5F5XA

Crystal structure of s116a ba3275 with amp bound
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
344
structure length
344
Chain Sequence
AMLIKPKRLQAGDIVATVSPSWGGAGDSEIRWRYEQGVKRLEEVFGLTVVPMPNSLKGSEFIYNNPQARAEDLMTAFQDTRVKAIIANIGGQDSIRLLPYIDFNAIRENPKIFMGYADVTISHLFCHKAGLSSFYGPAILTDFAENVEMDPYTVEMVNRTLFSNEMIGEIQPAPEWTSERLEWIEINKDTRRTMQQNNGYELLQGSTTVQGRLIGGCIEVLEFAKGTELWPEKKHWEDSILFFETSEDHPEPSYIKYWLRNYAAQGILQKAKGIIFGKPKDEMYYEEYKHEILQVMKEHNLEDLPILYNLNFGHTEPKFILPYGSMAEIDCENGSFSILESGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Ba3275-AMP complex from Bacillus cereus ATCC 10987
rcsb
source organism Bacillus cereus (strain atcc 10987 / nrs 248)
molecule tags Hydrolase
molecule keywords MccC family protein Ba3275
total genus 108
structure length 344
sequence length 344
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02016 Peptidase_S66 LD-carboxypeptidase N-terminal domain
A PF17676 Peptidase_S66C LD-carboxypeptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Class I glutamine amidotransferase-like 5f5xA01
3.50.30.60 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 LD-carboxypeptidase A C-terminal domain-like 5f5xA02
3TLEA 2AUNA 3TYXA 4INJA 3GJZA 5F5XA 5JYBA 3TLZA 4MI1A 3TLAA 4EYSA 3G23A 3TLGA 3TLYA 3TLBA 4IIXA 5F9MA 4E94A 4MJXA 4IIYA 1ZL0A 3U1BA 5K99A 4E5SA 5F1YA 3TLGB 2AUMA 3SR3A 3T5MA 3TLCA 4JVOA 5FD8A 4H1HA 1ZRSA
chains in the Genus database with same CATH superfamily
3S8EA 2C3YA 4UQLA 2JHPA 4W1QA 1OGIA 3PXUA 3L8GA 2J9FA 1MV5A 1H4TA 2AG8A 3G9ZA 3OTOB 3CVWA 2W43A 2C4VA 3MIIA 4RIEA 1YJQA 3IOYA 5EKDA 1TF7A 2HSWA 4YP0A 3FCUB 3GFPA 4EARA 3RVJA 1A77A 1JHYA 1OF1A 1JN0A 1S2NA 3W3AA 2EKBA 1NQAO 2JASA 3GOHA 2IYEA 2Y1DA 2RGEA 4PSKA 1C7EA 1CWUA 1S3FA 1NIJA 1VHWA 5DCYA 5IWCA 5EWJA 1WM1A 4GBED 5HZGA 1ZJ5A 3LY9A 4K05A 4Q4JB 1GRVA 1LNSA 1VE3A 3RF6A 3K05A 3QXGA 2HJWA 3LBHA 3U4HA 4WD3A 4WCFB 1Z4LA 4RZHA 2JFYA 4H08A 2ZUWA 5CTAA 3RSSA 5AQ1A 4J1TA 3RC7A 1P7PA 3EVZA 3LC2O 3WL7A 2YWDA 1NSTA 1T5OA 2CHFA 2XV1A 2ZS9A 1T8PA 2IDZA 3NYRA 3Q3JB 4LYEA 1Q44A 2VAPA 3PFGA 4M1MA 3K72B 4RLSA 4YP7A 4B7CA 1YF3A 3QUTA 1Y1KE 4ND2A 3BI1A 1B93A 1WQ4A 4AAYA 5AVYA 2QR5A 5KSPA 3NBXX 4NYMR 1VHJA 1YR3A 2YRXA 4OLFA 1V96A 3CLUC 4BBJA 4MCIA 1FRFS 2AUMA 1RXUA 4R0NA 5JU6A 1JWAB 3ETEA 3KAJA 5KINB 5DE3A 5DWVA 2PK3A 3HA3A 1NVWQ 1Z35A 4QNMA 4WNIA 3VZPA 7AT1A 3I12A 1LJ8A 1RC8A 2Q45A 3NPMA 1I8TA 2NZ8A 4ALMA 1FSGA 2Z08A 1KAMA 3KQHA 5L3RA 3M9LA 1QRTA 3LGAA 4L9SA 1PRYA 1J8QA 3Q6NA 4WNYA 5EUCA 4C2BA 5IH3A 1CVLA 4EYOA 1UPCA 1FTGA 3IV7A 3TL3A 2FLVA 4QOHA 2O8FA 3WA6A 2FEKA 2GUGA 4RWZA 3AONB 4K6KA 4JP5A 2P9FA 4M0FA 3PFCA 2B4AA 1M5RA 2RSLA 2RARA 3D64A 3P27A 4HDKA 3ACCA 3ADPA 4U9HS 5EZYB 1B0PA 3JWHA 3L7CA 2O2DA 4NC9A 4ZHQB 2RB4A 2J4FA 2VXCA 3DZIA 4LPSA 2HL6A 4QVGA 4RTNA 2OM2A 1NVVR 4W5JA 5E6SB 3VX3A 2XDQB 4GNRA 4RL4A 3FPGA 4PRLA 4YAEA 4E11A 3FOZA 3VR3D 4S0ZA 2UZAA 3LGSA 4IGFA 1EZZA 3EMDA 3T5BA 5CFRA 5JS8A 2WJWA 3IPYA 1VBGA 3D43A 2GP4A 2VT6A 2H1RA 5TDHA 1Y3BE 3L6RA 2CHEA 2QTAA 1TTQB 4UATA 1D4ZA 2DX7A 5DNAA 1EFHA 3UK7A 3INTA 4EG6A 1U9JA 1FL9A 3B6ZA 2CVFA 2NO5A 4OHKA 1DAKA 4QRIA 1X38A 3CNLA 4BXOB 4M0EA 3V5NA 4AN1A 2VUIB 1Z2AA 5TMEA 4ODIA 5H83A 4YHBA 5K5EA 2XCQA 3IVXA 4UM7A 4KFUA 5AI6A 2ZIXA 3OO1A 2B8TA 2PZBA 3OLZA 3QFTA 3L7MA 4H3HB 4MICA 4E88A 2CB9A 3WWEA 1JAHA 3H18A 1LVHA 1XAIA 2BMFA 2JFFA 3D4OA 4BJ5A 3HCWA 4ZOCA 3WMRA 2GTHA 1AN0A 4EUEA 1Q7BA 1FYWA 1O6CA 1AT1A 2BCJQ 2CE2X 2GYYA 3NWBA 4OHWA 3S27A 4AL4A 1XTTA 3GR6A 4Z9BA 2DSTA 1I94B 4DT1B 2WMYA 1IXKA 2X22A 3EPJA 2Q8QA 1W2WB 3FVQA 3M70A 1KDPA 4JXKA 4MVJF 1OB2A 1OXMA 1GNRA 2O8DB 3DDWA 1OILA 3L01A 4EG0A 3N0WA 1APBA 1AQUA 5J4KA 3COPA 1C1DA 1DBVO 2CXRA 3U44B 1DQSA 1HBJA 1NE7A 1Y0BA 2B4KA 2O2YA 4YFYA 1H6DA 2CMFA 3HXKA 3PG5A 5CVUA 4RFLA 4YRQA 1FCJA 4MJXA 5EE0A 3AOEA 4C01A 4DLVA 4F86A 1S0UA 2CHGA 4XWGA 1IM2A 4BV9A 4CM5A 3I5XA 4QTZA 1IZ7A 2GJ8A 4ARVA 5C2JB 3UZUA 2R8YA 1MRZA 1L7RA 1E20A 4NBLA 4Q1CA 1UBSB 2AFHE 5F33A 4UTXA 4TS9A 1TVMA 3BQ9A 3VSEA 2ZUSA 1PQYA 2NTEA 2XTNA 5CM9C 2Q3BA 2YZMA 1P2BA 3NIDB 3L0OA 4FJ0A 1OWNA 2GPTA 4QUJA 1KZ1A 1UJ5A 3DFIA 3A6GA 2J48A 1UT8A 3BPSA 2GAJA 3GPIA 4ITRC 1VB5A 2I6QA 3DKPA 3UT5A 1U81A 5LQCA 1EM8B 3NOOA 3OKPA 2PSHA 1C7FA 4QPDA 1ECGA 1WXXA 1YRAA 4YPVA 1VPVA 4C08A 1FP7A 3I2HA 1CDZA 1GRNA 4I1UA 1OFIA 4WKPA 3TRIA 4D96A 2IHNA 5I4IA 3MF4A 2CHUA 3IODA 3Q1KA 2K6GA 1QVAA 2HO5A 4DA7A 5B2ZA 2C2GA 3VNUA 3WLKX 2WB2A 1L9KA 4C6TB 3PEEA 4K8RB 4MULA 1J5EB 3GZ4A 4JR2A 1AQYA 5DBOA 3GLFA 4DV4B 3QFRA 2CT8A 1RWKA 2NTJA 2XDWA 4GVLA 3RC8A 4Y2XA 1FNCA 4U8HA 4JV5B 4OXKA 1XB2A 1T8SA 2JFVA 3C15C 3CLHA 4P4BA 1HDIA 2XE8A 5IR2A 1UBHS 4HDQB 1NRXA 5GONF 2E82A 2XRMA 3A1CA 1H9BA 4EB6A 2BF4A 3C4QA 4OOEA 4EFKA 2VP0A 2AG6A 4CGYA 4BUCA 1B3BA 3C3MA 4DYHA 1TMGE 4UNRA 2BHTA 1SXPA 4KWCA 3TLJA 3NTVA 1XNGA 5FUYA 1EVIA 3FCCA 4EITA 1TEHA 1RI1A 4CJXA 3ZHSA 3I9MA 1GCUA 4OL9A 4YH1A 5LQAA 1GCOA 1TZ2A 3AF1A 4PYNA 1TQHA 4MCJA 5F7ZA 4GZLA 2XYHA 4MUFA 4HNAB 1U6KA 1ZH2A 2Y68A 3R3WA 4MUEA 5JBIA 2HF9A 3FBTA 2YRWA 3C6KA 4JJ6A 2P2DA 4R6WA 4BEJA 3IJ5A 5IM4F 1PFKA 2G70A 4WLNA 1LI5A 1OBCA 3L9WA 1AXRA 3UB4A 2QIPA 3GLGB 4A15A 3ZEIA 5COQA 