4C9RA

Xenopus znrf3 ectodomain in complex with xenopus rspo2 fu1-fu2 crystal form i
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
161
structure length
161
Chain Sequence
ETGESLAKETAFVEVVLFESSPNGDYKTHTTELQGRFSRAGATISAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPEMDPKPCLTVLGKAKRAVQRGATAVIFDVSDNPDAVEQLNQGLEDPLKRPVVYMKGMDAIKLMNIVNKQKGARARIQHRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
publication title Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb
source organism Xenopus (silurana) tropicalis
molecule tags Ligase/signaling protein
total genus 38
structure length 161
sequence length 161
chains with identical sequence C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4c9rA00
4MCSA 4C9RA 3D7DA 4C99A 2C6PA 4NGTA 4NGPA 4P4JA 4JYWA 3I74A 3SJFA 4P4FA 4C9UA 3KASA 3IWWA 2OOTA 3BI1A 4MCRA 1DE4C 3BXMA 2PVVA 4NGSA 4CDJA 3BHXA 1Y9ZA 4P4EA 3SJXA 3S9LA 4C8UA 1XF1A 1Z8LA 3BI0A 4X3RA 4C9AA 4W9YA 2C6GA 4NGNA 4NGQA 1CX8A 3FECA 4C85A 3ICUA 2JBJA 2EK8A 4C8FA 4NGMA 4OMEA 4YN3A 4JZ0A 4OC3A 4CDKA 3EIFA 3FEDA 3SJEA 4C8CA 4OC0A 2C6CA 2OR4A 1V6CA 3D7GA 1WVMA 2JBKA 2XEGA 4C8PA 5D29A 2XEIA 4TJVA 4MCPA 2EK9A 4OC4A 3I6SA 4P4BA 4NGRA 2XEJA 4OC2A 4C86A 4LQGA 2CIJA 3S9MA 5IB9A 4TJXA 4C8TA 4OC1A 3IIBA 3S9NA 3D7HA 4C9VA 4P45A 4OC5A 4C9EA 3VTAA 5F09A 2XEFA 4C84A 4P4DA 2PVWA 4P4IA 4TWEA 3SJGA 3D7FA 3FEEA 5ELYA 3FF3A 3RBUA 4KNGE 4C8AA 4P44A 4MCQA
chains in the Genus database with same CATH superfamily
1VBGA 4MCSA 3TLGB 4C9RA 4COBA 3D7DA 3K4IA 4COGA 2OLSA 4H1HA 2C6PA 4NGTA 4C99A 2HWGA 4NGPA 4P4JA 4EYSA 4JYWA 1KBLA 3I74A 1ZYMA 4CZ1A 3SJFA 3TLBA 4M8DA 4P4FA 3U1BA 1VI4A 1JDBC 4C9UA 3KASA 3IWWA 2OOTA 3BI1A 4MCRA 1DE4C 3BXMA 2YJVA 2PVVA 1BXRB 4E94A 1GGOA 1C3OB 4NGSA 3EZBA 4CDJA 3BHXA 1Y9ZA 4P4EA 3SJXA 3S9LA 4C8UA 3TLZA 2PCNA 2EZCA 5JVLA 1XF1A 2E28A 3NOJA 1Z8LA 3BI0A 1A9XB 4X3RA 1M6VB 4C9AA 1CS0B 4MI1A 1ZRSA 4INJA 4W9YA 1ZL0A 2C6GA 4J0NA 4NGNA 4NGQA 1CX8A 3FECA 4C85A 3EZAA 3GJZA 2HI6A 1EZAA 3ICUA 2JBJA 5F9MA 4IIXA 1NBWA 2EK8A 4C8FA 4NGMA 4OMEA 4YN3A 4JZ0A 2GP4A 3EZEA 4OC3A 4CDKA 3EIFA 3FEDA 3K9TA 3SJEA 4C8CA 5K99A 4OC0A 3T07A 2DIKA 3TLEA 2C6CA 1VBHA 2OR4A 3SR3A 5JYBA 2EZBA 1V6CA 3D7GA 3TLGA 2B0AA 1NXJA 5FD8A 1WVMA 2JBKA 2XEGA 4MJXA 2C5QA 3T05A 3TLAA 4C8PA 5D29A 2X0SA 2YJTA 2AUMA 2XEIA 4TJVA 1T36B 4MCPA 5F5XA 2EK9A 4OC4A 3I6SA 4P4BA 4NGRA 1EZBA 2XEJA 4OC2A 3TLCA 1DIKA 1J3LA 3G23A 2FM4A 2D0PA 1R61A 4IIYA 4C86A 4LQGA 3TYXA 2EZAA 2CIJA 1KC7A 3S9MA 5IB9A 4TJXA 2R82A 3KRVA 4C8TA 3TLYA 4OC1A 4E5SA 3IIBA 2D0OA 5IR2A 3S9NA 3D7HA 4C9VA 4CO9A 4P45A 3T0TA 4OC5A 4C9EA 3VTAA 5F09A 2XEFA 3C8OA 4JVOA 2MP0A 4C84A 4P4DA 3T5MA 2HROA 2PVWA 4P4IA 4TWEA 3SJGA 3D7FA 2AUNA 3FEEA 1JDEA 1Q5XA 1CE8B 5ELYA 3FF3A 3RBUA 1KEEB 5F1YA 4KNGE 4C8AA 4P44A 4MCQA 1C30B
