4C9RA

Xenopus znrf3 ectodomain in complex with xenopus rspo2 fu1-fu2 crystal form i
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
161
structure length
161
Chain Sequence
ETGESLAKETAFVEVVLFESSPNGDYKTHTTELQGRFSRAGATISAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPEMDPKPCLTVLGKAKRAVQRGATAVIFDVSDNPDAVEQLNQGLEDPLKRPVVYMKGMDAIKLMNIVNKQKGARARIQHRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/signaling protein
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
publication title Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb
source organism Xenopus (silurana) tropicalis
total genus 38
structure length 161
sequence length 161
chains with identical sequence C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4c9rA00
2XEFA 5D29A 3SJXA 4C8UA 1Z8LA 4C86A 4C84A 4X3RA 3SJFA 4CDKA 4MCPA 1Y9ZA 4MCQA 4OC5A 4C8CA 3BXMA 3FEDA 4TJXA 2JBKA 5IB9A 4C9AA 4C85A 4OMEA 5F09A 4OC2A 4C8AA 3FEEA 4NGNA 4NGSA 4CDJA 3BHXA 4TWEA 4OC0A 4KNGE 3EIFA 4C8TA 4MCSA 2JBJA 3D7FA 1DE4C 4P45A 4LQGA 2EK9A 4MCRA 4P4IA 3S9LA 3IIBA 2EK8A 2PVVA 4NGMA 1XF1A 4NGQA 3D7HA 4YN3A 5ELYA 4C9VA 3FECA 3S9MA 4C9EA 3FF3A 3I74A 4OC3A 3BI0A 1V6CA 2OR4A 3RBUA 2XEIA 1CX8A 4JZ0A 2C6PA 3SJGA 3BI1A 3D7DA 2XEJA 1WVMA 4P4FA 4TJVA 4C8FA 4C9UA 4NGRA 2C6CA 3KASA 3I6SA 2C6GA 3D7GA 4NGTA 4OC4A 4OC1A 4P4JA 3SJEA 4C8PA 2PVWA 4P4BA 3ICUA 2OOTA 3IWWA 4C99A 2CIJA 4P4EA 4NGPA 4W9YA 3S9NA 3VTAA 2XEGA 4JYWA 4P4DA 4P44A 4C9RA
chains in the Genus database with same CATH superfamily
1R61A 2XEFA 3TLCA 5D29A 4JVOA 3SJXA 3K4IA 4C8UA 1Z8LA 4E94A 4C86A 4C84A 3TLEA 3TLYA 4X3RA 3T05A 1EZBA 3T07A 3SJFA 5JYBA 4CDKA 4MCPA 1Y9ZA 2AUNA 4MCQA 5IR2A 4COGA 3TLGA 4OC5A 4C8CA 3BXMA 3FEDA 4CO9A 4TJXA 2JBKA 3EZAA 2B0AA 5IB9A 2AUMA 4C9AA 4C85A 4OMEA 5F09A 4OC2A 1BXRB 4INJA 4C8AA 3FEEA 4E5SA 2FM4A 2EZAA 3TLZA 4NGNA 2DIKA 5K99A 1VI4A 4NGSA 4CDJA 3BHXA 4TWEA 4OC0A 3G23A 2D0OA 4MI1A 5F9MA 4COBA 4KNGE 3TLGB 1KC7A 3EIFA 5F5XA 4M8DA 4C8TA 4MCSA 2EZCA 2JBJA 3D7FA 1DE4C 4P45A 4LQGA 4MJXA 2EK9A 1GGOA 1CE8B 4MCRA 4P4IA 3S9LA 3IIBA 3EZEA 2EK8A 2PVVA 4NGMA 1VBHA 1KEEB 3SR3A 1XF1A 4NGQA 3D7HA 3KRVA 4YN3A 2PCNA 5JVLA 4IIYA 1NXJA 5ELYA 4IIXA 4C9VA 2OLSA 3FECA 3S9MA 4C9EA 3T0TA 3FF3A 2R82A 2HROA 3I74A 4OC3A 3BI0A 1V6CA 2OR4A 3RBUA 4CZ1A 2XEIA 1M6VB 2D0PA 1CX8A 5FD8A 4JZ0A 2C6PA 3SJGA 3BI1A 1A9XB 3D7DA 2XEJA 1T36B 2X0SA 1WVMA 3GJZA 4P4FA 3TLBA 3NOJA 1ZYMA 4TJVA 2MP0A 1VBGA 3EZBA 1DIKA 4C8FA 4C9UA 2E28A 4NGRA 1NBWA 2EZBA 1KBLA 2C6CA 3KASA 3I6SA 2C6GA 3D7GA 1JDBC 4NGTA 4H1HA 3C8OA 1JDEA 4OC1A 4P4JA 4OC4A 3SJEA 4C8PA 1CS0B 3TLAA 4EYSA 2C5QA 1C3OB 2PVWA 4P4BA 3U1BA 2HI6A 2HWGA 4J0NA 2YJVA 1ZRSA 3TYXA 1C30B 1ZL0A 2GP4A 3ICUA 2OOTA 3IWWA 5F1YA 4C99A 2YJTA 2CIJA 4P4EA 4NGPA 3T5MA 4W9YA 1J3LA 3K9TA 3S9NA 3VTAA 2XEGA 4JYWA 4P4DA 1Q5XA 4P44A 4C9RA 1EZAA
