4C9RA

Xenopus znrf3 ectodomain in complex with xenopus rspo2 fu1-fu2 crystal form i
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
161
structure length
161
Chain Sequence
ETGESLAKETAFVEVVLFESSPNGDYKTHTTELQGRFSRAGATISAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPEMDPKPCLTVLGKAKRAVQRGATAVIFDVSDNPDAVEQLNQGLEDPLKRPVVYMKGMDAIKLMNIVNKQKGARARIQHRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb
source organism Xenopus (silurana) tropicalis
molecule tags Ligase/signaling protein
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
total genus 38
structure length 161
sequence length 161
chains with identical sequence C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4c9rA00
4C9UA 4KNGE 1V6CA 3I6SA 4C84A 3IIBA 3SJXA 2EK9A 4CDKA 4OMEA 4NGRA 3S9LA 1Z8LA 4OC1A 4YN3A 5F09A 4NGNA 4C9AA 2C6CA 2JBJA 4X3RA 1CX8A 3S9NA 5IB9A 4P4EA 3SJFA 4OC3A 3BI1A 4NGPA 2XEJA 3D7HA 4C85A 3EIFA 3S9MA 2OR4A 4C8UA 4P4JA 3BI0A 1DE4C 4NGTA 4OC5A 3IWWA 4C8PA 4P4BA 4NGMA 5ELYA 4C8TA 3D7FA 4P45A 3KASA 4NGQA 4LQGA 2OOTA 3I74A 4C9EA 2XEGA 2PVWA 4TWEA 4C8AA 1XF1A 3VTAA 4MCPA 3FF3A 4P4IA 2C6GA 3FEEA 3FEDA 4TJVA 3RBUA 3SJGA 2XEFA 3ICUA 2CIJA 2C6PA 4CDJA 4JZ0A 1Y9ZA 3D7DA 4C9VA 4NGSA 2EK8A 2PVVA 4MCSA 3BXMA 2JBKA 4MCRA 3BHXA 2XEIA 4JYWA 1WVMA 3FECA 4OC2A 4P44A 4OC4A 4P4DA 4C8FA 4W9YA 3D7GA 4C8CA 5D29A 4C86A 4C99A 4MCQA 3SJEA 4P4FA 4OC0A 4C9RA 4TJXA
chains in the Genus database with same CATH superfamily
4C9UA 4KNGE 3T07A 1V6CA 3I6SA 4C84A 4CO9A 3TLGB 3IIBA 3SJXA 1KBLA 2EK9A 1NBWA 5F5XA 4CDKA 1ZL0A 4OMEA 4NGRA 3K4IA 4M8DA 3S9LA 1Z8LA 2C5QA 4MI1A 4OC1A 4YN3A 5F09A 4NGNA 4C9AA 2DIKA 2GP4A 2C6CA 2JBJA 4X3RA 3T05A 1VBHA 2FM4A 5JYBA 4MJXA 3TLCA 3TYXA 1CX8A 3S9NA 4JVOA 2D0OA 1EZBA 1T36B 5IB9A 4P4EA 4COGA 3SJFA 2YJVA 4OC3A 2OLSA 1ZYMA 2R82A 4H1HA 2D0PA 2B0AA 3BI1A 3K9TA 2HI6A 4NGPA 3NOJA 3TLZA 2XEJA 2YJTA 3TLBA 3D7HA 4C85A 5JVLA 1CS0B 1ZRSA 3EIFA 3S9MA 4EYSA 1A9XB 2OR4A 2EZCA 2PCNA 5FD8A 3EZEA 4C8UA 4P4JA 3BI0A 1DE4C 4NGTA 4OC5A 2EZBA 3IWWA 4C8PA 4P4BA 5IR2A 4NGMA 5ELYA 4C8TA 1BXRB 2AUMA 2X0SA 3D7FA 1KC7A 1GGOA 2HWGA 4P45A 3KASA 1EZAA 2EZAA 4NGQA 4LQGA 2OOTA 1VBGA 3I74A 1JDBC 2XEGA 3EZAA 4C9EA 2PVWA 4TWEA 3U1BA 1NXJA 4C8AA 4IIXA 1XF1A 1R61A 3GJZA 3VTAA 2MP0A 1C3OB 4MCPA 3FF3A 1KEEB 4P4IA 3C8OA 2HROA 5F9MA 2AUNA 2C6GA 3EZBA 3FEEA 3FEDA 1DIKA 4TJVA 3RBUA 3SJGA 2XEFA 3ICUA 2CIJA 1JDEA 1CE8B 2C6PA 4CDJA 4E94A 4CZ1A 3T0TA 4JZ0A 3TLYA 1Y9ZA 3T5MA 4IIYA 3D7DA 3TLGA 1M6VB 2E28A 4C9VA 4NGSA 3TLEA 2EK8A 2PVVA 3KRVA 4MCSA 4COBA 3BXMA 1J3LA 2JBKA 4INJA 4MCRA 3BHXA 1Q5XA 2XEIA 4JYWA 1VI4A 5F1YA 3SR3A 1WVMA 3G23A 3TLAA 3FECA 4OC2A 4E5SA 1C30B 4J0NA 4P44A 4P4DA 4OC4A 4C8FA 5K99A 4W9YA 3D7GA 4C8CA 5D29A 4C86A 4C99A 4MCQA 3SJEA 4P4FA 4OC0A 4C9RA 4TJXA