chains in the Genus database with same CATH topology
4MCSA 4C9RA 3D7DA 4C99A 2C6PA 4NGTA 4NGPA 4P4JA 4JYWA 3I74A 3SJFA 4P4FA 4C9UA 3KASA 3IWWA 2OOTA 3BI1A 4MCRA 1DE4C 3BXMA 2PVVA 4NGSA 4CDJA 3BHXA 1Y9ZA 4P4EA 3SJXA 3S9LA 4C8UA 1XF1A 1Z8LA 3BI0A 4X3RA 4C9AA 4W9YA 2C6GA 4NGNA 4NGQA 1CX8A 3FECA 4C85A 3ICUA 2JBJA 2EK8A 4C8FA 4NGMA 4OMEA 4YN3A 4JZ0A 2GP4A 4OC3A 4CDKA 3EIFA 3FEDA 3K9TA 3SJEA 4C8CA 4OC0A 2C6CA 2OR4A 1V6CA 3D7GA 1WVMA 2JBKA 2XEGA 2C5QA 4C8PA 5D29A 2XEIA 4TJVA 4MCPA 2EK9A 4OC4A 3I6SA 4P4BA 4NGRA 2XEJA 4OC2A 4C86A 4LQGA 2CIJA 3S9MA 5IB9A 4TJXA 4C8TA 4OC1A 3IIBA 5IR2A 3S9NA 3D7HA 4C9VA 4P45A 4OC5A 4C9EA 3VTAA 5F09A 2XEFA 4C84A 4P4DA 2PVWA 4P4IA 4TWEA 3SJGA 3D7FA 3FEEA 5ELYA 3FF3A 3RBUA 4KNGE 4C8AA 4P44A 4MCQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MCS A;  4C9R A;  3D7D A;  4C99 A;  2C6P A;  4NGT A;  4NGP A;  4P4J A;  4JYW A;  3I74 A;  3SJF A;  4P4F A;  4C9U A;  3KAS A;  3IWW A;  2OOT A;  3BI1 A;  4MCR A;  1DE4 C;  3BXM A;  2PVV A;  4NGS A;  4CDJ A;  3BHX A;  1Y9Z A;  4P4E A;  3SJX A;  3S9L A;  4C8U A;  1XF1 A;  1Z8L A;  3BI0 A;  4X3R A;  4C9A A;  4W9Y A;  2C6G A;  4NGN A;  4NGQ A;  1CX8 A;  3FEC A;  4C85 A;  3ICU A;  2JBJ A;  2EK8 A;  4C8F A;  4NGM A;  4OME A;  4YN3 A;  4JZ0 A;  4OC3 A;  4CDK A;  3EIF A;  3FED A;  3SJE A;  4C8C A;  4OC0 A;  2C6C A;  2OR4 A;  1V6C A;  3D7G A;  1WVM A;  2JBK A;  2XEG A;  4C8P A;  5D29 A;  2XEI A;  4TJV A;  4MCP A;  2EK9 A;  4OC4 A;  3I6S A;  4P4B A;  4NGR A;  2XEJ A;  4OC2 A;  4C86 A;  4LQG A;  2CIJ A;  3S9M A;  5IB9 A;  4TJX A;  4C8T A;  4OC1 A;  3IIB A;  3S9N A;  3D7H A;  4C9V A;  4P45 A;  4OC5 A;  4C9E A;  3VTA A;  5F09 A;  2XEF A;  4C84 A;  4P4D A;  2PVW A;  4P4I A;  4TWE A;  3SJG A;  3D7F A;  3FEE A;  5ELY A;  3FF3 A;  3RBU A;  4KNG E;  4C8A A;  4P44 A;  4MCQ A; 
#chains in the Genus database with same CATH topology
 1VBG A;  4MCS A;  3TLG B;  4C9R A;  4COB A;  3D7D A;  3K4I A;  4COG A;  2OLS A;  4H1H A;  2C6P A;  4NGT A;  4C99 A;  2HWG A;  4NGP A;  4P4J A;  4EYS A;  4JYW A;  1KBL A;  3I74 A;  1ZYM A;  4CZ1 A;  3SJF A;  3TLB A;  4M8D A;  4P4F A;  3U1B A;  1VI4 A;  1JDB C;  4C9U A;  3KAS A;  3IWW A;  2OOT A;  3BI1 A;  4MCR A;  1DE4 C;  3BXM A;  2YJV A;  2PVV A;  1BXR B;  4E94 A;  1GGO A;  1C3O B;  4NGS A;  3EZB A;  4CDJ A;  3BHX A;  1Y9Z A;  4P4E A;  3SJX A;  3S9L A;  4C8U A;  3TLZ A;  2PCN A;  2EZC A;  5JVL