4C8FA

Mouse znrf3 ectodomain crystal form iv
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
151
structure length
137
Chain Sequence
b'ETAFVEVVLFESSPSGDYTTHTTGLTGRFSRAGAMLSAEGEIVQMYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
publication title Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
total genus 32
structure length 137
sequence length 151
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4c8fA00
3D7GA 4NGQA 3FEDA 4KNGE 4P4BA 4JYWA 2EK9A 2PVWA 3D7HA 1V6CA 4OMEA 4OC2A 4NGRA 3I74A 4C9VA 3KASA 4C9AA 4CDJA 5IB9A 1DE4C 3I6SA 1Z8LA 3BHXA 4MCRA 3FF3A 3SJEA 3EIFA 3S9LA 2JBKA 4JZ0A 3BI1A 3D7FA 4P44A 4P4EA 4P4DA 2CIJA 3ICUA 4MCPA 5F09A 3SJFA 3VTAA 4TJXA 4C85A 1Y9ZA 2OR4A 4C84A 2XEGA 4NGSA 4NGNA 4P45A 2C6GA 3FECA 5ELYA 4CDKA 4MCSA 2JBJA 2XEJA 4TWEA 4C99A 4LQGA 2C6PA 4C9EA 4C9UA 2OOTA 1CX8A 4P4JA 1XF1A 3SJGA 4OC3A 4C8PA 3BI0A 2EK8A 4C8AA 3S9NA 4OC4A 2PVVA 4NGTA 3FEEA 3SJXA 3IIBA 2XEIA 4YN3A 4C9RA 2C6CA 4OC5A 4C86A 3RBUA 4C8CA 4C8FA 4C8UA 4P4FA 1WVMA 4C8TA 4OC0A 4W9YA 3S9MA 4X3RA 2XEFA 4TJVA 3IWWA 4OC1A 3BXMA 3D7DA 4MCQA 4NGPA 4NGMA 4P4IA 5D29A
chains in the Genus database with same CATH superfamily
4E94A 2DIKA 3D7GA 4M8DA 4NGQA 3FEDA 1NXJA 1T36B 1KBLA 1J3LA 2X0SA 2GP4A 4KNGE 4P4BA 3G23A 2EZAA 2EK9A 4JYWA 3TLZA 1Q5XA 2PVWA 3EZBA 3D7HA 2YJVA 1GGOA 1V6CA 4OMEA 4OC2A 4NGRA 3I74A 4C9VA 3KASA 1CS0B 5FD8A 4C9AA 1C30B 4CDJA 1CE8B 5IB9A 4J0NA 1DE4C 1EZAA 3I6SA 1Z8LA 3BHXA 2HI6A 4MCRA 3FF3A 3SJEA 1BXRB 3EZEA 3EIFA 5K99A 3TLAA 4E5SA 1JDEA 4MI1A 3S9LA 2JBKA 4JZ0A 3K9TA 2E28A 1EZBA 3BI1A 3D7FA 4P44A 4P4EA 4P4DA 2CIJA 3ICUA 4MCPA 5F09A 2AUNA 2AUMA 3SJFA 3VTAA 5F1YA 4TJXA 4C85A 1Y9ZA 2OR4A 4C84A 4EYSA 5IR2A 2XEGA 1NBWA 4NGSA 3TLEA 4CZ1A 4NGNA 4P45A 2C6GA 1JDBC 3FECA 3SR3A 3K4IA 2PCNA 5ELYA 4CDKA 4MCSA 2JBJA 1A9XB 2D0PA 2XEJA 4TWEA 4C99A 3GJZA 4MJXA 4LQGA 1KC7A 1M6VB 2C6PA 4C9EA 4C9UA 3C8OA 2OOTA 1R61A 1CX8A 4P4JA 1XF1A 2B0AA 3SJGA 3NOJA 2HROA 3U1BA 2MP0A 4OC3A 4C8PA 3BI0A 2EK8A 4C8AA 3T0TA 1KEEB 3S9NA 3TYXA 2R82A 4OC4A 4JVOA 1VBHA 2PVVA 4NGTA 5JVLA 1C3OB 3TLYA 3TLGB 2EZBA 3FEEA 3SJXA 3T07A 4INJA 3IIBA 3TLCA 2XEIA 4COGA 4YN3A 4C9RA 2C6CA 4OC5A 5F9MA 4C86A 4H1HA 3RBUA 1ZL0A 4C8CA 2FM4A 4C8FA 4C8UA 2OLSA 5JYBA 2C5QA 5F5XA 1ZRSA 1VBGA 4P4FA 4IIXA 4CO9A 1WVMA 2HWGA 1VI4A 1ZYMA 3KRVA 2YJTA 4C8TA 3EZAA 4OC0A 4W9YA 3S9MA 3T5MA 4X3RA 1DIKA 4IIYA 2XEFA 4TJVA 3IWWA 4OC1A 4COBA 3BXMA 3D7DA 3TLGA 3T05A 2D0OA 4MCQA 4NGPA 2EZCA 4NGMA 4P4IA 3TLBA 5D29A
