5F5XA

Crystal structure of s116a ba3275 with amp bound
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
344
structure length
344
Chain Sequence
AMLIKPKRLQAGDIVATVSPSWGGAGDSEIRWRYEQGVKRLEEVFGLTVVPMPNSLKGSEFIYNNPQARAEDLMTAFQDTRVKAIIANIGGQDSIRLLPYIDFNAIRENPKIFMGYADVTISHLFCHKAGLSSFYGPAILTDFAENVEMDPYTVEMVNRTLFSNEMIGEIQPAPEWTSERLEWIEINKDTRRTMQQNNGYELLQGSTTVQGRLIGGCIEVLEFAKGTELWPEKKHWEDSILFFETSEDHPEPSYIKYWLRNYAAQGILQKAKGIIFGKPKDEMYYEEYKHEILQVMKEHNLEDLPILYNLNFGHTEPKFILPYGSMAEIDCENGSFSILESGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MccC family protein Ba3275
publication title Crystal structure of Ba3275-AMP complex from Bacillus cereus ATCC 10987
rcsb
source organism Bacillus cereus (strain atcc 10987 / nrs 248)
molecule tags Hydrolase
total genus 108
structure length 344
sequence length 344
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02016 Peptidase_S66 LD-carboxypeptidase N-terminal domain
A PF17676 Peptidase_S66C LD-carboxypeptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Class I glutamine amidotransferase-like 5f5xA01
3.50.30.60 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 LD-carboxypeptidase A C-terminal domain-like 5f5xA02
5K99A 5F1YA 4EYSA 3G23A 5JYBA 3TLEA 4JVOA 3T5MA 5FD8A 3TLYA 4E94A 2AUNA 3U1BA 5F9MA 3TLGA 3TLAA 4E5SA 3TLBA 3TLCA 4MI1A 3TLGB 5F5XA 4MJXA 2AUMA 4IIXA 4IIYA 3TLZA 3TYXA 3GJZA 3SR3A 1ZRSA 4INJA 1ZL0A 4H1HA
chains in the Genus database with same CATH superfamily
3WVNA 3OCUA 1FS6A 1VG9B 5T4BA 3NOOA 5T8KA 1BX3A 2EJTA 1UP7A 2QTLA 4P7FA 7ABPA 3PXGA 3HPQA 5DTRA 1FVXA 4NE9A 3HI6A 1NP3A 2GJ8A 2XYRA 1FK8A 4N7JA 4LHWA 3CONA 2JHPA 2JIBA 4LMBA 1EWQA 2NV6A 2ZROA 2QXUA 2RGWA 1W35A 3KTAB 4GOLD 1PV4A 2JFUA 1J90A 3CW9A 1Y6JA 3C3YA 3THWB 1P3Y1 2HSGA 2PGAA 4NBTA 1MAAA 4JZKA 2Q4RA 2IEAA 4ZOEA 2J0VA 2XJ9A 4IWNA 1UBFA 2G80A 1T9HA 4ZIRA 3EVEA 3L7MA 5FP0A 5L8VA 1Y6FA 4RHFA 5AHOA 4FEYA 3V7YA 3JS5A 3JD3A 3EZ7A 3L07A 4CM5A 3CCFA 2B0CA 3ZJUA 3PQ4A 3BF8A 3MTEA 2KB0A 4ZOCA 3L06A 2XNDD 4M9XA 3OUZA 3HCCA 3T0IA 1DI0A 4DUPA 1SU8A 3UUEA 5A5GA 4IMPA 5FXMA 3INYA 4DWJA 2VDWB 3IJRA 4CF7A 1JHMA 1P8JA 3ZI7A 4B6EA 1JFFA 1TKBA 1ZPDA 5DM70 4MUGA 2E6UX 1G8MA 2XWBF 3MJVA 3IVMA 3BIJA 3ONDA 3P8ZA 4M0EA 3FYTA 4N40A 5DZSA 2JHFA 4MQLA 1MABA 3P4YA 4EI8A 4K26A 3G8BA 4Q03A 1EB8A 2WU8A 3OCXA 3GFRA 4P5PA 1UBLS 3CF0A 4IDGA 4N3AA 4RD1A 4IXMA 1KIAA 5DJ5A 2AHOA 4QSMA 3RTAA 2VS1A 2CXRA 4PYIA 1CF4A 4XQ0A 5MN5A 1MC8A 3C6MA 4PGAA 3FJYA 4YDRA 3K0HA 5FNZA 1WP4A 2PS3A 2VXOA 1N3YA 3UFXB 1PR2A 4RTLA 4HAOA 1YQUA 3RIXA 2I67A 1NQAO 3WJ7A 1L8AA 4KN8A 3HGQA 4LDAA 1L5HA 4G5RA 2BJHA 5MFZA 4I1YA 2HWWA 3DYIA 1I3MA 2Z4TA 2JI9A 3GLSA 5D6OA 3EIEA 4DLNA 4NCJA 5LMUB 3GELA 1GO2A 5CDSA 2DPMA 1OZHA 3Q7RA 1JXMA 1CUVA 1DEHA 3CUVA 4HEQA 3ED5A 4I8IA 4V0OA 2XNCA 1HM5A 1OWLA 1Z4JA 3CS3A 4LDPA 4TKUB 2AG8A 2IW1A 2WHEA 1YS7A 3L6RA 5DNYB 4QAJA 4YWHA 5GPBA 2BFMA 3UB2A 6PFKA 1W5SA 2I3ZA 1TCCA 2D0PB 1VRCA 3DFKA 5ETJA 4AU1A 4CTKA 4K0KB 1TC1A 4NP6A 1ICIA 5KYTA 3AUUA 5C8YB 2P9ZA 1XELA 1XK6A 2HCBA 1BX1A 4B48A 3BWDD 4D42A 3OQIA 4LCEA 4UFNA 1ORHA 3GUCA 4JQYA 3WXBA 3GEDA 1DUVG 2JK0A 4WH0A 3QFSA 4PAGA 1KR5A 1KE2A 3VR5A 1KQ3A 