4C9RA

Xenopus znrf3 ectodomain in complex with xenopus rspo2 fu1-fu2 crystal form i
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
161
structure length
161
Chain Sequence
ETGESLAKETAFVEVVLFESSPNGDYKTHTTELQGRFSRAGATISAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPEMDPKPCLTVLGKAKRAVQRGATAVIFDVSDNPDAVEQLNQGLEDPLKRPVVYMKGMDAIKLMNIVNKQKGARARIQHRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb
source organism Xenopus (silurana) tropicalis
molecule tags Ligase/signaling protein
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
total genus 38
structure length 161
sequence length 161
chains with identical sequence C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4c9rA00
2XEIA 2XEGA 4C8FA 2EK8A 4LQGA 1WVMA 4P45A 4OC0A 2JBJA 2PVWA 4NGMA 4NGQA 4C8AA 4OMEA 3FEEA 3BI0A 4JYWA 4P4BA 4C8UA 3D7HA 3RBUA 4NGSA 2OOTA 3IWWA 2CIJA 4MCPA 3SJXA 2PVVA 4TWEA 4P4EA 3IIBA 4C9RA 2C6GA 3D7FA 3BXMA 4YN3A 4MCRA 4JZ0A 4C85A 4NGTA 2C6PA 4P4JA 4CDJA 4X3RA 3FEDA 4TJVA 5IB9A 4C8CA 4C84A 3S9MA 4OC1A 2EK9A 4OC3A 4C8PA 3SJGA 3D7DA 4C9VA 4C9AA 4C8TA 3KASA 1Y9ZA 4CDKA 4NGNA 3VTAA 3FF3A 1XF1A 4OC5A 4OC4A 4C9EA 3BHXA 3D7GA 4OC2A 3SJFA 4TJXA 1DE4C 3BI1A 4P4FA 3S9NA 3ICUA 3I74A 4C99A 4P4IA 3I6SA 4C9UA 2OR4A 5F09A 2C6CA 2XEJA 4MCQA 4P44A 5D29A 1Z8LA 4P4DA 2XEFA 4NGPA 5ELYA 4MCSA 1V6CA 3FECA 4W9YA 3SJEA 3EIFA 1CX8A 4NGRA 2JBKA 3S9LA 4C86A 4KNGE
chains in the Genus database with same CATH superfamily
2HWGA 3C8OA 5F1YA 3TLEA 2XEIA 2XEGA 4CZ1A 2DIKA 2E28A 4C8FA 2EK8A 4E94A 4LQGA 2YJVA 1CS0B 1C3OB 1WVMA 3K4IA 4P45A 1ZYMA 2X0SA 4OC0A 3T07A 2HI6A 3U1BA 5JYBA 2JBJA 3KRVA 1C30B 2FM4A 2HROA 2AUNA 1VBGA 1T36B 2PVWA 2YJTA 4NGQA 4NGMA 4OMEA 3EZBA 4C8AA 3FEEA 3BI0A 1EZBA 3G23A 3TYXA 4JYWA 5F9MA 4IIYA 3TLCA 4CO9A 1ZL0A 3GJZA 4COGA 1KEEB 4P4BA 4C8UA 3D7HA 3TLAA 3RBUA 4NGSA 2OOTA 5JVLA 3IWWA 4H1HA 2CIJA 4MCPA 3SJXA 2OLSA 2PVVA 4TWEA 4P4EA 3IIBA 2C5QA 4C9RA 2C6GA 3D7FA 3BXMA 4YN3A 1KBLA 4MCRA 4JZ0A 4C85A 4INJA 4NGTA 2C6PA 4P4JA 4CDJA 4X3RA 3TLGB 4E5SA 3FEDA 4J0NA 4TJVA 3TLGA 5IB9A 1DIKA 4C8CA 4C84A 2D0PA 3TLZA 3S9MA 1BXRB 4OC1A 1KC7A 2EK9A 4JVOA 4OC3A 4C8PA 1GGOA 2GP4A 3SJGA 3D7DA 3EZEA 4C9VA 4C9AA 4C8TA 3EZAA 4M8DA 2EZAA 2B0AA 3KASA 5K99A 3SR3A 5F5XA 1Q5XA 1R61A 1Y9ZA 4CDKA 1A9XB 1JDEA 2EZCA 3FF3A 4NGNA 3VTAA 1XF1A 3K9TA 3TLYA 1ZRSA 4OC5A 2R82A 1J3LA 4OC4A 2AUMA 4C9EA 3BHXA 3D7GA 4OC2A 3SJFA 3T05A 4TJXA 5FD8A 1DE4C 3BI1A 4P4FA 4COBA 3S9NA 1M6VB 2D0OA 2MP0A 3I74A 3ICUA 4C99A 4P4IA 4IIXA 3I6SA 1VI4A 4C9UA 2OR4A 5F09A 2C6CA 2XEJA 4MCQA 3T0TA 4P44A 1EZAA 5D29A 1Z8LA 1NXJA 2EZBA 3NOJA 4MJXA 4P4DA 2XEFA 4NGPA 4EYSA 1NBWA 5ELYA 4MCSA 1V6CA 3FECA 4W9YA 3SJEA 3TLBA 1JDBC 2PCNA 3EIFA 1CX8A 4NGRA 2JBKA 1CE8B 3S9LA 4MI1A 5IR2A 4C86A 4KNGE 3T5MA 1VBHA
