3TLGA

Microcin c7 self immunity protein mccf in the inactive mutant apo state
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
335
structure length
333
Chain Sequence
PLLAAPLAVGDTIGFFSSSAPATVTAKNRFFRGVEFLQRKGFKLVSGKLTGKTDFYRSGTIKERAQEFNELVYNPDITCIMSTIGGDNSNSLLPFLDYDAIIANPKIIIGYSDTTALLAGIYAKTGLITFYGPALIPSFGEHPPLVDITYESFIKILTRKQSGIYTYTLPEKWSDESINWNEILRPKKLYKNNCAFYGSGKVEGRVIGGNLNTLTGIWGSEWMPEIRNGDILFIEDSRKSIATVERLFSMLKLNRVFDKVSAIILGKHELFDCAGSKRRPYEVLTEVLDGKQIPVLDGFDCSHTHPMLTLPLGVKLAIDFDNKNISITEQYLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MccF
publication title Structure and function of a serine carboxypeptidase adapted for degradation of the protein synthesis antibiotic microcin C7.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 112
structure length 333
sequence length 335
ec nomenclature
pdb deposition date 2011-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02016 Peptidase_S66 LD-carboxypeptidase N-terminal domain
A PF17676 Peptidase_S66C LD-carboxypeptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Class I glutamine amidotransferase-like 3tlgA01
3.50.30.60 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 LD-carboxypeptidase A C-terminal domain-like 3tlgA02
2AUMA 3TLYA 4IIXA 3G23A 4EYSA 1ZRSA 3U1BA 3TLAA 4IIYA 3T5MA 5F9MA 4JVOA 3SR3A 3GJZA 5FD8A 5K99A 1ZL0A 3TYXA 3TLEA 4INJA 4H1HA 4E5SA 3TLGB 4E94A 3TLGA 4MI1A 3TLBA 3TLZA 4MJXA 5JYBA 5F1YA 3TLCA 5F5XA 2AUNA
chains in the Genus database with same CATH superfamily
2VDUE 3WLQA 1RQPA 1I5OA 3KVNA 3K30A 2HU7A 1Z9BA 1TVKB 3T7TA 4P0QB 3ENZA 3P94A 4DR5B 3LY7A 3IO5A 2O4UX 1GZ3A 2P6MA 2NNLD 4OF4A 4OQQA 3LPAA 1E2KA 4F5DA 5BP7A 1GVHA 3GJSA 4O29A 4AF7A 2GCOB 4JLPA 4K9KA 3FLEA 3FPBA 4Y2TA 4CUJA 5K0FA 1NW3A 1B3RA 1N3YA 2N75A 4AB1A 2IZ6A 1E2BA 1MUUA 3T34A 3R6GA 1QLWA 1QX4A 2A14A 4CBVA 3U62A 5I8WA 3HJFA 2PX5A 4PCVA 4BQOA 5B7GA 1RQRA 1RWVA 3BGVA 1PJSA 2O2HA 1Z82A 2VEDA 5DLQC 4YJDA 1L1FA 4BUJA 2AXNA 2PL9A 1VFNA 3MGKA 1CQPA 1F4LA 4YCCA 2I3BA 3MUFA 4ISCA 1MC1A 3S81A 1Z4IA 4JJ4A 4QOGA 1PK9A 2BBTA 4AMZA 3QJGA 1JAHA 3CM0A 3H2JA 3MUNA 1WXXA 2COEA 1I1HA 1M2JA 4WOJA 1YB5A 1QZTA 1W88B 4K87A 2VZ8A 4KQ9A 4ZP1A 4CIDA 4R1UA 1P8JA 3AFNA 4K88A 3OTOB 2IS2A 4GKKB 2C6GA 1JZSA 3ZBTA 1XQVA 4I8XA 4KTVE 4EPYA 3DZBA 2EC5A 4XB1A 4EZBA 1XTVA 2PZ8A 3H13A 4RZ3A 1O57A 2AC4A 4ZKDA 4G1UC 4FNMA 4C3ZA 3ICEA 1SN7A 1QONA 4FOLA 2ZRDA 1JEJA 1QTNA 3JY6A 1W4CA 2WG1A 3I39X 2WSIA 4IIGA 1CS4C 4LECA 5JSKA 1GNPA 4TLCA 5TR9A 5IVKA 1E9EA 4I7EA 1FW8A 2HGSA 1II0A 3CLRD 4IF6A 3MCZA 2BMWA 4IDFA 4D4KA 1IN7A 3Q10A 2VT3A 2G8NA 2Z5LA 2AZMA 5CNKA 1ZK1A 5L45A 2B1GA 3UC5A 3B52X 5C4MA 2A1IA 4H6VA 4MWGA 2QS9A 1IOZA 5GONF 1R0BA 3I9NA 4R0MA 4X54A 2XMQA 4F5YA 5IN5A 1MVOA 5J23A 2GJ8A 3AR3A 1ORDA 3D0OA 1UH5A 4OYHA 3QJYA 1SK8A 4D9GA 3AF4A 1Z8FA 2WU4A 4NESA 5FOSA 4KAFA 4YRGA 2FDCA 2CCGA 2QLFA 2CBZA 2JGKA 3PHIA 4OLJA 3SZRA 3HVKA 3ZEAA 2XOKD 4XWOA 2XCTB 1JR3E 5AKLA 3BN3A 2YWCA 3M9XA 3RS4A 1G6OA 2RAVA 1YTLA 1XT6A 1JBEA 3PPVA 1UDWA 3CUKA 2FZ4A 4W6ZA 2PEZA 3UJAA 3EPLA 4V0ME 2EDCA 3RHSA 2EIHA 2LCFA 3FPGA 5K6AC 5GJVC 3WJAA 3WXMA 1AKMA 1M34A 3M1LA 3QI2A 1VB3A 4XVUA 3SC2B 4UZSA 2X2OA 3W0LB 4I4NA 1X7WA 4F71A 3KETA 3NALA 1BDHA 3KDPA 3CLSC 4QUEA 4X3RA 2HM7A 1T9GR 1V1MA 3CINA 3GEBA 4L0MA 2FZGA 2VA9A 1F3OA 5EXEA 1YO6A 2V98A 4W1PA 1WCXA 4GYWA 3WWDA 5E3HA 1N5OX 1Y89A 5A3QA 2IOHA 3T3GA 1BGXT 3Q7IA 4RWEA 1PWZA 1ISPA 3GEMA 4UHHA 5A0TA 2GK6A 3E2MA 4H18A 4BMVA 3IE0A 2YFQA 2GLXA 2NVWA 4QLOA 5EQDA 3DZKA 5JPIA 2EGUA 4BO7A 2BTQB 3AK4A 3P7MA 4DJDC 4ERNA 4LF6B 4RMIA 3ZVMA 4F3KA 4G2TA 2H63A 2ZZMA 4Q18A 3IURA 4LRYA 4CE6A 1EUZA 3LU1A 3AEXA 1UKAA 2XUZA 1RWMA 2O3RA 1QGAA 3MGGA 3LM8A 4RVCA 2QM7A 3UJ8A 2WJPA 1RFGE 3O1LA 3FMFA 3TLGB 4C04A 4EW2A 1NXSA 2FK8A 3EVNA 4D8WA 3ZWXA 4AT1A 2LR0A 3UTDA 1W75A 4G0NA 4G25A 4PLWA 5JV5A 2OGZA 4N03A 4ON9A 1XEWX 1YDWA 3OIGA 4IJVA 1D4AA 3Q8WA 2OMEA 5LR6A 2V9PA 5BWBA 2VVTA 4IO1A 3KOOA 3ZW9A 1JKFA 4U7FA 3HL4A 4RIHA 2BGNA 5ALQA 4QDOA 3MB5A 1QIJA 3H8VA 3QOYA 4KFRA 3V2HA 4FMDB 1FE8A 1UAGA 2X3YA 4CWAA 3WQHA 3U44B 3S28A 5LOVB 4F9FA 2DFDA 3ABQB 1UP6A 4PANA 3HFSA 2XJ9A 3EJ6A 5AH0A 1PJZA 1ZL0A 1QE0A 4XVRA 1BYUA 4N7MA 3COJA 2ZWOA 3L93A 3WRVA 1QB7A 5HGXA 3TECE 4KOAA 4LRSB 2E1PA 3C8OA 4A27A 3OE1A 4LY9A 4A36A 3AVVA 1Z35A 3L4EA 4OM8A 4R2KA 4ZTUB 2I2AA 4LNUB 2HFJA 2F1IA 5IB9A 2WIKA 3F46A 3JYNA 3CW8X 4CG1A 4K03A 5L3RA 3LT4A 4KLAA 3I5YA 1ZJJA 5DLYA 4EP1A 1QH1B 1ZQ1A 3RDPA 3H83A 4GYKA 3O93A 3HJHA 2OXIA 2QDXA 3V46A 1BMQA 3QWAA 1QIFA 4RHYA 4Y6QA 5B1EA 4OOEA 4FD2A 1OLOA 5CDFE 3U3MA 2EBHX 4U02A 1J56A 1TPZA 1N2BA 1X0VA 3S4YA 2W4MA 4ZZIA 2VSXA 4S0ZA 2OKGA 2ISQA 1XZHA 1FB5A 1OFUA 2EP5A 2NUPB 1YDHA 1B1CA 1YS6A 2PZJA 2V97A 1AJEA 4K9QA 3E9NA 4YP1A 2F90A 4R0NA 1SKUA 3OKCA 3R6TA 2O57A 1I2MA 3S2ZA 3ZE9A 4AKHA 3EC1A 3EIFA 2PQ6A 3PD0A 3AL2A 2QTHA 4BN5A 1JHOA 1KSGA 1G8SA 2DE0X 1M7HA 1BQ3A 2KW5A 2XMDA 3QLUC 1TXGA 4TTAA 3HNOA 1XZ8A 2BI4A 3E8SA 3L0DA 2RHTA 4PNEA 3U56A 4XGKA 3LK7A 2ZDQA 1KMHB 1JG2A 2O8VA 4V0LA 1TM7E 2RGGA 3VNSA 3F4LA 4WLUA 4K6OA 4DPKA 4EEZA 2CMDA 5HE9A 1ZBDA 2O7QA 5JISA 4XVHA 5CD1A 5JS1A 1PW7A 5JC1A 4IV8A 2VAPA 3QLUA 1G5RA 5JO9A 