5JYEA 2RHBA 3VXKA 1O54A 1J8FA 2V7VA 4F4UA 5F2NA 1JBEA 1IY0A 3N07A 2IYSA 4MP3A 2EW1A 1GDTA 4XWAA 2CFOA 5HKAA 2HMTA 5K4GA 4N4AA 5KDOA 4BFSA 1QQ5A 4KRXA 4D56A 1FTYA 2G4VA 1FRQA 1U28C 1UMBB 1C7RA 2I8AA 3GVHA 3WLRA 1QQ7A 3I05A 5GIPE 2NO1A 3FA2A 3EY9A 3R3UA 5AW4A 1NXOA 1A8QA 1N8KA 1OX4A 2G40A 4QGSA 4UD2A 3D6UA 5AVUA 1HZJA 3U7GA 3JQ9A 1JXAA 1W85B 3EPPA 2WWGA 4YP9A 5C8DA 2HXSA 1FTQA 1I2AA 1JX6A 1L8OA 2YMPA 3G0OA 3UUFA 1RXCA 2YMLA 4OLBA 2IT1A 3HWRA 4QO8A 3TZEA 3F73A 1O08A 4PZUA 4G26A 2ZAMA 3AVOA 2ZBVA 3T9FA 1MHPA 5HVNA 2R7AA 1NG1A 1VA4A 3CURA 3AFIA 1E66A 3H8SA 5AYVA 4I9UA 4TN5A 2WJZB 4HH3C 1J8YF 1FSZA 2HA4A 4QQFA 3GD7A 1ZD5A 3O1LA 4HH0A 1GZDA 2FWNA 4F9FA 2IU0A 4BQEA 1EHIA 4KQ6A 4PNZA 4U7JA 2KM1A 4TJVA 1FLDA 5TGTA 2Q3CA 1MA0A 1E77A 3P9KA 2H0QA 3OLQA 4BVFA 3MCUA 4ZTUB 3N28A 5IFKA 1BXGA 2QMHA 1PBTA 1G2IA 2DY0A 3QVMA 2MOKA 1UJ4A 1H22A 2FPIA 2HF2A 3G1WA 4JUDX 1NYQA 1FTSA 3I9KA 1JDNA 4RXMA 1NIPA 2A6PA 4W7IA 1RRMA 1TCBA 5HIMA 3BHXA 1XIVA 4OIMA 3GBPA 2NV6A 3K9TA 2YHBA 3NIWA 5CDYA 1VJDA 1F3LA 3MOSA 4JYZA 4G6ZA 4DSZA 4NNJA 1P0MA 3WLEA 1C29B 2PV0A 3NRCA 3NHZA 4ENVA 3LHIA 3PGVA 1TW3A 4JBWA 3W3AH 3W2IA 1USIA 4IDEA 1Z74A 5M3BA 1CR4A 4F6RA 5JI2E 2NOAA 2UDPA 3LBNA 4LYFA 1T1EA 4B2IA 1YVPA 3OD1A 5AK0A 1ACMA 1BKDR 3RKSA 1PZXA 3UXHA 4E2YA 4O4HA 4FYXA 1U3GA 2FQYA 3ZD9A 2QUHA 4L0QA 4EAQA 4EKGA 2BGKA 3I4FA 3SJXA 1DQZA 1LPOA 1RAFA 3E4DA 4DIUA 3SXJA 1N1DA 2V7QD 1FJXA 2C2OA 2QJFA 3WO1A 2IBMA 2Q5LA 4TVOA 4KDRA 3HDQA 5JQGF 3W3ZB 5A04A 3ORRA 3F2VA 1ORVA 2AKEA 4JU9A 2VHQA 2J7KA 4V3CA 1YQGA 2OG1A 1DMSA 1UXGA 2FPMA 4QATA 5KMGA 1EEHA 1GUDA 4HRXA 1WO8A 1SKQA 3A6JA 4OUDA 3D8HA 1I24A 2QP9X 4MV7A 4DKXA 3DPIA 4XDYA 1W35A 4A0FA 4D97A 2YW2A 1YB4A 4PQEA 2XNDA 5EMMA 4CUKA 2HRZA 3WJ2A 5B5SA 1I36A 5BQ3A 3OI7A 1YHNA 1LRKA 2J3MA 1BC5A 2IP4A 3ZKWA 2NADA 3L07A 4DL9A 1NP7A 1MB4A 4DJDC 3ABSB 3FE2A 4F8JA 5JXHA 4I6EA 3NM4A 4PQRA 3AR5A 4BRUA 1PJAA 2J07A 2HDOA 3KQQA 2CL5A 5JSYA 3NMUF 2RHRA 5D5QA 1YS2X 2TMGA 3O75A 1V7CA 1J8VA 2X13A 3OPQA 3KEOA 5DYIA 3ZQUA 1P1JA 3A1UA 2FSHA 5E2BA 2O8NA 2CD9A 3WDLA 4PRYA 3VR4D 3ZGNA 1MAAA 3A9SA 5G3YA 3FOWA 3HPRA 3JV7A 4YQZA 5CIYA 4CV2A 5CVEA 1FX1A 2L69A 2IHBA 3DAOA 4MLPA 5HCIA 4RETA 3RYIA 1IXYA 2AX3A 3K6KA 4WH0A 3SZMA 2JRCA 4X93A 2GR9A 4OQMA 4UUAA 5K4HA 2Q99A 2ODBA 3CX8A 4AVYA 3R6WA 2IYWA 4NENA 3VTFA 1DTEA 1W6RA 1LPBB 2WYHA 4FD3A 4RFVA 4J7UA 3LHDA 2DC1A 4Y2UA 3ZW9A 5JAUA 4YDSA 4ZYLA 4H3KB 5A3RA 1Q22A 1SXJD 4E70A 1IOVA 5JZVA 5K8IA 4L9AA 1HTBA 1DZ3A 1LS6A 3BRQA 5E1MA 1II8B 5TMDA 3U17A 3ZDXB 3QPDA 4A5SA 1NBME 5JS2A 3K0EA 4RFSB 3DZKA 3QA9A 2BBWA 5ENZA 5MN6A 4G5XA 1Y33E 5ALTA 4OX9B 2YZ2A 3ON5A 3ZBQA 1M34B 2HPVA 4BX8A 1NJGA 3LBYA 2Q1UA 4XCVA 2ECFA 1OI7A 1JI3A 1LDNA 3H75A 2ADFA 1HV8A 1PUIA 3BXZA 3HN2A 5DTMA 5F5XA 1SQSA 4DZTA 4KNGE 3L8YA 1K89A 1WMFA 4LK3A 1CJMA 3TFWA 3EPLA 2WD7A 1NULA 2AK3A 2DPGA 4F92B 4POOA 3WLTA 4QFBA 3QFFA 1CX8A 1VC2A 3I09A 3TZKA 5EKUA 2VJLA 1C3LA 4ALJA 1YB2A 3ZHUA 3E81A 1OZFA 4E5PA 5IBCA 1OWMA 3T3NA 5A6SA 1YDEA 3LNTA 2DETA 1OC2A 1I6KA 2UVPA 3VH2A 3CH6A 1RWBA 3VVMA 1UJMA 4BFLA 4Q3KA 2B21A 3UGJA 1A0OA 1UMCB 1QBGA 5KJFA 4LRUA 3P96A 4JLJA 5DBIA 4EGSA 2ZR0A 3GJTA 3INGA 3T35A 2ZU6A 1P62B 1U80A 4YJGA 2V9CA 3G02A 3ZE9A 5KYGA 2GILA 1K7EB 3UMMA 4C0XA 4EB0A 2PKRA 3IFSA 2HLPA 1O94C 1YHYA 2JFBA 4CMCA 2HDNB 4JLBA 5J59A 1BA2A 4EJMA 1BDIA 2I65A 4EQ6B 4JBXA 3OZSA 1U1EA 3RK0A 3PLRA 4HDOB 2BKXA 3TNFA 3DZFA 4PBTA 3FCOA 4FILA 3I9V1 2DT5A 1G5QA 1J9EA 2QJTA 3IQWA 5CA0A 3MT9A 3EWIA 3WXBA 4B7ZA 4D0NA 4F93B 3DOFA 3IT2A 5DNYB 3GJ6A 3B70A 3WWZA 4RS4A 3IPXA 5EVCA 1E2BA 4OJKA 3OESA 4IG4A 3SHVA 1V8BA 4OGFA 3DL0A 3G8CA 1Z6XA 3DMRA 4AU1A 1PG2A 3BBPA 3SMVA 1M8FA 2BBTA 1NBWB 2YS7A 2EEPA 2DHEA 5IUKC 4DLRA 3AYXB 3FGOA 5F4ZA 1TAGA 1FNBA 1T3GA 3PE6A 1TPYA 3FFWA 1HL7A 1EFPB 2AGVA 1V39A 2IQIA 3GOQA 5ELLA 1NXPA 2J59A 2JZCA 4CEHB 4QGGA 4R8KA 4HLUA 1IVNA 4Y1GA 2CCGA 2DLCX 1ODFA 3ZJTA 1Q1NA 1G5PA 1XQ9A 1XFAA 1EIWA 4KH1A 2EFHB 5MN4A 4GX1A 1NF9A 2XUOA 4IHKA 3D02A 4BX0A 1RPTA 4IJVA 3QMPA 4M89A 3PYXA 5JDCA 3ECSA 3BH0A 2WAAA 2O2JA 3HBFA 3E5HA 3IALA 3IBSA 4EFDA 4JX9A 3WIDA 3TQQA 3NCHA 1T2AA 3MJTA 4DNFA 4FBGA 1EE2A 4FMPA 2A1IA 2M6RA 3QLUA 4Q01A 2L0XA 2HRDA 2GBCA 1H8HD 1PUJA 2GJSA 1Y9DA 3AIOA 4A4DA 5JH7A 1PR1A 1SZDA 5K6AA 3U60B 1JAYA 2YJTA 3HKEA 1NKSA 4HL6A 5LP6C 1B6TA 2UZ1B 1HR0B 2QR2A 2XKJE 3CM0A 4AMGA 1OKKD 2VK1A 4A26A 3JWPA 2RONA 1NYTA 5JEDA 3UPUA 4KBGA 4CV0A 2VOEA 4IO0A 3UT6A 1F4VA 2NLOA 3WYEA 1N3YA 2I54A 1E2PA 4QE3A 3P9XA 5CLLA 2WJJA 4D7AA 3TEJA 2WDZA 2I4TA 1AV7A 3AJ8A 4NH4A 4XRRA 3L4EA 4F06A 4BRSA 5BSFA 3WNVA 4DLNA 2O14A 4E94A 4F2PA 2WWRA 2WTUA 1ZOIA 4C86A 4X1KB 3NHSA 1WKVA 3OIGA 2UYHA 2ONYA 3O1HB 1DXQA 1ZRMA 1VCHA 1D6JA 3QJGA 4E2FA 2XB4A 1A9TA 3MFQA 3IX7A 3BXHA 3GH3A 4NBRA 4JT4A 5KNDA 3VGJA 2PGOA 5EEHA 4EJ6A 3NHFA 2JIZA 3JQBA 3NBYC 4FWBA 3A6EA 4FUTA 4H16A 5AKJA 2O5RA 5EQDA 3VFDA 4B75A 4B3HA 1VE9A 3U4CA 3QOXA 2PZJA 3R3YA 1SHJA 4W1PA 1EX6A 1W6UA 1N75A 4BMOB 1U02A 4ZMBA 3EFEA 3D8UA 2FJPA 2HQOA 1G7SA 1OVMA 4FT4A 1DCMA 5JY6A 1RLTA 2ZFUA 1N0UA 1LLUA 1W30A 1WQ3A 4AF8A 2NUPB 3N2KA 1L7BA 2C54A 2FKNA 1F20A 3U49A 4JGGA 3RC3A 3HYSA 1K7SN 4NXNB 5J4HA 4PBRA 5ESXA 1XU7A 5HF6A 