A;  1XF1 A;  2E28 A;  3NOJ A;  1Z8L A;  3BI0 A;  1A9X B;  4X3R A;  1M6V B;  4C9A A;  1CS0 B;  4MI1 A;  1ZRS A;  4INJ A;  4W9Y A;  1ZL0 A;  2C6G A;  4J0N A;  4NGN A;  4NGQ A;  1CX8 A;  3FEC A;  4C85 A;  3EZA A;  3GJZ A;  2HI6 A;  1EZA A;  3ICU A;  2JBJ A;  5F9M A;  4IIX A;  1NBW A;  2EK8 A;  4C8F A;  4NGM A;  4OME A;  4YN3 A;  4JZ0 A;  2GP4 A;  3EZE A;  4OC3 A;  4CDK A;  3EIF A;  3FED A;  3K9T A;  3SJE A;  4C8C A;  5K99 A;  4OC0 A;  3T07 A;  2DIK A;  3TLE A;  2C6C A;  1VBH A;  2OR4 A;  3SR3 A;  5JYB A;  2EZB A;  1V6C A;  3D7G A;  3TLG A;  2B0A A;  1NXJ A;  5FD8 A;  1WVM A;  2JBK A;  2XEG A;  4MJX A;  2C5Q A;  3T05 A;  3TLA A;  4C8P A;  5D29 A;  2X0S A;  2YJT A;  2AUM A;  2XEI A;  4TJV A;  1T36 B;  4MCP A;  5F5X A;  2EK9 A;  4OC4 A;  3I6S A;  4P4B A;  4NGR A;  1EZB A;  2XEJ A;  4OC2 A;  3TLC A;  1DIK A;  1J3L A;  3G23 A;  2FM4 A;  2D0P A;  1R61 A;  4IIY A;  4C86 A;  4LQG A;  3TYX A;  2EZA A;  2CIJ A;  1KC7 A;  3S9M A;  5IB9 A;  4TJX A;  2R82 A;  3KRV A;  4C8T A;  3TLY A;  4OC1 A;  4E5S A;  3IIB A;  2D0O A;  5IR2 A;  3S9N A;  3D7H A;  4C9V A;  4CO9 A;  4P45 A;  3T0T A;  4OC5 A;  4C9E A;  3VTA A;  5F09 A;  2XEF A;  3C8O A;  4JVO A;  2MP0 A;  4C84 A;  4P4D A;  3T5M A;  2HRO A;  2PVW A;  4P4I A;  4TWE A;  3SJG A;  3D7F A;  2AUN A;  3FEE A;  1JDE A;  1Q5X A;  1CE8 B;  5ELY A;  3FF3 A;  3RBU A;  1KEE B;  5F1Y A;  4KNG E;  4C8A A;  4P44 A;  4MCQ A;  1C30 B; 
#chains in the Genus database with same CATH homology
 4MCS A;  4C9R A;  3D7D A;  4C99 A;  2C6P A;  4NGT A;  4NGP A;  4P4J A;  4JYW A;  3I74 A;  3SJF A;  4P4F A;  4C9U A;  3KAS A;  3IWW A;  2OOT A;  3BI1 A;  4MCR A;  1DE4 C;  3BXM A;  2PVV A;  4NGS A;  4CDJ A;  3BHX A;  1Y9Z A;  4P4E A;  3SJX A;  3S9L A;  4C8U A;  1XF1 A;  1Z8L A;  3BI0 A;  4X3R A;  4C9A A;  4W9Y A;  2C6G A;  4NGN A;  4NGQ A;  1CX8 A;  3FEC A;  4C85 A;  3ICU A;  2JBJ A;  2EK8 A;  4C8F A;  4NGM A;  4OME A;  4YN3 A;  4JZ0 A;  2GP4 A;  4OC3 A;  4CDK A;  3EIF A;  3FED A;  3K9T A;  3SJE A;  4C8C A;  4OC0 A;  2C6C A;  2OR4 A;  1V6C A;  3D7G A;  1WVM A;  2JBK A;  2XEG A;  2C5Q A;  4C8P A;  5D29 A;  2XEI A;  4TJV A;  4MCP A;  2EK9 A;  4OC4 A;  3I6S A;  4P4B A;  4NGR A;  2XEJ A;  4OC2 A;  4C86 A;  4LQG A;  2CIJ A;  3S9M A;  5IB9 A;  4TJX A;  4C8T A;  4OC1 A;  3IIB A;  5IR2 A;  3S9N A;  3D7H A;  4C9V A;  4P45 A;  4OC5 A;  4C9E A;  3VTA A;  5F09 A;  2XEF A;  4C84 A;  4P4D A;  2PVW A;  4P4I A;  4TWE A;  3SJG A;  3D7F A;  3FEE A;  5ELY A;  3FF3 A;  3RBU A;  4KNG E;  4C8A A;  4P44 A;  4MCQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...