chains in the Genus database with same CATH topology
4C9UA 4KNGE 1V6CA 3I6SA 4C84A 3IIBA 3SJXA 2EK9A 4CDKA 4OMEA 4NGRA 3S9LA 1Z8LA 2C5QA 4OC1A 4YN3A 5F09A 4NGNA 4C9AA 2GP4A 2C6CA 2JBJA 4X3RA 1CX8A 3S9NA 5IB9A 4P4EA 3SJFA 4OC3A 3BI1A 3K9TA 4NGPA 2XEJA 3D7HA 4C85A 3EIFA 3S9MA 2OR4A 4C8UA 4P4JA 3BI0A 1DE4C 4NGTA 4OC5A 3IWWA 4C8PA 4P4BA 5IR2A 4NGMA 5ELYA 4C8TA 3D7FA 4P45A 3KASA 4NGQA 4LQGA 2OOTA 3I74A 4C9EA 2XEGA 2PVWA 4TWEA 4C8AA 1XF1A 3VTAA 4MCPA 3FF3A 4P4IA 2C6GA 3FEEA 3FEDA 4TJVA 3RBUA 3SJGA 2XEFA 3ICUA 2CIJA 2C6PA 4CDJA 4JZ0A 1Y9ZA 3D7DA 4C9VA 4NGSA 2EK8A 2PVVA 4MCSA 3BXMA 2JBKA 4MCRA 3BHXA 2XEIA 4JYWA 1WVMA 3FECA 4OC2A 4P44A 4OC4A 4P4DA 4C8FA 4W9YA 3D7GA 4C8CA 5D29A 4C86A 4C99A 4MCQA 3SJEA 4P4FA 4OC0A 4C9RA 4TJXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C9U A;  4KNG E;  1V6C A;  3I6S A;  4C84 A;  3IIB A;  3SJX A;  2EK9 A;  4CDK A;  4OME A;  4NGR A;  3S9L A;  1Z8L A;  4OC1 A;  4YN3 A;  5F09 A;  4NGN A;  4C9A A;  2C6C A;  2JBJ A;  4X3R A;  1CX8 A;  3S9N A;  5IB9 A;  4P4E A;  3SJF A;  4OC3 A;  3BI1 A;  4NGP A;  2XEJ A;  3D7H A;  4C85 A;  3EIF A;  3S9M A;  2OR4 A;  4C8U A;  4P4J A;  3BI0 A;  1DE4 C;  4NGT A;  4OC5 A;  3IWW A;  4C8P A;  4P4B A;  4NGM A;  5ELY A;  4C8T A;  3D7F A;  4P45 A;  3KAS A;  4NGQ A;  4LQG A;  2OOT A;  3I74 A;  4C9E A;  2XEG A;  2PVW A;  4TWE A;  4C8A A;  1XF1 A;  3VTA A;  4MCP A;  3FF3 A;  4P4I A;  2C6G A;  3FEE A;  3FED A;  4TJV A;  3RBU A;  3SJG A;  2XEF A;  3ICU A;  2CIJ A;  2C6P A;  4CDJ A;  4JZ0 A;  1Y9Z A;  3D7D A;  4C9V A;  4NGS A;  2EK8 A;  2PVV A;  4MCS A;  3BXM A;  2JBK A;  4MCR A;  3BHX A;  2XEI A;  4JYW A;  1WVM A;  3FEC A;  4OC2 A;  4P44 A;  4OC4 A;  4P4D A;  4C8F A;  4W9Y A;  3D7G A;  4C8C A;  5D29 A;  4C86 A;  4C99 A;  4MCQ A;  3SJE A;  4P4F A;  4OC0 A;  4C9R A;  4TJX A; 
#chains in the Genus database with same CATH topology
 4C9U A;  4KNG E;  3T07 A;  1V6C A;  3I6S A;  4C84 A;  4CO9 A;  3TLG B;  3IIB A;  3SJX A;  1KBL A;  2EK9 A;  1NBW A;  5F5X A;  4CDK A;  1ZL0 A;  4OME A;  4NGR A;  3K4I A;  4M8D A;  3S9L A;  1Z8L A;  2C5Q A;  4MI1 A;  4OC1 A;  4YN3 A;  5F09 A;  4NGN A;  4C9A A;  2DIK A;  2GP4 A;  2C6C A;  2JBJ A;  4X3R A;  3T05 A;  1VBH A;  2FM4 A;  5JYB A;  4MJX A;  3TLC A;  3TYX A;  1CX8 A;  3S9N A;  4JVO A;  2D0O A;  1EZB A;  1T36 B;  5IB9 A;  4P4E A;  4COG A;  3SJF A;  2YJV A;  4OC3 A;  2OLS A;  1ZYM A;  2R82 A;  