1BJRE 1JW9B 1N2ZA 1QWSA 1AF4A 1VCNA 3MMZA 4TMYA 3V2HA 3WB2A 2NP7A 3LUKA 1LZLA 2JCXA 3LG2A 1S96A 4GC9A 4PO8A 3LY9A 3A1NA 3TLXA 5EHNA 1NV8A 3RK0A 3WSTA 1SN7A 4A73A 1SCBA 4RIGA 5TT0A 1ONNA 3E8XA 2IY7A 1TQ6A 1YR9A 4BUCA 4XI9A 5F4ZA 1JIVA 1O96B 1VJ5A 2LNDA 4FGJA 4G1UC 4OQYA 2MTBA 2VSXA 1K97A 1G9SA 2F4NA 1DCMA 3A32A 3LUJA 4MQFB 2DUJA 4P4LA 3FY4A 4B2YA 2W5UA 4KYTA 4C1NA 1NVFA 3CTPA 1SXJC 4UBLA 1E9DA 2X58A 4Q4CA 2WJJA 1OJ7A 4IYRA 3SF0A 3H8WA 5LBIA 2GFIA 2P6MA 3QEMB 5DGHA 4P4EA 4Z7QB 3CN7A 4HNAB 4HGQA 3OZAA 4ZU6X 4XWOA 1BHQ1 2AXQA 2NG1A 3AXTA 1YL6A 3EC1A 3P9PA 5EI5A 1RYYA 2XKJE 3TQHA 1VLZA 4Y3UA 2Z9BA 2QORA 2EYQA 3W5IA 3AIIA 2ZJ1A 5HE8A 2HL6A 4IHJA 1BIFA 2QQFA 2C04A 2NXJA 4TLLB 1WV0A 3UG6A 3U7IA 3BTVA 3K6JA 4IY1A 4A8JC 5COAA 5IWAB 1VMIA 5CJJA 4ID3A 1KPHA 4F56A 1AS3A 1XQ6A 3VR4D 4EY8A 1Q0ZA 2CDRA 4F84A 1LKZA 3KD2A 4L0CA 3O38A 4J94A 1P72A 1XF1A 2I3DA 1P2FA 3L8GA 3ORQA 3QBEA 2EQ5A 3G7NA 3ZUGA 4M21A 1KK0A 3MB5A 2IGBA 1P39A 2QNIA 2VCEA 4H0NA 4BCBA 3DP7A 3EOAI 2XDWA 4HAUA 3OJFA 1TTHA 5G4KB 2X4DA 4IGEA 4IXDA 2J3EA 2JDIA 1DBQA 4R0NA 2PZEA 5CEJA 1GHTA 3HLKA 3OA0A 3B7GA 4JENA 4YUZA 2Z2YA 1FBNA 4BWYA 3IBFA 5GONB 3REQA 2AI1A 1XRNA 4AZ0A 5IDYA 1WUJS 1T36A 2P91A 4CCWA 2B98A 1A1SA 4LBWA 4MCHA 3W3AH 5A4FS 4RMNA 3SHTA 2V5VA 3RBXA 1U8FO 4UHJA 3LK7A 2WPDA 2F00A 1WW3A 2I5PO 2BMDA 1CY7A 2JCVA 1P4HA 2PCJA 2OPHA 1T6BY 1NVKA 5M04A 3DTTA 4YMSA 4V3BA 5J1TB 1U3VA 1R0CA 3PE4A 4B83A 3LT1A 1GGMA 1WNTA 1ZW1A 3GLTA 1BYUA 1MG5A 3OQHA 1T3HA 2ODNA 4X94A 4YAOA 3SQNA 2ZRDA 1TVKB 2IHUA 2UZ1A 3PDUA 1ADBA 1Y89A 4JCCA 3S2UA 4TZ6A 3F98A 4AURA 4P8RA 2OAQ1 1GPYA 1ZN9A 4CN9A 4M1KA 3FPEA 2HI0A 4UPEA 3OURA 3TBFA 3BWBA 3DWEX 4M22A 1YULA 3GJYA 4AWAA 5TV2A 3Q7SA 1KU6A 1U9YA 3DHWC 5DVZA 4BKMA 3QXHA 3VDQA 4J7UA 5KNBH 3HJNA 2Q1YA 4FFSA 5M3BA 5MDHA 3F47A 2EKQA 5GWXA 4UOQA 2O1XA 1MB2A 1AQ6A 5F7XA 2XHEA 4MWOA 3V46A 2QHXA 3IE2A 5F98A 3E9QA 4GFDA 2CXPA 2AEMA 1NHGA 2AOWA 4I1OA 4WVLA 1F2VA 2BZSA 3WFZA 4BMYA 4C20A 4Q37A 4XWKA 2FMTA 2VF5X 1XMPA 2YXLA 5LZ7A 3TTYA 4OY3A 2VTBB 1MC1A 1CJCA 3SAJA 3WGHA 3JQ7B 2WIBA 1H69A 1V5FA 2YHIA 3ABOB 1E6UA 3N8HA 1SCKA 3QK7A 3WO1A 1WZEA 1NUAA 2PMDA 4JJ6A 4K6MA 4RO0A 5AW7A 2GUGA 4Q93A 3EZ6A 4RXUA 5ULLA 3DMTC 3I72A 4INJA 2FHPA 4PR3A 1K7YA 4HQRA 3EXG1 3EE6A 2NSDA 4X6LA 1U3CA 1BHJA 1TQHA 2X4IA 4G63A 2ZRPA 4R16A 1HT0A 3ZYZA 3WADA 2YOGA 8GPBA 2P9BA 3OC0A 2ZB2A 4KRXA 4A82A 5JJLA 1KE1A 4M1QA 4OHWA 3I12A 1QIFA 4TMVA 2CHUA 1QRDA 1TJ3A 5C3MA 3HCOA 2VPIA 2QRLA 3JAMA 1BEZA 4CUKA 5AI9A 1CS0B 1C1HA 2GAJA 2HX1A 1MQ8B 1N1GA 4NE2A 3P0IA 1J2UA 3TAXA 4B3FX 1MT0A 2GN9A 4DQXA 1HK7A 4EOGA 1Z37A 1RKUA 1G6KA 3EDQA 3IB3A 3E9DA 1R0YA 3HXKA 3NHFA 4QOHA 1XOIA 2C42A 3BOSA 4BO1A 2C3UA 4E4YA 3TVYA 1KSHA 1QHNA 2KX7A 4ML3A 3KB8A 1S8AA 4MVJM 2W48A 3SJBA 1YQTA 2CYCA 2ZJAA 1PZGA 1NKVA 4PS1A 1WKBA 3HUEA 3PXCX 5E7MA 2MYUA 3KHSA 1CJMA 4BFLA 1VIDA 2QN2A 3FOZA 3ID6C 1SUPA 4NG4A 4F2GA 4DB4A 4LJ5A 2C5FA 1YR7A 4RH1A 5EG5A 3RJTA 3S1AB 2P5UA 4LDQA 9GPBA 3GLIB 1O0BA 1FTQA 2PD3A 3IIBA 2GDZA 2YNMD 2H4ZA 2WUDA 3UUWA 4MRMA 4BNKA 4BP9A 4UHDA 1TM3E 1A98A 5JTTA 1U65A 1ES9A 1LPSA 5FNVA 5DXAA 4EA8A 2O7QA 3E22B 2FPRA 1YFLA 4EW2A 3FMFA 4Y1FA 5LQCA 3CHYA 4MYDA 2ONZA 