chains in the Genus database with same CATH topology
2XEFA 5D29A 3SJXA 4C8UA 1Z8LA 4C86A 4C84A 4X3RA 3SJFA 4CDKA 4MCPA 1Y9ZA 5IR2A 4MCQA 4OC5A 4C8CA 3BXMA 3FEDA 4TJXA 2JBKA 5IB9A 4C9AA 4C85A 4OMEA 5F09A 4OC2A 4C8AA 3FEEA 4NGNA 4NGSA 4CDJA 3BHXA 4TWEA 4OC0A 4KNGE 3EIFA 4C8TA 4MCSA 2JBJA 3D7FA 1DE4C 4P45A 4LQGA 2EK9A 4MCRA 4P4IA 3S9LA 3IIBA 2EK8A 2PVVA 4NGMA 1XF1A 4NGQA 3D7HA 4YN3A 5ELYA 4C9VA 3FECA 3S9MA 4C9EA 3FF3A 3I74A 4OC3A 3BI0A 1V6CA 2OR4A 3RBUA 2XEIA 1CX8A 4JZ0A 2C6PA 3SJGA 3BI1A 3D7DA 2XEJA 1WVMA 4P4FA 4TJVA 4C8FA 4C9UA 4NGRA 2C6CA 3KASA 3I6SA 2C6GA 3D7GA 4NGTA 4OC4A 4OC1A 4P4JA 3SJEA 4C8PA 2C5QA 2PVWA 4P4BA 2GP4A 3ICUA 2OOTA 3IWWA 4C99A 2CIJA 4P4EA 4NGPA 4W9YA 3K9TA 3S9NA 3VTAA 2XEGA 4JYWA 4P4DA 4P44A 4C9RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XEF A;  5D29 A;  3SJX A;  4C8U A;  1Z8L A;  4C86 A;  4C84 A;  4X3R A;  3SJF A;  4CDK A;  4MCP A;  1Y9Z A;  4MCQ A;  4OC5 A;  4C8C A;  3BXM A;  3FED A;  4TJX A;  2JBK A;  5IB9 A;  4C9A A;  4C85 A;  4OME A;  5F09 A;  4OC2 A;  4C8A A;  3FEE A;  4NGN A;  4NGS A;  4CDJ A;  3BHX A;  4TWE A;  4OC0 A;  4KNG E;  3EIF A;  4C8T A;  4MCS A;  2JBJ A;  3D7F A;  1DE4 C;  4P45 A;  4LQG A;  2EK9 A;  4MCR A;  4P4I A;  3S9L A;  3IIB A;  2EK8 A;  2PVV A;  4NGM A;  1XF1 A;  4NGQ A;  3D7H A;  4YN3 A;  5ELY A;  4C9V A;  3FEC A;  3S9M A;  4C9E A;  3FF3 A;  3I74 A;  4OC3 A;  3BI0 A;  1V6C A;  2OR4 A;  3RBU A;  2XEI A;  1CX8 A;  4JZ0 A;  2C6P A;  3SJG A;  3BI1 A;  3D7D A;  2XEJ A;  1WVM A;  4P4F A;  4TJV A;  4C8F A;  4C9U A;  4NGR A;  2C6C A;  3KAS A;  3I6S A;  2C6G A;  3D7G A;  4NGT A;  4OC4 A;  4OC1 A;  4P4J A;  3SJE A;  4C8P A;  2PVW A;  4P4B A;  3ICU A;  2OOT A;  3IWW A;  4C99 A;  2CIJ A;  4P4E A;  4NGP A;  4W9Y A;  3S9N A;  3VTA A;  2XEG A;  4JYW A;  4P4D A;  4P44 A;  4C9R A; 
#chains in the Genus database with same CATH topology
 1R61 A;  2XEF A;  3TLC A;  5D29 A;  4JVO A;  3SJX A;  3K4I A;  4C8U A;  1Z8L A;  4E94 A;  4C86 A;  4C84 A;  3TLE A;  3TLY A;  4X3R A;  3T05 A;  1EZB A;  3T07 A;  3SJF A;  5JYB A;  4CDK A;  4MCP A;  1Y9Z A;  2AUN A;  4MCQ A;  5IR2 A;  4COG A;  3TLG A;  4OC5 A;  4C8C A;  3BXM A;  3FED A;  4CO9 A;  4TJX A;  2JBK A;  3EZA A;  2B0A A;  5IB9 A;  2AUM A;  4C9A A;  4C85 A;  4OME A;  5F09 A;  4OC2 A;  1BXR B;  4INJ A;  4C8A A;  3FEE A;  4E5S A;  2FM4 A;  2EZA A;  3TLZ A;  4NGN A;  2DIK A;  5K99 