4C9RA

Xenopus znrf3 ectodomain in complex with xenopus rspo2 fu1-fu2 crystal form i
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
161
structure length
161
Chain Sequence
b'ETGESLAKETAFVEVVLFESSPNGDYKTHTTELQGRFSRAGATISAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPEMDPKPCLTVLGKAKRAVQRGATAVIFDVSDNPDAVEQLNQGLEDPLKRPVVYMKGMDAIKLMNIVNKQKGARARIQHRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
publication title Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb
source organism Xenopus (silurana) tropicalis
molecule tags Ligase/signaling protein
total genus 38
structure length 161
sequence length 161
chains with identical sequence C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4c9rA00
4P4JA 4CDJA 3BI1A 4NGQA 3D7GA 4OC2A 4NGMA 4P4DA 5IB9A 3SJXA 4P4IA 4OC0A 3VTAA 4C8PA 4P4BA 3ICUA 3D7HA 4C8AA 1CX8A 3SJFA 4MCSA 2XEFA 2OR4A 4C8CA 4W9YA 4C84A 2C6GA 3I74A 4C99A 3S9NA 2XEIA 4NGTA 4C9AA 3SJEA 3EIFA 3S9MA 4C9RA 2PVVA 4OC5A 3FEEA 3FEDA 2C6PA 1Z8LA 4P4EA 3KASA 3I6SA 4OC4A 2XEJA 4C8FA 4TWEA 2EK9A 2XEGA 4OMEA 5ELYA 4OC1A 4JZ0A 1DE4C 1Y9ZA 4P45A 4C85A 4P44A 4NGPA 3FF3A 3IWWA 2PVWA 4LQGA 2OOTA 4TJVA 2CIJA 3BHXA 2JBKA 1WVMA 3BI0A 1XF1A 3BXMA 3D7DA 1V6CA 3D7FA 4NGSA 2EK8A 3S9LA 4YN3A 4MCRA 4MCQA 3SJGA 4C86A 4P4FA 2JBJA 4OC3A 4KNGE 5F09A 4JYWA 5D29A 4X3RA 2C6CA 4NGNA 3IIBA 4NGRA 4C8TA 4C9VA 4MCPA 3FECA 3RBUA 4C8UA 4C9UA 4C9EA 4CDKA 4TJXA
chains in the Genus database with same CATH superfamily
4P4JA 4CDJA 1ZRSA 4MJXA 2YJVA 3BI1A 4NGQA 3D7GA 1A9XB 4OC2A 4M8DA 4NGMA 4P4DA 5IB9A 3SJXA 4P4IA 4OC0A 3VTAA 1EZBA 2YJTA 2D0OA 4C8PA 3GJZA 4P4BA 2FM4A 3ICUA 3D7HA 4C8AA 1CX8A 3SJFA 5K99A 3T05A 4MCSA 3TLGB 2GP4A 2XEFA 5IR2A 4E94A 2OR4A 5FD8A 3TLEA 3U1BA 1JDBC 4EYSA 1CE8B 4C8CA 4W9YA 4JVOA 4C84A 4CZ1A 4COBA 2C6GA 3TLZA 4H1HA 3G23A 3I74A 4C99A 3T07A 3C8OA 3S9NA 2XEIA 4NGTA 4C9AA 4E5SA 3SJEA 2E28A 1ZL0A 3EIFA 3SR3A 4TJXA 1KC7A 1KEEB 5F9MA 3S9MA 4C9RA 2PVVA 4OC5A 3FEEA 3EZAA 3FEDA 1GGOA 1DIKA 4INJA 1R61A 2C6PA 1Z8LA 4P4EA 3KASA 2EZCA 2PCNA 3I6SA 2EZAA 1BXRB 4OC4A 2XEJA 4C8FA 4TWEA 2EK9A 2XEGA 4OMEA 5ELYA 2OLSA 4OC1A 4JZ0A 1DE4C 3TLGA 4MI1A 3TLCA 4CO9A 1Y9ZA 3EZBA 3K4IA 4P45A 4C85A 4P44A 5F5XA 4NGPA 3FF3A 3IWWA 2PVWA 4LQGA 3T5MA 3T0TA 2OOTA 4TJVA 1VBGA 2DIKA 2CIJA 2EZBA 3BHXA 2JBKA 1WVMA 5JVLA 1VBHA 3BI0A 1M6VB 2X0SA 1XF1A 1Q5XA 3BXMA 3D7DA 1C3OB 1V6CA 1J3LA 3TLYA 5JYBA 2HI6A 3D7FA 4NGSA 2AUNA 2EK8A 4J0NA 3S9LA 1CS0B 4YN3A 4MCRA 4MCQA 3SJGA 4C86A 4P4FA 2JBJA 3EZEA 4OC3A 4KNGE 5F09A 1ZYMA 4JYWA 1EZAA 1T36B 2C5QA 4X3RA 5D29A 3K9TA 3TLBA 2C6CA 2MP0A 2B0AA 2HWGA 4NGNA 3IIBA 4NGRA 4C8TA 4C9VA 4MCPA 1NBWA 3FECA 2R82A 3RBUA 3KRVA 2D0PA 1C30B 3NOJA 1NXJA 4IIYA 4C8UA 5F1YA 4COGA 3TYXA 4C9UA 3TLAA 2AUMA 1VI4A 4C9EA 4CDKA 2HROA 1JDEA 1KBLA 4IIXA