4LJAA 4W63A 1YCHA 3V34A 1O5OA 4OLAA 2IPOA 2OGSA 3WYDA 3VVMA 1WABA 4EPXA 2HJWA 3IWWA 4FMDF 1QSGA 1BWPA 1ZC4A 1BKSB 2PH5A 4FHFA 4I1VA 1EFRD 2WQZA 3AY3A 1PDWA 2JLSA 2D2FA 4KFRA 3WS7A 3DL4A 1PCXA 1NRJB 1EBFA 1VKJA 3JQQA 1CF9A 5KWSA 2BHNA 1SBZA 1UC5B 4I1RA 3AL0C 2CL7X 3CR8A 5TQ2A 2I91A 1TZBA 1XEWY 5P21A 1T35A 3M4XA 4L9SA 1ZGAA 4F06A 5D3MB 3U44A 3OIUA 5IH3A 4PNEA 1GU0A 1UPAA 2C7GA 1MTOA 2Q3CA 2BTQB 4JWKA 4Q6BA 4ZHQA 5TSDA 2IHYA 5IC6A 4YGYA 3VPCA 1POXA 3FYUB 5IK2D 2MSWA 5JYCA 4A1OA 5C1BA 3HVUA 3FUXA 1U0GA 3L8HA 4P44A 3SVLA 3ESCA 1EUQA 2PUBA 3COJA 5JCOC 1ML3A 3ORRA 1YC2A 3H5IA 1XL1A 4YUXA 3LV8A 1G2IA 2NM0A 1CQPA 4Z51A 3FIJA 4M99A 5E8RA 3FNFA 2BHTA 4CMCA 3ML1A 5KDOA 2ZVPX 2VJQA 4J90A 1OLSB 1ZD9A 2IJGX 2XNKA 1UK7A 1UODA 1AX9A 2XF8A 3A2KA 4P34A 8ABPA 2R8OA 1N57A 5IP5A 1WUIS 1RPTA 2Q2OA 3B2QA 3KKKA 4NS4A 1WCWA 2WM2A 3ZW8A 4QGGA 2VJOA 1GGJA 3FPGA 2GFHA 3QUQA 1ZIXA 4Q05A 1SPBS 3QLUC 5ALYA 2XXAB 4R1PA 1XTKA 2GILA 4HS4A 4KACA 5GV8A 2CYAA 4KG7A 1LNQA 4J0EA 4XIYA 4BJHB 4KK4A 3RU3A 1DCTA 4P4IA 4MV3A 1THMA 3ABZA 2X0FA 1UBJS 1WB5A 4PCVA 3WLPA 2BD0A 3TLEA 4D8YA 4C8UA 4C99A 3UAYA 3R44A 4B6SA 4E7PA 3QVGA 5FUMA 3SC3A 4EEZA 4UD2A 2Q5OA 3UT6A 1JR4A 1NQWA 2JGNA 5LZ5A 3PNBA 3SXUB 1Y1RA 1XI2A 2CUTA 3KE9A 1K3TA 2NUPB 4PAWA 5KREA 2QD5A 2VR1A 4KIJA 1F4LA 1TO2E 3MT8A 2NXWA 3K8OE 1Q50A 3BI1A 2HO5A 5SZKB 4LN1A 5CEEA 1CQIA 4XVRA 5CVDA 4CJXA 2UKDA 5A02A 2PMEA 2PZ8A 3M1YA 4WY5A 2PTHA 1ZONA 2PH1A 4KBGA 2I2FA 2R6FA 2JD0A 5K3DA 1IVYA 2WHRA 3PWSA 1J0EA 1T3TA 2JATA 3QOWA 4IO0A 7REQB 3GJRA 1S01A 2CFTA 3TQRA 1H2XA 1Y5NA 3FSJX 4YMTA 2D8AA 1NPTO 2DH6A 4TMTA 3F2VA 4G07A 2Z2JA 1GXSA 3OWXA 4UHBA 1TO6A 5K0GA 3QLTA 2XH8A 4N5NA 1TKCA 3UGJA 4OGFA 4F2DA 2A1TS 1QNFA 3CN9A 4C7JA 2BCEA 4RHYA 1T1SA 2CNWA 3SJFA 4TL6A 2L82A 5CD1A 1JSLA 1Z25A 4DC0A 1IVSA 4FBLA 2B92A 2POQX 1L5VA 3K4PA 1V7QA 2QT1A 5DNVA 4DCNA 4IDFA 2CHGA 3QLUA 4MKZA 1CE8A 4MYTA 3TR5A 2OBNA 4BE4A 3RREA 1GTVA 1Y7PA 1NW8A 1GZ5A 1QM5A 1RBYA 4OXYA 2WW8A 4W1RA 5C0OE 2VHCA 1E69A 1VE5A 3WRXC 5BYKA 1RABA 3OUUA 5T3UA 4B7ZA 2XRZA 2GZ3A 2WJIA 1G41A 4FYYA 1F0KA 3BXZA 1DJOA 3BH6A 1JE1A 4A7PA 4HQKA 1KRXA 2IU4A 1Q16A 5KHLB 5I9SA 1OH6A 3W4IA 4F6RB 2H57A 4MPTA 4DA8A 4RPHA 1OAOC 3DC2A 3W2TA 1SB8A 4R1LA 1E9SA 4UBNA 4UUQA 1WAMA 1FRZA 3TJZA 3FOEC 1MRSA 1NUHA 3TTVA 1GVNB 1R5OA 4B3JA 3ZE9A 4IQGA 1E3EA 3WRYC 2IEZA 4OC2A 9LDBA 3E27A 4P82A 4G0YA 2WWGA 3QUAA 3GGSA 1E62A 2A35A 4P35A 4ZQEA 1X7ZB 2HXYA 4HS9A 3PQ6A 1RVDA 4N3CA 4PAMA 5FWXB 4AJ4A 3KK0A 2EW1A 1L9XA 5JQGF 1Z2CA 4JJAA 1YK0A 3AHDA 4BFCA 3X1DA 2O07A 2VYVA 1TW2A 4OMUA 3QE3A 2VQEB 1LD3A 1KZHA 2AN9A 3N53A 4OQFA 4QOFA 5C32A 2FXVA 1SQGA 2WEKA 3CVJA 5TJ9A 4JH0A 1HYBA 1RWOA 4RAQA 1RQPA 2JBWA 2QYSA 3AX6A 3IAAA 4PHFA 4DRZA 5JSHA 1QJ4A 4QPDA 2VRCD 1D9XA 3HGTA 1I2DA 3G5UA 4FKMA 2CMGA 5L9AA 1XZGA 3QUCA 4WCVA 3MB8A 1TADA 5C35A 1T2DA 4E32A 4ZIRB 4OLJA 4HB2A 1G66A 3DTYA 3F7OA 4O29A 4Z9XA 4DDTA 1YHYA 3MWFA 2B5OA 5B4TA 2ZJ7A 2PGOA 4YYZA 4D4JA 2O1SA 4XGIA 3FJOA 1MKYA 1U0RA 3GV0A 3A1CA 2XBUA 3WRXA 4BLPA 3A0UA 3QM1A 4JNCA 3M4ZA 3T07A 2WNIA 2Y0EA 2CMKA 1DEKA 4AG5A 2B21A 4TTJA 3WNQA 4F93B 3M6AA 2W37A 3BGIA 3OJ0A 1AGYA 1W9HA 2P62A 1UZAA 5HOQA 4OP3A 4ZREA 5HM8A 1JFFB 