1KDYA 1M2VB 4P32A 3O1IC 3PDWA 4GBGA 3H11A 4IR7A 4U6QA 3W3AD 2I3ZA 3UV7A 1QHIA 5FPYA 3GT3A 2QSUA 2PA0A 3MJVA 2M1XA 1H8ED 2XZDA 4UVHA 3QI2A 2G76A 4WADA 4BE4A 1O0CA 4OBBA 3H1FA 1II9A 5DXAA 1JEDA 2A5YB 1Q0QA 2A9PA 2VA9A 4MR8B 3WGZA 1MB9A 1NQXA 2H06A 2CCKA 3RS3A 2V0CA 2JZNA 3HNPA 1ZJZA 1ODTC 3L7BA 3Q3IA 1CQZA 1TJ5A 4TOIA 5JHHB 1J39A 5DASA 2SBTA 4BP3A 3AY7A 5E0KB 2IS1A 3MMSA 4AICA 4TZKA 2RGRA 4C7BA 1B76A 1ZINA 4GKKB 3DP9A 4FK8A 3AF0A 3IAXA 4S0XA 2HW8A 2QNBA 1TKCA 2G77B 4NHEA 1VL8A 1U8FO 3ABQB 4CG2A 5KS2A 4YTEA 3H4MA 2QZZA 2XVMA 3G5TA 4LDJA 4OGWA 3HDTA 4EKIA 2Z58A 2RJOA 3ZU5A 4RM2A 3OZGA 5BSMA 1UT5A 1P9NA 5JECA 2YZNA 1JVNA 1QFXA 1RC1A 4ATNA 2GNOA 1WIWA 1A1SA 2X19A 5CR9A 3O9ZA 1GQQA 4ZPJA 2YOHA 3R7WA 4ZT2A 2LE0A 2QROA 3GARA 2VBGA 2XD4A 4UUOA 1CF2O 3PC8A 4JJKA 3SYLA 1QIIA 4E2WA 4JLPA 4UNSA 4X66B 2KYRA 4E7OA 4M99A 1DVRA 3U9SA 4C8FA 2IUTA 5L7YA 1U0GA 3EVFA 4YO8A 1QYWA 3THRA 4QQNA 2JPDA 4TV8A 3DTNA 5E4TA 3IOCA 4CN8A 1HMPA 5FLEX 4YRMA 2QPOA 2UYGA 2H54A 5H82A 3K70D 1ZRNA 2VQ6A 3X44A 3PEUA 4C7MA 5MF6A 1NW8A 1ZZEA 3G0CA 2O8CB 2A0KA 4XPIB 1Y48E 3UTDA 3CRRA 3R7DA 1IE3A 2XNKA 2D1SA 5L3SB 3A9CA 3ZBPA 3I28A 2H4YA 5TT0A 2F3PA 3GC6A 3M33A 3OOSA 1TU0A 3NT2A 5EJEA 4QUIA 2JBWA 4DB2A 5F1OA 3STUA 3ZK8A 4L8VA 4CM7A 2BGUA 3EUEA 3LFHA 4QHTA 1QQ6A 3D8SA 5F2EA 4K9LA 4FI3F 4CRWB 2FU5C 3PE3A 1E2UA 4H7IA 5LOVF 3GI1A 1PWYE 5EJIA 4IIFA 5KNLA 3UTCA 4NULA 4X3PA 1ZEMA 3PGXA 2CV1A 2IL1A 2W2OA 1SCBA 2C82A 3CWQA 4R2WA 2PZEA 3C39A 4YAFA 4RTKA 3NNDA 2WOOA 4B40A 5JADA 1LNZA 4R5HA 1UWKA 4BLSA 1IL0A 4HDMB 5JOQA 4FXPA 2Y1WA 2D2EA 3GZNA 3L8DA 3OX3A 3ISTA 1L5NA 1SVLA 4JJIA 4NOJA 2UXDB 2QTMA 3BD9A 4U2FA 3TQHA 4RPCA 4JI8B 3LCMA 2F3QA 3WGGA 3QYPA 1T1IA 2PX4A 4JWTA 4EA9A 3EIFA 2XH8A 4FFRA 5HDQA 1XTVA 3TIVA 1KOJA 3COSA 3NOQA 4MITA 1A97A 3OU6A 4NZYA 4JVLA 2CWWA 3DXXA 1Y81A 1QH0A 1WF3A 5I5EA 3QVXA 1A27A 4D3DA 5LP6B 4DHEA 1EP2B 1Y5RA 4LSWA 1T15A 4KR7A 1KAHA 3D7RA 4I1RA 1U0HC 3AHFA 4RQBA 1EFLA 3VUEA 1HPLA 4Z3KA 4TT3D 4DILA 2QTCA 2Y0CA 2XGOA 3HXPA 4FN5A 1TM4E 1JEEA 4YVFA 5IABA 2BEJA 4MQ6A 2WHRA 1NJ6A 4PE5B 1O1YA 1R8SA 3LCUA 1I9CA 1JB9A 3AR6A 2JB9A 3BZWA 2GBFA 3KVRA 4CGZA 1AHIA 1MCZA 5IUNC 4L28A 1DQPA 1RYYA 2QHXA 3V3KA 4C6SA 4WBNA 5GGXA 3JTMA 2ONZA 1JKXA 1NZDA 1PZFA 1BU5A 2ZPAA 1VLVA 2QRNA 3S99A 3Q7SA 4XIIA 3BXXA 4J1TC 4P82A 4BZZA 2ZTHA 1AD2A 1VLLA 3EXFB 4ZYYA 5J63A 1KIAA 4BJHB 2AFHB 3Q9UA 2Y0BA 4KYTA 3CW8X 5FTKA 5THQA 1FFXB 1Y3CE 3OEHD 4PLFA 4ZAXA 3SKVA 5EESA 3HL4A 4EEXA 3PUXA 3QG5A 4G5YA 2OVBA 4Y9TA 3SHQA 1Q1ZA 5JMPA 3EJ6A 1D1QA 3ETLA 4MP8A 3ILYA 1BDHA 1UOQA 1VP9A 4C7OB 3SXUB 4TWJA 1BKSB 4HNSA 1VQ1A 5T8KA 4L9RA 1EFVA 5CNKA 3ITKA 3N70A 4TWZA 3GUHA 4C84A 4EJSA 2AFIA 4KQGA 4U02A 1B8PA 4NXMB 1JG2A 3KUXA 3OCVA 3V1NA 2X0IA 1V11B 2V6JA 1GILA 4OAOA 4B85A 3BGDA 3HYTA 1MJGA 1XV5A 5JJBA 2XYQA 2NZUG 4C85A 1KDOA 3OZ7A 3DFMA 1U2PA 4DVJA 3OQNA 5LWHA 2QX8A 3IPCA 4BNUA 1WUHS 4E2ZA 1R37A 3HCFA 1IUNA 1NPYA 1K08A 2RJ3A 3R4VA 1L4HA 4C2UA 3PGA1 1BN6A 1I3NA 3TJMA 4Q48A 3LWNA 5EE1A 3STVA 3GVCA 5A9RA 2NU6B 4UOZA 1Q3TA 4G4GA 1B0UA 1SXHA 1JEOA 3LUGA 5J40A 3ENQA 1G7TA 1JALA 1ML3A 3EIHA 3R24A 4YRAA 1L8XA 4IVRA 4LDPA 3A3YA 4PU0A 2QP4A 4XARA 2CZQA 3S8YA 1Z17A 2ATXA 1LDBA 1FDWA 3FMPB 4EW6A 3M49A 4DEXA 4CCYB 1JHOA 4HYQA 2HRCA 4KXQA 5KHLB 5EWLB 3REOA 1MU0A 1YS4A 3TPZA 1M0SA 3H2BA 2BR3A 3QM1A 3EUWA 3S2EA 2YTZA 1D2HA 3JQFA 3V42A 1X39A 5K8JB 2PH3A 1PJTA 2I3DA 3D2AA 4IKOA 1SEPA 1H5QA 1NQTA 1R8JA 1YDMA 3MWKA 3LG2A 1KPGA 3ZI7A 3ND6A 2H2AA 5DIFA 3L5KA 2AE1A 4G1FA 2VPPA 5B2EA 4NGQA 2DT8A 1UQUA 2BD0A 2HTEA 3U09A 3V6MA 3OWHA 2AMVA 5C32A 2R7MA 3F98A 4ENRA 4INAA 4XFJA 3A6LA 4TUYB 3TSWA 4AK9A 3HVKA 1I4OA 5J2UF 1QB8A 2O8BA 1HDOA 2X5NA 3VHXB 4X6YA 3WP0A 3S1SA 3EBOA 1XD2A 2WRZA 4PHFA 3F6BX 1XPJA 5TQ0A 1D1SA 1X70A 4ITUA 1L4YA 4LHYA 3C14C 4WZAB 5FTLA 4IDQA 1W4BA 4Z2YA 3NEAA 4ZO6A 4P8RA 2F67A 1UBTS 1XUOA 4V2IA 3A10A 2GVNA 3NWOA 5L9AA 4H1VA 2H2GA 4KQJA 3AI7A 1ABFA 1KBZA 2LKDA 4UDOA 2HHCA 4K46A 3UK1A 2VZEA 5CFZA 4ISCA 5DTEA 2I4NA 3IA7A 3W0LB 3MCWA 5BXQC 3HLYA 1KI6B 2A1UB 2UYOA 3LPLA 1EUCB 4KI7A 4CF7A 1MR3F 4P38A 5KYYA 1GXSA 2QA5A 2WSMA 4L51A 3DOOA 5FPQA 1TRHA 2AHOA 5DHQA 3L06A 4HB3A 4BO8A 1OTXA 2VXBA 1T3LA 2DMRA 3WL8A 4B6PA 4OI0A 2X0DA 2BL4A 1IATA 3PDUA 2LW7A 1YWGO 4MLDA 3ZD6A 3JASA 4PXSA 5IDYA 3AMVA 4C4YA 1SXGA 1U4OA 2DQSA 3T1TA 2GO7A 2NXEA 2GKOA 3HEBA 1O6BA 2J67A 3GRPA 3T1OA 4TLBA 2B94A 1C3JA 1GAXA 3BMOA 4KYIB 1M8GA 5D7NA 3UUGA 1HXHA 3MJSA 5JANA 3QHQA 1XMQB 2D0PB 2C88A 1B8OA 2MYPA 1VLZA 2GYUA 2E1PA 4KXFB 3SSNA 3TX2A 1G3UA 3I34X 3QVGA 4MLCA 1YNSA 4D0GA 3K92A 4Q7QA 1OSNA 3HM2A 4W4TA 2VHZA 4INZA 1CHDA 2B7LA 2B8JA 3H87A 1SVOA 4IHJB 3WISA 4AS2A 1M2OB 2WF7A 3ZXIA 4C5BA 4ENTA 3F3YA 1YQXA 1WDMA 1V3VA 4ZT3A 3WO0A 2AV6A 3SXPA 3G9TA 3VTAA 2MTBA 1RFGE 5KU1A 1W0KD 4KTVE 1CB7A 1YU9A 3BN3A 2G7ZA 4CT4B 3RYHB 3O8DA 4V39A 2FMTA 1VCIA 1ST3A 3P2IA 1RKXA 2AD1A 3CPJB 1RTTA 4QEKA 2NU7B 2OT3B 2ODNA 2PIAA 4CV3A 1Z7BA 2OILA 1GA6A 1U7ZA 5HIIA 2YV2A 1XMSA 3H6HA 4IS3A 2N1MA 3KEGA 2P68A 2TMDA 2ZSHA 3D7FA 1HKUA 1QLWA 3LLMA 2ZIUB 2ZBDA 3OX1A 3Q8LA 4R7ZA 2WICA 1GL7A 3C6QA 3RYCA 1CUGA 3IP1A 3QPBA 5KI6A 4HAYA 2Z95A 4B8WA 4D79A 1KVQA 1D6NA 4U7WA 1B4DA 