1MBZA 3EX7C 2HBQA 4HLUC 2CE7A 2ZTMA 3OEHA 2CNKA 3LHIA 3OJLA 3PHBE 4R1QA 4RACA 4WZZA 4Y3UA 2EZ8A 3AXSA 3NHFA 3FVVA 2EV9A 3RFTA 4AL4A 5JCXA 2IEDA 1LLUA 1OAOC 5EWJA 2J3EA 4QQ8A 3IQFA 1W2HA 4OKIA 4A8JC 1DAPA 4PS1A 1D04A 3LUKA 4ROSA 4KXXA 3RV3A 4G81A 4OHBA 1UDAA 4HLUA 2E0IA 3MMNA 3PNKA 3D3JA 3CRNA 5I4KA 1X77A 1A9TA 1I1QB 3IYLW 3EVFA 2BHNA 3R5SA 3S2YA 1VE3A 4URUR 2XVYA 1DIOB 1OAOA 4P35A 1OU0A 2H9YA 2XAAA 5G3YA 3MLBA 1KORA 4E31A 5IJ9B 2BEUB 5IDXA 2OO5C 2EZ9A 2VHVA 4FFSA 4G84A 4A8JA 3PDWA 3IO3A 1V6AA 1KS2A 5DK4A 2I6SA 4H35A 4M36A 1SKAA 1MPXA 3CKLA 1GV1A 1UJMA 5EZYA 2WZDA 3HCEA 1ZD2P 3EAGA 3PSHA 4O4JA 5H9WA 5EJ5A 1NYLA 4YJ2B 1CJCA 1RQ2A 2JIRA 3ILHA 1VA5A 1GAJA 2IYUA 2YOHA 2OO5A 1QO0D 3L7BA 1WCWA 1JF8A 4BO6A 2C07A 1RYYA 4M8LA 3BSFA 3ID6C 1I24A 3CVXA 4FIZA 2HWKA 3CR7A 4O25A 1VDMA 1DBVO 4CIXA 4JYZA 3EY9A 4NABA 1DRVA 4C6RA 1M1UA 1QRAA 4LV5B 6CHYA 1TVMA 2P4SA 3OD5A 3JQ8A 1P1KA 5HCIA 2VYNA 2QX4A 1ZD5A 2PZKA 2ZROA 3DVLA 3PWSA 5KYWB 2Z04A 4DG5A 2PKQP 2X6TA 4N5IX 5ED0A 1IRXA 1W5EA 3BSSA 3G6WA 3KOWA 3CX6A 3CJRA 1E7RA 3ORFA 4C20A 3VZQA 5JIBA 1F0YA 4FUTA 4CMIA 2GR9A 1OFVA 3PR1A 4RCVA 5DULA 4D6XA 3W9BA 1VIDA 2IYNA 4X94A 4QUBA 3RRJA 3BJEA 1T13A 4ENVA 4RDIA 1TZBA 4LZJA 3M9WA 4OC5A 4W9NA 1S2LA 3FEDA 4LC1A 1XR3A 3TVDA 3BXEA 2IH4A 4WZBB 5BWLA 3ZHQA 2A0XA 5CD9A 5LJLA 1NQUA 4PHGA 1E6MA 4C3VA 2BKXA 1E3IA 3FNGA 3SEFA 4V0QA 3RSLA 3H8SA 3IUBA 3MRVA 1JAZA 4L8GA 4MR8A 4PAQA 1TIBA 1U9CA 2O1WA 521PA 5A5DA 5IVPA 2GLTA 4R8VA 1WBJB 2V0CA 2D5BA 1V35A 4LGMA 4Q9KA 2VIIA 3ENWA 3WK9A 4NV1A 1A7JA 2CUTA 1FMJA 2Z5VA 3STTA 3K0FA 4HAXA 2NADA 2CLMB 4LYGA 3LQ1A 5FIUA 3NANA 3ZCUA 3UWKA 3ZCRA 3DOFA 3I2GA 4RTNA 1YNSA 1RZRD 3K0BA 1MJ5A 3QXJA 3T99A 1AF7A 4KXLA 1N1GA 1BDMA 3FOAA 2FWNA 1R6BX 3FM9A 1OFIA 3UMSA 5F9FA 1U0LA 2JGDA 3WO0A 1HRDA 4EEKA 5LP6B 4EL5A 4QRIA 9GPBA 2PLRA 5JTUA 1JKMA 4R2IA 3DDNA 5D29A 1G5IA 1S8OA 5E2BA 4A5OA 1A77A 1M6NA 1BDJA 4RSRA 1RM5A 1XRRA 1XZCA 4IDCA 4QYMA 3F2VA 2DCMA 5DXAA 1OBFO 1HYBA 3OZWA 1XA3A 1XQXA 1SCUB 4QUDA 5D1HA 1BHO1 2C98A 3RK0A 3FOBA 3RKUA 2Q99A 3O1JC 4NU8X 4HEA1 5LSAA 1DVRA 5HKBA 4J4TA 2FX2A 2VF7A 3RABA 2YC2C 4MV3A 1CR1A 5C34B 4KVGA 2WD8A 3OWHA 4K6FA 1CR0A 1Z6QA 1DXQA 1U9JA 2OY0A 3E9QA 2X9LA 5JSQA 4BKQA 5EIHA 4DN6A 1CUSA 3PXEA 1JHYA 3LVQE 1PZNA 3GP5A 4Y2RA 4DCUA 3MHPA 3OLYA 3QVJA 4YP7A 3O74A 1L8AA 5FBRB 4BYMA 1KPIA 4D9JA 2IYOA 3U7JA 3PLAE 1NN0A 3OICA 4R1PA 3GLGE 1M10A 2D2EA 4C4ZA 3G8DA 4N49A 3D7GA 2ERYA 2OV8A 1BXRA 1QB8A 4DNOA 2VUUA 3R9KA 4K1XA 2EEPA 2NU6A 4NFLA 4HGZA 5HW0A 1XXLA 3SZUA 4HDSA 4IMJB 3LPMA 5KEIA 3T3DA 1FP7A 1G2OA 3VO8A 4Q7QA 3N6VA 1AZWA 4X62B 2JEOA 4N4AA 1G55A 2P3QA 2IHNA 2JBWA 1GA4A 4HEA6 4ARSA 1CS0A 5FOXA 2ORVA 5HIIA 2WTMA 1C2TA 2WSMA 1XLUA 1AKTA 4C2AA 2XB8A 3WK4A 1FNNA 3I8SA 3GDOA 1YJBA 4U5XA 5DKFA 3T9DA 2EJCA 4MEJA 1ZK0A 3D6VA 2OBBA 2HCBA 3K5PA 4JVMA 5EIAA 3OPNA 4UOQA 1LSUA 5THKA 4PTZA 1NMSA 1XKLA 3ZH9B 4AURA 3TAXA 2OXRA 1KAMA 3VR6A 4D46A 4NZMA 4ZHSA 3V8MA 1G6HA 1K89A 1A69A 5ADUS 2OAEA 4PFKA 1CK4A 4V0RA 4OX9Y 1EAYA 3DBRA 1PLLA 1VFPA 1AV6A 1F7VA 1QYDA 1QP8A 4GI2A 1RKQA 3SYTA 1GXSA 2JIDA 2R1UA 3LT1A 2GP4A 4TRRA 1DBIA 2BC9A 2FTKE 3HGTA 5C1DA 2XMRA 4GX0A 3FOCA 5EPOA 1WB5A 3C7AA 1N5LA 4YMGA 3E3LA 5ALDA 3Q8KA 2O14A 3F9RA 1GU7A 1KVTA 3BSYA 2R96A 3ADOA 4KE7A 5TJ9A 1P3Y1 1JG3A 4YCSA 4MJLA 3VKVA 3DW1X 1TKAA 3S5JA 2JD1A 1Q0LA 4D8VA 1RVV1 5C8YA 2GF9A 1U3WA 4ETNA 4LTNA 2JGLA 2Q28A 4P4GA 3MTQA 1UJ5A 1ZG3A 2QE7A 4CEJA 2OESA 3L7DA 2YYZA 3HQ4O 1OASA 3D8SA 1T6YA 3KSRA 2WAYA 1T36A 3B5EA 1GPDG 1C4KA 3IQIX 4KWIA 1LLCA 2C4TA 1SVKA 1MNQA 1JPVA 1PV2A 3H4VA 3SMQA 3T9CA 3NAMA 4D9IA 3FPCA 3L8HA 3ESAA 4M7RA 4WOBA 1Y3HA 3JWEA 1XU4A 2WYIA 2XOXA 4WXEA 3BT7A 1N8SA 4RAOA 4XVCA 3T7JA 4TWZA 3RK1A 1V48A 2O2EA 4MYUA 4HGNA 5JAPA 1QZ3A 1EDOA 3VR4H 5IH7A 2O2DA 3MCVA 1CHNA 3VSBA 3MA0A 1FDIA 1X6VA 3C6MA 1QWOA 4MRNA 2CLFB 3RPEA 1EBUA 1OCEA 3DL0A 4XFDA 3C3EA 5CNJA 4HWTA 1AMUA 1C9YA 2WYWA 1VG0B 2M1ZA 4L15A 2UXCB 4ML3A 1YS4A 1W5FA 1FS4A 3FROA 1Z13A 1M75A 5D8DA 1M34B 5AVQA 1J97A 3ZIAD 4OB7A 5I7UA 5DT2A 2HX1A 1Q16A 3CNBA 3IP8A 3RU2A 1MH1A 1Z6XA 1X7WB 2GERA 1YB2A 2JS7A 4OQEA 5EHNA 1Y6ZA 3DE2X 3T7RA 4B2YA 1V1MB 1UT6A 2GK3A 4JFRA 3THOA 2H17A 3FKSA 3HCPA 1KSFX 4N6GA 4DCNA 5AKHA 1SC3A 3R9IA 2HA0A 1ZICA 1TUEA 2W4QA 3S29A 1P3JA 1ZIPA 3K1ZA 4CR7A 1N0HA 4F3CA 2H7YA 2GEUA 4NGRA 1H66A 4NXNB 3Q1KA 1P31A 2HK9A 2QM8A 2Q41A 2DERA 5A7FA 3HXQA 1A95A 4WACA 5IFLA 3AUAA 4K40A 3T7SA 3VJKA 1OAKA 3COVA 2FSVC 5C52B 4U7WA 3ACCA 3H5OA 3OQPA 4RK5A 3UT0A 1A9OA 2QUZA 4C08A 2F59A 4E1BA 1CX8A 4HQ0A 4RSMA 1USWA 5K3FA 1AD2A 3O9VA 3NC4A 4B5KA 4WKNA 2FSVA 1AT1A 2NZWA 1LSJA 2UV8A 3PGMA 2JKYA 5K8LA 1NKVA 3DOJA 3N6XA 1ZJ5A 5G1PA 2A86A 1QV7A 2AG8A 2IPXA 3TS1A 4BQRA 3NC1C 4PZLA 4Q82A 5DBHX 2YIJA 3T0GA 5AHRA 3ZE8A 2Q46A 4XJSA 2X22A 4PF1A 4OJQA 4ER6A 1L7AA 3BMCA 4BAZA 3QE9Y 2E28A 5M2QA 1Y8QA 4BZPA 1L5SA 3HB9A 5EIWA 4EIWA 1K98A 5EXTA 3L8DA 4PYJA 3HYCA 2WMDA 4CHTA 3U4CA 4YV0A 1KPGA 3MC1A 5HKLA 3LQQA 3D7LA 1UJBA 3ISJA 5H83A 4U7JA 5HF5A 3FDZA 3RIYA 3URKA 3WDSA 1D2GA 3K9WA 1QU2A 2Z4TA 1OI2A 4PYKA 1TM5E 2EL9A 3CO0S 1FFBA 5DWDA 1HE1C 4JC5A 3U26A 1E9VA 2JPDA 2DTDA 4WJKB 3JQQA 1XQ9A 4ZO7A 1KVQA 2Q9CA 3I4LA 