2PIDA 1K7CA 2D2XA 2XYHA 1OAOA 3PEEA 1DPFA 1E2FA 1KO5A 2MSDB 1CY2A 3QVSA 5G40A 4FK8A 5D2CA 4L0MA 1U1FA 4YMUA 1MABB 1VTKA 4DJTA 4E3WA 1RXVA 3FAKA 3WRYA 1IY1A 2IHKA 3RBAA 4E5NA 1D5WA 1NXSA 5DMHA 1WBJB 1O8BA 1XVLA 2GJAA 4PAQA 2GM4A 1H85A 2D8MA 3RVPA 1UQUA 2GCEA 3EDMA 3HBAA 1FU4A 1M1UA 4DUGA 2V0GA 4BNNA 3TW6A 4ZMBA 5BORA 4IDAA 4JMPA 4D26A 1W4LA 2WD8A 3T5GA 1UDWA 1L5HB 1W47A 2WM8A 2X0NA 5AVXA 4IIYA 2GPTA 3HA2A 4PQGA 1LVHA 3RLIA 2XV1A 3VR6D 1RE1A 1JIIA 3NUGA 1LTQA 2HK6A 1CEXA 2JIZD 3KJFA 3LDGA 2W0SA 3W5SA 3RFVA 4AF8A 2Z8XA 4P86A 1J1ZA 4JLDA 2ID9A 5F7JA 5KAPA 3RRFA 2YWXA 1XCGB 2A57A 5JPDA 1SVWA 2XYGA 3BH0A 3WYFA 5B2ZA 4WKOA 2RSLA 1IY9A 4G97A 1Z47A 4XFKA 5DCLA 1T4MA 3LQKA 5E7JA 2F2TA 3OQIB 4IV5A 1GU1A 4PYLA 2NPFA 4CM1A 2CLOB 2M6LA 2CV1A 2AIRA 4RZSA 1QKJA 1EE9A 1I9GA 4H4EA 1CX8A 2J8ZA 1JG7A 1MO5A 3QY0A 4XQ9A 1U0HC 5A3RA 3LUAA 1XHLA 3JRNA 1ORIA 4MAMA 1GAQA 1X7WB 4D9BA 5DHAA 2C4UA 5IYZA 3OQOA 1UXOA 2FZ4A 1JDNA 3K4HA 4WEQA 2XWJI 5ADWA 2IH4A 1GTZA 1LNSA 1W8DA 3DV9A 3HYCA 4PIMA 1R12A 1J06A 2BGKA 2Z09A 3OKPA 1E4EA 3Q3IA 4EBBA 5BYAA 4KIFA 1UK9A 5EIEA 3D2BA 4ZCLA 4C5AA 1J4AA 2M6KA 4J8PA 2HK8A 3CZ9A 3Q7TA 4RVHA 1VJRA 3RVDA 4QPPA 2XE8A 3EUWA 1BCSA 5IT9A 3GLQA 1NY6A 2LW7A 3R5SA 3MILA 3ZH9B 1VYUA 3MOSA 4KDCA 4D25A 3CYFA 3I2KA 1RMTA 4MUJA 4LE2A 3DAHA 2FSUA 4RKYA 4DCMA 4DOMA 3G2HA 4IHJB 4YACA 3ZX4A 1X42A 1XFDA 3H7AA 3OAAA 1NC1A 2QRQA 4LY3A 2PKRA 5CGZA 4PXSA 1EP2B 4LF5B 1BWQA 2EVWX 1EQUA 2ACKA 5IF3A 3OKFA 2VPPA 1SMKA 3CKYA 3NXSA 4YJ2F 2NZ8A 4XIIA 1SELA 4BKRA 1EDEA 1M67A 2X0JA 1SUSA 3IEIA 3OU7A 4BGVA 5FEMA 4J2HA 4D97A 2XB6A 3DPSA 3MAGA 4QFDA 2QGFA 4RFSA 1BS2A 1A4RA 1NJ5A 4B7UA 1BX0A 4RDCA 5THXA 4DR5B 2GA9A 3DEZA 5HRAA 5EOVA 5E9AA 5BPHA 3LUPA 4QHYA 2YIVX 1R8JA 3EA0A 4R9RA 2PWPA 2O8CA 1A04A 1LU9A 3REQB 4KPGA 5DU2A 3LCMA 1U0LA 4AZ0B 4DADA 1T36B 4MW6A 1S2DA 3QI2A 4C8FA 3LC7O 2IPMA 5TLSA 5C4IA 3RK4A 4AX4A 5EMJA 1JDZA 1SHJA 1NU6A 3REFA 4C3UA 1YOVA 3WBBA 2B78A 4EG5A 4YRKA 1QAOA 4XKJA 3NPMA 5JNLA 5LQUA 1Q83A 3EEFA 3PNYA 5LYYA 4X00A 5IU6A 3SLKA 4P1ZA 1OWPA 3R23A 3KTOA 5JZMA 4PPQA 1BEEA 3A14A 2RHMA 4YALA 4R05A 3HP1A 4IDEA 4RCVA 4DJJA 2UZ1B 4OSOA 1W581 2X0SA 4C8TA 4CL8A 3IL2A 3VPAA 4JJFA 2VYFA 1Y0BA 2I1VB 5LZ9A 3VAAA 3LHSA 3MWGA 1FDIA 1ODCA 3IVCA 5CXSA 2CD7A 4YUVA 4UUBA 3GGCA 2J6BA 1NW9B 4DG9A 2H7YA 4OA8A 4XM2A 1K6JA 3AT1A 5DWQA 3TAHA 4DNPA 3EHEA 2OL4A 4G8DA 2VCHA 4S0ZA 2EERA 4U2BA 3SYKA 1TU4A 3OY2A 3ZBPA 2BFPA 4ZI2A 1PWEA 2BSQA 2VBFA 1TNDA 2Z43A 3BG5A 4QAQA 1P1HA 3D4OA 4KMSA 2NAPA 1RYNA 1EDZA 2I8CA 4GT1A 3G17A 5KJ6A 1FL9A 1M1YA 3OZSA 1ENPA 3AR4A 3LHFA 4G37A 4CMAA 2HU5A 4QEKA 4X6XA 1PHPA 3V8QA 4EYKA 4C85A 1A9XA 5LL6P 4NV1A 4Y9SA 1HEYA 1YJ8A 4P98A 3EXEA 2YHIB 2LCIA 4HQOA 5CW2A 1EFDN 3JTMA 4O4IF 3TX2A 3EBOA 1TYDE 3D1JA 3H2JA 3E8MA 5HIJA 2GOYA 4G25A 1IN7A 1GZ4A 5FUYA 3FCEA 4NZOA 2AQIA 4NBLA 2OPBA 5DULA 2AYZA 3I9FA 5B6IA 3TK1A 1YB7A 1DOAA 1MB3A 3DQQA 3DLPX 1X7GA 2OGWA 3KSMA 4R0MA 4E5MA 1CHDA 4R68A 5BNWA 1JEQA 5IYZF 3Q8KA 2ZEJA 2CXUA 1CRPA 3ZEIA 1BKDR 4LI0A 4AYXA 1DEAA 5AJVB 4RLFA 1J22A 3QP9A 2OM6A 4LJ8A 4Q02A 4LK2A 3MC1A 5ANRB 3ANNA 1DTSA 3QPBA 2IH5A 1RP7A 1JR6A 1H6AA 3P96A 1SVKA 3JQ8A 3KXDA 1JWLA 4PFKA 5AXDA 