4TM7A 3H42B 6PFKA 2HJRA 2V1XA 3IC5A 4AIRA 1DDOA 2EL7A 3EC1A 3VO1A 1AKEA 1QRAA 2KE5A 3OJEA 4DPLA 2FWAA 1SBHA 1YRLA 1Z4IA 5IYZB 2CNWA 4LY0A 1P0QA 1ZYUA 1ZYMA 4IYJA 5JE8A 1PJ2A 4QGBA 4FD2A 3KQUA 3T0TA 2P75A 5E3IA 2ICAA 1NN3A 3I42A 3RC1A 1T36A 3UJNA 1OFGA 4LWZA 2HY7A 3T4PA 3IOEA 1E9DA 5J9FA 2RI6A 1OAOA 2M98A 3GRZA 3VDQA 1FE8A 3QF4B 5JJIA 1ZUD1 2K2QB 1Z5PA 3G2MA 3VU9B 3ZIAA 4QM7A 1F0PA 3OAAD 2EW2A 4YJHB 1U0EA 3E15A 1LWNA 1G55A 2HA7A 2Y66A 1NN1A 1QZ3A 2GAOA 3F6PA 3JTEA 4X1YA 5EWMA 3IDQA 1ZITA 3CF0A 2R1VA 3S5JA 4MI6A 4U00A 5TGDA 2XTAA 3GEBA 1B43A 1CIPA 1KFKB 1YR1A 1YK1A 2Q3DA 4R9NA 2G0AA 1QGDA 4CFYA 2FF7A 3KT0A 4EMTA 1GG8A 2WBLC 3W8EA 2GFIA 1NV8A 4EVRA 2VZ9A 1WV1A 1TQDA 1ZUHA 5HPYB 1LSUA 1Q20A 3FSEA 2P9ZA 1Y7IA 4D3FA 3WYBA 5EY5B 2ENWA 4IMJB 2DB3A 1BIFA 4J16A 1SHUX 2FPOA 1RWOA 3BHMA 4KODA 2DQYA 3SIPA 1R4ZA 3TRJA 3VC1A 2HJ9A 1ZH4A 2B2XA 2ZYSA 1GTL1 2JA2A 1JEQA 2N47A 1U7PA 3EBPA 3ODPA 1VOTA 5L3VA 4BLVA 5JBNA 1F2TB 1HYEA 1V9LA 3OE4A 4FGKA 1E89A 4WGGA 1PEDA 3K9HA 3PD0A 3Q40A 5IKEA 1R15A 4MQUA 4NR0A 1QHSA 3AHHA 4WLEA 5LMUB 2VJPA 1GARA 4BMPB 1WG8A 2R8PA 3CX6A 3RTDA 3E18A 3O8OB 3EVEA 3GUYA 1IHYA 3AF3A 3Q3HA 3IDAA 3L0DA 2BBOA 3GMIA 5TY0A 3E5NA 4BJ6A 3UMSA 3BA6A 4LMPA 1IQ0A 1ZAYA 4E5MA 5L53A 4EELA 1MW9X 1P4SA 4LZWA 4WSOA 5BN4B 3E58A 3WB1A 4ZCRA 4QZVA 5JNWA 1WNFA 1BEZA 2PMBA 2FEAA 3X1ZA 3E5RA 4W6QA 4C9AA 3RHSA 1RE1A 5FUMA 1ZNYA 5F3DA 1XU4A 2OHHA 5GOZA 4YJFA 1A8SA 1KRHA 1U9IC 5FBZA 1I80A 4WE3A 1IXRC 1HFKA 2VHVA 4WY2A 4ZRNA 2WPDD 1VL1A 2FI1A 1WNTA 3ED5A 1T8RA 3OFSA 3PPWA 2YXLA 3PRKE 4GKAA 4LF7B 2VF8A 3THWA 1WRBA 2EZTA 3EC7A 3UT0A 5BW4A 3UV6A 4OI4A 3WADA 4NOKA 5ENVA 1CUBA 3DE3X 1VJRA 4P34A 1PIWA 3T3MB 3ZNOA 3C85A 5SZIA 4YRPA 4XE5A 4BLUA 1HSOA 4K9DA 1NATA 1OYWA 4LDRA 3VU1A 2UU9B 3J7AC 4X3CA 3REFA 3M1IA 1PE0A 3PL1A 1A4XA 2WHQA 1TKBA 1B1AA 2DOKA 4TLMB 4Y6SA 2ZUFA 4ZCLA 1L5GB 4BC1A 1JH8A 1IY9A 3OTQA 5EMNA 4NESA 1H9CA 4LA4A 4MUXA 2GVZC 2VBIA 3AFMA 4YX9A 1Z83A 1DG3A 2REQA 3CKKA 2DKNA 4K87A 5JRDS 1DLJA 1ZN2A 3P9PA 4IRMA 4C4SA 4RADA 3R5HA 1ZIYA 1Z5OA 3OTGA 1RWNA 3THOA 4COOA 5BYKA 2BZ0A 3CB4A 2OHXA 4RK4A 4LTNA 4DDTA 4ASUD 1WUJS 1EGAA 4V0ME 4ZO7A 4ENQA 2J0VA 1BMFA 1CRQA 1J5XA 1SUPA 2FZEA 1V2HE 2DFKB 3I2FA 4DMHA 4ENUA 1M2KA 1DEAA 1NBOA 1T6ZA 3OKCA 1KKUA 1EXWA 1SIWA 2K2WA 2XBLA 1OXSC 2H0AA 2VS1A 1OXTA 3AH8A 3AT1A 4LHEA 3RVNA 3RAPR 4G8CA 4KR0A 5ALJA 1G5IA 2NU8B 2W6NA 3T7CA 1V8ZA 2ZPTX 1U0RA 3K9WA 2A94A 3E22A 3NNNA 4JMLA 1AHNA 3ZDQA 3HCEA 3BJMA 1J0DA 3B8EA 1VXOA 2JJYA 3C3AA 2C4MA 5DHAA 3VKHA 2ZBGA 4DG9A 2ASVA 4FXOA 5I3ZA 2OG2A 3CLVA 3A37A 3SHWA 1UQRA 4O3FA 1WMBA 4ZYVA 5CXQA 2Q50A 4IL5A 4RLQA 4II7A 4WLVA 2HMYB 4DGSA 1CJTC 2D5CA 2P67A 4NEQA 4GX2A 3EODA 1C3VA 1GZ6A 3BULA 4HPJB 5FBHA 4ZZ0A 1XEXA 4L6CA 3LW7A 2GDZA 3IBCA 2QDXA 5TXGA 2H4FA 4ETIA 4B3IA 2JLZA 2QN3A 4EO9A 5A02A 1PUXA 4DR5B 4BNDA 3DBHB 4ZFNA 2BEVB 3CLRC 3EXHB 1TD9A 1JIXA 2ORED 3GEMA 5JASA 4P7GA 5LKAA 4REMA 1N5IA 4RV4A 1F2TA 1JIIA 1ZGGA 3H8JA 2P6UA 1DAFA 2JLBA 2QR3A 3N75A 5CNIA 3JVIA 3O21A 4PZ9A 3GRCA 4UKDA 2B6HA 1I33A 2ATCA 2EJTA 2VHJA 2YS6A 5AW3A 2EYQA 3A6DA 5K1ZA 2WZQA 4ZYWA 2CUZA 2SKCA 1MOQA 1P7VA 2YWFA 3HDGA 1DOAA 5EUBA 2GHIA 3ZV3A 1QF9A 3MT7A 1O94A 2B25A 3Q7TA 4BB9A 4Z4CA 1TFUA 1M6NA 1Z0AA 2Y1EA 1DHRA 5ICCA 5G0VA 1AUVA 1BEUB 3GRFA 4KIUA 4CUJA 5B55A 4MQ4A 1WB5A 2QRVA 3X43A 3PNPA 3K2EA 4E0BA 4F3TA 2AX4A 4X1YB 1L5SA 3CUYA 4GI1A 2PT9A 1PL7A 3KTAA 5LC1A 3RLFA 3ILHA 4RD3A 2I9PA 3AY0A 1POWA 3RUEA 1W1UA 4ESHA 5K8TA 3NM6B 1SK8A 1GZ7A 3QF4A 3VSBA 4DJJA 1UOPA 2FQWA 4JY7A 2VDVE 3TE7A 2EWMA 2DXIA 2AN5A 1Q83A 3MPUA 4LW8A 1EZBA 3NT4A 5B57C 2DPLA 2HGZA 2RBGA 2F3TA 5EPEA 5LXTF 2NVUB 5F2OA 2I29A 2QQEA 4HDRA 3USES 3KT3A 4CCSA 5GADl 2X0EA 2SKEA 4P98A 1JVBA 3LH5A 4DM7A 4B76A 4DSNA 4YMWA 1RD4A 5TRTA 1K98A 4YONB 4BFVA 2XCLA 1I4WA 1CRWG 2MYNA 3NASA 1YQQA 5EQFA 5FOWA 4FFDA 4Y2HA 2I55A 2N3ZA 3BGVA 4K6CA 3RVDA 1ECFA 3SQMA 3AVWA 1ADFA 3ZDEA 1YDGA 3B3QA 3QVWA 5E95A 1RABA 4URFA 5D3KA 3VOAA 4DLUA 4Y0VA 2UXBB 1F2UA 2OBYA 2Q8PA 3SDZA 2IHYA 1N2BA 1EQAA 1ZFNA 3TFOA 5BV0A 1M34E 4RVGA 5LFAA 1QFSA 2X8JB 3OJCA 3J7TA 3M89A 2GD2A 2HCFA 1EFDN 1XRNA 4D8TA 3KIPA 2DBYA 4US1R 1L9XA 4HN9A 3A6PC 3C7KA 2ZJ4A 4B35A 1L4GA 1ONPA 2I8CA 1CJUC 4WXYB 4CXMA 5AI5A 4Z54A 3HU2A 3FKQA 5KEIA 3RUAA 3GGPA 2D62A 4RK0A 3T7SA 4DJAA 3Q11A 2DU8A 4O0MA 2ZYRA 1D2EA 1SHZA 4HJXA 3ZZTA 3G2OA 2NV0A 1ISMA 3DF7A 3KVYA 3VKWA 5I9LA 2I1LA 4AI6A 1O6ZA 5K09A 5CB4A 4PGGA 3H19A 1D6MA 1MEOA 2WZDA 4FGZA 2V4UA 4ZVQA 1PDOA 1ZESA 3SIWA 1ILEA 2CNOA 3FWNA 4QXAA 1XTRA 1QU3A 2QLTA 1YZKA 2GHTA 3QVGB 3ZHTA 2BHLA 3D5TA 5CIQA 3O9VA 1WUIS 2DRIA 3N2YA 2PYZA 4CW7A 4J03A 3D1JA 4O0LA 1R0LA 1YBVA 2BFMA 4IXNA 4YT8A 4HNTA 1M1YE 3JWJA 2DWOA 2O7VA 4OQPA 4BQSA 1XKXA 1UEJA 5KZMB 4B3RB 3NWJA 3KQYA 2QMOA 2BAGA 1Z39A 3NR2A 4FFSA 4R5MA 4EHJA 3B6JA 3KETA 3H9CA 4LSMA 4PM4A 5ALWA 3CRZA 3RS8A 5AW2A 3PEYA 2EZBA 3MCVA 3MNFA 2V7PA 3P2EA 1N0IA 1MPTA 5HNKA 3E2PA 4I9FA 3UAOA 3GT7A 1GFIA 3AW8A 3MJRA 4OMUA 3TD9A 3V2UA 4DR1B 4Y1RB 3LUBA 3JASB 1NJ1A 3T5AA 3FTNA 3B5JA 3H65A 5IZ4A 3I64A 4KL8S 3OP1A 1HQKA 4BJ1A 3T99A 2B8WA 2QL7A 4I81A 4KWHA 2C59A 2IEGA 3PQ6A 1KFCB 3DYVA 4QOSA 3WTCA 2E6KA 1G63A 4YRLA 