4XZ3A 3VOTA 4DIOA 1SBQA 4NDNE 1WB6A 3AM3A 4RADA 1K7XB 4F3NA 2GRJA 2AWOA 2CJPA 3FRJA 1EWVA 2XTMA 4W7HA 4JIGA 4XWWA 2VTBA 3FTFA 4R6WA 4W1SA 2BFMA 3F74A 3OC6A 5NULA 4FGUA 3W3AH 4BMYA 2PU5A 4ARBA 3FDIA 3RIGA 2G1UA 2FXIA 2WC1A 3WISA 3QXXA 4U63A 4BLTA 5FULA 4K9OA 3VC2A 1YR3A 2ODWA 3OQHA 1YZNA 1H8ED 3CH7A 4ONEA 2B83A 4IQ8A 4PWYA 1GQQA 4UNPA 2QAJA 4GPZA 3TX2A 4BO2A 3GWZA 3PITA 1PO7A 2C2GA 1Y6JA 4IDEA 4GF5A 3W78A 5JU6A 1Y4SA 2AF4C 4YDRA 2NNWB 2C4UA 3BVPA 1XYVA 2PRSA 1QRTA 1TEXA 3EDOA 5H16A 3TQHA 1ZK4A 3I6QA 3OQJA 1GY8A 3HR7A 3PIDA 1TMYA 2A9KA 2O2XA 4O1MA 4UNNA 2LDXA 4WA8A 4YT2A 3PP8A 3QG1A 1DBSA 2R1TA 1OZGA 3Q15C 4M9SA 1S7GA 4EHKA 1KVRA 1V11A 1RI2A 1A7KA 1YRYE 1NA5A 3P5SA 4X7RA 4YONB 3SPXA 4ANFA 4TKVA 1KO7A 4UBJA 1W93A 3C4VA 4DY4A 2AOUA 1U2DC 3GAMA 3MF4A 1EQAA 1NR5A 3ZI0A 2ANBA 2IQ5A 4L4SA 3F4KA 4B6OA 5L9AA 4TM8A 3EZGA 4QASA 4YRAA 5EWJB 2AEJA 2DYKA 5AESA 2HQOA 3H2IA 3JD3A 4IRUB 3NCTA 4DT1A 3FX2A 1AQNA 5LPNA 1U7ZA 3IPAA 1N1DA 4DLWA 1E6CA 3I74A 4YAKA 2QMHA 3FKQA 1H0HA 3EGXA 4CN9A 2QHXA 2P1ZA 5CJ2A 1RABA 5IW8A 4PFSA 4YUWA 3L05A 3PD1A 3NT5A 1XE3A 2C5FA 2GN2A 2W93A 2VT7A 2WYVA 1BX1A 3Q41A 5FLXA 4D3XA 4C3UA 4LXXA 3LUDA 4NSNA 3A9WA 4UXHA 5D3ZA 3GGOA 2ARKA 3GJRA 3GROA 4J7AA 1G19A 4UAGA 4Z3DA 1WCYA 4A8JB 2FDRA 4HRXA 1ISGA 1W5TA 2Y1EA 4BWGA 2BR4A 1M2KA 2UYGA 5EZYB 4Q9JA 2VYCA 3P9SA 4O4JB 3OVMA 4DTCA 5IU6A 2AHRA 3D7HA 3C74A 1PWHA 3JVUA 2I29A 2GSDA 5TB5A 3A1EA 3K5HA 4JUDX 5HIJA 4IFTA 4C7VA 4KK4A 3COZA 3EDRA 1CIPA 2TYSB 1P1IA 2OB1A 1Y6FA 3JWPA 5DIZA 4L3OA 4M9UA 2G04A 2EDAA 5AIBA 2ZRMA 5AQEA 5K3AA 3JARA 4I66A 2OD2A 4BKPA 2DUWA 3WJ1A 2H4XA 2GASA 1ZOSA 3INNA 4L5CA 4E11A 1J7KA 1BWQA 4R54A 2WKWA 1YJQA 1JMYA 2FV8A 3JQ8B 4X8OA 4DLLA 1UOOA 3AIIA 2YDXA 1EWQA 1K3UB 1TEVA 2AK3A 1YDGA 3ED1A 4RKEA 4DLRA 2WQ7A 2EFHB 3O26A 2CT8A 1P80A 1L5RA 4B6SA 4D9BA 2AH5A 3PHLA 3S68A 1WXWA 3ZNQA 4G09A 4CMIB 1FCJA 5THXA 2NUTA 4JI3B 3T3NA 1KTVA 2WP0A 3GGGA 4JJAA 5LQKA 2CSUA 2ZDHA 1W47A 3AJ8A 4IX9A 4NZYA 4BDSA 3OU7A 1YVUA 4GMDA 5FJJA 1PV1A 5LZ4A 3M8KA 5DNWA 3IQZA 3VU9A 3FRIA 1BG6A 3HSYA 2I8LA 1W5BA 2ONZA 3AVQA 1RYEA 1QHIA 3AHFA 3T54A 3WB0A 5JXIA 5KCZA 3A32A 3HUDA 5TSDA 3HVJA 4RPJA 5TC4A 5AVYA 3VYTB 4W63A 1VJ5A 3DEKA 2BDEA 2KQUA 3HBLA 1T3HA 3NHBA 1FFHA 4MR8B 3UTCA 1YQWA 4UDOA 1U0FA 4M83A 4CCSA 1I32A 1Y0BA 2L2QA 1AHPA 2K6GA 5E7JA 1HKUA 3SI7A 3A3OA 5IM4A 1N2EA 4G0VA 4M99A 4IUCS 1LRLA 3A7EA 3AHGA 3K0FB 1DJMA 3NX4A 2GM5A 1DAKA 4GE0A 2W6JD 4M46A 4P2BA 2BLNA 5C80A 1N5IA 2HRQA 3L1IA 3RNLA 4BNZA 3GH3A 1CDZA 4B45A 4L85A 3QVGA 4DJJA 1H65A 4LXIA 2BKVA 3DDHA 3SS7X 1VL1A 3A0RB 2JGDB 4AF6A 4DCPA 4B3GA 3PENA 4FLFA 1XVVA 2GN9A 3G85A 3CJTA 3GRUA 5AKXA 3WK7A 1PCXA 4BCBA 3GFPA 4I6EA 4LJYA 2C8KA 3O1IC 4C84A 4JZKA 1LQTA 3ZXSA 1RU3A 4OTZA 4BO8A 1Z06A 1SPXA 1U4SA 3LWDA 3CUYA 4UBOA 3AIKA 1ZIDA 4ZDWA 2R7KA 4OJMX 2HJ9A 4D0NA 4JAVC 1GFZA 3KELA 3UAZA 1GSIA 3DMNA 2HJSA 1SVOA 1FRQA 5DX8A 3QOWA 1XTZA 2MR6A 1ZNQO 1YGPA 2IY7A 4QZVA 1BGWA 1Y3BE 4BUZA 4RZ2A 5DNDA 1KKUA 4IG9A 4OJYA 3WK5A 4UFNA 2BTOA 3HO6A 3ROPA 1GRNA 2VCHA 3FFBA 5L7WA 1WDKA 4Z8YA 1M72A 5H3LA 3EXG2 3T5AA 5TMPA 1KJZA 2FVYA 2VBCA 4Q19A 3TQOA 2IK8A 2X5JO 2OFFA 1RJ9A 5C32A 3HA5A 4NS4A 3ZNPA 2C2YA 4TQAA 1BE0A 3ZNOA 2BCGY 3V5NA 2NXJA 4UE3S 1WBDA 2W6ID 3E3AA 5GIOE 1BXRB 3AT1A 3F7NA 3HKEA 4FHZA 4FWIB 4GWLA 2NU6B 4O6VA 5KVVA 1QG6A 2WIFA 4R83A 3MJCA 2JCYA 1XF1A 3INYA 4HDSB 2ZYUX 2UYCA 5G0TA 2PS9A 2G82A 3CN9A 2YHUA 3Q3VA 1HDOA 4K81B 4BMZA 4DNXA 5JCJD 5K3BA 3QFCA 3LD9A 1MG5A 1W6RA 4A6XA 5K1ZA 2V4MA 2ZK7A 3FIUA 4BATA 1CS0B 1XMXA 1FFXA 2B30A 1MHPA 4KC0A 1DKQA 4QUIA 5D6NA 3VYWA 1EXMA 3GX1A 1Y1RA 1VPDA 4WLNA 4KFCA 5I9LA 2F8TA 1UXOA 3UMRA 4HMOA 2O06A 2XQFA 3U1VA 4X60A 2OK8A 1L0BA 5IASA 3RW9A 2H1LA 2OBFA 4LEIA 2GT1A 3R5JA 2QD3A 5CA1A 1KETA 2H51A 4Z54A 4C0LA 1AY0A 5IT0A 4B2IA 2W42A 1V71A 3IC5A 3L0OA 4WRRA 4C8AA 2D1SA 2Y71A 3CU5A 3T52A 5BSGA 2BEVA 1KJ8A 1MC4A 1XZFA 2D06A 2VJYA 3W2FA 3PXUA 2YYYA 3CH5A 2OBMA 3DBRB 4N48A 2A9OA 4F11A 2ZWMA 1BVUA 1LBIA 4KPUA 2WG0A 1N0WA 4JVLA 2GBIA 4IJQA 1GXSB 1RAHA 3M6AA 1RM3A 3OPMA 4IIHA 3RU3A 3ZU2A 1B14A 4FMBB 2QTWB 1ORIA 4I4TF 4JC0A 2YMQA 5AW5A 3SIXA 1ZX1A 2WHRA 1Z8LA 4C9AA 3D2CA 3V3TA 4AJLA 2WU1A 2JCBA 1O94C 4MW5A 4EHIA 2ZJ5A 3EASA 3QVXA 1O08A 3WL3A 2GILA 3AWIA 5JQWA 3I34X 2BELA 3ECAA 4PONA 2Y8EA 3CHYA 2Q4DA 2BJHA 4GU5A 2Q50A 2R6AA 4GWGA 4H7EA 3AKDA 3GMDA 4LWZA 5BSRA 1G291 4AKEA 1LK0A 1XAHA 4G4SP 1F0PA 2CD9A 5C8YB 2FWBA 1WIWA 3LCUA 3NHPA 3UICA 4BJ1A 1JR2A 1ULZA 1CD5A 2JZNA 3LHSA 4RJIA 3W2HA 2A4MA 2HTFA 2RJNA 1VKRA 4B9EA 3IPYA 3H5IA 4EGFA 3TIVA 4CEJB 3VSCA 1VE6A 1Y5LA 1MG0A 4W9YA 2XB2A 1T36B 3T9EA 1MVLA 1XVUA 2JIZA 4ALLA 1RCFA 1SG0A 4FOOA 4TL6A 2H3HA 4FBLA 3H2ZA 4KDEA 4MIYA 2FPLA 3DYIA 4HVTA 3D6HA 3HCDA 3A31A 4ND8A 2H7CA 4BP9A 2AMVA 3LQ4A 4R2HA 1QIKA 2G9ZA 3U7RA 1NUUA 1CUVA 4B82A 2DGDA 2AKEA 1C7JA 3P9CA 4ZTZB 4WA7A 3HI4A 2I7CA 5ILGA 1BVRA 3DDOA 4EG5A 1XRQA 5HS6A 1QFJA 3QFHA 2X6RA 4OK3A 1WY5A 2VQSA 4RIIA 5IKXA 4NZZA 2XT6A 3THRA 1XZMA 3M3HA 1SCJA 2AJCA 1NJ1A 3NBMA 5C5EA 1DRUA 4YXWD 5ALUA 4I1YA 1G63A 4YI3A 1W35A 2GVDC 3SBDA 5C7LO 1PX2A 1YAJA 4W5OA 3BSWA 2P9TA 1I6MA 1MZPA 3OAAD 2CB9A 4FYJA 4H3HB 2ZS9A 3UB4A 2VTDA 5GWXA 1NXWA 