2AX4A 4DMFA 3HXTA 3PC3A 4DUZB 2CLHB 2GEDA 1L5SA 2C7PA 1M6NA 2PH7A 2I7VA 1XQWA 1OV4A 1NLFA 1W4AA 1VYTA 3C6XA 5H81A 1AM4D 3JYLA 5CU7A 1MAHA 2NP6A 1SQ0A 2JFWA 1XGKA 4CTJA 5AW8A 1E2LA 1JZSA 1YDHA 3BJZA 4UMDA 4HXYA 4MUXA 1Q2UA 4QD3A 4CKXA 3R7WA 1V7ZA 5K8LA 2KW5A 4YXWA 1V37A 2HMSA 1ZKMA 1TEXA 3KLMX 4TV9F 5HPYB 1U02A 1PQYA 2O59A 4C4OA 3RSZA 1CTQA 1C4OA 3GY0A 3SZGA 1NXJA 3A27A 1QRAA 1ZFNA 4OJTA 3TZEA 3X43A 3BXHA 3F4LA 4XB1A 2QLJA 3ITNA 4QQ8A 5FNVB 5LQRA 4TT3A 5AO9A 1ZIYA 4ZV9A 2FX2A 1QYIA 2OORC 1G8HA 4KMRA 3M6MD 1YQWA 4RY9A 2MSNA 3AOGA 4CMIA 3TH5A 1CIPA 5HFJA 1NHWA 1E2JA 3Q0IA 5ELXA 3SM9A 4F12A 1RW4A 1G8SA 2RB5A 3GBSA 1T24A 4DIFA 1WU8A 1AQLA 2YXEA 4H0CA 4JLMA 4TXHA 1EVEA 3AEZA 4ETIA 3IVAA 3FLBA 1A5TA 2GFQA 3HSKA 4WY8A 3ZE1B 3D5EA 1JYFA 1P3JA 3HU3A 1II9A 2NAFA 3BJEA 3PV0A 5TQ2B 2Z1MA 3WK6A 4OL9A 4AI6A 1HMYA 3A11A 1G3RA 3OY7A 3QEJA 1P1KA 2JIQA 5DW0A 3U44B 1RMQA 2RHJA 1X2BA 1R3DA 4D2IA 5ADHA 2R1TA 5A4JA 1XDSA 1ZD3A 3UC9A 2X2FA 3H1BA 3U3ZA 3ZD9A 1GT6A 2IOFA 3TOVA 1PL8A 2RGEA 1CUHA 2XT6A 2AJDA 3Q2OA 4JJIA 4CMEC 3OZTA 3HBJA 2B2NA 2PCNA 2DE0X 1QX3A 1XL0A 5F1KA 4UREA 1IJFA 4YMWA 1YH3A 3L18A 1BVHA 2JFZA 3PU6A 3IDQA 3URMA 5IDXA 4PANA 1DCKA 1UBMS 3PQDA 2DCUA 4QNRA 3G82C 3UUFA 1CUSA 2HT6A 2NUBA 3HWX1 5EVCA 5BSWA 1SHKA 5L7WA 4DV2B 4B45A 3ONFA 1U7TA 2IYPA 4CG3A 3K6KA 1JKXA 3JWJA 3MT9A 3UWKA 1P1CA 3SYRA 4P4DA 1MH1A 3GP5A 1IBSA 5DP1A 4GECA 1YRAA 3IURA 5KOHA 3Q3CA 4Z2AA 1MIOA 5AJHA 1NUPA 2EDCA 1Y3CE 2I71A 2WHYA 2Y2UA 3NTQA 3L7AA 4ZVTA 2OORA 3TQTA 4HQNA 6ABPA 1SK8A 1A8SA 1KVSA 3H9JA 2R4QA 3A6HA 3G5TA 2GO1A 1JG4A 1RYHA 2WKSA 4UBJA 2ZJ3A 2B5VA 3ZQUA 1VHDA 3K8ZA 5JFOA 4A0GA 1QUEA 3AJ9A 1G6OA 1SCIA 3QVGB 4L75A 5EIBC 4UNQA 4US0R 3TIIA 3TUIC 3U7RA 2C0PA 3NVKI 4A6XA 3B3GA 4GHWA 3EX7C 4HOYA 3IESA 3JQFA 1UAGA 3HN2A 3ESQA 3NM4A 1E1KA 4D96A 5IG2A 1W73A 2R2AA 2WZCA 1OYWA 5COQA 4DSOA 3QE2A 5AVQA 1ODSA 1EVJA 1QMPA 5EIXA 1CQIB 1EA5A 3DE1X 4BEWA 1QFYA 2O20A 4A26A 3L0DA 2V9PA 1O8CA 2GS9A 3LNCA 2FH5B 1N2SA 3YASA 2NT3A 4Z54A 3T5AA 4JY7A 4EY7A 1SB9A 1H1TA 4RL6A 3KLPX 2BRUC 1E7RA 2G7MC 3BQNB 3G2IA 1N5IA 1QVVA 2NNLD 3ODGA 4UTXA 5AESA 4C0XA 1RZRD 5EL0A 4X9XA 3ZCSA 5ERGB 1BSVA 1UEIA 4HNQA 2IS1A 4KAJA 2IEIA 1D7OA 3KE8A 3LX8A 5FAKA 2JD2A 1GXSB 1J39A 1E1QA 5IN5A 4JB8A 1UBHS 1Q0PA 4LMPA 3BFPA 5IABA 2A0KA 1OWNA 3BSFA 2IKQA 3MUFA 5EEHA 5JLAA 3A6ZA 5BW4A 2PLAA 2ZDHA 1KEPA 2J9ZB 3U3KA 3NCTA 1LA2A 4L4ZA 1N2CE 1V71A 4OOFA 5HUHA 1CFZA 4FDVA 3RHFA 4DLLA 2NZYA 1CE8B 1NBMD 2Z57A 2WVJA 3PVZA 2FUNB 5H8WA 2GSDA 5C8XA 4GDFA 2I6SA 4PX5A 4N48A 2PUEA 2QUJA 1RI2A 3N6XA 3ORYA 5DLEA 4ZYLA 5CDFA 1EM8A 3JU3A 1IONA 4MCSA 2YZGA 1CP2A 1XAJA 1YC5A 3CR3C 4I5DA 1FVHA 1EP9A 4K9MA 4DT1A 1JKMA 2R87A 2I55A 4WX2B 1Z39A 1Z5PA 4TM8A 4Y98A 3WICA 1JWBB 1DJPA 5IAJA 1C0PA 5CXXA 4NICA 5IBPA 5C5DA 1RXUA 3GJXC 1XD2A 4EY4A 1AGNA 1FLDA 2LD4A 2QUBA 4I08A 4PXYA 4BNZA 4FHGA 2FZLA 3HQ4O 1IULA 3UJ6A 2CHQA 1E79D 1YNSA 3I8OA 3FFAA 4KN5A 5GJBA 1DO0A 4TV8F 1IU9A 2OESA 4KR7A 4ENUA 1KMIY 1VCMA 3O3OB 1GY8A 2VUHB 1W19A 3C3XA 4B8YA 3U5ZB 2A1TR 4MK4A 2PHZA 2O8BA 3IVGA 4ZEXA 1M6VA 2RHLA 4TJVA 2YFKA 3ZVRA 5KNCA 2H65A 3OTIA 4WJLA 2JEOA 2IELA 5CFQA 1UAAA 2UDPA 5FFMA 1WCYA 3ESRA 3K72B 3N8DA 