIBA 4C9EA 3S9NA 4C8AA 4JYWA 3FEDA 3BI0A 4C8CA 4C99A 4P45A 1DE4C 1V6CA 4NGPA 4KNGE 3FECA 2OOTA 4NGNA 2XEGA 2XEJA 3D7GA 4P4JA 4NGRA 4TJXA 2PVVA 3SJEA 4OMEA 3FF3A 2C6PA 3ICUA 2XEFA 4C85A 4C86A 2XEIA 4X3RA 2CIJA 2OR4A 3I74A 4OC5A 1Y9ZA 2C6CA 4C84A 3K9TA 2GP4A 4W9YA 3KASA 4C9RA 3D7DA 4NGQA 4MCQA 2EK8A 4P4IA 3D7HA 4NGMA 5F09A 5IB9A 3FEEA 4OC1A 3SJXA 1CX8A 3BHXA 5IR2A 4P4BA 3S9LA 1XF1A 4YN3A 2EK9A 5ELYA 4TWEA 4P4EA 3IWWA 4OC2A 2JBKA 4P4DA 4OC4A 4OC0A 3EIFA 3BXMA 4C8UA 3SJGA 3I6SA 4P44A 2PVWA 4C8TA 3SJFA 2JBJA 2C6GA 4MCSA 4TJVA 4C8FA 4C9VA 4P4FA 1WVMA 4CDJA 4MCPA 4OC3A 3BI1A 4NGSA 4C8PA 4JZ0A 3VTAA 4NGTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RBU A;  4C9A A;  4LQG A;  4MCR A;  4CDK A;  4C9U A;  3S9M A;  1Z8L A;  5D29 A;  3D7F A;  3IIB A;  4C9E A;  3S9N A;  4C8A A;  4JYW A;  3FED A;  3BI0 A;  4C8C A;  4C99 A;  4P45 A;  1DE4 C;  1V6C A;  4NGP A;  4KNG E;  3FEC A;  2OOT A;  4NGN A;  2XEG A;  2XEJ A;  3D7G A;  4P4J A;  4NGR A;  4TJX A;  2PVV A;  3SJE A;  4OME A;  3FF3 A;  2C6P A;  3ICU A;  2XEF A;  4C85 A;  4C86 A;  2XEI A;  4X3R A;  2CIJ A;  2OR4 A;  3I74 A;  4OC5 A;  1Y9Z A;  2C6C A;  4C84 A;  4W9Y A;  3KAS A;  4C9R A;  3D7D A;  4NGQ A;  4MCQ A;  2EK8 A;  4P4I A;  3D7H A;  4NGM A;  5F09 A;  5IB9 A;  3FEE A;  4OC1 A;  3SJX A;  1CX8 A;  3BHX A;  4P4B A;  3S9L A;  1XF1 A;  4YN3 A;  2EK9 A;  5ELY A;  4TWE A;  4P4E A;  3IWW A;  4OC2 A;  2JBK A;  4P4D A;  4OC4 A;  4OC0 A;  3EIF A;  3BXM A;  4C8U A;  3SJG A;  3I6S A;  4P44 A;  2PVW A;  4C8T A;  3SJF A;  2JBJ A;  2C6G A;  4MCS A;  4TJV A;  4C8F A;  4C9V A;  4P4F A;  1WVM A;  4CDJ A;  4MCP A;  4OC3 A;  3BI1 A;  4NGS A;  4C8P A;  4JZ0 A;  3VTA A;  4NGT A; 
#chains in the Genus database with same CATH topology
 3K4I A;  3TLA A;  3RBU A;  3TYX A;  2EZB A;  3C8O A;  1VBG A;  3TLG B;  4C9A A;  2E28 A;  1CS0 B;  4LQG A;  4MCR A;  3TLB A;  4CDK A;  2YJV A;  4C9U A;  2HRO A;  2C5Q A;  5F1Y A;  3S9M A;  1Z8L A;  5D29 A;  3T5M A;  1M6V B;  4M8D A;  3D7F A;  3IIB A;  4C9E A;  3S9N A;  4C8A A;  4MI1 A;  4JYW A;  2EZA A;  3FED A;  3BI0 A;  1GGO A;  4C8C A;  2X0S A;  4C99 A;  4P45 A;  3T0T A;  4CZ1 A;  2FM4 A;  2D0P A;  1DE4 C;  1V6C A;  3TLG A;  4NGP A;  4KNG E;  3TLC A;  2HWG A;  1EZA A;  3FEC A;  4COB A;  2OOT A;  1NXJ A;  4NGN A;  2XEG A;  1KEE B;  2XEJ A;  3D7G A;  1DIK A;  4CO9 A;  1C30 B;  5F5X A;  4P4J A;  4NGR A;  3EZA A;  4TJX A;  3T07 A;  1R61 A;  2PVV