3SS8A 1RKQA 3VPAA 3QVSA 2WJ4A 2FN7A 5CBKA 5EXDA 5K0FA 1NLUA 3N6XA 1B42A 1C7IA 1VE6A 4DQLA 5BNZA 2JC3A 1W5FA 4ZI2A 1T4BA 1VE5A 2OO7A 5E2AA 4GDFA 2GN4A 4C4RA 3HUTA 4KAXA 2FEPA 5CH3A 4EI7A 5LQNA 2PHZA 4PCUA 2QV7A 1YZTA 3CIOA 3KTOA 3B7WA 2RIPA 4OFWA 1UUFA 5DGHA 1Z6ZA 4HDNA 3DTTA 1GT6A 1Z06A 4PYJA 3HCCA 1EWRA 1NMEA 3X1XA 1TU4A 1XHLA 2B82A 4GR4A 4UZFA 1XD2B 2CHQA 2RHLA 1I2ZA 4LMAA 2QZPA 5HZMA 1MO4A 1OU4A 4EW1A 4BQFA 4F8EA 4FFVA 4KDEA 2Y0PA 2O8BB 4XJVA 2FWJA 1X8KA 2BP7B 2Z4SA 4IIUA 3BHIA 1KO7A 5ESWA 1RI5A 1ZPDA 4H1HA 3KFXA 5JJLA 2MYTA 2HEIA 4HXFB 1A9RA 3TM4A 5IK2D 4J3NA 3KSZO 3LBAA 1PBNA 4GEKA 2MJLA 3PFIA 3UHAA 1JH9A 3I9LA 1RHQA 1S2GA 2JBHA 2RAPA 4FMCF 3C41J 5CB0A 2CJPA 1D2GA 1XBTA 4A8JB 3FEEA 5JSQA 2VTEA 1EJ0A 1C2TA 2PJDA 4O8ZA 4X97A 4UAGA 1JIVA 4WQMA 4CM9D 2CLSA 4BZPA 1UK8A 2IZOA 1XCBA 1XCMA 3JZAA 3NFRA 4FZJA 1NR7A 4H4DA 1QGOA 3FB1A 3P4UA 1H66A 4ZVPA 5AVXA 3EZNA 1AE1A 1PEYA 3URKA 2JF0A 2ZE6A 3DHEA 2QMEA 2CUNA 3K15A 2AS0A 3HCBA 4L4SA 1BJRE 4FC6A 1SOMA 1C8VB 5LOVB 3UG7A 2P4EA 5BSHA 3N2ZB 1JA0A 1IHDA 2YN2A 3QFHA 1GU7A 4PR0A 2A9QA 3T3IA 3VJMA 5TT1A 1PL6A 1OWOA 3TSZA 1ZVVA 3G9QA 4HVLA 3IQHX 3IKJA 3LUHA 3MBIA 4BO1A 3MUNA 4PONA 2ZANA 2WPNA 3TOVA 2ZI3A 4ZAZA 2NU6A 4H4EA 3CT6A 4B2YA 2VLBA 1GGFA 4ESVA 1HE5A 2O2HA 2PGLA 3BXEA 2NUBA 4TMTA 3ICUA 5AUOB 2Q3LA 5IARA 3UJ8A 4GQAA 3RVKA 1X15A 4FFWA 1PR3A 2ANBA 3TR5A 1NXTA 3MLBA 2REXB 3TLKA 3ZIUA 4KNYA 3UGTA 1R3DA 5C7YA 1V11A 1OFVA 2ACKA 4Z4EA 1O8BA 1XWIA 2NO9A 3DLTA 4D44A 4H1WA 3OZFA 5FQNA 2WVHA 1DBWA 2YBDA 4EJSB 2OXFA 5KC9A 2D2XA 3KKOA 2P1RA 2QJOA 4D5GA 1W96A 3C5CA 4INJA 2MIIA 4BX2A 2QJWA 3CLUD 2NSLA 1H6CA 1XJWA 4JNKA 4C7OA 1FDOA 2BMWA 1BYIA 4OP1A 4ZRMA 2EZAA 5IM5A 3NKFA 3M4YA 2JBKA 3UHOA 3OF5A 4WX2B 2JLVA 2F43B 3R4CA 2WYUA 3Q2KA 1H6BA 1OU0A 1VYTA 1CLEA 2V5AA 2HGSA 4DV6B 4FZ3A 4M1YA 1GPDG 5I4BA 1PJ3A 1X1TA 4P86A 2P6MA 3VYTB 3KRTA 2HA6A 5EUQB 3FH0A 5HJ5A 4A8JA 1F12A 2I2WA 3NIFB 5HKBA 5LQDA 1IY1A 5HGXA 5JJ5A 2VUHB 4NU0A 4EL0A 3PXBA 3QY9A 3SICE 3BICA 1DOZA 3VOBA 4UBLA 4XWWA 3SIXA 4MI3A 4N39A 2R8XA 3LM8A 3PQFA 2BP7A 1GHTA 3PXDA 1CETA 1F9EA 2ZTVA 1KYZA 3HU1A 4YWJA 3USCS 4WBNB 1I6LA 1JWBB 2CXSA 3JQAB 1EQ2A 2EFGA 2XMZA 5DNWA 1MFZA 4I5GA 3Q3GE 4QJ5A 3H7AA 2XWJI 4IMPA 1OA1A 3K96A 5E9AA 4DIDA 4NL4H 2VRBA 4C78A 1F5NA 1ZBDA 3ZEAA 3AVPA 1U0SY 1DAMA 1UINA 4FOLA 3U1BA 2HNKA 3SLRA 3WLJA 4C5CA 4DCGA 5HS4A 1EXDA 5GWXA 2IGTA 3QWBA 1Z6AA 3PRJA 1RMQA 2ZE5A 3R6DA 1Z4JA 2D7CA 3LIIA 4MKRA 1M2JA 3R3SA 3KOXA 4XGKA 5BT8A 1LK7A 1PJBA 2ZRBA 3EQ9A 1H42A 3IURA 4MVCA 1JTFA 1BXRA 2PFKA 3K0KA 3GT4A 1HI9A 1NFQA 3L6CA 3LSYA 3MTQA 3IR5A 1C7QA 4JJ4A 3ZNNA 4UU0A 3VKFA 1E3MA 1F9AA 5GP1A 3PUHA 2OZKA 3QYAA 1QYRA 1KVRA 2P0YA 5CVDA 1RQNA 2WINI 3NU1A 2C6PA 3FFBA 4HFJA 2W6ID 4D4MA 3ZZ0A 4B3GA 3TF5A 3IV6A 3IA2A 4D92A 1VB3A 1MOSA 4QJ3A 2BRUA 1JDBC 4MAFA 3N87A 1LBIA 1YUMA 2XNDD 2G5GX 3PU6A 4JSTA 2GNPA 4Q3BA 3IB3A 1U0FA 4Q3LA 5I7AA 1OPRA 2O2EA 2QI9F 4F2GA 1DAOA 2OWDA 1PI3A 4ZC8A 3E7PA 4O59O 3BWYA 4RPKA 4A1OA 1DHTA 4R54A 4CFZA 4KAAA 1I5RA 2BHNA 3TQCA 4MDEA 1XK7A 4EJSC 3KJIA 4IGKA 1TF5A 5BSRA 4AF7A 1CY0A 1LLDA 1QHFA 1IWPB 3ESRA 3NAZA 3G8AA 3O3CA 3HCAA 2J3KA 1NNLA 1VRVA 4UTOA 3DOIA 4UDXX 3IEPA 5H3LA 2GLXA 3WRXA 2AW5A 1KK1A 2QGZA 2ZT7A 2HLNA 1YQ9A 5CFPA 4DPMA 2A5DA 2BCGY 2RBEA 1DU4A 1UKYA 5AK4A 4US0R 1ZOOA 4FQ8A 1Q7TA 1YONA 1Y98A 3RWMB 3IQGX 3QXXA 3AR2A 5K2OA 2KBFA 4Q0MA 1RIIA 2QG9A 2O8CA 2PYDA 3C3WA 3K0BA 2QUIA 4N6GA 4V1CA 3G2QA 3H2YA 1J3LA 2H48A 4AW9A 3ELYA 3BMQA 3N5KA 3FZEA 4E33A 1DFGA 4CIYA 1CTQA 3BSYA 4FWIB 2FMUA 4CMEC 5A4FS 2CLCX 2RH4A 3QLTA 4F1JA 4GKBA 1E6MA 1HTWA 2XZOA 2UAGA 1UOOA 4MUHA 5BQXA 1ZN8A 1QTRA 3I9JA 4RIFA 3RWBA 4D9GA 4JB2A 3ER8A 3T9CA 1CUVA 4TTPA 2GA9A 2OK8A 2X8JA 3RO7A 3VNVA 2F17A 1AURA 2YC2C 2X8WA 2RAFA 4D8YA 3U3DA 3AKDA 3P9ZA 1HEYA 2FNAA 1P9LA 1IK4A 1SU8A 4NBTA 4YP6A 5JD3A 4DQ0A 3EDQA 3U7IA 2Q62A 1IG0A 4LYDA 1XC7A 4UAJA 2I2DA 3H3XA 3T94A 4FTWA 1V3QE 3OPYI 1XEWY 3S28A 3VZQA 1ZOLA 1BE0A 4XB2A 1GU0A 1V0JA 3TCNA 3H2HA 2PH7A 4Q1BA 4QDKA 2IP2A 3AUJB 4H27A 3SJBA 1Q21A 3OMXA 4O4HF 4IH1A 4DLZA 5HRAA 4Q1AA 1QOZA 3SPXA 3SR0A 3EZ7A 1I2BA 2A0UA 1L7XA 4QU5A 3DBLA 4JBIA 2DGDA 2A58A 1KQPA 2RH5A 4C22A 4E13A 3D1VA 5REQA 5LLSA 2XGMA 4BP1A 2UUCB 3CO5A 2MCFA 4EA7A 4JXZA 2IEYA 4P81A 2W6QA 2J0UA 5AUNB 2ADOA 2W83A 3DE7X 5EP2A 3RC2A 2OAP1 3QKWA 2P3LA 1EX9A 4UJ3A 5F35A 2ZYIA 4TT8A 4KJXA 3ZW7A 1UEXC 1VPWA 4MA0A 2O19A 4LRWA 1M2VA 1YNOA 1CJKC 2WIFA 5HTOA 1UDBA 4R9RA 1IBLB 2CNNA 2WWIA 2YNMD 3KSMA 2FUEA 3U9LA 4DMRA 3DVRX 3FFXA 3GA7A 2VN8A 4OLHA 5CT4A 3FW1A 3L1VA 3P7MA 4OJYA 1RQRA 1D9ZA 3NBQA 3ZI4A 1B26A 1USWA 3WRYA 1X7GA 1UWVA 2PGDA 3A1NA 3PF8A 1E1RA 4FBLA 1XCGB 4ZARA 3DVQX 4C7KA 1JF8A 1KJZA 1D1TA 1N6KA 3L8CA 4KQCA 3I1IA 5IBQA 2IDMA 3ITNA 5CB4F 1E0SA 4TV9B 3WGQA 4RF3A 4RSHA 1Y8AA 3LOQA 5T4HA 1U2DC 5F23A 2O6HA 4MVJD 2OXEA 2VAMA 5KIAA 2VPYA 2AOWA 1OASA 5GY7A 1K8YB 1T4MA 1NUUA 2PZKA 3C5VA 3LSTA 5BNWA 2OGTA 4E21A 5JO0A 4C9UA 1RQ2A 3EXHA 3D7DA 1BE8A 3LYHA 4CKBB 5DNVA 4TN1A 3SCZA 4HX9A 3PHIA 1GFSA 1ODLA 5HK8A 4E30A 4XR9A 3PGLA 2PZFA 2ETVA 1KMQA 4G0UA 1ZM4A 1R16A 3PQ5A 4UCXA 1O96B 3ZY5A 2VNIA 2YKGA 1OX5A 4R3UC 1JR4A 2QD5A 5KO2A 1I9GA 3B7GA 