4X93A 4YRJA 3S8YA 3RC9A 4AKGA 4BV9A 1RRVA 3A3PA 5TC4A 4QJBA 2Q28A 1H6CA 3BE6A 2D0DA 1S2GA 3ENZA 3HCRA 3LPAA 4MKHA 5DBHX 2YHSA 4XWTA 3KZ1E 1ZXBA 4B3MB 1NF3A 4IINA 4ETNA 1AV6A 3ILSA 3SXPA 1GQRA 1RYFA 2V3CC 4UVEA 3ZCQA 2O3JA 4B85A 4BZWA 4YV2A 2WABA 4OQMA 4BE7B 1CVRA 3FDXA 4X3OA 1IIRA 2RG1A 3JQBA 4QXMA 4PBRA 4XLLA 4ZTBA 3DLTA 3ROGA 3H05A 4LKRA 4DDUA 5JAPA 2PWZA 1DO2A 2X9NA 3VPGA 3K9BA 3L7OA 3MFQA 3UV6A 1EFAA 3MRXA 5G1NA 3TNFA 4QG3A 3LVRE 4NR0A 1RYDA 2JB9A 8MHTA 1QFMA 2PVPA 1DT3A 1SUBA 2PVVA 2EJWA 2GD0A 4R6XA 2QY6A 1SXHA 5MF6A 1T34A 1ZL2A 4FB5A 1KWGA 3KVNA 2UV8A 4YMLA 5ICMA 4M8LA 1NMYA 2AK2A 3HCBA 4IJMA 4JUFA 2G1AA 5B55A 5CA1F 1M66A 1I10A 1E3IA 1BGXT 4MVJP 3GDOA 3EGWA 1O7JA 2ZRGA 5IKOA 2QTWB 5M29A 3SCZA 2M1XA 4OSEA 1ZAKA 3NUZA 4MIOA 3Q9UA 4QO8A 3D4BA 4FI3F 2GBPA 1KHTA 3T9DA 4E88A 5A3QA 4DA0A 2KLBA 5JSKA 2WQ6A 1PEAA 1GKIA 4I3FA 4F71A 1Z63A 3ACCA 1L4EA 1R5NA 2DBVO 2XKBA 3OPYI 4K9PA 4ZA2A 3S4YA 1TZ2A 2ET6A 4MAFA 1C4WA 3IUBA 2F55A 3GJ4A 5EMMA 3RADC 1YQ9A 5AM3A 1TAGA 4CLRA 4MUFA 4YP6A 2IXTA 3IEXA 2O48X 2XWPA 3KLNA 2IU6A 3LIPA 1K7SN 2YIMA 3OZXA 4D5EA 2ZI7A 4ZI7B 1VSUA 2BFCA 1HEIA 1G8AA 1GR0A 1GTMA 2XUGA 2HN9A 1YGYA 2XSZA 3BA6A 4QVGA 4RX1A 2EP8A 4NCXA 5IKXA 4I2VA 3UK6A 1XALA 4XUGB 3G9ZA 3SVTA 2C95A 4KO2S 2WJGA 3ONEA 1K8XB 5F09A 2A9PA 3DE5X 2WSMA 2UXCB 1XZNA 3EYWA 1RI3A 2QNRA 5J23A 4GPD1 3Q87B 1YBFA 3GWZA 1U31A 4QUKA 2GRJA 3THSA 2OWEA 4ND1A 5EHZA 5DYIA 2G71A 5K6AA 1QWOA 3IIKA 4P2GA 2ZR0A 2Y27A 4H27A 1DDGA 4Q5IA 1PVVA 1Z06A 1GGFA 2AN1A 2VUTA 4M9QA 3SIXA 2JHGA 2HNAA 1E4EB 5BWMA 1EDDA 4BEJA 2ZBRA 3PUWA 3DMFA 1DEXA 3R3VA 1QK4A 3H2YA 4QEZA 1KFKB 1ZMOA 5GM1A 4O2RA 4D7AA 4Q1CA 4CIXA 4MTLA 4CV0A 1BCSB 3IOYA 3L4SO 5I8PA 4YA6A 3W7VA 3WK8A 1SEVA 2ZKLA 3AJDA 2ATCA 3FMGA 5IJXA 2V3WA 3UAOA 2O3QA 1E18A 3WWOA 4KZKA 4IAOA 4X6YA 2YIJA 1BXRB 2A33A 1ZRSA 5LN1A 1DLIA 3BHMA 1SUEA 3W78A 1MJ5A 3MK31 2QW1A 4PYRA 2G28A 3R9KA 5AVVA 1KKLA 4OHOA 4Q7JB 1MEOA 5AKZA 2RGCA 4LJYA 4PO1A 1VBMA 2XR1A 4Q16A 1KORA 3TMAA 3WWPA 3DGEC 2IXFA 1W4RA 3EZ2A 2YC2C 4Q7EA 4UCFA 3WZMA 4GGMX 3DR3A 4RFSB 4S1WA 2Y1LA 3W34A 4DLWA 2XECA 5P8WA 3RYTC 3GRKA 3WYEA 4CG1A 1T1GA 3SP1A 4DWVA 4WAUA 3DR5A 3G2NA 2G67A 5BMVA 3VR3A 3O8BA 4A8HA 1E66A 5KJEA 3ICOA 2GJSA 2WJAA 3NM6B 2Z2ZA 3V8PA 1H65A 4BTLA 1H2FA 4LWPA 2FVXA 2P1RA 2PRIA 1P4SA 1JHXA 2ZRCA 3DQPA 3I2JA 2IUYA 3JVEA 2CUNA 2V0CA 2YVLA 2LIVA 4H3VA 3NASA 4JBWA 1OI7A 4M46A 4WNCA 1QP7A 1TPYA 1J20A 1R00A 2NTEA 4Q9NA 3D7FA 4L15A 2Q1WA 3NG1A 1B8VA 3S2ZA 1FSSA 5IEBA 5HGXA 1YOVB 3ABIA 3NV7A 3O4RA 1FDUA 1NN1A 4ZT4A 1H2HA 3P5BA 5CVVA 4LOLA 1YAHA 1UPTA 4R3UC 5H3CA 5LLSA 4DWWA 4WECA 3UICA 3QMVA 4DA6A 1CIVA 2FWRA 2VBGA 3DV0B 4YGXB 4MPPA 5H16A 1P2BA 3OMLA 1CB7A 2JRLA 3PC6A 3CZMA 3RIEA 3ICQB 3OEWA 3Q7EA 4F38A 2KBEA 3BXFA 1SEPA 4CG0A 4O1HA 1MW8X 2P2GA 5FBKA 1XYVA 4KLAA 4ZODA 3U81A 2A8YA 1DMSA 2K7FA 2B99A 1T0IA 2CMHA 3HB7A 4KI0A 1CZUA 1W1WA 2GR9A 4PSDA 4UVHA 3T3NA 3AF0A 2GJ4A 2EBHX 2XZPA 1OU0A 1FJGB 3C8OA 3K2BA 2YV3A 3UJNA 3E6AA 3DEHA 2FZEA 2W70A 4E5UA 3HA7A 4ZTZB 5F9HA 2EKPA 2H54A 3NYWA 5EQJB 4D79A 4E09A 4V1CI 5EPUA 2X1HA 2OCXA 5ALNA 4D8TA 2BSAA 1NR5A 3LKZA 2R5FA 5GJWC 3TOXA 5C18A 4BWVA 2EWWA 4QASA 3KC2A 1M1YB 