4TS9A 4U2DA 4D92A 4G0YA 5JHGB 2PVPA 3D9QX 1W19A 4WN9A 4X85A 2LCQA 3K9QO 4XOIA 1B15A 1E1YA 3THSA 4YRMA 1V16A 2ZXUA 2BUCA 3Q3CA 2OFWA 5C1OA 3BCRA 3FOFC 4R68A 3O75A 3B1VA 2ODQA 3ZV4A 5LA6F 4DGQA 1AQIA 3ZDRA 2P6PA 4DYHA 2JRLA 2PRYA 2NUBA 4G0MA 1VI2A 4OQLA 1O95C 2GBLC 3UV7A 4KIJA 2CBGA 1R0YA 2EX0A 2PJDA 2DETA 4FI3C 3QMVA 1R0KA 2AV6A 4MCJA 2R3SA 3GL9A 3ER9A 1SKMA 1N36B 4U3JA 5K3FB 1UBSB 2JCVA 2DQZA 2H2IA 4MIOA 4O8ZA 1JEEA 3B60A 2CHUA 1NX6A 1NLZA 1O95A 2GBLA 3H1PA 4O1HA 4QOSA 1JTFA 3G13A 2QR3A 3NO4A 2NP7A 4WW0A 4MB6A 2VR1A 5FPQA 3U4DA 2FPPA 1DIKA 2MYPA 3BMCB 5DV9A 4NNJA 4UDYX 2XNJA 1Y8QB 3GFOA 3TM4A 4UTRA 1UK8A 4NBVA 3GMSA 3V1UA 4B6JA 1CJMA 4ZT6A 1SIUA 4EL0A 3LO8A 3WGJA 3CE6A 3IULA 3JQ9C 5CHEA 5CDTA 3H5WA 5IAAA 2FK7A 3V7FA 4REOA 5FORA 3FDZB 3VYVA 2YR0A 4OI2A 5EKUA 3SSNA 2R6ZA 1J1ZA 1S3GA 3FKJA 4DF3A 1ZL2A 3HMQA 4G8DA 4H17A 3HEBA 4O2BF 3I9V1 1G9SA 1XPJA 5CA0A 2BHLA 1IHXA 3GAFA 4QQFA 4C4OA 2AMFA 5ICSA 8ATCA 5E95A 3B2NA 4IIFA 4E14A 1GPH1 1SCIA 1YGYA 4HH1A 2JI9A 4NCJA 4OXIA 3N0RA 2OA0A 3X43A 2XDWA 4BQNA 1R8XA 5KTMA 1DCMA 3LC7O 4DDWA 1ZGHA 1CUWA 1XJCA 3DZCA 3ZI7A 4BU1A 3O0DA 4EO9A 5IJZA 4MOWA 4N0EA 2RI6A 1UPFA 5EJFA 2VTBB 1Z0IA 1CETA 2H31A 4Z9FA 3UKJA 4ETIA 2B4KA 5AUPB 4GKJB 2FA9A 3FF3A 5T4EA 3T61A 4DUPA 5LB4A 1J5XA 3VNUA 1ZAYA 4OAPA 1J2JA 2JF0A 4PSKA 3IOCA 1OZFA 4AYWA 2GZSA 2WIJA 2OWEA 1H8HD 2CXUA 4L8FA 5AOAA 2FLKA 3J80A 1QQAA 1ODLA 4MVXA 4JCCA 1VLMA 4L51A 2QT0A 4A0GA 1XRLA 2WK1A 3MG9A 1XP5A 3BZUA 1QYXA 2XT0A 3DLPX 4KXQA 3IEUA 1JEYA 2UUBB 2IP1A 3SIPA 5K8IA 4GR4A 4JBIA 1KU0A 3QU9A 1ZKDA 2RB5A 4NBNA 1TD1A 5JPCA 4HZUB 1U3TA 1ZVJA 4KR7A 1G17A 2EF0A 2GS9A 3SC6A 2R1TB 3ZLVA 2ACEA 3RVSA 1USVA 4I1IA 4LMBA 5FA5A 3ANMA 5DGCA 1V11B 2W90A 4EJ6A 4I1PA 1YHYA 1Q50A 4ABYA 2V58A 4JOQA 2WKQA 3K4PA 3BL8A 4J7XA 4TKVB 2K87A 4RXUA 3QBJA 3ZCSA 3DSRA 3MMXA 4ECEA 5KQLA 2AOUB 3O1HB 3CX8A 1OIXA 1SUIA 2Q3FA 1FP1D 1Z2EA 2ZWVA 4OCZA 3TPZA 1NQVA 1V47A 2FOIA 3GEDA 2YVQA 2RIRA 1PW5A 3CWQA 3LECA 2YRFA 1H3NA 3E0XA 4JNKA 4L6AA 4KGZA 3EE6A 4Y6PA 4CM8A 5KTOA 4HZIA 2GQ0A 1V5EA 1XL1A 2QD1A 3JASA 4ND6A 1TFUA 1V2HE 4DT1B 2JLYA 1FFAA 1TJ4A 5BSTA 1PEKE 1RT9A 3EGXB 2PGNA 2PVCA 2GTHA 1QSGA 5G0WA 5JAHA 2K7ZA 5FUVA 4H77A 4HX2A 3WFZA 4AG5A 2FR8C 2RMKA 2VF8A 2WKRA 4LI0A 2IEIA 1O5TA 2ZIUB 3FNEA 1P1JA 4I50F 3GGPA 4I50A 3RAFC 2GEFA 4I1UA 4JJ7A 3WWEA 4AXBA 4Z53A 4FKZA 1TDJA 2J67A 4MV6A 4RDHA 1ZI6A 2ATVA 3ESQA 1CIVA 2RBEA 4UCWA 1S4QA 2FR8A 4JSYA 2YHAA 1XZPA 3O21A 5AK0A 1DXOA 1RQNA 3UGJA 4XYEA 1SXJA 1SZCA 5IARA 1XMQB 1SVMA 2X3UA 4HNVA 1K8QA 1Y1LA 1EE9A 3FIJA 4MRMA 4YUVA 1QDUA 4OU4A 1E1KA 2DR0A 2FUG6 4B73A 3JARB 2GYUA 1VPWA 2R65A 5CLHA 3Q85A 1LBQA 1V5WA 1XDSA 1WLSA 2VCEA 1HQYE 4BO1A 3VBCA 4MVYA 1U9ZA 2SNIE 3ESXA 3MQ2A 2QPTA 4MQFA 2OCIA 2Y1XA 3ZZ1A 4B3DA 1BDIA 1A97A 2Z6AA 1WY7A 3O8CA 3B3AA 3Q7TA 2AMYA 3FUCA 4A2CA 1Y5MA 1LV8A 2GDZA 4NG5A 2YXNA 4PGFA 1YULA 1KFBB 2Q5EA 4YLEA 5KCMA 3TJRA 2DUNA 3FWZA 5K20A 1AKVA 4CTJA 2PEYA 1USKA 2CNWD 2C83A 2M98A 2NUTB 4PIPA 1VCMA 4YUZA 2ETVA 5IPFA 1G59A 3VO2A 4UPEA 5BV1A 2CMHA 1U9IC 4X1OA 4CCYA 1NL3A 2QTZA 2QVLA 2FSSA 3DONA 4H31A 4KI0A 4V38A 3DZFA 3VU9B 1J2RA 1WSWA 2BBWA 2JJYA 3DGEC 4FE4A 3UWPA 3VJLA 4AO6A 2GN4A 3ND9A 3NT4A 2XWQA 4KAAA 4YMWA 5FLYA 1GAQA 2W2LD 4WLEA 1BQEA 1T8PA 4MLCA 4ZYXA 5F1OA 3GA5A 1QM5A 5DW0A 4NPHA 1SK9A 1L7VC 3V1TC 1SZDA 4MQ4A 1W36D 3O4RA 5H4GA 1ZXBA 3HHPA 4KQHA 1XEFA 1ZOPA 2Q1TA 3GLQA 3I9OA 1JVSA 4AX4A 1DJPA 3L7YA 2CDCA 1R0ZA 2FGKA 2I0FA 1W6UA 3ROMA 4EI2A 2QN7A 4R1MA 4PZYA 4ZT3A 3VR5A 2WABA 2JATA 4TYPA 1T0JB 3SGLA 3TAUA 1JFLA 3FHLA 3VV3A 2D6FA 4P7BA 4RIGA 3M6LA 1V9SA 4PQYA 3OTWA 4UDXX 1XD2A 5ETJA 4BJ6A 3QVGB 4BHTA 3JPWA 4Q9HA 3JVIA 4JI5B 3D8NA 4DSZA 4EPWA 5CCXA 3E70C 5FYDA 2IV3A 4PN3A 2XR1A 3D81A 3FUWA 3WOHA 5IT9A 2UXDB 2WJ3A 3ZDCA 3KOZA 4F2HA 5JI3E 4OFZA 2MSEB 2JIPA 2Y66A 2YNMD 4X91A 1KARA 5DASA 5L4SA 2C77A 5SZHB 1G64A 4AJJA 3UBTA 5DI3A 5EINA 4O3MA 2MDTA 3OIUA 1EA5A 2ODNA 2VDWA 1YJ5A 4ER3A 3MGAA 1FUYB 5CFNA 5MN5A 1NW9B 2I6XA 5DHUA 2PSSA 2GSWA 1HT3A 2RK4A 1RXWA 1JA1A 4XQ0A 5KWJA 1L4MA 1PBTA 1WMAA 2HR1A 4XFKA 3SE0A 3KQQA 1SXHA 3I42A 3KWFA 5IMSA 3D7FA 5ER6A 4JGGA 3WWYA 1IWOA 1RYDA 2X8WA 2IZZA 3O4GA 5KC9A 4CR6A 1TGVA 2FJPA 1KIAA 1UWLA 2JFVA 3EBOA 3PI6A 2WUEA 4UHEA 4DWJA 4ZVSA 1XMJA 4TPKA 2VH5R 3X0DA 2BMFA 1PSWA 3HI6A 4POOA 3JZMA 5EWLA 3NJRA 1RJ9B 3WK6A 3O82A 4KBGA 4LBZA 3UENA 3UUGA 3R4VA 2AJTA 1GAWA 4H27A 3RBAA 3FXAA 1PJAA 3AF1A 3KQPA 1J24A 4BLUA 1TW3A 1SUDA 3N8KA 4YP6A 1LLFA 1PJLA 3HKEB 3WDLA 4OGKA 3KRVA 1MDBA 1WNFA 2GJSA 3KXDA 2I2BA 3GQVA 4YO7A 2L69A 1Z17A 2O2ZA 3DFKA 2PZFA 3SBOA 1BWRA 5BW5A 3R6LA 4QHSA 5JROA 4MICA 3K9TA 3FDFA 2QGNA 4KHPB 3GJ0A 3KQTA 2XX3A 3PUXA 3LUCA 2QSUA 4OHUA 1FFXB 2IW1A 4N7BA 4DNFA 1JG6A 2XB6A 2NYVA 1WQ4A 4E3ZA 1NBWA 1IBRA 4FOTA 3TBKA 1J07A 2R8RA 4E2ZA 5EPEA 3NTUA 2ZBDA 3C1TA 1XKQA 1EH5A 2RHHA 3QUSA 3DBIA 3A7DA 4UBIA 2VRNA 1JAXA 3DMGA 8OHMA 1BNCA 1KAHA 4PLVA 1NRXA 3JCZA 2OCAA 4IQ0A 2PH3A 2NYUA 1YXMA 2Q8PA 2XUFA 4ZPJA 5CA1B 1W8IA 3C3PA 5IEJA 4YFYA 4WI1A 4NDAA 3WGLA 3OX4A 2HJVA 1S89A 3LIIA 2BJVA 4EB8A 3TSZA 1K4YA 3UBMA 2ONYA 4N41A 1YB7A 2LCIA 1ZISA 5AW8A 2BEVB 4J29A 1A4RA 3LTEA 1A71A 4GRIA 1U6IA 1Y33E 