4AJLA 5BN1A 3ANNA 3DCNA 2IIVA 3P97A 1JJFA 2UZ1A 1GL3A 4JDUA 4YGXB 4D9CA 2VJYA 3E22B 5EERA 4RKFA 1VI6A 4X3OA 3GXBA 2JIOA 4PPFA 1JQJC 3WBFA 3H84A 4BFWA 1Y89A 4PG7A 4HBGA 3PEWA 1EFKA 1EHCA 4TPKA 3WYGA 3B3AA 1QO0D 5IDVA 4EVQA 1BWRA 3B7PA 3DV9A 1D7OA 3NT5A 2VWQA 4PXYA 4A9AA 4KACA 3AEKA 1QSGA 2V8OA 2VH5R 4H0CA 1KE2A 3QHAA 2WNHA 3GCDA 3F46A 2X4GA 1RVV1 2O06A 3KU4A 4GYKA 4MW1A 1X19A 4R0VA 2PT5A 4DMLA 4DDWA 3LQ2A 2J5BA 2E4VA 4KN5A 2H08A 3CF2A 4JROA 1SXJC 3QUCA 3V4ZA 4Y2JA 3EBLA 4I1YA 3RSZA 2QPLA 4L5BA 4NE9A 1C4OA 5HFNA 1BOOA 4TL9A 1BFKA 4AO7A 3EA0A 1PNQA 1E2GA 2RIRA 4LMBA 4LYYA 1NUQA 1DC8A 4P4EA 1WPRA 1XAHA 1J90A 2PBZA 1WU7A 2Y2VA 3C3YA 3MTGA 1UJBA 4ARZB 1PQUA 1IXZA 4J1QA 3G2KA 4FOTA 3DHWC 4WZBE 3SE0A 2DPYA 5CEFA 2GSWA 1X3SA 2H0RA 3HSKA 4GLFA 4CDMA 1L5MA 2IY8A 2Q49A 1GPMA 2RB5A 2W2LD 2WZCA 1ZSYA 1W52X 2PEYA 3IVGA 4L4RA 2HK7A 1NBWA 4NV0A 4BATA 3P1JA 4Q7MB 3E9ZA 4IZHA 2VP2A 3HXMA 1XRPA 2CE7A 1N2SA 3ZHQA 3THWB 3GRAA 3G9XA 3Q8MA 2VYND 5C1IA 3WOVA 1O95D 1VIAA 1JXQA 3FNBA 3WKAA 2O48X 2Y1OA 2FN8A 5FYDA 3VV2A 1JKIA 1RQGA 2XPCA 3CQ9A 2O5CA 4OCZA 2VPWA 2RH8A 3Q8XB 4HNHA 3U80A 1KVSA 3RM3A 4BJ3A 1TYBE 1GPNA 5JZOA 3U7FB 4N47A 3CCBA 2C2XA 3LCJA 5BN4A 3UWDA 3T3GA 4LWPA 2GASA 2ZJAA 3L77A 3H86A 4ZMRA 3RTGA 3BL8A 1DUSA 2SICE 3R6TA 4KQWA 4Y0NA 5B30A 3QEBZ 4DMGA 1CR6A 1M10A 5K8CA 3HR7A 2J3HA 2FDRA 3CRQA 3MLAA 2NG1A 2W2MA 2QMZA 3O8OA 4RK1A 1SQ6A 2FRDA 4YJGB 5AJZA 1GSIA 1KK0A 2R5NA 1GSHA 5EMLA 1QBKC 3DXFA 3OLCX 4ALIA 2Q0QA 1W7AA 4POAA 1ETUA 4E07A 3IR7A 3F7TA 3P26A 3GXOA 2FHPA 1ECLA 1TM2A 4LGVA 1NJ5A 1IBKB 1T0UA 1XQWA 4JHLA 2Z8YM 2UVPB 4HY3A 3F5FA 1PLLA 2PX6A 2AN1A 5FUWA 4JA2A 5SY9A 4ARCA 1DJMA 3N8GA 1F06A 1UKBA 1ODIA 1Z08A 1G42A 3F3MA 4UE6A 3WL4A 2VEOA 5HUJA 2H5IA 3OBBA 4KQIA 8ATCA 2FW9A 3H5VA 1BH6A 4G24A 2NSYA 3VNSA 3WLSA 5SYNA 1YS9A 3EY4A 4OL0A 4DREA 5AW0A 3HU5A 2GZ3A 3QY0A 3UC9A 3AR7A 4G97A 3D3KA 4FFNA 4N5IX 1NE2A 1B73A 3KKMA 4LXIA 1UDCA 4XYMA 4TSKA 3GAAA 1DEOA 3GCXA 3QV2A 4QBIA 4WLUA 1GTG1 1XZDA 3TLYA 3WL3A 2G4CA 3W8DA 4A3SA 1FXWA 1MABA 2R8OA 3HBJA 4NYIR 3WOHA 4ZEVA 1DKRA 3P20A 2FMFA 1BX1A 3OT1A 3E5MA 4J49A 1QCDA 4KLRA 2Y93A 3FTEA 2JI6A 2QE6A 4UOEA 1M1ZA 4NBWA 3O31A 1NF8A 1GZHB 3RTBA 4E5KA 3ZI0A 3S7ZA 3BJEA 1UBEA 3G8DA 3GFSA 3IT0A 1EBFA 3LT2A 2XEGA 1N2HA 5B58C 3VR4A 4GMHA 4PYLA 4U39A 4NJEA 1J49A 3LP5A 4FGUA 4HGZA 1YL5A 2YMQA 4PRZA 2K5UA 3TUZC 2AYZA 4OP3A 1FUUA 1W2GA 1Y6RA 5LZ8A 3S4YA 4E6PA 3NGXA 4GAEA 3TOXA 1S7CA 1TLLA 1OGJA 2PMDA 4BNTA 4EHDA 5ICMA 1JXOA 2Q1TA 4IWYA 4H59A 1QLHA 2ZUTA 1EB8A 1XDUA 5I9SA 3ND7A 1E0DA 2GF2A 3DW1X 3MOIA 2YJVA 5JISA 4FIZA 4HTFA 2IU4A 2OUKA 3K5HA 4AWXA 4OSPA 1S01A 1L6RA 3C3XA 5AVWA 1QYXA 3IP5A 4TROA 2ZTUA 1L1QA 5FI1B 3SEZA 3F9IA 5IEJA 3RYCB 1NBMD 4UHFA 2IYYA 2AN3A 2HU5A 2QTBA 3R5FA 4GXQA 1YUNA 2E0IA 1P4HA 5E7JA 3AUTA 3FTCA 2PRKA 2IC5A 2Q6IA 3FPFA 5KSZA 4BQOA 2MSNA 4OUDB 4N40A 3VYUB 2VVTA 5JARA 2P2CA 1E59A 1JL3A 4EX7A 4BECA 1TAUA 4MRPA 3OPXA 5COBA 5KBYA 4AY2A 4PG6A 3KC2A 1ZIDA 3QUQA 1SUDA 1G6OA 4ER0A 2G28A 2IWRA 1CY2A 1JLRA 2HN9A 4H2DA 3U40A 4AROA 5HKKA 1JEAA 1QGAA 4RZSA 1PYGA 4UCQA 4HCJA 1DV1A 2C5HA 3V4LA 4MWGA 3QXCA 3TKAA 1MRSA 1T9DA 3KJGA 4TTVA 1YQWA 2R6JA 2YDXA 3ZU4A 4UVIA 4DBZA 3I6IA 3E0XA 4O4HB 1A8PA 3HG7A 1I7PA 3A4MA 1PT8A 4QICA 1AGNA 3DEZA 2HJSA 4LHSA 5GJWC 4F6RB 3BYZA 2ODWA 1ZXXA 2Q27A 4WOBA 3RFVA 3EZBA 2IKQA 4PWZA 2LDXA 1NXVA 1Y5IA 4LX8A 2WK1A 5BR1A 2ZXEA 2R5WA 2YHSA 3HU3A 3IEUA 4HQFA 4G84A 4EH1A 4IVNA 4Q4LA 1D4FA 1RAEA 3ENNA 4XSHA 1OA0A 3GGDA 1T5SA 4XGIA 1L5QA 2I3BA 1RAAA 3WAKA 1JG1A 3P8ZA 2ISQA 2ZJZA 5D5PA 3V9PA 4RXTA 5HHTA 1W36D 1CZLA 1NM5A 4N3GA 4EPVA 1T43A 3NIBA 1IVYA 4C0LA 4FE4A 2VZ8A 1X9IA 4IV8A 4JI2B 1ATZA 1PNOA 1QCCA 1YQEA 3JCZA 2H1LA 3ESZA 3G89A 3HV2A 3KOUA 4H7EA 4P4LA 3FF1A 5EOVA 1J70A 1K88A 1MC1A 2G88A 4WL0A 3WWCA 3RFXA 2R82A 2GEFA 1GXSB 1C0LA 4IFIA 4OIFA 4YMSA 4ESOA 4F9EA 4ENSA 4Q9DA 1FDVA 5EHIA 3T5CA 5C51B 1N8TA 2QX4A 3KKEA 4YASA 3RIYA 2IYPA 3G7NA 1LNQA 1EZ1A 2GXQA 4R16A 3AR9A 4PTZA 4W8GA 4EO4A 3ISVA 4BBZA 3GT0A 4BKOA 1N2EA 3ILVA 1WSWA 4UTVA 5A5VA 1RDFA 3R77A 2L2QA 4LJ7A 3L5OA 4MR7A 3RROA 2PZMA 4NZOA 5CUQA 3VC3A 4MYSA 4CTJA 3O8NA 4CE6A 2PG3A 4FQ5A 1GGJA 4Q66C 5C5IA 3KKPA 5DH9A 2C84A 4MAMA 1LFAA 2QQ5A 3BIWA 1XKQA 1MIHA 3HLKA 3LLVA 1MO3A 4AG6A 4ZZ1A 1U65A 2JJMA 4HEQA 3L46A 5L40A 2OQIA 1UZMA 3EXG1 1JNXX 4G01B 4UREA 2G82A 2EHJA 4F38A 2XEJA 2RK6A 1CVRA 2IOHA 3BRWD 4MVWA 4BEVA 2V7UA 4LN1A 5KYKA 2FPRA 3IRVA 1CUFA 2YXNA 4KQEA 4RO0A 2C2ZA 1VG9B 3B1ZA 2R7KA 4TWIA 2F48A 2OMEA 3VU8A 2AH5A 5CA0F 4LOIA 3J81k 2GN9A 5T41A 5ALUA 2UYYA 2YX1A 4N5NA 4GT1A 4QKQA 1KU0A 1XF9A 2JCBA 3DHYA 4JELA 1UKEA 1GM5A 2X3UA 3O26A 1ZUIA 4M60A 4KWTA 5F5LA 4UBNA 4B8YA 3CONA 1CY8A 3OH8A 4YO7A 3G23A 4ZT6A 2X0KA 4CCYA 1DRJA 1KKMA 3VYWA 4R83A 1ULAA 4GD3Q 4HNAA 1HE3A 3ANXA 1MAWA 1YRWA 1C3XA 1VBNA 3MRSA 4O2AB 3VAZA 4BVBA 5JZMA 1DJLA 5A2GA 4LKOA 1OTYA 3EQ2A 3FMIA 2C5LA 1LVUA 1QFZA 1A5TA 5BQPA 4ZAGA 5DKFA 2PL9A 1D7AA 1I1OA 3T1VA 3A4YA 2WP8J 3DEKA 3JATA 3PQCA 4XTRA 2R6GA 3E9CA 2PX5A 4TV9F 1QG0A 4X60A 2O6LA 2BM9A 3OQBA 5ADVA 1L4LA 2OM6A 1UFQA 1ZVKA 3PHJA 2OQRA 5FA6A 3F3KA 2IXTA 1QHHA 2GCNA 1SBNE 1SC4A 1JFFA 3FBGA 1GL6A 4QO7A 4CLDA 