4H1H A;  2D0P A;  2B0A A;  3BI1 A;  3K9T A;  2HI6 A;  4NGP A;  3NOJ A;  3TLZ A;  2XEJ A;  2YJT A;  3TLB A;  3D7H A;  4C85 A;  5JVL A;  1CS0 B;  1ZRS A;  3EIF A;  3S9M A;  4EYS A;  1A9X B;  2OR4 A;  2EZC A;  2PCN A;  5FD8 A;  3EZE A;  4C8U A;  4P4J A;  3BI0 A;  1DE4 C;  4NGT A;  4OC5 A;  2EZB A;  3IWW A;  4C8P A;  4P4B A;  5IR2 A;  4NGM A;  5ELY A;  4C8T A;  1BXR B;  2AUM A;  2X0S A;  3D7F A;  1KC7 A;  1GGO A;  2HWG A;  4P45 A;  3KAS A;  1EZA A;  2EZA A;  4NGQ A;  4LQG A;  2OOT A;  1VBG A;  3I74 A;  1JDB C;  2XEG A;  3EZA A;  4C9E A;  2PVW A;  4TWE A;  3U1B A;  1NXJ A;  4C8A A;  4IIX A;  1XF1 A;  1R61 A;  3GJZ A;  3VTA A;  2MP0 A;  1C3O B;  4MCP A;  3FF3 A;  1KEE B;  4P4I A;  3C8O A;  2HRO A;  5F9M A;  2AUN A;  2C6G A;  3EZB A;  3FEE A;  3FED A;  1DIK A;  4TJV A;  3RBU A;  3SJG A;  2XEF A;  3ICU A;  2CIJ A;  1JDE A;  1CE8 B;  2C6P A;  4CDJ A;  4E94 A;  4CZ1 A;  3T0T A;  4JZ0 A;  3TLY A;  1Y9Z A;  3T5M A;  4IIY A;  3D7D A;  3TLG A;  1M6V B;  2E28 A;  4C9V A;  4NGS A;  3TLE A;  2EK8 A;  2PVV A;  3KRV A;  4MCS A;  4COB A;  3BXM A;  1J3L A;  2JBK A;  4INJ A;  4MCR A;  3BHX A;  1Q5X A;  2XEI A;  4JYW A;  1VI4 A;  5F1Y A;  3SR3 A;  1WVM A;  3G23 A;  3TLA A;  3FEC A;  4OC2 A;  4E5S A;  1C30 B;  4J0N A;  4P44 A;  4P4D A;  4OC4 A;  4C8F A;  5K99 A;  4W9Y A;  3D7G A;  4C8C A;  5D29 A;  4C86 A;  4C99 A;  4MCQ A;  3SJE A;  4P4F A;  4OC0 A;  4C9R A;  4TJX A; 
#chains in the Genus database with same CATH homology
 4C9U A;  4KNG E;  1V6C A;  3I6S A;  4C84 A;  3IIB A;  3SJX A;  2EK9 A;  4CDK A;  4OME A;  4NGR A;  3S9L A;  1Z8L A;  2C5Q A;  4OC1 A;  4YN3 A;  5F09 A;  4NGN A;  4C9A A;  2GP4 A;  2C6C A;  2JBJ A;  4X3R A;  1CX8 A;  3S9N A;  5IB9 A;  4P4E A;  3SJF A;  4OC3 A;  3BI1 A;  3K9T A;  4NGP A;  2XEJ A;  3D7H A;  4C85 A;  3EIF A;  3S9M A;  2OR4 A;  4C8U A;  4P4J A;  3BI0 A;  1DE4 C;  4NGT A;  4OC5 A;  3IWW A;  4C8P A;  4P4B A;  5IR2 A;  4NGM A;  5ELY A;  4C8T A;  3D7F A;  4P45 A;  3KAS A;  4NGQ A;  4LQG A;  2OOT A;  3I74 A;  4C9E A;  2XEG A;  2PVW A;  4TWE A;  4C8A A;  1XF1 A;  3VTA A;  4MCP A;  3FF3 A;  4P4I A;  2C6G A;  3FEE A;  3FED A;  4TJV A;  3RBU A;  3SJG A;  2XEF A;  3ICU A;  2CIJ A;  2C6P A;  4CDJ A;  4JZ0 A;  1Y9Z A;  3D7D A;  4C9V A;  4NGS A;  2EK8 A;  2PVV A;  4MCS A;  3BXM A;  2JBK A;  4MCR A;  3BHX A;  2XEI A;  4JYW A;  1WVM A;  3FEC A;  4OC2 A;  4P44 A;  4OC4 A;  4P4D A;  4C8F A;  4W9Y A;  3D7G A;  4C8C A;  5D29 A;  4C86 A;  4C99 A;  4MCQ A;  3SJE A;  4P4F A;  4OC0 A;  4C9R A;  4TJX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...