chains in the Genus database with same CATH topology
3D7GA 4NGQA 3FEDA 4KNGE 2GP4A 4P4BA 4JYWA 2EK9A 2PVWA 3D7HA 1V6CA 4OMEA 4OC2A 4NGRA 3I74A 4C9VA 3KASA 4C9AA 4CDJA 5IB9A 1DE4C 3I6SA 1Z8LA 3BHXA 4MCRA 3FF3A 3SJEA 3EIFA 3S9LA 2JBKA 4JZ0A 3K9TA 3BI1A 3D7FA 4P44A 4P4EA 4P4DA 2CIJA 3ICUA 4MCPA 5F09A 3SJFA 3VTAA 4TJXA 4C85A 1Y9ZA 2OR4A 4C84A 5IR2A 2XEGA 4NGSA 4NGNA 4P45A 2C6GA 3FECA 5ELYA 4CDKA 4MCSA 2JBJA 2XEJA 4TWEA 4C99A 4LQGA 2C6PA 4C9EA 4C9UA 2OOTA 1CX8A 4P4JA 1XF1A 3SJGA 4OC3A 4C8PA 3BI0A 2EK8A 4C8AA 3S9NA 4OC4A 2PVVA 4NGTA 3FEEA 3SJXA 3IIBA 2XEIA 4YN3A 4C9RA 2C6CA 4OC5A 4C86A 3RBUA 4C8CA 4C8FA 4C8UA 2C5QA 4P4FA 1WVMA 4C8TA 4OC0A 4W9YA 3S9MA 4X3RA 2XEFA 4TJVA 3IWWA 4OC1A 3BXMA 3D7DA 4MCQA 4NGPA 4NGMA 4P4IA 5D29A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D7G A;  4NGQ A;  3FED A;  4KNG E;  4P4B A;  4JYW A;  2EK9 A;  2PVW A;  3D7H A;  1V6C A;  4OME A;  4OC2 A;  4NGR A;  3I74 A;  4C9V A;  3KAS A;  4C9A A;  4CDJ A;  5IB9 A;  1DE4 C;  3I6S A;  1Z8L A;  3BHX A;  4MCR A;  3FF3 A;  3SJE A;  3EIF A;  3S9L A;  2JBK A;  4JZ0 A;  3BI1 A;  3D7F A;  4P44 A;  4P4E A;  4P4D A;  2CIJ A;  3ICU A;  4MCP A;  5F09 A;  3SJF A;  3VTA A;  4TJX A;  4C85 A;  1Y9Z A;  2OR4 A;  4C84 A;  2XEG A;  4NGS A;  4NGN A;  4P45 A;  2C6G A;  3FEC A;  5ELY A;  4CDK A;  4MCS A;  2JBJ A;  2XEJ A;  4TWE A;  4C99 A;  4LQG A;  2C6P A;  4C9E A;  4C9U A;  2OOT A;  1CX8 A;  4P4J A;  1XF1 A;  3SJG A;  4OC3 A;  4C8P A;  3BI0 A;  2EK8 A;  4C8A A;  3S9N A;  4OC4 A;  2PVV A;  4NGT A;  3FEE A;  3SJX A;  3IIB A;  2XEI A;  4YN3 A;  4C9R A;  2C6C A;  4OC5 A;  4C86 A;  3RBU A;  4C8C A;  4C8F A;  4C8U A;  4P4F A;  1WVM A;  4C8T A;  4OC0 A;  4W9Y A;  3S9M A;  4X3R A;  2XEF A;  4TJV A;  3IWW A;  4OC1 A;  3BXM A;  3D7D A;  4MCQ A;  4NGP A;  4NGM A;  4P4I A;  5D29 A; 
#chains in the Genus database with same CATH topology
 4E94 A;  2DIK A;  3D7G A;  4M8D A;  4NGQ A;  3FED A;  1NXJ A;  1T36 B;  1KBL A;  1J3L A;  2X0S A;  2GP4 A;  4KNG E;  4P4B A;  3G23 A;  2EZA A;  2EK9 A;  4JYW A;  3TLZ A;  1Q5X A;  2PVW A;  3EZB A;  3D7H A;  2YJV A;  1GGO A;  1V6C A;  4OME A;  4OC2 A;  4NGR A;  3I74 A;  4C9V A;  3KAS A;  1CS0 B;  5FD8 A;  4C9A A;  1C30 B;  4CDJ A;  1CE8 B;  5IB9 A;  4J0N A;  1DE4 C;  1EZA A;  3I6S A;  1Z8L A;  3BHX A;  2HI6 A;  4MCR A;  3FF3 A;  3SJE A;  1BXR B;  3EZE A;  3EIF A;  5K99 A;  3TLA A;  4E5S A;  1JDE A;  4MI1 A;  3S9L A;  2JBK A;  4JZ0 A;  3K9T A;  2E28 A;  1EZB A;  3BI1 A;  3D7F A;  4P44 A;  