4C8FA

Mouse znrf3 ectodomain crystal form iv
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
151
structure length
137
Chain Sequence
ETAFVEVVLFESSPSGDYTTHTTGLTGRFSRAGAMLSAEGEIVQMYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
total genus 32
structure length 137
sequence length 151
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4c8fA00
1CX8A 1Z8LA 2XEGA 4NGNA 4OC0A 2PVVA 2OOTA 4TJVA 3IWWA 4C9UA 1WVMA 4W9YA 4C84A 2JBJA 5F09A 4MCRA 4C8TA 3BHXA 5ELYA 2C6PA 3BI1A 4OC2A 3D7GA 4X3RA 4NGSA 3IIBA 4MCPA 1Y9ZA 3I6SA 5IB9A 2EK8A 4CDJA 2CIJA 4OMEA 4P44A 4C85A 2OR4A 4C8FA 3D7HA 4CDKA 4C8AA 2C6GA 4NGTA 4OC4A 3EIFA 4C9AA 4C8PA 4P45A 3BXMA 4LQGA 2EK9A 3KASA 4JYWA 2PVWA 3S9NA 2XEJA 4TJXA 4C9VA 4C99A 4P4BA 4JZ0A 3VTAA 4C9RA 4NGQA 3D7FA 4NGMA 4C9EA 4YN3A 4P4EA 3SJXA 2XEIA 3FECA 4NGPA 1XF1A 4C8CA 3RBUA 4OC1A 3D7DA 3SJEA 4MCSA 4MCQA 4TWEA 4C86A 3FEDA 2C6CA 3S9LA 4C8UA 3FEEA 1DE4C 2JBKA 4P4DA 3SJFA 4P4JA 4P4IA 2XEFA 4NGRA 3SJGA 4P4FA 4OC5A 4KNGE 1V6CA 5D29A 3I74A 3FF3A 4OC3A 3ICUA 3BI0A 3S9MA
chains in the Genus database with same CATH superfamily
3C8OA 1CX8A 1ZYMA 1C3OB 1J3LA 2C5QA 3TLEA 4E5SA 1Z8LA 2XEGA 4NGNA 1BXRB 2OLSA 1KEEB 4OC0A 2PVVA 2OOTA 3EZBA 4TJVA 2AUMA 3IWWA 4C9UA 2R82A 4COBA 1WVMA 3T05A 3NOJA 4JVOA 4W9YA 4C84A 2JBJA 5F09A 4MCRA 4IIYA 4C8TA 3BHXA 5JVLA 5ELYA 2C6PA 3BI1A 3TLYA 4OC2A 2D0OA 3D7GA 4J0NA 3IIBA 4NGSA 4X3RA 2YJVA 3TLAA 5K99A 1GGOA 4MI1A 4MCPA 1NXJA 2HROA 1Y9ZA 3TLGA 3I6SA 4INJA 3U1BA 5IB9A 3T5MA 2EK8A 4CDJA 2YJTA 2CIJA 4OMEA 4P44A 4C85A 2OR4A 4C8FA 1KBLA 3D7HA 4CDKA 4C8AA 4CZ1A 5F1YA 2C6GA 4NGTA 3T0TA 4OC4A 4MJXA 5FD8A 3EIFA 4C9AA 2HWGA 4C8PA 4P45A 3BXMA 4EYSA 1VBHA 3TYXA 5IR2A 1C30B 4M8DA 4LQGA 2EK9A 2HI6A 1VI4A 2FM4A 1NBWA 3TLZA 3G23A 3KASA 4JYWA 2PVWA 2DIKA 2E28A 3S9NA 2PCNA 1T36B 2XEJA 1EZAA 1CE8B 1Q5XA 2AUNA 4TJXA 4C9VA 2X0SA 1CS0B 3GJZA 3TLCA 4C99A 4P4BA 4JZ0A 3KRVA 3VTAA 4C9RA 4NGQA 3D7FA 2EZCA 4NGMA 4C9EA 4YN3A 4P4EA 3SJXA 2XEIA 3FECA 4CO9A 1KC7A 4COGA 1A9XB 1M6VB 4NGPA 1XF1A 4IIXA 3K4IA 4H1HA 2B0AA 4C8CA 1ZL0A 1R61A 2GP4A 3RBUA 4OC1A 3D7DA 5F5XA 3SJEA 1JDEA 4MCSA 1EZBA 3K9TA 4MCQA 4TWEA 3EZEA 3FEDA 2C6CA 3T07A 4C86A 1JDBC 3S9LA 4C8UA 3FEEA 5F9MA 1VBGA 3TLGB 3SR3A 1DE4C 3EZAA 2JBKA 4P4DA 3SJFA 4P4JA 5JYBA 1ZRSA 4P4IA 2XEFA 4NGRA 1DIKA 4P4FA 3SJGA 4OC5A 4KNGE 1V6CA 2EZBA 5D29A 2D0PA 2EZAA 4E94A 3I74A 3FF3A 3TLBA 4OC3A 2MP0A 3ICUA 3BI0A 3S9MA
chains in the Genus database with same CATH topology