chains in the Genus database with same CATH topology
2XEIA 2XEGA 4C8FA 2EK8A 4LQGA 1WVMA 4P45A 4OC0A 2JBJA 2PVWA 4NGMA 4NGQA 4C8AA 4OMEA 3FEEA 3BI0A 4JYWA 4P4BA 4C8UA 3D7HA 3RBUA 4NGSA 2OOTA 3IWWA 2CIJA 4MCPA 3SJXA 2PVVA 4TWEA 4P4EA 3IIBA 2C5QA 4C9RA 2C6GA 3D7FA 3BXMA 4YN3A 4MCRA 4JZ0A 4C85A 4NGTA 2C6PA 4P4JA 4CDJA 4X3RA 3FEDA 4TJVA 5IB9A 4C8CA 4C84A 3S9MA 4OC1A 2EK9A 4OC3A 4C8PA 2GP4A 3SJGA 3D7DA 4C9VA 4C9AA 4C8TA 3KASA 1Y9ZA 4CDKA 4NGNA 3VTAA 3FF3A 1XF1A 3K9TA 4OC5A 4OC4A 4C9EA 3BHXA 3D7GA 4OC2A 3SJFA 4TJXA 1DE4C 3BI1A 4P4FA 3S9NA 3ICUA 3I74A 4C99A 4P4IA 3I6SA 4C9UA 2OR4A 5F09A 2C6CA 2XEJA 4MCQA 4P44A 5D29A 1Z8LA 4P4DA 2XEFA 4NGPA 5ELYA 4MCSA 1V6CA 3FECA 4W9YA 3SJEA 3EIFA 1CX8A 4NGRA 2JBKA 3S9LA 5IR2A 4C86A 4KNGE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XEI A;  2XEG A;  4C8F A;  2EK8 A;  4LQG A;  1WVM A;  4P45 A;  4OC0 A;  2JBJ A;  2PVW A;  4NGM A;  4NGQ A;  4C8A A;  4OME A;  3FEE A;  3BI0 A;  4JYW A;  4P4B A;  4C8U A;  3D7H A;  3RBU A;  4NGS A;  2OOT A;  3IWW A;  2CIJ A;  4MCP A;  3SJX A;  2PVV A;  4TWE A;  4P4E A;  3IIB A;  4C9R A;  2C6G A;  3D7F A;  3BXM A;  4YN3 A;  4MCR A;  4JZ0 A;  4C85 A;  4NGT A;  2C6P A;  4P4J A;  4CDJ A;  4X3R A;  3FED A;  4TJV A;  5IB9 A;  4C8C A;  4C84 A;  3S9M A;  4OC1 A;  2EK9 A;  4OC3 A;  4C8P A;  3SJG A;  3D7D A;  4C9V A;  4C9A A;  4C8T A;  3KAS A;  1Y9Z A;  4CDK A;  4NGN A;  3VTA A;  3FF3 A;  1XF1 A;  4OC5 A;  4OC4 A;  4C9E A;  3BHX A;  3D7G A;  4OC2 A;  3SJF A;  4TJX A;  1DE4 C;  3BI1 A;  4P4F A;  3S9N A;  3ICU A;  3I74 A;  4C99 A;  4P4I A;  3I6S A;  4C9U A;  2OR4 A;  5F09 A;  2C6C A;  2XEJ A;  4MCQ A;  4P44 A;  5D29 A;  1Z8L A;  4P4D A;  2XEF A;  4NGP A;  5ELY A;  4MCS A;  1V6C A;  3FEC A;  4W9Y A;  3SJE A;  3EIF A;  1CX8 A;  4NGR A;  2JBK A;  3S9L A;  4C86 A;  4KNG E; 
#chains in the Genus database with same CATH topology
 2HWG A;  3C8O A;  5F1Y A;  3TLE A;  2XEI A;  2XEG A;  4CZ1 A;  2DIK A;  2E28 A;  4C8F A;  2EK8 A;  4E94 A;  4LQG A;  2YJV A;  1CS0 B;  1C3O B;  1WVM A;  3K4I A;  4P45 A;  1ZYM A;  2X0S A;  4OC0 A;  3T07 A;  2HI6 A;  3U1B A;  5JYB A;  2JBJ A;  3KRV A;  1C30 B;  2FM4 A;  2HRO A;  2AUN A;  1VBG A;  1T36 B;  2PVW A;  2YJT A;  4NGQ A;  4NGM A;  4OME A;  3EZB A;  4C8A A;  3FEE A;  3BI0 A;  1EZB A;  3G23 A;  3TYX A;  4JYW A;  5F9M A;  4IIY A;  3TLC A;  4CO9 A;  1ZL0 A;  3GJZ A;  4COG A;  1KEE B;  4P4B A;  4C8U