2UVQA 1DPGA 4KEAA 3RV4A 2ZXEA 3WWOA 3TE6A 4G0PA 2VAVA 3DE1X 4KPUB 5LZ7A 1OYOA 4RF4A 2CFRA 1WUYA 4DKXA 2E1RA 1Y4DE 2F2TA 3L0CA 3LW7A 1GO2A 2CUKA 2EHDA 2RGXA 3IAM1 3IAEA 4RPHA 3PHJA 4E5VA 3AB8A 2FQYA 4CPDA 1Y9EA 5KWVA 2GBPA 2GXSA 2PH7A 3U7EB 5K6RA 5IN4A 2PMKA 4RS3A 4GVPA 3TCNA 3C7TA 4YH1A 1SFRA 2JA2A 3WGUA 1W73A 2RARA 2TMYA 3AHDA 4IDQA 4XTRA 3NM6B 3PGJA 3ZE1B 3ZKWA 3AFOA 2BI8A 4YV1A 4HGYA 1A98A 2IL1A 3LY9A 3KOMA 4M55A 3EXG1 1IRIA 1UXJA 4PNZA 1SCAA 4PIVA 1JPUA 4XWYA 2HT1A 5ITZA 3K1TA 3L4BA 1EE1A 2VRWA 4RESA 1OKKA 4WGFA 3WV5A 2I1QA 1KDRA 3SQNA 1JL3A 3NJ8A 4ZVNA 4A0FA 5JY1A 3Q87B 3U49A 1SR8A 2H52A 3OQBA 1D4OA 3I05A 2ZSAA 3VVLA 2VJOA 2X9NA 1KP2A 4M8DA 5F7ZA 1UP7A 1W52X 3VNBA 4S2UA 5DTEA 4ND8B 4CMGA 4DV3B 3Q8MA 4G0UA 4COBA 2GPTA 5A9RA 3QELA 2XWPA 1X19A 1W2WB 3L8MA 3QNWA 1E7WA 4ZRNA 1T29A 3RF7A 2CL0X 2X42A 3GT4A 1MOSA 4EMTA 4ZYLA 1JIQA 4IXNA 1FXWF 5KYUA 1FXWA 2W2KA 4HMQA 2QLLA 1Z26A 2ZRLA 3GZNA 3INTA 4JP2A 4L4UA 4DMFA 2XCRB 1W25A 3CEMA 1SGWA 1HLGA 4J90A 2I34A 4O4LA 2C58A 4MPDA 2Z3WA 3Q7EA 4AS1A 1SKBA 2CLKB 4PWZA 1JT2A 4BGVA 1CUJA 1NBAA 2Y1FA 2P3LA 2WTEA 2YRWA 1Y1KE 3DTVD 1SVIA 3OSZA 2CWDA 3F4BA 3Q9UA 4C2UA 2WLSA 1PJQA 3DVAA 3RLIA 4BUCA 2QJFA 5ARBA 4XJVA 3HWSA 5F2EA 2OHJA 3HU3A 1WB4A 3F47A 1L8QA 1KOLA 4BLWA 2YWXA 3E1SA 1KYTA 3LMKA 5DNYB 3IBSA 2E37A 5T8KC 3HXMA 3IIBA 4PYLA 4WN9B 3ICCA 2PE5A 1VKHA 4F85A 1V16B 5B2EA 2YHSA 4QO8A 3AEKA 5PNTA 5B6PA 1G7TA 1GD1O 2VPXA 5J4YA 5HYVA 2BBOA 2H16A 2H8GA 3PXBA 3J81A 2WHPA 1VM6A 1EDBA 2Q21A 3BFVA 2V7WA 2BKAA 3BMXA 2QAGC 4IM7A 4TZTA 3VZBA 5B58C 4EYSA 5G4KA 3ENNA 2QOEA 1WMDA 3ENQA 5EXPA 5LMNB 2VP4A 2Y77A 4Y7CA 4HJRA 2YV4A 2E9SA 2WMYA 2XCQA 3A6LA 4FNOA 4U3JB 2O3TA 3UXYA 1RRGA 4LSMA 2IS4A 4NGTA 1I4WA 1PR5A 5ALFA 1JXMA 2XNDA 3V4LA 2QAGA 2UZ1A 4MVCA 4OMEA 5KDLA 3SJCA 2VBFA 4ZVPA 7GPBA 3HUEA 4Q66C 1YZVA 5F52A 2CJXA 4UZEA 2GBGA 3ENKA 3E0QA 2FPPB 5K6TA 1E1QD 3CR8A 4UM7A 3H2GA 1H3EA 1XCGB 3AUSA 4LQLA 3I2JA 5DCWA 4AN0A 4WZAE 1QDLB 2HD4A 2FCRA 1W87A 4P33A 2C4KA 3BJMA 3E1GA 2Q3CA 3OF2A 2YV5A 4M3NA 4X1IA 1RRPA 3UFXA 4YYEA 1SQGA 2LPMA 2O2YA 1TUIA 4H7DA 1I10A 4GPEA 5AOVA 2F8MA 3BCHA 3LOQA 1AZSC 5CA0B 2PFKA 2XGJA 3EPPA 3PQ6A 5AKGA 2J45A 5COBA 5CT8A 4RULA 2WIBA 5D51S 4AS3A 3JQAD 5MF6A 2ZSIA 2VRCA 3B3GA 1FMCA 3ESRA 3IRUA 3NXSA 1QIGA 4BJHB 2IYTA 2HI6A 3AGPA 3GRRA 4BCDA 3CLUD 1A8SA 3GRVA 4BLPA 2J6CA 4D3FA 1Z0UA 2A0WA 1G41A 3RWBA 1R00A 1BRMA 4MUNA 4AY4A 4EG1A 3RFXA 3RRZA 1AA6A 1OJ7A 5AOCA 4FEEA 4DDVA 4IEFB 1MXHA 2BDTA 2FQ1A 3Q6MA 3L7MA 1G3IA 1F8YA 2YZMA 3M5WA 4A73A 1OC4A 2QA5A 4B8WA 2VQ3A 3ZHCA 4E6EA 3OCVA 1CYEA 3KZVA 3QY9A 4UPVA 4EKIA 2DR3A 5I9NA 1JSZA 4BU0A 4H1HA 4GVLA 3T1HB 1OYWA 3OO1A 2X8BA 2WT4A 4AJ9A 1P1RA 2IF0A 3EZ9A 2CF5A 4MVJP 4Z5XA 3LE8A 2HDNB 2D7CA 2PUWA 1JEYB 4ZEOA 3PL1A 1AXEA 1G21A 1C8VB 1DKNA 1O4WA 1W94A 5BSMA 3UPDA 6REQA 3GLHA 5IKPA 5JNTA 1QHGA 1T15A 4N8DA 1HTBA 1ZN7A 3PRYA 3H42B 1NBMA 2GM9A 4MVJA 4B32A 3A6GA 3GIWA 4YCLA 2C99A 3ZTWA 4WDQA 5ECYA 4XX0A 2BGGA 2VP3A 2Z6UA 1OB5A 1E4OA 2ZSBA 3I6YA 3N76A 3REGA 3WNDA 5T64A 3BICA 2HK7A 5E1OA 2ISCA 1FSZA 3GJYA 3MCWA 1HDEA 1TCVA 2IXAA 2JBKA 3TTUA 1JNYA 2PUHA 4UDNA 2XEDA 5CLGA 5AM2A 3WFIA 1EUDA 3AV0B 4DDUA 3LHKA 1P45A 1U0BB 1EFLA 4CM8B 5FOUA 1P0FA 1NC3A 2ZGVA 3JASB 1PR0A 1Q3TA 2PS3A 4OUKX 1I0IA 1UBTS 2W6NA 3GA0A 1W9HA 3TB6A 3IEIA 1RIIA 4OXQA 4Z7NB 3UA3A 1CWUA 3R3WA 3JWHA 1P9NA 4GOKA 2R8XA 2R60A 1HR0B 3SZ3A 1UMBA 1GTJ1 2X4LA 2I6QA 4I50B 1QRSA 4IRXA 5GZ1A 4JLNA 2WU0A 2ATXA 3G2PA 1L5VA 1GNTA 1XWWA 4HAYA 2XYRA 2VPTA 2ZITA 2BTEA 1P2UA 3ER8A 2FUKA 2M6LA 2P78A 1J00A 4EPTA 4EYOA 2DHEA 3NEPX 4FU0A 1W4RA 2CLIB 3PT5A 3A4TA 3UV3A 2FP4A 3HP1A 1H6CA 1SXJB 1VBNA 2DFKB 2EU8A 3NEAA 1WS6A 1C3JA 1XHEA 2CFOA 2FLWA 1P2BA 3HM2A 2OM6A 4NKRA 5EY5B 3X1MA 3MSXA 3WAGA 4NI5A 4PPYA 4MRMB 3WE7A 5DBGA 2Q5JA 2QY9A 2FUEA 2R11A 3JQBA 3LKDA 4L5BA 3VTKA 5FF9A 1L4UA 3MILA 1TB4A 3QQPA 5IKMA 2HO4A 1E2LA 3M34A 4QFDA 3RFFA 3IUSA 4KRGA 1YK0A 3E7WA 2XADA 4MQFB 3RVNA 5L95A 1Z0DA 2WNHA 2ZSUA 5CLIA 1ZZGA 4X3OA 3O8LA 1G5PA 4MKFA 1TTTA 3TYXA 2X15A 2DWQA 2PU7A 5J40A 2RD2A 1IZYA 1K7FB 4KN6A 5DW3A 4E5SA 2VBGA 4ND4A 2EZBA 5L3SA 3KT8A 4HX9A 2J3JA 3P19A 2DKOA 1U8EA 2XUQA 2O2IA 4BBPA 4B74A 1IY1A 1CUDA 4OQ4A 2IYLD 4XIIA 1YL7A 4CCYB 3BGIA 3VX3A 4YQZA 3H84A 1Z18A 3C70A 2F1RA 2XWJI 1EX7A 3TFOA 4DV5B 1AXGA 1U0NA 1J09A 3PUJA 2YMMA 4NCKA 4HH0A 3IVAA 2X19A 1B6SA 4KDRA 5T5QA 2OUKA 1T8RA 5KYVA 4EI9A 2QP3A 3MERA 3E53A 5JBNA 2P9CA 4RA6B 3KALA 2BZSA 3H9QA 5C0OE 2KWIA 1DO0A 1OGJA 1S5PA 2ZE7A 2QRHA 3KX2A 3O2JA 3U7FB 1EIZA 2ZT8A 2VHQA 3LGSA 4IIBA 1Y82A 4FZ5A 4AZTA 1OH7A 1ZVMA 1SIWA 1EAMA 3GJQA 2JJ1D 4QUGA 1E1DA 3C3JA 4RTOA 2HCFA 2DUUA 3S7ZA 1SB8A 4IINA 5IXJA 1XD2B 2PPVA 3D8RA 4ALKA 2AN4A 5HIAA 5E1MA 4LXUA 4BN0A 2ZUSA 121PA 2FHPA 1I14A 1USIA 3CW2A 1NBHA 1FPMA 1I94B 5ARCA 1YR7A 2B0AA 5GV7A 1ZW1A 1BEEA 1U98A 3BQNB 4MHOA 3P2IA 4B34A 4G0XA 1Y37A 5DI3B 2MSDB 3ZWCA 2IRWA 4XEUA 2VDWB 3I9KA 4AO7A 4HK4A 1FXUA 3L01A 4MQ5A 3EEQA 2PGAA 3AVWA 1GADO 5LZ9A 3D5EA 2ZBGA 3EEYA 2BF7A 1B3BA 5JADA 1KHHA 1WG8A 2GZDA 5EIFA 4RD0A 2GX6A 4G0QA 5I7FA 2D1YA 1DGQA 1SD2A 3RS7A 4D82A 2F3UA 5ECWA 2BPOA 3H4MA 3PYLA 1VXOA 2HDHA 1A4UA 3L0BA 1WJGA 1P7ZA 2ZUEA 