1CX8A 2C5QA 1Z8LA 2XEGA 4NGNA 4OC0A 2PVVA 2OOTA 4TJVA 3IWWA 4C9UA 1WVMA 4W9YA 4C84A 2JBJA 5F09A 4MCRA 4C8TA 3BHXA 5ELYA 2C6PA 3BI1A 4OC2A 3D7GA 4X3RA 4NGSA 3IIBA 4MCPA 1Y9ZA 3I6SA 5IB9A 2EK8A 4CDJA 2CIJA 4OMEA 4P44A 4C85A 2OR4A 4C8FA 3D7HA 4CDKA 4C8AA 2C6GA 4NGTA 4OC4A 3EIFA 4C9AA 4C8PA 4P45A 3BXMA 5IR2A 4LQGA 2EK9A 3KASA 4JYWA 2PVWA 3S9NA 2XEJA 4TJXA 4C9VA 4C99A 4P4BA 4JZ0A 3VTAA 4C9RA 4NGQA 3D7FA 4NGMA 4C9EA 4YN3A 4P4EA 3SJXA 2XEIA 3FECA 4NGPA 1XF1A 4C8CA 2GP4A 3RBUA 4OC1A 3D7DA 3SJEA 4MCSA 3K9TA 4MCQA 4TWEA 4C86A 3FEDA 2C6CA 3S9LA 4C8UA 3FEEA 1DE4C 2JBKA 4P4DA 3SJFA 4P4JA 4P4IA 2XEFA 4NGRA 3SJGA 4P4FA 4OC5A 4KNGE 1V6CA 5D29A 3I74A 3FF3A 4OC3A 3ICUA 3BI0A 3S9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CX8 A;  1Z8L A;  2XEG A;  4NGN A;  4OC0 A;  2PVV A;  2OOT A;  4TJV A;  3IWW A;  4C9U A;  1WVM A;  4W9Y A;  4C84 A;  2JBJ A;  5F09 A;  4MCR A;  4C8T A;  3BHX A;  5ELY A;  2C6P A;  3BI1 A;  4OC2 A;  3D7G A;  4X3R A;  4NGS A;  3IIB A;  4MCP A;  1Y9Z A;  3I6S A;  5IB9 A;  2EK8 A;  4CDJ A;  2CIJ A;  4OME A;  4P44 A;  4C85 A;  2OR4 A;  4C8F A;  3D7H A;  4CDK A;  4C8A A;  2C6G A;  4NGT A;  4OC4 A;  3EIF A;  4C9A A;  4C8P A;  4P45 A;  3BXM A;  4LQG A;  2EK9 A;  3KAS A;  4JYW A;  2PVW A;  3S9N A;  2XEJ A;  4TJX A;  4C9V A;  4C99 A;  4P4B A;  4JZ0 A;  3VTA A;  4C9R A;  4NGQ A;  3D7F A;  4NGM A;  4C9E A;  4YN3 A;  4P4E A;  3SJX A;  2XEI A;  3FEC A;  4NGP A;  1XF1 A;  4C8C A;  3RBU A;  4OC1 A;  3D7D A;  3SJE A;  4MCS A;  4MCQ A;  4TWE A;  4C86 A;  3FED A;  2C6C A;  3S9L A;  4C8U A;  3FEE A;  1DE4 C;  2JBK A;  4P4D A;  3SJF A;  4P4J A;  4P4I A;  2XEF A;  4NGR A;  3SJG A;  4P4F A;  4OC5 A;  4KNG E;  1V6C A;  5D29 A;  3I74 A;  3FF3 A;  4OC3 A;  3ICU A;  3BI0 A;  3S9M A; 
#chains in the Genus database with same CATH topology
 3C8O A;  1CX8 A;  1ZYM A;  1C3O B;  1J3L A;  2C5Q A;  3TLE A;  4E5S A;  1Z8L A;  2XEG A;  4NGN A;  1BXR B;  2OLS A;  1KEE B;  4OC0 A;  2PVV A;  2OOT A;  3EZB A;  4TJV A;  2AUM A;  3IWW A;  4C9U A;  2R82 A;  4COB A;  1WVM A;  3T05 A;  3NOJ A;  4JVO A;  4W9Y A;  4C84 A;  2JBJ A;  5F09 A;  4MCR A;  4IIY A;  4C8T A;  3BHX A;  5JVL A;  5ELY A;  2C6P A;  3BI1 A;  3TLY A;  4OC2 A;  2D0O A;  3D7G A;  4J0N A;  3IIB A;  4NGS A;  4X3R A;  2YJV A;  3TLA A;  5K99 A;  1GGO A;  4MI1 A;  4MCP A;  1NXJ A;  2HRO A;  1Y9Z A;  3TLG A;  3I6S A;  4INJ A;  3U1B A;  5IB9 A;  3T5M A;  2EK8 A;  4CDJ A;  2YJT A;  2CIJ A;  4OME A;  4P44 A;  