chains in the Genus database with same CATH topology
4P4JA 4CDJA 3BI1A 4NGQA 3D7GA 4OC2A 4NGMA 4P4DA 5IB9A 3SJXA 4P4IA 4OC0A 3VTAA 4C8PA 4P4BA 3ICUA 3D7HA 4C8AA 1CX8A 3SJFA 4MCSA 2GP4A 2XEFA 5IR2A 2OR4A 4C8CA 4W9YA 4C84A 2C6GA 3I74A 4C99A 3S9NA 2XEIA 4NGTA 4C9AA 3SJEA 3EIFA 3S9MA 4C9RA 2PVVA 4OC5A 3FEEA 3FEDA 2C6PA 1Z8LA 4P4EA 3KASA 3I6SA 4OC4A 2XEJA 4C8FA 4TWEA 2EK9A 2XEGA 4OMEA 5ELYA 4OC1A 4JZ0A 1DE4C 1Y9ZA 4P45A 4C85A 4P44A 4NGPA 3FF3A 3IWWA 2PVWA 4LQGA 2OOTA 4TJVA 2CIJA 3BHXA 2JBKA 1WVMA 3BI0A 1XF1A 3BXMA 3D7DA 1V6CA 3D7FA 4NGSA 2EK8A 3S9LA 4YN3A 4MCRA 4MCQA 3SJGA 4C86A 4P4FA 2JBJA 4OC3A 4KNGE 5F09A 4JYWA 2C5QA 4X3RA 5D29A 3K9TA 2C6CA 4NGNA 3IIBA 4NGRA 4C8TA 4C9VA 4MCPA 3FECA 3RBUA 4C8UA 4C9UA 4C9EA 4CDKA 4TJXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P4J A;  4CDJ A;  3BI1 A;  4NGQ A;  3D7G A;  4OC2 A;  4NGM A;  4P4D A;  5IB9 A;  3SJX A;  4P4I A;  4OC0 A;  3VTA A;  4C8P A;  4P4B A;  3ICU A;  3D7H A;  4C8A A;  1CX8 A;  3SJF A;  4MCS A;  2XEF A;  2OR4 A;  4C8C A;  4W9Y A;  4C84 A;  2C6G A;  3I74 A;  4C99 A;  3S9N A;  2XEI A;  4NGT A;  4C9A A;  3SJE A;  3EIF A;  3S9M A;  4C9R A;  2PVV A;  4OC5 A;  3FEE A;  3FED A;  2C6P A;  1Z8L A;  4P4E A;  3KAS A;  3I6S A;  4OC4 A;  2XEJ A;  4C8F A;  4TWE A;  2EK9 A;  2XEG A;  4OME A;  5ELY A;  4OC1 A;  4JZ0 A;  1DE4 C;  1Y9Z A;  4P45 A;  4C85 A;  4P44 A;  4NGP A;  3FF3 A;  3IWW A;  2PVW A;  4LQG A;  2OOT A;  4TJV A;  2CIJ A;  3BHX A;  2JBK A;  1WVM A;  3BI0 A;  1XF1 A;  3BXM A;  3D7D A;  1V6C A;  3D7F A;  4NGS A;  2EK8 A;  3S9L A;  4YN3 A;  4MCR A;  4MCQ A;  3SJG A;  4C86 A;  4P4F A;  2JBJ A;  4OC3 A;  4KNG E;  5F09 A;  4JYW A;  5D29 A;  4X3R A;  2C6C A;  4NGN A;  3IIB A;  4NGR A;  4C8T A;  4C9V A;  4MCP A;  3FEC A;  3RBU A;  4C8U A;  4C9U A;  4C9E A;  4CDK A;  4TJX A; 
#chains in the Genus database with same CATH topology
 4P4J A;  4CDJ A;  1ZRS A;  4MJX A;  2YJV A;  3BI1 A;  4NGQ A;  3D7G A;  1A9X B;  4OC2 A;  4M8D A;  4NGM A;  4P4D A;  5IB9 A;  3SJX A;  4P4I A;  4OC0 A;  3VTA A;  1EZB A;  2YJT A;  2D0O A;  4C8P A;  3GJZ A;  4P4B A;  2FM4 A;  3ICU A;  3D7H A;  4C8A A;  1CX8 A;  3SJF A;  5K99 A;  3T05 A;  4MCS A;  3TLG B;  2GP4 A;  2XEF A;  5IR2 A;  4E94 A;  2OR4 A;  5FD8 A;  3TLE A;  3U1B A;  1JDB C;  4EYS A;  1CE8 B;  4C8C A;  4W9Y A;  4JVO A;  4C84 A;  4CZ1 A;  4COB A;  2C6G A;  3TLZ A;  4H1H A;  3G23 A;  3I74 