A;  1VI4 A;  4NGS A;  4CDJ A;  3BHX A;  4TWE A;  4OC0 A;  3G23 A;  2D0O A;  4MI1 A;  5F9M A;  4COB A;  4KNG E;  3TLG B;  1KC7 A;  3EIF A;  5F5X A;  4M8D A;  4C8T A;  4MCS A;  2EZC A;  2JBJ A;  3D7F A;  1DE4 C;  4P45 A;  4LQG A;  4MJX A;  2EK9 A;  1GGO A;  1CE8 B;  4MCR A;  4P4I A;  3S9L A;  3IIB A;  3EZE A;  2EK8 A;  2PVV A;  4NGM A;  1VBH A;  1KEE B;  3SR3 A;  1XF1 A;  4NGQ A;  3D7H A;  3KRV A;  4YN3 A;  2PCN A;  5JVL A;  4IIY A;  1NXJ A;  5ELY A;  4IIX A;  4C9V A;  2OLS A;  3FEC A;  3S9M A;  4C9E A;  3T0T A;  3FF3 A;  2R82 A;  2HRO A;  3I74 A;  4OC3 A;  3BI0 A;  1V6C A;  2OR4 A;  3RBU A;  4CZ1 A;  2XEI A;  1M6V B;  2D0P A;  1CX8 A;  5FD8 A;  4JZ0 A;  2C6P A;  3SJG A;  3BI1 A;  1A9X B;  3D7D A;  2XEJ A;  1T36 B;  2X0S A;  1WVM A;  3GJZ A;  4P4F A;  3TLB A;  3NOJ A;  1ZYM A;  4TJV A;  2MP0 A;  1VBG A;  3EZB A;  1DIK A;  4C8F A;  4C9U A;  2E28 A;  4NGR A;  1NBW A;  2EZB A;  1KBL A;  2C6C A;  3KAS A;  3I6S A;  2C6G A;  3D7G A;  1JDB C;  4NGT A;  4H1H A;  3C8O A;  1JDE A;  4OC1 A;  4P4J A;  4OC4 A;  3SJE A;  4C8P A;  1CS0 B;  3TLA A;  4EYS A;  2C5Q A;  1C3O B;  2PVW A;  4P4B A;  3U1B A;  2HI6 A;  2HWG A;  4J0N A;  2YJV A;  1ZRS A;  3TYX A;  1C30 B;  1ZL0 A;  2GP4 A;  3ICU A;  2OOT A;  3IWW A;  5F1Y A;  4C99 A;  2YJT A;  2CIJ A;  4P4E A;  4NGP A;  3T5M A;  4W9Y A;  1J3L A;  3K9T A;  3S9N A;  3VTA A;  2XEG A;  4JYW A;  4P4D A;  1Q5X A;  4P44 A;  4C9R A;  1EZA A; 
#chains in the Genus database with same CATH homology
 2XEF A;  5D29 A;  3SJX A;  4C8U A;  1Z8L A;  4C86 A;  4C84 A;  4X3R A;  3SJF A;  4CDK A;  4MCP A;  1Y9Z A;  5IR2 A;  4MCQ A;  4OC5 A;  4C8C A;  3BXM A;  3FED A;  4TJX A;  2JBK A;  5IB9 A;  4C9A A;  4C85 A;  4OME A;  5F09 A;  4OC2 A;  4C8A A;  3FEE A;  4NGN A;  4NGS A;  4CDJ A;  3BHX A;  4TWE A;  4OC0 A;  4KNG E;  3EIF A;  4C8T A;  4MCS A;  2JBJ A;  3D7F A;  1DE4 C;  4P45 A;  4LQG A;  2EK9 A;  4MCR A;  4P4I A;  3S9L A;  3IIB A;  2EK8 A;  2PVV A;  4NGM A;  1XF1 A;  4NGQ A;  3D7H A;  4YN3 A;  5ELY A;  4C9V A;  3FEC A;  3S9M A;  4C9E A;  3FF3 A;  3I74 A;  4OC3 A;  3BI0 A;  1V6C A;  2OR4 A;  3RBU A;  2XEI A;  1CX8 A;  4JZ0 A;  2C6P A;  3SJG A;  3BI1 A;  3D7D A;  2XEJ A;  1WVM A;  4P4F A;  4TJV A;  4C8F A;  4C9U A;  4NGR A;  2C6C A;  3KAS A;  3I6S A;  2C6G A;  3D7G A;  4NGT A;  4OC4 A;  4OC1 A;  4P4J A;  3SJE A;  4C8P A;  2C5Q A;  2PVW A;  4P4B A;  2GP4 A;  3ICU A;  2OOT A;  3IWW A;  4C99 A;  2CIJ A;  4P4E A;  4NGP A;  4W9Y A;  3K9T A;  3S9N A;  3VTA A;  2XEG A;  4JYW A;  4P4D A;  4P44 A;  4C9R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...