4C85 A;  2OR4 A;  4C8F A;  1KBL A;  3D7H A;  4CDK A;  4C8A A;  4CZ1 A;  5F1Y A;  2C6G A;  4NGT A;  3T0T A;  4OC4 A;  4MJX A;  5FD8 A;  3EIF A;  4C9A A;  2HWG A;  4C8P A;  4P45 A;  3BXM A;  4EYS A;  1VBH A;  3TYX A;  5IR2 A;  1C30 B;  4M8D A;  4LQG A;  2EK9 A;  2HI6 A;  1VI4 A;  2FM4 A;  1NBW A;  3TLZ A;  3G23 A;  3KAS A;  4JYW A;  2PVW A;  2DIK A;  2E28 A;  3S9N A;  2PCN A;  1T36 B;  2XEJ A;  1EZA A;  1CE8 B;  1Q5X A;  2AUN A;  4TJX A;  4C9V A;  2X0S A;  1CS0 B;  3GJZ A;  3TLC A;  4C99 A;  4P4B A;  4JZ0 A;  3KRV A;  3VTA A;  4C9R A;  4NGQ A;  3D7F A;  2EZC A;  4NGM A;  4C9E A;  4YN3 A;  4P4E A;  3SJX A;  2XEI A;  3FEC A;  4CO9 A;  1KC7 A;  4COG A;  1A9X B;  1M6V B;  4NGP A;  1XF1 A;  4IIX A;  3K4I A;  4H1H A;  2B0A A;  4C8C A;  1ZL0 A;  1R61 A;  2GP4 A;  3RBU A;  4OC1 A;  3D7D A;  5F5X A;  3SJE A;  1JDE A;  4MCS A;  1EZB A;  3K9T A;  4MCQ A;  4TWE A;  3EZE A;  3FED A;  2C6C A;  3T07 A;  4C86 A;  1JDB C;  3S9L A;  4C8U A;  3FEE A;  5F9M A;  1VBG A;  3TLG B;  3SR3 A;  1DE4 C;  3EZA A;  2JBK A;  4P4D A;  3SJF A;  4P4J A;  5JYB A;  1ZRS A;  4P4I A;  2XEF A;  4NGR A;  1DIK A;  4P4F A;  3SJG A;  4OC5 A;  4KNG E;  1V6C A;  2EZB A;  5D29 A;  2D0P A;  2EZA A;  4E94 A;  3I74 A;  3FF3 A;  3TLB A;  4OC3 A;  2MP0 A;  3ICU A;  3BI0 A;  3S9M A; 
#chains in the Genus database with same CATH homology
 1CX8 A;  2C5Q A;  1Z8L A;  2XEG A;  4NGN A;  4OC0 A;  2PVV A;  2OOT A;  4TJV A;  3IWW A;  4C9U A;  1WVM A;  4W9Y A;  4C84 A;  2JBJ A;  5F09 A;  4MCR A;  4C8T A;  3BHX A;  5ELY A;  2C6P A;  3BI1 A;  4OC2 A;  3D7G A;  4X3R A;  4NGS A;  3IIB A;  4MCP A;  1Y9Z A;  3I6S A;  5IB9 A;  2EK8 A;  4CDJ A;  2CIJ A;  4OME A;  4P44 A;  4C85 A;  2OR4 A;  4C8F A;  3D7H A;  4CDK A;  4C8A A;  2C6G A;  4NGT A;  4OC4 A;  3EIF A;  4C9A A;  4C8P A;  4P45 A;  3BXM A;  5IR2 A;  4LQG A;  2EK9 A;  3KAS A;  4JYW A;  2PVW A;  3S9N A;  2XEJ A;  4TJX A;  4C9V A;  4C99 A;  4P4B A;  4JZ0 A;  3VTA A;  4C9R A;  4NGQ A;  3D7F A;  4NGM A;  4C9E A;  4YN3 A;  4P4E A;  3SJX A;  2XEI A;  3FEC A;  4NGP A;  1XF1 A;  4C8C A;  2GP4 A;  3RBU A;  4OC1 A;  3D7D A;  3SJE A;  4MCS A;  3K9T A;  4MCQ A;  4TWE A;  4C86 A;  3FED A;  2C6C A;  3S9L A;  4C8U A;  3FEE A;  1DE4 C;  2JBK A;  4P4D A;  3SJF A;  4P4J A;  4P4I A;  2XEF A;  4NGR A;  3SJG A;  4P4F A;  4OC5 A;  4KNG E;  1V6C A;  5D29 A;  3I74 A;  3FF3 A;  4OC3 A;  3ICU A;  3BI0 A;  3S9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...