4EG3A 2OXTA 3A9VA 4NGSA 2PT7A 4C5AA 1LJUA 1RWXA 13PKA 2ZE7A 2V3WA 5EMJA 3JZFA 3W4JA 3SXUA 3JRNA 1SVIA 4K5QA 2FPLA 5DT9A 1DP4A 3O7MA 1ODSA 2QRPA 3SK0A 4EVIA 4RH1A 1FA9A 1Z33A 4M1QA 3ZX5A 4NAUA 3C3BA 3R7AA 4EUSA 5CYFA 2JH8A 3MUEA 4M0KA 1FRZA 1T2VA 1YJAA 1ZRSA 3CTMA 4S24A 4TXNA 1OAKA 4Q18A 5AI8A 4XVUA 4UM8B 3KVVA 1R50A 3WSVA 1FFXA 1KJYA 2GKSA 2ZWVA 2OE2A 2D59A 3R44A 2AFHA 4XYEA 2KJQA 1LK0A 4NI5A 3Q7RA 3EXFA 3GYGA 2B92A 5H80A 1KO1A 2X9NA 2PBRA 3DUFA 3BILA 3A3PA 5JV5A 2HHLA 4HBZA 1VIMA 2OSVA 3B82A 3CISA 1MTZA 4KPFC 1TQ2A 4HI0E 2IZ0A 1J09A 3AFHA 3P2OA 4HZIA 5DOZA 5JUWA 1IHXA 2X9VA 4I99A 2B5OA 1C4XA 4URUR 3TIIA 3GMDA 2AW3A 4NQRA 2I5PO 2Z4RA 3ZG6A 1UDRA 3OQHA 1SUIA 2XW6A 2D2FA 4M98A 4P53A 5DDIP 4BIIA 2XUZA 4EHLA 5CFOA 1E9SA 4Q9IA 3P5BA 1JFFB 3GA5A 1AO3A 1QHHB 4QVKA 4BVJA 2WJVA 2R8EA 1KEVA 3L1JA 3NBAA 6LDHA 2QAIA 3HXTA 4QWMA 3TLBA 4IIXA 3UW3A 1XEWX 1R6VA 1ONBA 1XQYA 4RJ2A 1JEYB 1AV6A 2X0SA 3EMBA 4R2KA 1G16A 2YN4A 5AI0A 1L7AA 1XVIA 3G2HA 1KH3A 3CKLA 1CHNA 1RCFA 1V8OA 3OEHA 4TZTA 3WL6A 1WB9A 3SAJA 1T5DX 3DFFA 4CU2A 3FLBA 3CT4A 5KTYA 4BNXA 4W1RA 2QLNA 3H5IA 1ISRA 2VL7A 1N34B 3KOWA 4GLJA 1B14A 1FU7A 3A6HA 4O2AA 1LF0A 3GZNB 3ZCRA 4F5WA 1T8YA 2W93A 3R0VA 2JBJA 1SQGA 3MWLA 4ZAVA 4Z9XA 1AGRA 2JKZA 3LQYA 4YRFA 1FVHA 5JRZA 3HUEA 2JRLA 3FXAA 3UCXA 4ACBA 4BXOA 3ZWVA 1M54A 4G0QA 2FEXA 4E14A 3RGGA 4CTKA 2SCUA 3E61A 4YUVA 3CLTD 3DXZA 3H9EO 3NW9A 3PJFA 1TAHA 2XIQA 5F7JA 1N2OA 4WACA 1NW9B 1ZI8A 2C2KA 2R8ZA 2VT3A 3A4LA 1ENZA 4G07A 3COZA 2EGHA 4GR9A 2WVAA 5B7QA 5HKKD 2OBBA 2XDQA 1Y4ZA 2IHTA 5FIUA 3I73A 4I2NA 4CMKA 4KREA 1PWZA 1FBNA 1G21B 2PR7A 5L3SA 4MDYA 4XB1A 5DGIA 3NFYA 4ZCTA 4HXEB 5EZYA 4ZHQA 4UE3S 821PA 1FMLA 2HMWA 1RJWA 1WUKS 3KJZA 3PA6A 4NZZA 1PJZA 4ZT4A 4EW3A 3GLFE 4IJWA 1Z37A 5KAMA 2R11A 5AIBA 3RBUA 4TV8B 1LU9A 3MWYW 3A04A 2C5BA 3HFRA 4OQNA 3CINA 3FSRA 3AHCA 4OM7A 4YNBA 3PR2B 4BQPA 2E85A 1P80A 1NA5A 2FDXA 2YFHA 3PYLA 3UW1A 4K88A 2GH1A 5CFNA 2J30A 4B83A 3GPLA 3VJRA 3RABA 3MA0A 4ARIA 4CODB 2V6MA 1E63A 3L8ZA 1MO2A 3DGEC 2XVXA 1J2TA 4DG5A 5JTTA 3AVVA 1WB6A 3GJ3A 2OORC 4QVIA 3PC7A 3D0KA 3KTDA 3LPDA 4Q3NA 1ZR4A 3LUDA 2IZZA 2Z1NA 4MYHA 1SXJE 1BZYA 4RPIA 1IULA 1J24A 5AKEA 3EDOA 2XE6A 2HWXA 1NBIA 3EZLA 1IZYA 1BU8A 4ND6A 2DUNA 2CJYA 2HCBA 3OUTA 3TAXA 5ESDA 2XYGA 3G0BA 1XPOA 1XLUA 3UMVA 3AERA 2P1ZA 1ESDA 2OXIA 4BOYA 3NHJA 5ALSA 4MV6A 5EP3A 4C8UA 3JZMA 1E99A 4KX3A 2BC9A 1EAMA 1J23A 1IHPA 1UT6A 2AEMA 3TLMA 3W5UA 5TMPA 4MV9A 3RUDA 2PUHA 5BYBA 1N0VC 2CEAA 4ZIRB 5FTJA 1MRNA 4MYDA 5ERXA 5DX8A 2AI3A 1JQ5A 1KFEB 2W6JD 3P9SA 3RVRA 3AG6A 2A0XA 1NTRA 5DCUA 1RLOA 1O9BA 3RS2A 2HAEA 4F6LA 3C6BA 1GY8A 5L4NA 3GX1A 4YECA 2IPNA 2CDRA 3GEPA 1GNTA 4C0SA 1UPBA 2H1WA 2YWXA 4LY3A 4MMYB 1FLAA 4XWYA 3QQPA 3D8BA 3BE5A 4G41A 4EGJA 2W70A 3K4IA 2J9FB 3DE0X 3GJYA 2PCJA 4U3JA 5DBGA 1RNLA 2EBFX 1LW7A 3H9GA 4RVHA 2RGCA 1Y7PA 4EG7A 2NZJA 4Z9YA 2ZVJA 1RAIA 4RA9B 3N2KB 1ENYA 1CPYA 2C94A 3JQDA 4G56A 3UH0A 1ICEA 2DUMA 2Y6UA 3MGGA 1ADCA 5IJAA 2P30A 4QUDA 2FLWA 3S2SA 5DMHA 1EP9A 3M6WA 2OC4A 2VHCA 2A59A 4UVEA 4M9XA 4GM0A 4DHWA 1EXMA 4DIEA 3BI0A 2QN7A 3EAQA 4ME6A 4FGJA 4H0FA 4I6GA 4UU8A 1YAHA 3ZNPA 4DAOA 3G5AA 3IUEA 4HAUA 1IY8A 1JILA 3TE6A 2FR0A 3M5WA 4KRFA 1ID8A 3WLFA 3UCEA 5D5HA 4O02B 4B0OA 1PG5A 5E8RA 3W2FA 3EW9A 3HGQA 5BSKA 1YS1X 4WKNA 3SIRA 1SCQA 1H05A 2N9UA 3HCOA 4I14A 5FNZA 4BNMA 3GYBA 4YCMA 1RU3A 2CFTA 3ZC3A 3ABIA 5L95A 1A4RA 4LOKA 2XE4A 5GQSA 3C74A 2JI9A 3H9JA 5TS3A 2XWPA 3JVVA 2L18A 3HH8A 4MW2A 2JJ1D 4UEOA 3TQFA 1JAZA 1F0NA 1EGMB 1PJ8A 1ZJ6A 3KALA 2JJ2A 4BFTA 4GKJB 1XEFA 5ALLA 3GWZA 2P6PA 5BV8A 1SXJB 5EE5B 2ZDHA 4JLDA 2PPVA 2B0AA 4NG4A 3WRVA 2Q7OE 2PANA 1RQPA 1UXJA 2QL5A 2NP6A 1KY4A 2WF8A 2H2HA 3PRYA 4L6AA 3AF2A 4W8OA 1V45E 4UPEA 1IDN1 1ZMTA 2OYSA 3EXAA 1Q3HA 5FPHA 1OIXA 1TU3A 4PHHA 5HKOA 2E3JA 2CL6X 2JIMA 2RJNA 1P81A 3EGOA 4X95A 1I1NA 2EP8A 4LDNA 4MIKA 1L5KA 4A23A 5A5DA 2BEKA 3K9NA 1YK0A 3NGLA 1GLVA 1BO6A 1M6VB 1PX0A 1WZIA 4RMIA 4TJXA 4JQCA 3VAYA 4NJEB 4DLSA 1P7CA 1QWOA 2OECA 3E2MA 3JX9A 3CZQA 1U0LA 1PGQA 2FR8C 2XT9A 2IBTA 2FMIA 4HZGA 1KDVA 1XWFA 2FFQA 4OAPA 2XD9A 4AECA 4LG1A 2GK3A 3OT1B 2VRNA 1WXEA 3IHKA 1PKEA 4XM2A 4AKEA 2FUNB 4XVCA 1H2AS 2I6TA 5FBLB 1DUIA 3TTUA 3P9RA 4CBVA 2HDWA 2W2PA 3OU2A 1LH0A 3HZHA 4MQEA 4OP2A 4CEHA 1BRTA 2NTYC 4CO9A 3CJRA 5CAEA 2NW6A 1DC4A 1THZA 2X9LA 1TA4A 1HE1C 1P5RA 4B3FX 4BVEA 5LQUA 3H0EA 3DBIA 5BWBA 4YC7A 4EAAA 2Y0DA 1C9EA 1GEEA 4FINA 3L4SO 1ZBQA 3PC8C 1OFTA 4TXHA 1AIPA 3LWZA 1O6GA 1AC5A 1WUTA 2X7JA 3IAS1 1XYVA 4YLYA 1K7FB 2HCJB 3NYIA 1I30A 1SH7A 1SBIA 1AXGA 2G8LA 2VT7A 2ZT6A 3FKSD 1G66A 3I5AA 3KB2A 4I46A 2I6XA 2DTDA 5HMMA 3RVBA 2F4NA 2PAFA 3MTAA 4YJ2F 3SYRA 2NQTA 2B20A 4BB0A 4L57A 4BN4A 3OAAA 1VCMA 4ECAA 2PWZA 3JW8A 1ORRA 2JKVA 3I92A 2H00A 3H05A 3LAWA 3IE0A 1IRXA 2WM3A 2FW6A 3ZH9B 2VEDA 4QTYA 1L3IA 1WU8A 3PTZA 4KBYA 4K26A 1T3HA 2ZI4A 1MOPA 3WYAA 5FR1A 5BYJA 4P3XA 1GG2A 4I1VA 1DX4A 4TTTS 2JEZA 2OV1A 4X8MA 5CPFA 1NJ2A 4Y6GB 4JDPA 4L08A 4B6GA 3RUFA 4JODA 3BXOA 5KNBD 1YRHA 3II6X 2IOYA 4PX3A 3WRYC 2OXCA 1H0SA 1RRKA 2C77A 4B9AA 4D98A 3LIPA 4Y67A 1F4LA 2FN4A 3IP8A 2FOLA 4YCAA 1EA5A 2DWQA 1AQLA 4HD8A 4BNIA 4EBFA 2MSWA 2CNLA 2PX3A 4LHWA 