2DQYA 1RHUA 4FFBA 1A7KA 5GMOA 3ZIAA 4F5EA 1MZPA 1M8FA 1VPLA 1ODLA 4I6JA 3U17A 1A9XB 1B15A 1PJBA 1KSGA 2AJBA 2B8TA 1IWOA 3RUEA 4AJEA 5CFRA 3KUCA 2XLCA 1YFKA 4KL8S 2V58A 3B1FA 5I7WA 4LY0A 2JVIA 1C9KA 2CNBA 1OASA 1Y4DE 1SNYA 4PICA 4BLRA 4E12A 4W4TA 2GVDC 4R51A 2Q50A 1FUIA 3GK3A 1TM2A 3KOYA 2X1MA 1PK9A 1SBCA 3CEAA 3RRJA 1DNPA 3DAPA 2QQ5A 3D6MA 4D4HA 2JLCA 1JEQB 1JFVA 4HVAA 4JX8A 1GPDG 3KIPA 4PHTA 4DSAA 1OPXA 1ENZA 1FYWA 2BEKA 4R2WA 4PE5B 1U9IC 1X1BA 2GN0A 3N8NA 3HB0A 2HBZA 3V7FA 1IK4A 1CEQA 1IRIA 2JLQA 1A5BB 1DTEA 2AA3A 3PIRA 3WLMA 2C58A 5HS6A 4LFCB 2GJ9A 5HBGA 2TS1A 3MJEA 5HKBA 3UKDA 4IH9A 4EA6A 1FXWF 1DBVO 1XCPA 1SUCA 2ZCVA 4EF6A 5BMVB 3ZHQA 1JQEA 4JWTA 4ZPJA 1W30A 4PIVA 1W36D 2Y68A 3A26A 3MCUA 1JALA 1U7UA 3TOSA 3GCDA 2DERA 1G21E 3R7WB 5A5DA 3TQCA 2VBIA 2RI0A 2DFLA 1ISFA 3EPPA 4LBZA 3VMFA 4Z5XA 3ADCA 2QJWA 5JQGA 3JZFA 2HMWA 2B35A 4LOKA 4XFJA 3GFQA 2HA4A 3V9AA 5K0ZA 1ORVA 3OPYA 1XX6A 1JGTA 4DMMA 3ZCUA 2QRUA 2WTBA 5EUMA 4D9HA 3FHLA 2WWYA 3F8WA 4CMIB 1G6HA 2QGNA 3MGCA 3R9WA 1MFZA 3LFHA 1RXCA 2YBDA 4BASA 4GI2A 1KAOA 2PKYX 4W82A 2OZKA 3KQPA 1V2HE 1TJ5A 1OXMA 3NOQA 3P9SA 4MZXA 4CWAA 6GPBA 2QPTA 3NKVA 1IN6A 1QF9A 1FQOA 3PGJA 4I4TF 4I8DA 4JEHA 2I4MA 3UOGA 4U6NA 3ZJ4A 4GM1A 4EJ0A 1A9TA 2J0UA 3F6PA 5LJIA 3T6KA 1M34A 1SCQA 2PFSA 5E2IA 4H08A 3R6WA 3LK6A 1W0CA 3BF7A 2YBEA 3PC2A 1NZFA 3KL4A 4QGBA 3WYCA 4C3VA 1BCRA 2X23A 4RGBA 1A9QA 2CFIA 3MOIA 2HFKA 1F8GA 2GMWA 2F64A 1W76A 2R1TB 3HB4X 4N54A 4AG3A 5IVHA 5F2NA 1PJCA 4Q9JA 1NYQA 1C7EA 1E2NA 3BWXA 3DE2X 2NZVG 4PG4A 3AO0B 5FA5A 3ZV7A 4KWHA 3RS3A 1IZ8A 3M6IA 1RC8A 1YQQA 1G8GA 3CVVA 3FETA 3SC2A 2HDWA 3BJRA 4JUBA 1RPNA 1Z16A 2MCFA 1OPRA 1QGUA 4D57A 4XRGA 1UWKA 2ODQA 4KVGA 4RHXA 3GF4A 3T34A 3TNLA 4L0DA 2PKXA 1MW9X 1P6XA 2VK1A 3FD8A 3RF7A 3COYA 4L95C 3ICPA 3PKZA 1T26A 3WL8A 3SYLA 4R69A 2IU0A 4P4JA 2Y71A 1HYQA 2ZIGA 4PPGA 3D3NA 1D8AA 3B7PA 1S3GA 1F48A 1WZNA 2R6JA 5DM4A 3UXHA 1BE1A 1M54A 3IIIA 5KOHB 1MIOB 1THTA 2HQOA 2J9FA 3OP1A 3I8XA 3NC1C 4P3XA 4AD8A 1JMVA 3KQTA 4PTLA 1WY7A 4FS8A 4GI3A 2H1HA 4V03A 4ZOLF 1CEEA 3RU2A 4COGA 4HNGA 2I62A 3FGOA 2FK8A 4JBLA 4KMMA 4CFZA 2HJSA 2WWTA 3BGVA 1G59A 1MO2A 4K0RA 4K81B 4QARA 2Q7XA 2WSYB 4Q0MA 4G5HA 3C14C 2AYYA 2YV5A 3D6AA 3R6GA 3GLGE 4B82A 5FRDA 5AQ1A 1T5DX 2XCOA 1YDMA 3NNNA 2LVBA 2QE7A 1CKEA 2MSEB 2YASA 2WA1A 2QJFA 4JYAB 1XNGA 2DKFA 4O0MA 3UJPA 1P2TA 2EF0A 4MV1A 3HBNA 4ZAXA 3ANLA 1NPYA 5CFPA 2QZSA 3NB0A 4L4UA 5EE1A 2O9JA 4A2QA 4B75A 4YRNA 4OMFG 3VJRA 3HRKA 1N4AA 4GL2A 1N2OA 2D3TA 3KKOA 2D62A 3VKFA 3ZQ6A 4FC6A 3RWBA 1XD8A 5BSEA 2EBWA 2Y66A 5BWOA 1NL3A 5ENZA 4IJWA 4M1EA 3MQFA 2ZB8A 5BWCA 4F45A 4JROA 1J33A 1OU4A 1XLTC 2A0XA 3CRNA 4QATA 4DYDA 1X80A 3Q10A 4RC9A 5LQSA 3RV3A 4NFSA 4DBLC 5CPBA 4YIHA 1JVBA 2O8DA 4E08A 4QLOA 1E5TA 1NJ8A 5AUQA 5D29A 2QW0X 4F9EA 3KHTA 2RC5A 3L8DA 3DJFA 3ESYA 2G5CA 4MVJH 2P9TA 5KYXA 1N6OA 1V7CA 3MUNA 5E3JA 4K2AA 3O4JA 4C08A 4YQYA 4PY2A 4TSRA 2Q07A 3FZQA 2GWHA 4PSAA 3SIWA 2O6HA 2BFNA 2PT9A 4C9AA 4L3VA 2B0JA 1ID1A 1RRFA 2WKPA 1QDUA 4YJDA 1QO7A 3IO5A 4HDSA 1JDJA 2BF7A 1JMYA 1H0KA 4LF9B 1T3SA 4L28A 4Y9DA 4K9RA 1TQDA 1B0PA 1LCIA 3H4VA 4G5YA 1RQRA 2V5AA 4JZYA 4UEOA 4UEJA 3ZWQA 4C03A 3T61A 3JD4A 1H2AS 