A;  3D7H A;  3TLA A;  3RBU A;  4NGS A;  2OOT A;  5JVL A;  3IWW A;  4H1H A;  2CIJ A;  4MCP A;  3SJX A;  2OLS A;  2PVV A;  4TWE A;  4P4E A;  3IIB A;  2C5Q A;  4C9R A;  2C6G A;  3D7F A;  3BXM A;  4YN3 A;  1KBL A;  4MCR A;  4JZ0 A;  4C85 A;  4INJ A;  4NGT A;  2C6P A;  4P4J A;  4CDJ A;  4X3R A;  3TLG B;  4E5S A;  3FED A;  4J0N A;  4TJV A;  3TLG A;  5IB9 A;  1DIK A;  4C8C A;  4C84 A;  2D0P A;  3TLZ A;  3S9M A;  1BXR B;  4OC1 A;  1KC7 A;  2EK9 A;  4JVO A;  4OC3 A;  4C8P A;  1GGO A;  2GP4 A;  3SJG A;  3D7D A;  3EZE A;  4C9V A;  4C9A A;  4C8T A;  3EZA A;  4M8D A;  2EZA A;  2B0A A;  3KAS A;  5K99 A;  3SR3 A;  5F5X A;  1Q5X A;  1R61 A;  1Y9Z A;  4CDK A;  1A9X B;  1JDE A;  2EZC A;  3FF3 A;  4NGN A;  3VTA A;  1XF1 A;  3K9T A;  3TLY A;  1ZRS A;  4OC5 A;  2R82 A;  1J3L A;  4OC4 A;  2AUM A;  4C9E A;  3BHX A;  3D7G A;  4OC2 A;  3SJF A;  3T05 A;  4TJX A;  5FD8 A;  1DE4 C;  3BI1 A;  4P4F A;  4COB A;  3S9N A;  1M6V B;  2D0O A;  2MP0 A;  3I74 A;  3ICU A;  4C99 A;  4P4I A;  4IIX A;  3I6S A;  1VI4 A;  4C9U A;  2OR4 A;  5F09 A;  2C6C A;  2XEJ A;  4MCQ A;  3T0T A;  4P44 A;  1EZA A;  5D29 A;  1Z8L A;  1NXJ A;  2EZB A;  3NOJ A;  4MJX A;  4P4D A;  2XEF A;  4NGP A;  4EYS A;  1NBW A;  5ELY A;  4MCS A;  1V6C A;  3FEC A;  4W9Y A;  3SJE A;  3TLB A;  1JDB C;  2PCN A;  3EIF A;  1CX8 A;  4NGR A;  2JBK A;  1CE8 B;  3S9L A;  4MI1 A;  5IR2 A;  4C86 A;  4KNG E;  3T5M A;  1VBH A; 
#chains in the Genus database with same CATH homology
 2XEI A;  2XEG A;  4C8F A;  2EK8 A;  4LQG A;  1WVM A;  4P45 A;  4OC0 A;  2JBJ A;  2PVW A;  4NGM A;  4NGQ A;  4C8A A;  4OME A;  3FEE A;  3BI0 A;  4JYW A;  4P4B A;  4C8U A;  3D7H A;  3RBU A;  4NGS A;  2OOT A;  3IWW A;  2CIJ A;  4MCP A;  3SJX A;  2PVV A;  4TWE A;  4P4E A;  3IIB A;  2C5Q A;  4C9R A;  2C6G A;  3D7F A;  3BXM A;  4YN3 A;  4MCR A;  4JZ0 A;  4C85 A;  4NGT A;  2C6P A;  4P4J A;  4CDJ A;  4X3R A;  3FED A;  4TJV A;  5IB9 A;  4C8C A;  4C84 A;  3S9M A;  4OC1 A;  2EK9 A;  4OC3 A;  4C8P A;  2GP4 A;  3SJG A;  3D7D A;  4C9V A;  4C9A A;  4C8T A;  3KAS A;  1Y9Z A;  4CDK A;  4NGN A;  3VTA A;  3FF3 A;  1XF1 A;  3K9T A;  4OC5 A;  4OC4 A;  4C9E A;  3BHX A;  3D7G A;  4OC2 A;  3SJF A;  4TJX A;  1DE4 C;  3BI1 A;  4P4F A;  3S9N A;  3ICU A;  3I74 A;  4C99 A;  4P4I A;  3I6S A;  4C9U A;  2OR4 A;  5F09 A;  2C6C A;  2XEJ A;  4MCQ A;  4P44 A;  5D29 A;  1Z8L A;  4P4D A;  2XEF A;  4NGP A;  5ELY A;  4MCS A;  1V6C A;  3FEC A;  4W9Y A;  3SJE A;  3EIF A;  1CX8 A;  4NGR A;  2JBK A;  3S9L A;  5IR2 A;  4C86 A;  4KNG E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...