A;  3TLY A;  3SJE A;  1VBH A;  3KRV A;  2AUN A;  4OME A;  4J0N A;  3FF3 A;  1KBL A;  2C6P A;  3ICU A;  4INJ A;  2OLS A;  5JYB A;  2R82 A;  2XEF A;  1JDE A;  4C85 A;  4C86 A;  2XEI A;  4X3R A;  2CIJ A;  2OR4 A;  1NBW A;  3I74 A;  1Y9Z A;  4OC5 A;  2C6C A;  4C84 A;  3K9T A;  2HI6 A;  4E5S A;  2GP4 A;  4W9Y A;  3T05 A;  3KAS A;  4C9R A;  2PCN A;  3D7D A;  4NGQ A;  2MP0 A;  4EYS A;  4COG A;  4MCQ A;  2EK8 A;  2D0O A;  4P4I A;  3D7H A;  4E94 A;  1CE8 B;  4NGM A;  5F9M A;  5F09 A;  3GJZ A;  1A9X B;  4IIY A;  5IB9 A;  3FEE A;  4MJX A;  4OC1 A;  1ZYM A;  3SJX A;  1CX8 A;  3BHX A;  5IR2 A;  1ZL0 A;  4P4B A;  5K99 A;  1XF1 A;  3S9L A;  1J3L A;  2YJT A;  3EZE A;  4YN3 A;  2EK9 A;  5ELY A;  4TWE A;  4P4E A;  1ZRS A;  1EZB A;  3IWW A;  4OC2 A;  4JVO A;  2JBK A;  4P4D A;  4OC4 A;  4OC0 A;  3EIF A;  3BXM A;  3SR3 A;  4C8U A;  3SJG A;  3I6S A;  1T36 B;  3TLE A;  1VI4 A;  4P44 A;  2PVW A;  4C8T A;  3SJF A;  2JBJ A;  2C6G A;  4MCS A;  4TJV A;  1JDB C;  4C8F A;  4C9V A;  3G23 A;  4P4F A;  1BXR B;  1WVM A;  4CDJ A;  4IIX A;  5FD8 A;  2DIK A;  5JVL A;  3U1B A;  1KC7 A;  4MCP A;  4OC3 A;  1C3O B;  3BI1 A;  2AUM A;  3NOJ A;  4NGS A;  2EZC A;  4C8P A;  4H1H A;  4JZ0 A;  3VTA A;  3TLZ A;  1Q5X A;  2B0A A;  4NGT A;  3EZB A; 
#chains in the Genus database with same CATH homology
 3RBU A;  4C9A A;  4LQG A;  4MCR A;  4CDK A;  4C9U A;  2C5Q A;  3S9M A;  1Z8L A;  5D29 A;  3D7F A;  3IIB A;  4C9E A;  3S9N A;  4C8A A;  4JYW A;  3FED A;  3BI0 A;  4C8C A;  4C99 A;  4P45 A;  1DE4 C;  1V6C A;  4NGP A;  4KNG E;  3FEC A;  2OOT A;  4NGN A;  2XEG A;  2XEJ A;  3D7G A;  4P4J A;  4NGR A;  4TJX A;  2PVV A;  3SJE A;  4OME A;  3FF3 A;  2C6P A;  3ICU A;  2XEF A;  4C85 A;  4C86 A;  2XEI A;  4X3R A;  2CIJ A;  2OR4 A;  3I74 A;  4OC5 A;  1Y9Z A;  2C6C A;  4C84 A;  3K9T A;  2GP4 A;  4W9Y A;  3KAS A;  4C9R A;  3D7D A;  4NGQ A;  4MCQ A;  2EK8 A;  4P4I A;  3D7H A;  4NGM A;  5F09 A;  5IB9 A;  3FEE A;  4OC1 A;  3SJX A;  1CX8 A;  3BHX A;  5IR2 A;  4P4B A;  3S9L A;  1XF1 A;  4YN3 A;  2EK9 A;  5ELY A;  4TWE A;  4P4E A;  3IWW A;  4OC2 A;  2JBK A;  4P4D A;  4OC4 A;  4OC0 A;  3EIF A;  3BXM A;  4C8U A;  3SJG A;  3I6S A;  4P44 A;  2PVW A;  4C8T A;  3SJF A;  2JBJ A;  2C6G A;  4MCS A;  4TJV A;  4C8F A;  4C9V A;  4P4F A;  1WVM A;  4CDJ A;  4MCP A;  4OC3 A;  3BI1 A;  4NGS A;  4C8P A;  4JZ0 A;  3VTA A;  4NGT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...