A;  4C99 A;  3T07 A;  3C8O A;  3S9N A;  2XEI A;  4NGT A;  4C9A A;  4E5S A;  3SJE A;  2E28 A;  1ZL0 A;  3EIF A;  3SR3 A;  4TJX A;  1KC7 A;  1KEE B;  5F9M A;  3S9M A;  4C9R A;  2PVV A;  4OC5 A;  3FEE A;  3EZA A;  3FED A;  1GGO A;  1DIK A;  4INJ A;  1R61 A;  2C6P A;  1Z8L A;  4P4E A;  3KAS A;  2EZC A;  2PCN A;  3I6S A;  2EZA A;  1BXR B;  4OC4 A;  2XEJ A;  4C8F A;  4TWE A;  2EK9 A;  2XEG A;  4OME A;  5ELY A;  2OLS A;  4OC1 A;  4JZ0 A;  1DE4 C;  3TLG A;  4MI1 A;  3TLC A;  4CO9 A;  1Y9Z A;  3EZB A;  3K4I A;  4P45 A;  4C85 A;  4P44 A;  5F5X A;  4NGP A;  3FF3 A;  3IWW A;  2PVW A;  4LQG A;  3T5M A;  3T0T A;  2OOT A;  4TJV A;  1VBG A;  2DIK A;  2CIJ A;  2EZB A;  3BHX A;  2JBK A;  1WVM A;  5JVL A;  1VBH A;  3BI0 A;  1M6V B;  2X0S A;  1XF1 A;  1Q5X A;  3BXM A;  3D7D A;  1C3O B;  1V6C A;  1J3L A;  3TLY A;  5JYB A;  2HI6 A;  3D7F A;  4NGS A;  2AUN A;  2EK8 A;  4J0N A;  3S9L A;  1CS0 B;  4YN3 A;  4MCR A;  4MCQ A;  3SJG A;  4C86 A;  4P4F A;  2JBJ A;  3EZE A;  4OC3 A;  4KNG E;  5F09 A;  1ZYM A;  4JYW A;  1EZA A;  1T36 B;  2C5Q A;  4X3R A;  5D29 A;  3K9T A;  3TLB A;  2C6C A;  2MP0 A;  2B0A A;  2HWG A;  4NGN A;  3IIB A;  4NGR A;  4C8T A;  4C9V A;  4MCP A;  1NBW A;  3FEC A;  2R82 A;  3RBU A;  3KRV A;  2D0P A;  1C30 B;  3NOJ A;  1NXJ A;  4IIY A;  4C8U A;  5F1Y A;  4COG A;  3TYX A;  4C9U A;  3TLA A;  2AUM A;  1VI4 A;  4C9E A;  4CDK A;  2HRO A;  1JDE A;  1KBL A;  4IIX A; 
#chains in the Genus database with same CATH homology
 4P4J A;  4CDJ A;  3BI1 A;  4NGQ A;  3D7G A;  4OC2 A;  4NGM A;  4P4D A;  5IB9 A;  3SJX A;  4P4I A;  4OC0 A;  3VTA A;  4C8P A;  4P4B A;  3ICU A;  3D7H A;  4C8A A;  1CX8 A;  3SJF A;  4MCS A;  2GP4 A;  2XEF A;  5IR2 A;  2OR4 A;  4C8C A;  4W9Y A;  4C84 A;  2C6G A;  3I74 A;  4C99 A;  3S9N A;  2XEI A;  4NGT A;  4C9A A;  3SJE A;  3EIF A;  3S9M A;  4C9R A;  2PVV A;  4OC5 A;  3FEE A;  3FED A;  2C6P A;  1Z8L A;  4P4E A;  3KAS A;  3I6S A;  4OC4 A;  2XEJ A;  4C8F A;  4TWE A;  2EK9 A;  2XEG A;  4OME A;  5ELY A;  4OC1 A;  4JZ0 A;  1DE4 C;  1Y9Z A;  4P45 A;  4C85 A;  4P44 A;  4NGP A;  3FF3 A;  3IWW A;  2PVW A;  4LQG A;  2OOT A;  4TJV A;  2CIJ A;  3BHX A;  2JBK A;  1WVM A;  3BI0 A;  1XF1 A;  3BXM A;  3D7D A;  1V6C A;  3D7F A;  4NGS A;  2EK8 A;  3S9L A;  4YN3 A;  4MCR A;  4MCQ A;  3SJG A;  4C86 A;  4P4F A;  2JBJ A;  4OC3 A;  4KNG E;  5F09 A;  4JYW A;  2C5Q A;  4X3R A;  5D29 A;  3K9T A;  2C6C A;  4NGN A;  3IIB A;  4NGR A;  4C8T A;  4C9V A;  4MCP A;  3FEC A;  3RBU A;  4C8U A;  4C9U A;  4C9E A;  4CDK A;  4TJX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...