4P4E A;  4P4D A;  2CIJ A;  3ICU A;  4MCP A;  5F09 A;  2AUN A;  2AUM A;  3SJF A;  3VTA A;  5F1Y A;  4TJX A;  4C85 A;  1Y9Z A;  2OR4 A;  4C84 A;  4EYS A;  5IR2 A;  2XEG A;  1NBW A;  4NGS A;  3TLE A;  4CZ1 A;  4NGN A;  4P45 A;  2C6G A;  1JDB C;  3FEC A;  3SR3 A;  3K4I A;  2PCN A;  5ELY A;  4CDK A;  4MCS A;  2JBJ A;  1A9X B;  2D0P A;  2XEJ A;  4TWE A;  4C99 A;  3GJZ A;  4MJX A;  4LQG A;  1KC7 A;  1M6V B;  2C6P A;  4C9E A;  4C9U A;  3C8O A;  2OOT A;  1R61 A;  1CX8 A;  4P4J A;  1XF1 A;  2B0A A;  3SJG A;  3NOJ A;  2HRO A;  3U1B A;  2MP0 A;  4OC3 A;  4C8P A;  3BI0 A;  2EK8 A;  4C8A A;  3T0T A;  1KEE B;  3S9N A;  3TYX A;  2R82 A;  4OC4 A;  4JVO A;  1VBH A;  2PVV A;  4NGT A;  5JVL A;  1C3O B;  3TLY A;  3TLG B;  2EZB A;  3FEE A;  3SJX A;  3T07 A;  4INJ A;  3IIB A;  3TLC A;  2XEI A;  4COG A;  4YN3 A;  4C9R A;  2C6C A;  4OC5 A;  5F9M A;  4C86 A;  4H1H A;  3RBU A;  1ZL0 A;  4C8C A;  2FM4 A;  4C8F A;  4C8U A;  2OLS A;  5JYB A;  2C5Q A;  5F5X A;  1ZRS A;  1VBG A;  4P4F A;  4IIX A;  4CO9 A;  1WVM A;  2HWG A;  1VI4 A;  1ZYM A;  3KRV A;  2YJT A;  4C8T A;  3EZA A;  4OC0 A;  4W9Y A;  3S9M A;  3T5M A;  4X3R A;  1DIK A;  4IIY A;  2XEF A;  4TJV A;  3IWW A;  4OC1 A;  4COB A;  3BXM A;  3D7D A;  3TLG A;  3T05 A;  2D0O A;  4MCQ A;  4NGP A;  2EZC A;  4NGM A;  4P4I A;  3TLB A;  5D29 A; 
#chains in the Genus database with same CATH homology
 3D7G A;  4NGQ A;  3FED A;  4KNG E;  2GP4 A;  4P4B A;  4JYW A;  2EK9 A;  2PVW A;  3D7H A;  1V6C A;  4OME A;  4OC2 A;  4NGR A;  3I74 A;  4C9V A;  3KAS A;  4C9A A;  4CDJ A;  5IB9 A;  1DE4 C;  3I6S A;  1Z8L A;  3BHX A;  4MCR A;  3FF3 A;  3SJE A;  3EIF A;  3S9L A;  2JBK A;  4JZ0 A;  3K9T A;  3BI1 A;  3D7F A;  4P44 A;  4P4E A;  4P4D A;  2CIJ A;  3ICU A;  4MCP A;  5F09 A;  3SJF A;  3VTA A;  4TJX A;  4C85 A;  1Y9Z A;  2OR4 A;  4C84 A;  5IR2 A;  2XEG A;  4NGS A;  4NGN A;  4P45 A;  2C6G A;  3FEC A;  5ELY A;  4CDK A;  4MCS A;  2JBJ A;  2XEJ A;  4TWE A;  4C99 A;  4LQG A;  2C6P A;  4C9E A;  4C9U A;  2OOT A;  1CX8 A;  4P4J A;  1XF1 A;  3SJG A;  4OC3 A;  4C8P A;  3BI0 A;  2EK8 A;  4C8A A;  3S9N A;  4OC4 A;  2PVV A;  4NGT A;  3FEE A;  3SJX A;  3IIB A;  2XEI A;  4YN3 A;  4C9R A;  2C6C A;  4OC5 A;  4C86 A;  3RBU A;  4C8C A;  4C8F A;  4C8U A;  2C5Q A;  4P4F A;  1WVM A;  4C8T A;  4OC0 A;  4W9Y A;  3S9M A;  4X3R A;  2XEF A;  4TJV A;  3IWW A;  4OC1 A;  3BXM A;  3D7D A;  4MCQ A;  4NGP A;  4NGM A;  4P4I A;  5D29 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...