4BV3A 4R8SA 2I1LA 3AY6A 4MCSA 2WM2A 4FZJA 4HH3C 1Y8AA 4OY3A 3PFKA 1RLIA 1G1AA 2Q8NA 1GL9B 2RB4A 4FGKA 4IS3A 4RZHA 5EWLB 1YA6A 3Q9NA 3ZHRA 1MNAA 1M7GA 4OB6A 3VHXA 2O5EA 4L9RA 5JSUA 4E07A 2WVGA 2EP8A 2POQX 3GEPA 3FZEA 5HILA 3RS0A 2ZBRA 5L40A 2HYDA 2OGUA 2G5TA 1DS6A 1YL6A 3DLIA 4U2CA 3ICQB 1VE1A 4B0OA 1JFFA 1ULSA 1WZUA 2G5PA 2W2OA 3AFIA 3A10A 2PYDA 3BGOS 2ZAYA 4KUHA 3MOGA 4XRRA 4XB2A 3ZHSA 4PNPA 2YVLA 2YICA 3IOMA 2ZU0C 5EI5A 1A1SA 4C0AC 4FC6A 4YMHA 4MGEA 1T3GA 3HHEA 4MUGA 4JZ0A 2ZW9A 2WT9A 4Q7MB 3WO1A 2YJ5A 1VPTA 3FZYA 2HV8A 4F9EA 2R4TA 3IAS1 4MULA 3KVRA 1EZ4A 4TXMA 1NBWB 3RTCA 4HVLA 4LNHA 2HCJB 4QXQA 3ZGYA 2R82A 4XJXA 3PCXA 1UK6A 2V59A 3BPSA 2O3JA 5M7EA 1GPKA 2O1SA 2ZI9A 3PWTA 2WJIA 3U37A 3SOZA 5JXWA 4RTMA 2HBRA 2UUOA 1CY0A 3SSAA 5B2FA 1RWBA 4M9XA 3I53A 3KZMA 2P7HA 4PLFA 4RTPA 4K9LA 1ST3A 3DZIA 3QEAZ 2YH2A 2P6UA 3FR7A 1UDBA 5EAIA 3UAVA 2DR2A 4UUNA 1VZ3A 1LS1A 3R20A 5I3ZA 2G4CA 1T6XA 1KC1A 1YS1X 4QYSA 4B4OA 4NMXB 3BQMB 3NBXX 2HMTA 2NU8A 4DLYA 2P30A 1Q0PA 2UYQA 4IX1A 4DZRA 4YRZA 1LPNA 3SWWA 2HWGA 3EGDA 2EFGA 3RSCA 3F97A 3GVCA 4ZVQA 3DZHA 1SBCA 3K2QA 1YUNA 2PL3A 4ZODA 3I01A 4BP3A 4ZCLA 1L8LA 3HLYA 1ZK3A 1ODIA 3BIWA 1Z2OX 1GZVA 4QYTA 3RS9A 1BHQ1 4TQ9A 3OM1A 5DM60 3C97A 4CM5A 2I3DA 5JY6A 4MI1A 5JWRA 3DOUA 4YPFA 3ZKWB 1G16A 3GLUA 4M21A 1C3XA 1YRHA 3L84A 3WY9A 1HXHA 1DAEA 1F8GA 2EOAA 2IDKA 2XIQA 3UV6A 3WYDA 4CLHA 1XOIA 3AJAA 3KL2A 5BSEA 2IP4A 1UWCA 1Y5IA 3B1ZA 3HEMA 3UA4A 5ITZB 2R44A 4EGSA 3NNSA 4W5TA 4LFAB 4D81A 1DT5A 1NZFA 3DUFA 3Q3EA 2CZGA 5H4HA 1XSEA 1GUBA 3MUEA 5CGZA 1X1TA 3QTLA 5H7XA 2LP4Y 1S01A 3NRCA 5DEIA 4K9DA 1THTA 1HOTA 1E3QA 2GZHA 2OD7A 3CR3C 3F1LA 3KWLA 1IQUA 3QELB 2YYAA 4UATA 1O0SA 3CB4A 3QF4A 2O8NA 3JQPA 3W2EA 1QGUA 1SUWA 3LV8A 4I81A 4RKWA 1ZM9A 2YV3A 4W1QA 5AXCA 421PA 1QF7A 2OHGA 5KYUB 2W2KB 1MW9X 2WILA 4MYSA 1IG0A 1PT8A 1X42A 3GZNB 4DAEA 4X6XA 4P3XA 1QIIA 4DQ0A 4EKYA 1JJAA 4O4LB 3HTXA 4NL4H 4PGHA 5TPZD 2WJHA 2NTJA 3C5WP 1HWYA 5LUAA 1Y7IA 1QZXA 3VTAA 1NBEA 1PL6A 5J4HA 3VHRA 3DVAB 4ZO9A 3DMHA 2P2YA 5JW6A 1ONPA 1XQ6A 1GV0A 4EZEA 3ZE0B 3JVDA 4FKBA 3GG9A 2DFPA 3T15A 1MP0A 1NZDA 3FD8A 3GGCA 3P20A 4C78A 1G42A 2QLNA 2YFYA 2I65A 1EVJA 2Q9UA 5EUQB 4J3NA 4MHSA 5ITVA 4UVEA 3OQNA 3R40A 4AS2A 3AEKB 3UWSA 5AK4A 5GJCA 2ZBEA 3CUVA 3BXMA 2L0XA 5GY7A 2WHPB 3DC2A 1GA6A 1MFPA 4DE5A 2H57A 2YJ6A 5BXYA 3B2EA 5AK6A 4DCJA 1NG9A 1M1YE 1GKKA 2I66A 2KBEA 5AVOA 5G4KB 2IIQA 2XZPA 2ZTSA 2N47A 2I4IA 4LJKA 5K01A 3UG7A 4U7DA 3R7LA 2E3JA 3F8TA 3KR2A 4H6WA 3TCXB 3LKBA 4JB3A 2DSTA 2H6EA 2Q1WA 5F9HA 2GCIA 1OV4A 1A5ZA 2QAGB 1PEYA 1UWVA 2UZ1B 2ZZKA 4I4CA 3C3AA 3IT3A 2OPHA 3N9IA 1NHGA 5DB4A 2XYGA 2JHFA 4QUJA 5ECDA 1AKUA 1P0CA 4XIYA 2G17A 3G9TA 1EX1A 1SCNE 3KHUA 3M4YA 1PRYA 4J0DA 1WF3A 5ER9A 3TIFA 4BFWA 4EG4A 3TZCA 3KC2A 4ER7A 2QROA 2CW5A 4B48A 5AM5A 4NZPA 2FMXA 1O03A 1OPRA 2X8JA 2HMYB 4ODIA 4TMVA 5G0UA 2AUMA 4LVCA 3GV0A 2W37A 4L5YA 3LDUA 2DQSA 1G8KA 2BEWA 2QV0A 3LBHA 4X1IB 3RTGA 3UFXB 1MVNA 1L3BA 1II9A 1HA3A 4NCAA 1SCBA 1EP3B 1ZNXA 1KGDA 1FMLA 4ZAGA 3OZXA 3AJEA 3IOYA 1D3AA 5A9TA 4EVSA 3BE6A 1EFRA 3WGIA 1N6LA 1P2SA 4WY8A 3PA8A 4FCVA 2QZPA 1ZMRA 4FPXA 1J8MF 1UOPA 4EY7A 1IUKA 2VDPB 3CUEF 1FSFA 1D09A 3M6UA 1GT6A 1YUBA 3PEWA 3H9JA 1X8JA 1KYWA 1RBQA 2I4OA 3DC7A 3X1JA 4MCRA 1J4AA 3U6KA 2XW6A 5C53B 1JEDA 1K6XA 2IEGA 2FWPA 1JQAA 1JTVA 5AW7A 2OG1A 3OEWA 3Q0IA 3HFGA 1B2LA 3ZK9A 2D5AA 3D6MA 3GZTB 5A9SA 5HM8A 4B8ZA 4WNAA 5C5IA 4D99A 2I6TA 2ZJ4A 2WTBA 1TMOA 3NOOA 2HSGA 1DTWA 1QNLA 4WHMA 4AWBA 1IL0A 3QX3A 1QRRA 2WJGA 2Z9BA 4Q93A 2J7PD 3IKVA 4RPCA 4TLBA 3U9LA 4J0KA 1M0WA 4WADA 3DXXA 1JYEA 1N7HA 1DE0A 2VH2A 5CH3A 1Z7GA 4MQEA 1YBAA 2JCGA 1OFHA 1G21B 2C2XA 3SM9A 3ZOZA 4EUSA 4F3TA 4UULA 2NAFA 4PHTA 2BUBA 3GLHB 5EMKA 3ZJ4A 4A16A 1IXKA 3OP1A 4GS5A 3UJ6A 4CT4B 1T2VA 5D7NA 1ML4A 3R4CA 1A5SB 2AFRA 2RHRA 2QRKA 2VNIA 5IAKA 4U2EA 4XX0B 1PTKA 3DFZA 4MLDA 4IW3B 1Y8CA 4HWOA 3TLXA 1I2DA 2A35A 4UASA 3WA6A 2X40A 4G6ZA 5THQA 4Q4LA 4JSRA 3HNPA 3AP2A 1EUDB 1AVTA 4W5JA 3ZQKA 3DKRA 1Z7EA 1EK1A 4CU5A 4P7KA 3MAGA 3QHQA 3IP9A 2BCEA 3W8RA 3ZDEA 5SY4A 3IDAA 2B20A 1G3MA 1DADA 5DTQA 3W9UA 2XODA 2R86A 3OM8A 1ID8A 2WTXA 2R4QA 1VMAA 3CSSA 5DN6D 1O5IA 2ZRHA 1L5ZA 1VMKA 3PUHA 1E6EA 2V74B 3B1FA 4K0RA 4RE5A 1XK6A 3K71B 5KB3A 5KOJA 5CB4A 4HEJA 1UMBB 5I9BA 4LV6A 3OE7A 3S2IA 5LLTA 5KKNB 1A4XA 2TSYB 1I51A 4P7GA 5I01A 4RY9A 1OPXA 3OEED 4WAUA 3CYFA 1OXMA 2EXXA 2ZUWA 1VQ1A 3H19A 5CVCA 5JD4A 5JAQA 3A8TA 4I6JA 3LPDA 3ZVKA 3K2BA 3D7DA 1ITZA 4HTAA 5J2TA 1XD8A 1GTSA 3EZBA 4Q1AA 2X77A 2FP4B 3ET5A 5B57C 4G1FA 1W2GA 3L8YA 5KAPA 4ZRMA 3OIWA 3ZV7A 4IH1A 4E7PA 5B4UA 4AI6A 4GG1A 1KZ1A 1BZYA 1YZTA 4AJPA 2AJLI 1EB9A 3ASZA 2NV6A 3E3MA 3PGLA 1P9RA 1JZTA 4LI3X 1CUCA 2NO7A 2ZKLA 3YASA 4TTRA 4GEKA 2Y1GA 3V2GA 1IULA 2JVKA 1K2VN 5FHQA 4P80A 3ZWBA 3I3SR 1U7OA 4KBFA 4HGRA 2HEGA 3O91A 2B1QA 3HB5X 3ONEA 3A3NA 1E2PA 1DU4A 1XL0A 3A9VA 4M88A 4V0MA 3TNLA 4ZMBA 5A4KA 5L3SB 4WBSA 4O4HA 2B5OA 2A4KA 3K2EA 3DVQX 1V4VA 2YFKA 4MQMA 1ZRHA 2QX9A 4Q47A 3QTTA 5FUQA 2ILVA 3CGWA 1E2FA 2JH9A 2AL7A 2E89A 4B17A 1GGEA 1H5UA 1RAIA 1RQLA 2UZ4A 5AHKA 1OGIA 4E70A 4M98A 2E4ZA 4JUIA 1P29A 3FVTA 2O7RA 4UTVA 1ADYA 4C9RA 2ZAIA 3I2YX 4I9GA 5CUQA 1UOQA 