2R7LA 4QPNA 4BB5A 3OQVA 5B7GA 4XSVA 1UMCA 3DOHA 4C1NA 4UU7A 2DFTA 1R0CA 3HEAA 5LR6A 1NWCA 1KI8A 5JR3A 3AIIA 4AKIA 5ES4B 3BL6A 5LQKA 5A6SB 1SO8A 3IUSA 3WFZA 4HJRA 4X63A 1JB1A 1T2NA 2CWDA 5J5CA 4G4IA 4RHEA 1AY0A 1T2DA 3EXHC 1JDBB 5EL0A 4ES6A 2XXAA 1FFEA 1W0JD 2AEEA 3DAYA 2I2AA 2PVSA 5J23A 1XQXA 2WD7B 3VKUA 1QP8A 5HJEA 3SP1A 3I0ZA 2BBSA 1DEXA 3CLRD 2RGNC 1OZGA 3EQZA 3G0GA 3FMFA 4MQEB 4C9BA 2J0SA 2HOQA 3SC6A 2ET6A 1Q6ZA 2P27A 1IWBB 1INLA 4UHHA 2H3EA 1IZ9A 3QXJA 3WY9A 1MLDA 3SDBA 3G85A 4B3CA 4Y0AA 2OGUA 2QN8A 3D7SA 3DVLA 3HA5A 4GLLA 1RYZA 3A1VA 3OJFA 4ZOAA 4J9VA 5ED0A 4ZA2A 4DV3B 4L5IA 1ZD1A 2IZ6A 1VE1A 2XOKD 3AEKB 3PPYA 1XA0A 3CU5A 3FPAA 4HAIA 4OXYA 4P3OA 1D2AA 5ICSA 5F3WB 4DRXB 1MP0A 1TA0A 2ZI6A 5B3JA 1DWUA 2YJ6A 1G2QA 2BSXA 1J56A 4JSYA 4D41A 5LZ2A 1O9GA 3VPSA 4OVKA 1R0YA 5H3CA 3RU9A 3F5SA 2VSOA 1IPHA 3AUYA 4D9KA 3U1TA 5TV2A 1TTTA 1SXJA 1US8A 4LGMA 3F47A 1NY5A 2XNJA 3DOJA 4AB1A 3AJEA 3AVXA 4UTNA 1U8XX 4NDAA 3ZIAD 2QAGA 3CE6A 3D9QX 4PO8A 1NR5A 4WECA 4OFZA 3NJRA 1IPFA 3EZGA 2AMYA 2H2WA 3I83A 3VR6A 1V35A 5EXEA 1FP6A 4HK4A 2QTHA 4NGMA 1JZQA 3ONEA 1R4AA 3ZJ5A 4MP6A 3MAGA 3R9KA 5KSWB 3SF8A 3OQ6A 4ILKA 3N7AA 1KY5A 2OOKA 3GK3A 4GMFA 4NYJQ 5DX0A 4MV5A 1T4GA 4NTZA 4ZZ3A 2APJA 4PX9A 4RCYA 3B5EA 4ZT5A 1ZM7A 4AD8A 5A9TA 1L5LA 5KMGB 1O3YA 1UBCA 5L7WA 3R0XA 4D80A 2I1WA 1V8PA 2HKIA 3BJZA 4TV9A 4X84A 4XI9A 5IDQA 1H1TA 1QPBA 1WEKA 4U6SA 2XUHA 1SVMA 5DW3A 1R27A 5U9CA 1FMJA 2LCIA 1TM7E 2DH6A 1C1YA 1IM8A 1GUAA 3GJ8A 1USKA 3ENVA 3EGWA 4QYSA 5HBRA 3VSCA 5K0EA 1KDRA 2ZWOA 4DUZB 3FRJA 3O9MA 4NMMA 1A2BA 1HC7A 2FUG1 3E9RA 3WK9A 5LWQA 3GHYA 3WGVA 1M5UA 5I01A 3T38A 4PBSA 5CJ2A 3KEMA 1DAIA 4JEMA 3PX7A 1E2KA 3TIGA 5CLGA 2EQ5A 3ZY3A 4LVNA 4AZWA 3EVCA 4YI3A 1UWCA 2KX7A 1MORA 1WP4A 5CP8A 5TS2A 4F1WA 3HGMA 2ZVQX 1VG0B 1RWQA 4PC7A 4FPXA 4U3JB 4H77A 4GKVA 2ZB8A 4WOPA 1VSUA 2YZ7A 5FEMA 1JKMA 2LDBA 3A4VA 3DT9A 4IUYA 1VA5A 1XL1A 5C5EA 2NYUA 1L5YA 3LFUA 3UAXA 4P4IA 3R23A 2QYSA 3HY4A 1XF1A 2ILTA 1DIGA 3UHPA 2EJCA 4AQYB 1CUWA 3GLVA 2GCGA 2GEBA 1E5QA 1UDAA 2ZB7A 5F73A 2WZBA 4R0MA 3IAM1 2NWQA 3LMKA 3DBLB 4ZKDA 1S2OA 3JQFC 1PLKA 4UDYX 3L7YA 4ZIRA 2JAQA 2C92A 4I4CA 2Y6VA 5ICEA 2EHDA 1GGKA 1YVDA 1O0BA 4Q4AA 4IILA 3ONWA 1BWSA 2A7XA 2ECKA 5GZ1A 5C8XA 1VFPA 2DUJA 1BXGB 3AERB 4O3MA 1L5RA 2RHDA 3I62A 2PJRA 2IS2A 2V3CC 4Z7OB 5JBQA 4FCCA 3ONVA 2TYSB 5KUTA 4JI1B 2OY0A 3LTEA 3DLCA 2PSDA 2W2VA 1JFVA 1NHWA 1P8AA 3HM9A 2YXBA 3LPAA 1NF2A 2IHJA 4Q47A 5DMXA 3RU7A 4G8BA 5C1BA 3RV3A 5I7OA 3UA3A 2FV8A 3S5UA 4LJ4A 3KJEA 4DLLA 4GE0A 4BGUA 1HEIA 3R74A 1A9QA 3TSOA 2EF1A 2AOVA 5CNMA 2ZUCA 4OBXA 5TQVA 1S4MA 3U3XA 1X86B 3X2EA 1ATIA 3KOOA 3W04A 4I4NA 2OLKA 3DW3X 4BU0A 5A4IS 3BMQB 2GOYA 3EEIA 3FI9A 3K6RA 4QELA 3VH4A 4A6EA 3JALA 5A1JA 2E5LB 4R7TA 5E1BA 5FCDA 3DLHA 4HX2A 4H4CA 4DRZA 3E05A 4JXJA 2RKWA 2G0TA 1HLDA 1H2YA 3HC7A 4Y18A 1G21A 4S2EA 1P7WA 1M9NA 2B8NA 4F3CA 4YT4A 1KY2A 1S2DA 1U99A 1WV0A 2IYAA 2VZLA 3I2KA 2CNKA 3M5CA 4K6MA 3CKYA 4M8NE 2HQ1A 1NVEA 4PC6A 5AM4A 2FN9A 2ZSDA 2BMVA 5ESRA 3UMYA 2D1TA 1NQVA 1K5HA 4GWGA 4ZMSA 3ITEA 2D2VA 2FX3A 4KIFA 3LOPA 4MRSA 3CIFA 3P9YA 1V5FA 2ZT5A 3GFFA 3GLGA 3V1LA 4YV2A 5L3QB 2SCUB 3NANA 4G5OA 2DERA 2WYWA 3K5PA 1R6TA 3SMQA 1SK9A 3UJ9A 5LIRA 3R9WA 4HXYA 2XNSA 4YACA 4EFNA 3GCZA 4PZDA 3JRXA 3F6SA 4QL3A 4GL2A 1DFIA 4LHXA 2FVXA 1QIHA 1IN5A 5G41A 4D3XA 2UV8A 1U2GA 1GUFA 4DIKA 4IX1A 4NOMA 1R0XA 1Y6JA 1DJOA 3FROA 3IEIA 5IULC 4R7GA 3TL6A 1HKHA 1BDJA 4PCAA 2VPZA 3RGWS 3TJRA 4BUZA 4DBLE 4YDHB 4RF4A 3BGIA 4DCMA 1POXA 4P92A 1JEYA 2ZWPA 3CZAA 3A28A 4HAVA 4N3AA 5KWVA 4XVQA 2WSIA 3KPWA 4BPBA 1A5BB 3H8WA 2P2ZA 4EMBA 2CJWA 2I4IA 3BC1A 1LFDB 4KE9A 3FPCA 1H3FA 3PJRA 2IPLA 3MSCA 3KD2A 5FOVA 1AKYA 3QOYA 1PWXA 1UP7A 2JIQA 4C8PA 3PFKA 3BD6A 5TJ9A 3KAQA 3KRVA 1UBGA 1HG1A 3MC1A 2DSNA 3AOEC 3MG9A 4LBYA 2WR8A 3ZGZA 2WWFA 4L4YA 1QZXA 3HP1A 1BTOA 1DKUA 3LRPA 3RUHA 2UVDA 3O3MB 3JQAA 4X71A 5C37A 2C61A 3RT9A 1D9XA 2OD9A 3AV0B 3INRA 1AG9A 3RRXA 5C3UA 1GJRA 1NLFA 3DHVA 2F1KA 5HCUA 2PVPA 1TMYA 2GA8A 3A6KA 3DUFB 4MUGA 4UFNA 4CM9A 1Y4SA 2PVWA 3K2QA 4NNPA 3O95A 4WBSA 2O3SA 4EHFA 5IKXA 4QGAA 1AX9A 2B7BA 2F8LA 4D8VA 1Y4AE 4HGRA 4PCLA 4WBXC 4D3ZA 4DR6B 2C6CA 3T5GA 4DBVO 4XFKA 5DBEX 1RI4A 4GOXA 5AJTA 2F43A 3GLSA 4OMFG 4A6DA 2H59A 3CLSC 3CBGA 4F5DA 1DRVA 2BONA 3PI6A 4PF1A 1GQRA 2H16A 3BTSA 4JKYA 3TLZA 3WQSB 5FP0A 1CRLA 3PD7A 4RMNA 3CX4A 4CMJA 1GVNB 3TTTA 3MJDA 4QC2A 2QM7A 3RR2A 3OFVA 5F1PA 5H70A 3MWGA 3TMKA 5JCJD 4B31A 5DFAA 1OZ0A 2BFWA 3B1XA 5JZSA 3HJNA 1W29A 2HRBA 4H60A 1U2TA 2N0SA 1M6HA 1Q95A 1XCOA 2Z2YA 4J0QA 5DVZA 3W1WA 2X8LA 4PGFA 3HB7A 4IXMA 1DCTA 3GFRA 4DSAA 4DT1A 3JATB 1FS5A 4H3SA 2KWIA 4HAOA 3PGJA 3F4KA 3R8FA 1H2ZA 1ORTA 1URPA 2R8BA 3C87A 3GAZA 5CT9A 2O8EB 1CK4A 3PNQA 3KYIB 1PVOA 2K4MA 3RF7A 2G1PA 3CVXA 2PGIA 4RJIA 3OCZA 2P0AA 4U1RA 1YTUA 4WI1A 3RRYA 1ECJA 1W94A 4XOIA 3IEKA 3EWAA 2PMCA 2XYVA 4J0NA 2LR0A 4C3OB 3ECCA 4DJTA 1D8AA 2R6AA 1BXZA 4J16C 1SWVA 2BY4A 3VHQA 2VJCA 4W9RA 3NTOA 2D7JA 4KMMA 3LQRA 2CV2A 4W6ZA 4ZT7A 2FSSA 2FQ1A 1RBZA 1V4NA 2CYBA 1YR8A 3UK0A 1IJKA 5D8DA 5IANA 5K0ZA 1KRWA 1P45A 4JC4A 3IQZA 5YASA 3VM6A 4J0JA 1NXQA 3ELBA 3F49S 2VUSA 4M1ZA 3TOSA 3NO4A 3CNQS 3JAWA <