4LYEA 4R6XA 1FXSA 2YJGA 1FDOA 4WT7A 4IDNA 5A71A 1JB1A 4F93B 3GOQA 3UPUA 3E5NA 2Z6VA 3HKCA 5U9CA 3CJQA 1PL8A 3COPA 3LPCA 1KAGA 3CSDA 3KKNA 2PSHA 1I7SB 2FQXA 2W0MA 4NWIA 2P4EA 5A03A 3O2NA 5KTRA 1QCCA 3STWA 4RYDA 4CFYA 5J59A 1WUIS 1AF4A 2FX3A 5ICEA 1U81A 4KPFC 4Z9YA 1PNOA 1MO3A 3GPIA 3RSGA 1H4VB 3W6PA 1Q74A 2J5BA 4LISA 3WMGA 2JGIA 2V45A 4P4FA 1Y34E 1QC5A 4EWLA 1AB5A 1J20A 1Z62A 4LTMA 5DJ5A 4CM9D 5GZ3A 5LMCA 4DYVA 2D5LA 3BHNA 4TTIA 3RRNA 4QDTA 3TKAA 3K6JA 4IHQA 3EODA 3O9MA 4J0QA 1F17A 3R3ZA 6LDHA 3RC1A 1ACMA 1P4HA 1WPRA 2R8OA 2I4TA 3I8XA 5IK2A 1QVZA 3UQZA 5CEJA 3GJ8A 1XQWA 2HO5A 3CRZA 2QRVA 4QDZA 2P2CA 3T5DA 3KQMA 4BB6A 1K7CA 3N70A 4MPPA 5A1TA 1GKLA 1Z5ZA 1QVVA 5H68A 4Q4JA 2G8LA 2XTJA 3KZOA 3W3AA 1QMGA 2OYCA 4JR0A 1Q57A 1ZHFA 1V1JA 3O4VA 1IXYA 1ESEA 3AMVA 4DJEC 2N0SA 5DHRA 1R6XA 1PKXA 2I3GA 4QFBA 5JFTA 2RI1A 3INRA 2JFZA 4DUGA 2X3FA 4LX0A 5EZ6B 1JLKA 3ZCQA 1PTJC 1U2SA 3SLGA 1I4EB 3NHSA 3I8OA 4XGNA 3PE6A 3VDRA 4XX1A 1MF7A 4D9EA 3OZRA 4D3DA 2H65A 3ANLA 1Z45A 1RLJA 5TARA 4Z1OA 2QVBA 2R9VA 3AI1A 3VHXB 2A1UA 3G82C 4IOJA 4MUJA 2PRIA 1H94A 2PX2A 3CB2A 4JSTA 4LIPD 4UQPA 2PUJA 4I6GA 2DQYA 4H3VA 3VPSA 1BYIA 4A7PA 2X8LA 4RMNA 4CF6A 4RENA 5CDFA 3PJEA 1FJGB 3T1NA 1JFFB 2DFLA 1OXSC 5BYKA 4UNIA 3D3KA 2HLHA 2CLSA 4HGOA 2Z56A 1GGVA 2BT4A 2IEYA 3KP1A 1FNSA 3MINA 5IEBA 2OORC 3R7FA 2G6BA 4KITB 1N77A 1HYEA 3N39C 1W29A 3EZLA 4CF4A 2ZANA 4YRTA 3M6MD 1T0IA 1DQYA 2YMLA 3IMCA 4LG1A 5D3KA 1OFUX 5AW6A 3TRKA 4FGJA 2FWMX 2AA3A 2ZSFA 1Y42X 1ONSA 1Z5NA 3BXPA 3MCTA 3P1JA 2OORA 3AZOA 2WJ4A 3U48A 3EC2A 1J9ZA 1FY2A 5DWQA 4P82A 4ZALA 1DEHA 4H7JA 4KREA 2LVBA 2EW1A 4X7PA 1JYFA 1QYVA 1T5LA 4L0CA 3CNHA 2W2XA 3RVJA 2OENG 3JQRA 4YMIA 3FPHA 3GRCA 3IP3A 4Y9TA 5BNTA 3QLJA 2DU8A 4MCIA 1IY2A 4DOMA 3F8WA 4RGYA 4YHHB 1A2OA 2OCYC 1JHXA 1WXQA 3IT1A 3X1ZA 2AE1A 3ETCA 2HA4A 2XYQA 3BCUA 4RLFA 4BVKA 2NU8B 2OGWA 3NW9A 3C98A 3RRFA 3D43A 1C1YA 3EGDB 4BL5A 3A9TA 3A6KA 3PUIA 3CMMA 4B3FX 4HPJB 2OV3A 1PR2A 1TQHA 2YXEA 3CQ9A 3E05A 1EQ2A 3OU6A 3F2IA 3M4NA 4INAA 4JA0A 4HAZA 2FW1A 3PDCA 4PPGA 1VLLA 3KU1A 1NXPA 1VG9B 4KQ1A 4N12A 4NECA 5DYGA 1GJRA 5T4FA 3LX6A 5TPWA 4MV5A 3O0TA 5LIPA 3G8AA 4ZGGA 2C2OA 3UB2A 1L6RA 4YN3A 5FOQA 3IKTA 2ZUBA 3UOGA 4F7DA 1MFZA 2BH2A 2DECA 4D42A 4OYLA 5HF6A 3VU0A 3F78A 1P81A 1ESDA 2G7MC 3MQ4A 4BKUA 1Y3IA 3A6HA 4RV5A 4D9FA 3DUFB 3OJ0A 1R0CA 3CLSD 3OF5A 5LBTA 4HDQB 3MOSA 3P0IA 4U7TB 5ALTA 4RSGA 3UAXA 1JVBA 4IMRA 4M0LA 3G2IA 1PFQA 3TE7A 3KJZA 2ATIA 1TOAA 4FNGA 4X0EA 1NJGA 1SXPA 1WXHA 4MV7A 1R74A 1AQ6A 3QVWA 1J06A 4FSHA 3QF4B 4I5FA 5JAUA 3DXYA 1QGUB 5K0SA 4BOYA 4UU0A 1PD0A 1KYIA 1Q21A 1YDFA 4KBYA 1CQWA 1ZD3A 3TIGA 1ZCAA 4MP8A 1QQ7A 3TMKA 3SN6A 1GGMA 4M0UA 4WCFC 3TJMA 2BRUC 5ALHA 5LXTA 4KMRA 4IVNA 1JKJA 1EUCA 1CUAA 1ZD1A 3AP3A 3N2YA 4K1LA 2VF2A 4LOLA 4DWOA 2PUCA 1JSRA 5EP1A 4RQTA 4F4UA 4XSGA 1NM5A 1WXFA 1Z36A 3TRIA 3AUKA 3KV3O 4RTLA 1T3LA 2NGRA 3FGOA 4JKIA 4FBGA 2B37A 1W48A 5AR1A 2JLQA 1EGAA 4EVQA 4UEJA 5CURA 2GETA 2GNOA 3A9UA 2Q6TA 4WCFA 2YJTD 4DMKA 4JH0A 3NOXA 4IGKA 3P96A 2XE6A 4XFJA 5K51A 4M1KA 3F6BX 2P9HA 2Y1KA 4DUYB 3MJSA 2V6BA 3L77A 3P9NA 4GM1A 3FYTA 5AFSA 4ZU1X 5HSGA 4Y2GA 5G1NA 4TMYA 3KYDA 3U9TA 4G01B 4YAIA 1SU6A 3KQKA 1C3OA 1QP0A 5D84A 2YQ4A 2F43A 1H42A 3B3JA 2HZ7A 1KDVA 4XDGA 1MQSA 1VP3A 3FGNA 3O73A 4LBYA 5AIAA 1DG9A 1GZHB 2X86A 1JHQA 1AN0A 3BTSA 2Q2WA 2SCUA 3L7AA 5BRJA 5JR3A 5CFRA 1YBHA 4B2PA 1JU3A 1S2NA 2DHCA 4BDTA 4F6RA 3GLFE 3GQBA 3AL0C 1U02A 1U8TA 3SFTA 5EJIA 4DZTA 5SZKB 3MBOA 2D54A 5CHYA 3ILVA 5HUJA 3UATA 5EJGA 1IFXA 1WV0A 2R8ZA 2BZGA 1FZTA 1FP2A 4OAOA 4CV2A 3PC3A 2VN8A 1JILA 1QCDA 2WYHA 2NWQA 5BQFA 4J75A 3C16C 1R9JA 1YRAA 3IELA 1QG0A 4GR9A 3QMPA 2C1EA 1ICIA 2X8JB 4OAQA 1ZJZA 3VC1A 4DCMA 2J6BA 2EW2A 3K35A 3VDNB 4NMHA 2A57A 4MP3A 3EOZA 4PCUA 4ZVOA 2BEWB 2OPBA 2OMKA 3IBYA 3NPAA 5BPFA 2R0QC 5G53C 1KNQA 4BECA 4F96A 3JYQA 4RK0A 2ODTX 4LF8B 4WOPA 1WDWB 2NXWA 3LYLA 1IZ0A 2OHHA 1OWNA 3K32A 4PG4A 5ALKA 2YC4C 2FEPA 2AJ8A 2IZ5A 5TT0A 4WBNA 4MWTA 1I3KA 4OI1A 1F14A 1QR6A 1E2JA 2JC3A 2A3NA 3UJ7A 4REQA 2E5WA 1PJRA 4B71A 4EATA 4WJLA 4JJEA 3MT8A 1ZJYA 4IV0A 3SEAA 3PKJA 4CKCA 2HF2A 2CV2A 3W77A 4IVPA 4EHLA 3D7MA 4HEHA 3B36A 4EA7A 3V3KA 1U2QA 3EGEA 3BRCA 5A9SB 1A0OA 3OOJA 3GLGA 4WNAB 4W5QA 2IZ7A 2JANA 3E7PA 2I33A 1U8YA 4CM6A 1DTWB 4RD6A 3T4EA 4TSFA 4UMVA 1HLDA 1N6KA 3U39A 4CG3A 4RTSA 4L4YA 4JV5B 1ABBA 4CDKA 3L0SA 3ZJUA 1QR2A 3DQZA 1UC9A 3WLNA 2ZYDA 1CJSA 1M6YA 5HEKA 1C8LA 1PLJA 1K9SA 5IJXA 4G3XA 4MQEB 5AI9A 2VKQA 4Q12A 3FUXA 1B76A 3FSEA 1H2YA 1F5NA 4OB8A 2XQIA 2X0IA 4L4ZA 2H06A 2IXDA 4MTCA 3EGVA 3PFHA 1P17A 1U0EA 2XNHA 2NXNA 1VPEA 3AR6A 2CLOB 4QUHA 1UADA 3DAFA 1VC2A 4OGFA 2QJWA 5JDIC 2Z3ZA 1MAWA 1NP7A 3O2QB 1NLMA 2XT9A 3H0EA 2G3YA 3FSJX 4YLGA 1CZHA 3ILYA 2IYEA 1XMOB 3AR2A 5KOIA 1YI1A 2ZBPA 3LF2A 1AS3A 2ZPTX 1B7GO 2X5NA 1PZFA 1F3LA 1G5TA 1RACA 2VYND 4DLNA 2AF3C 5JDIA 2KBFA 3LUHA 4GT1A 5JD5A 3G9ZA 3AKEA 2NSHA 4NE7A 1BFKA 5GAJA 3JR3A 2C3OA 4LMRA 5J5CA 3QYJA 1PYOA 4JMLA 3TEMA 1APBA 4KQXA 5FBVB 1MT0A 1C9JA 9LDTA 3G9QA 5KOJB 1TAGA 4S1OA 5CB4B 3K6SA 3A4YA 3BL5A 2ZE8A 2GH1A 1OXXK 3OIDA 4KDCA 3CNLA 4DC1A 4RPKA 4OLBA 4URHA 2GAIA 3GW8A 5E8JA 4TMFA 5TMBA 1FYDA 3R0QA 1BEUB 3OTIA 4UHCA 3CRMA 5I7WA 4MA5A 3DEHA 5J2TB 2IYQA 1JSCA 2BM1A 1EINA 3OZVA 4QVKA 4LY6A 1ENZA 1VJRA 3IH5A 2HBYA 1E1RA 4I9HA 3ZHOA 4MKGA 3KXLA 3RODA 1QH8A 3QWFA 1E6LA 1S3SA 2GA9A 3GI1A 3DYVA 2L18A 3S2EA 1I5RA 2WU8A 2QE6A 3OLVA 3ZLTA 2RE8A 3RTBA 1YZGA 2OCBA 1R2QA 1E66A 2FZEA 4MB2A 3ZDXB 3CXRA 2VSYA 1VE7A 3TAHA 2DKNA 2WWFA 1L4KA 3VYUB 3K9HA 3EG9A 4KE9A 5TVGA 1Z3CA 1QCYA 4QPJC 4IUBS 4P0PB 3ZK7A 1GGHA 4QLBA 4O4HB 1RZ3A 1R66A 1N2CE 2NZ2A 2R6R1 1GRVA 4XARA 4XIGS 5KS2A 1NF8A 1WE2A 1T4GA 3KCNA 2FPRA 5TQ2A 2FW7A 2OR4A 1VLHA 4B6PA 2I7XA 4C05A 2RK3A 2PX6A 5G1OA 1MAVA 4MTLA 1XC7A 1J2YA 3H4IA 4H4CA 4UTZA 2EFJA 3ZHTA 1E2GA 2X2PA 1DC8A 3BE4A 1U1GA 3CXUA 3TUJC 4FR0A 5AO9A 2QU7A 3GDFA 1J8YF 3ADPA 1NQOA 2IYFA 4JL8A 4U39A 5CIQA 4YMTA 2JRCA 3DOCA 2EATA 1INLA 3CKYA 4KE8A 5E4JA 3MYRA 1Z4KA 1YE8A 2BWJA 4YBRA 7AT1A 1P60A 3DMRA 1PAUA 2H3EA 5IBPA 1LXCA 5E3IA 4B3TB 4J76A 4N6NA 4Q1FA 4WK4B 4KAXA 2CHGA 3MSCA 1IEQA 2NO5A 3LCVB 4D3SA 1QC5B 3L1HA 1FNDA 4MKXA 1ABFA 1X2BA 2Y4NA 5EIXA 3PEYA 4N18A 3IQDB 1YVRA 1I6KA 2L17A 3LBIA 3G1UA 5IWCA 1R1DA 3L8FA 3GD5A 3PZRA 4GLOA 3BZBA 2WLTA 4RNCA 1C14A 1M2HA 1Y7TA 2A6PA 2PMDA 3E9CA 4M49A 4PZ0A 5ERGB 3IEVA 4PQFA 2IHZA 5ENDA 1LFDB 5DT9A 2QRVB 1PS9A 2PGLA 4PG6A 2DH6A 3TFWA 4YLYA 1BA2A 2BHTA 3AUYA 4KQWA 4BBJA 5LFAA 3G0HA 1JMKC 2C29D 3RH0A 3U5ZB 5M29A 1L7NA 4A92A 1ZOLA 1AK2A 1CUBA 4RVGA 3M83A 4KIFA 4Q4JB 4B6QA 2Z9CA 1OTYA 1V25A 3KQWA 1HSOA 2Y3IA 3H6KA 3QHAA 5A3VA 2HNBA 3K0EA 3GUUA 1QUFA 1NVXQ 4G9GA 3PF8A 3GOHA 2DPYA 3FH0A 4NBKA 1C3LA 2ETXA 2CVHA 1SG6A 3VAYA 1ELOA 3KZXA 1DJOA 2JLZA 2P0EA 1F5SA 2PX3A 2ZAOA 3DDSA 4RUKA 3V2IA 3VR6H 3MWYW 2PR7A 5B6IA 2IYPA 3RIMA 1XMSA 1TM1E 3QE4A 4S12A 4UREA 3SLRA 1F48A 1Z6YA 2P9ZA 3TMAA 1QMPA 2D7JA 3LCJA 4BNTA 2QX6A 3EIEA 4IBOA 2WSYB 4NZNA 3FI9A 4NP6A 1CY8A 1Z08A 4YB8A 2I03A 1PJ4A 2A1UB 5EKXA 1ZA1A 4RY8A 4BVBA 3CG0A 1PT7A 1FTNA 3FFWA 4PICA 1DFHA 2XXAA 1F8XA 3ZLBA 1YZ3A 2GBFA 3HCBA 1ULBA 2QQEA 3STYA 3UVEA 3N53A 3QKUA 4MGYR 4KWHA 1RC8A 2CDBA 3MRTA 3RIXA 1JEQA 2ZUUA 3MINB 5CPFA 3NRJA 4I99A 4CETA 4IKOA 2JI4A 2F62A 4HEQA 1FYXA 4DPLA 2FHSA 3DE0X 3K0HA 4L16A 4X84A 4BFLA 5JAIA 3IAUA 5K45A 5KKCA 1U3FA 5KNDA 4HR7A 1W1IA 1DB3A 3I2FA 1GUAA 3EGCA 3SKXA 3I52A 4M0PA 3G3EA 1L4EA 2DBVO 1XKXA 1B8NA 5IRCD 2OR3A 3D3QA 2VPYA 5IFKA 1D2HA 3DE4X 2JAHA 2QTNA 4AUMA 2GWHA 2QE7D 3D6TB 4J16A 5IVDA 1UC5B 4EITA 1P75A 1SM4A 4GKAA 2DLDA 1U0HC 4GR5A 4B3XA 2IY9A 3LQFA 2GNPA 3SP1A 5IDQA 3L7IA 1NVKA 3A04A 3KYJB 4B7UA 1QYCA 1V41E 2RGYA 2J0UA 2O23A 4JP5A 5CEFA 3PLRA 5LUBA 1PNQA 4ZZ3A 3LQKA 4CO9A 1DQPA 2WUFA 4RSHA 4NJOA 4BE7B 4DHWA 5IC4A 2R7AA 3TTVA 2PAAA 1GTZA 1X8KA 3F5DA 1CVRA 3HR4A 3OM0A 2DUJA 2J32A 4D41A 3ZR4B 2GAFA 1PL0A 2B4RO 2PR2A 2Q5FA 3HDYA 1EQUA 4HRAA 4DA6A 1HO3A 3SNKA 3ZBPA 1MO5A 1AOXA 4C76A 1GLVA 1VJDA 1KQNA 3BBPA 1E2HA 2H0AA 4GWKA 4IOMA 4LRUA 5TPWB 3UW3A 4BZWA 1JJVA 3OPXA 4U7HA 5JJCA 4Z2AA 1D2EA 2GK4A 3E3OA 3HV0A 3LXRA 4M1ZA 2TS1A 2LKCA 4MVWA 3V6LA 3WLSA 1UFOA 4EF5A 4DDMA 4UD6A 5ESRA 1YBMA 5JEDA 4INPA 4U2FA 4DL9A 4QBGB 1CIJA 2V7EA 4LFBB 5J1SB 4OHPA 3HYLA 5DF1A 3SR0A 2W43A 3IWWA 4MW1A 4R40A 4JELA 3DLBA 3BF8A 3CT4A 1BKSB 3HUFA 4GAEA 3B8EA 4B3JA 4UHKA 2IT1A 3S2SA 3WZ2A 3X2EA 4DXHA 1NBOA 2ZS7A 3TW8A 4LSZA 5ES4B 3BXFA 3DG9A 2EEZA 2HRRA 3C45A 4MWSA 2G70A 4QBTA 3UH0A 4BO3A 1IJBA 2JK1A 3ND8A 4BWVA 3ZJVA 1JQLB 3I5XA 2Q2VA 1NRJB 3HV2A 4HRYA 5JJBA 4LDQA 3MWDA 2FR0A 4V0NA 4YRLA 7REQA 3RSFA 2XTAA 3QU2A 5F12A 3H97A 1IPHA 1XDGA 5K3DA 1HL7A 2Y76A 5H1YA 1BXZA 5SYMA 1JKJB 1HFKA 3MJTA 1CJTC 1EUCB 1QPGA 2IOQA 3LP6A 3RC9A 3KLPX 2XTZA 4KE6A 3JWJA 2CEKA 3VHLB 3WMXA 2C9YA 2WINI 2ZJ3A 3OPYI 5I5GA 5E2AA 4KV7A 5DYTA 5IYZF 2DBYA 3A2NA 3LI2A 5AKIA 4J0IA 3KZCA 5JAOA 1MABA 2JGEA 4IIDA 1IBCA 3DMYA 3PCRB 4WCFB 4E22A 5AUOB 1Z25A 3PC7A 4MWDA 4WIAA 5ALRA 4JK3A 1VYVA 4D7AA 4HUJA 8ABPA 4D8TA 221PA 4OI4A 2FFBA 2YINC 3VPBA 2VTEA 4JBYA 5AVZA 1D8TA 2FW9A 2BW0A 2V9ZA 1Z4JA 2C97A 4YRPA 3C6XA 1ISRA 1G9XA 1AN9A 1Z83A 2GKSA 3C8HA 3K6KA 4QDXA 1II8A 2ZBFA 1CUEA 3B6MA 3OLQA 1TUBA 4QFMA 1VP9A 3KYDB 1PGPA 1YT5A 3BREA 3KTOA 3SX4A 3IJ5A 1HMYA 1C3OB 5TF4A 4C6SA 2TRSB 1GU0A 1T0UA 3RRBA 5JZSA 1YR2A 2F43B 2ZYGA 3DEZA 3W5VA 2Y0BA 2FN3A 1HETA 1JA0A 4OU5A 2CV0A 4ZTBA 1CERA 1NT2A 1YDMA 3D7KA 4IHKA 4GMFA 5FP0A 2SCUB 3EVZA 1LX6A 1AGXA 1SUAA 2WJYA 3F3KA 4RTRA 1CLUA 3IJRA 3R5KA 4F6RB 3GQBB 3WB2A 4DJAA 1QVAA 1J5PA 4HNRA 4ITUA 1O5OA 3HXPA 3VO1A 1NW8A 2IW3A 3HN2A 4QTZA 4IFEA 4KXUA 4Q3OA 3C3MA 2WVAA 1FX0A 4PGAA 1JG1A 3Q6NA 2F9MA 1EX9A 4DZZA 2FMHA 2I55A 2H2WA 1TJ3A 1LI4A 3G5LA 4OUDA 1US8A 4JYAB 4RFSA 1S8FA 4TXNA 4DLKA 1DHRA 3HYRA 2YWHA 1VLJA 3P0JA 4M1OA 4TM7A 4FB4A 2K5UA 5I5EA 3CY6A 4UHJA 1J2UA 2VUHB 2C6CA 3FUVA 3K09A 4QJ3A 2A5LA 3GYGA 1K9VF 4NZ9A 1XZJA 4R71A 2H1IA 1BJKA 4IRMA 4Y0VA 4WBNB 3K0SA 3VXKA 4C01A 4BNNA 1M6WA 1T35A 1WAMA 1ENOA 2IPNA 2P9GA 4PX3A 1SVWA 3B5IA 4QBFA 4KNVA 5CCBA 1ULUA 4REQB 3NIBA 3P9YA 5C37A 1SCQA 2E6UX 2GHQA 4QJBA 3L0ZA 1JW9B 4CKCB 1YVEI 1NU8A 3K9CA 5FRDA 3VOSA 5LD2B 3GHHA 3GF4A 1MB0A 4M38A 2BD0A 2WG2A 1BCSA 3WYEA 3I61A 1IJEA 2R7LA 1Y1TA 5HTKA 3GLGB 1NN1A 4PSVA 1F8UA 2CVFA 4NEGA 3TXYA 1HEIA 4A6DA 4D57A 1L2TA 1NPDA 3OX2A 4P4DA 3ZC3A 3WLKX 3PRHA 4NBLA 1W8DA 4QOEA