3SYTA 3ZE6A 2OCDA 5EXXA 2I22A 4RD3A 4YJ2A 2HTFA 1G2PA 2HZ7A 1AOXA 2XMCA 2ZRKA 3QE4A 4HB0A 1GPUA 4N9QA 5PGMA 3JQEA 5ESXA 3JVVA 4R9VA 4V1CA 1IUPA 3ZE7A 1ZI8A 4KQWA 4N8EA 2FZVA 1EM8B 1CUUA 3IAEA 2FUG1 1DAMA 1GDHA 1TQ8A 2FMUA 3I5AA 1KQOA 4FGWA 1ESEA 4DT1B 4ZDJA 1RD4A 2Z83A 2HROA 2W6ZA 4BLUA 1A97A 3EARA 2AFHE 1HOXA 4BP3A 2RI1A 5LDGA 2C7QA 1UMKA 4HDAA 1XD2B 1GIAA 3U56A 1Y8AA 1ZMXA 1SZCA 2SNIE 2A5JA 1EWTA 2HHAA 4S05A 3I2GA 4RY2A 5EERA 3IEVA 4HP8A 1XLTA 2C5GA 4REMA 3ZDDA 1LQUA 3HWRA 1A96A 2KI5A 4MMYB 2OP1A 3EMBA 3TCKA 5KINB 3VAZA 4DIUA 2DKOA 2WVGA 2XYPA 1C3OB 3C3BA 2WYIA 2WB4A 3K05A 2D5BA 8AT1A 1RWPA 5TVGA 3ZDFA 5IKMA 2BBSA 4QOGA 2FMFA 4IMRA 4KXMA 4DIBA 4DLBA 2GBCA 1OT5A 1ZK3A 1G8YA 2RHOA 1F20A 1M6VB 1VSTA 2QU8A 4KVAA 4MUMA 4ZVUA 5IFLA 4YP1A 1T8WA 3K0CA 4TWAA 2J3MA 1RACA 3VJMA 1B8UA 2V7QA 2ZT8A 5AKKA 4V0NA 3BC1A 2O0MA 4LYDA 5HKAA 2OG1A 1RJGA 2OKGA 4J7XA 4M9ZA 2QL7A 2ZUUA 4OKIA 5KX5F 2PVSA 1XSEA 2B83A 1UUFA 1FFEA 4N65A 1R0XA 4QFBA 3DMHA 1GARA 1YRQA 1RM3A 2ATIA 4RQAA 3TGLA 1S7CA 1QB8A 4PLZA 4AYTA 1K4MA 5IS2A 1HNNA 2BEUA 1K5DA 3AP1A 1IMJA 1YB4A 5B1IA 5DI9A 2QX4A 4D8XA 1YIDA 4OB6A 3Q6IA 3WRWA 3JQPA 1XTIA 1PX2A 4HEA1 3AF4A 5K3SA 3W9BA 3QJYA 4EUKA 5F3WB 1N3BA 1OWMA 1GOTA 5DT9A 4WGGA 3TLYA 2MYPA 1M33A 2CZCA 1C8VB 1KO7A 3LVBA 5DIFA 4DS3A 2AC4A 4B1FA 3NXKA 1A69A 5EQDA 4LIPD 1F4PA 1ZHOA 4O4IA 2VP4A 4DV7B 4PRLA 2ZJ6A 4H7KA 2IA5A 4EO9A 3N2LA 3WB1A 4EAQA 1THGA 2FY8A 1KVUA 1IYZA 1TDJA 2CJWA 3NU1A 1X8KA 3MJCA 4NOMA 4BNMA 3MGGA 4YUAA 1YBVA 3GP8A 3K6RA 5CPFA 2QX8A 1U1DA 3V7NA 5EHXA 4G89A 3QKWA 1SKQA 3ZWMA 1NE2A 3LWNA 5JFTA 1GYQA 4YRMA 5DNWA 1RPZA 3H5WA 4IDQA 4IZHA 4ND7A 4QQFA 2JCBA 2RH8A 1XQXA 3G23A 4OYYA 5TX7A 2Z6QA 2F1JA 3EASA 5EKDA 1HE1C 1QCYA 3ZNQA 3LQ1A 5NLLA 1C30A 3Q2KA 4WZBE 1Z4KA 1V3UA 3RANA 3Q9NA 3TDKA 4YR9A 1VMAA 2WG2A 2DFPA 4WZAE 1NVBA 4GPTA 1AV7A 2BFCB 3B1VA 4OI1A 1VE9A 1SHLA 4HGZA 1RJWA 4LNUB 3SR4A 4BFTA 1U6JA 4ICIA 3KSBC 4BNVA 4EPVA 4LF4B 4O4LF 3NR2A 1YZKA 1PRYA 5ALHA 3DFIA 3FF4A 4W8OA 1C8LA 4C0HA 4DCUA 4UU7A 3C3JA 5KKAA 3OE7A 4BATA 1WQ3A 4L9WA 1RCUA 4YRQA 2HD4A 5BWNA 1Y7TA 4Q3EA 1CG6A 1YHNA 4TV9A 3CF6R 4D44A 2VP9A 3GG2A 5TPWA 2PS9A 3A9VA 4WXYB 2PJUA 1RQ2A 1GP2A 2H85A 5JO9A 5JMWA 3U7GA 1XNQB 1PE0A 3WZ2A 3CG4A 1UINA 1FQWA 1KDRA 2XOKD 4HX2A 2HCFA 4UVIA 5EP1A 4F21A 4WQMA 3IJEB 5JZ9A 2JK1A 1YVRA 3ZHUA 1MIHA 4PSUA 4RPLA 1JEAA 3HLYA 3VC2A 1ONOA 4K6KA 3FWHA 4ND2A 4RJIA 4CIDA 4FMDB 4D9NA 3NO4A 1QH9A 1GN9A 3WWCA 1UIMA 2XB8A 3AHHA 1ZX1A 1R6UA 4PZCA 5EZ6B 4E7OA 2Q5CA 2HBYA 1DG3A 3AP3A 1LW7A 4IDCA 3GPBA 4JX9A 4M8NE 4MUBA 5HIIA 4Z1OA 5F64A 3HU2A 1B73A 3E7FA 1GUFA 1Z8NA 3NEJA 2IY8A 2A1IA 4FFWA 3ZJVA 4TYMA 1LPMA 1ZM4A 3AR3A 3EUFA 3OIWA 4YS6A 4FYKA 3FA2A 2H07A 4P92A 5KMGB 1UP4A 5JS7A 4WW0A 2NZ2A 4BMNA 4MDFA 4NFLA 4KSCA 4ZV7A 4J3NA 2RH4A 1NJ2A 3BFKA 3P9QA 4WXPA 3MJHA 4D4MA 3CRQA 4V0LA 3ETGA 1PNRA 2N1BA 1VBKA 2QX9A 4J0JA 3WC4A 4IEFB 3CTMA 1JXQA 4X7PA 1QCDA 1JHDA 1OIXA 2IP1A 2Y9MB 1HY3A 1TYEB 3EVNA 4B7CA 4NCIA 2DXIA 3F4KA 1SVMA 2VJLA 3PTZA 5CGQB 3NMUF 3TLCA 1T1EA 1N34B 3DDWA 2GZMA 4LOIA 4JI1B 2QRVB 3D0KA 5H68A 2OZPA 1YRHA 1W5TA 2X86A 4RTRA 2EFHB 3H2KA 1T25A 4H4CA 4DM4A 3ILXA 1ILEA 3K20A 3OWOA 2G0TA 3OCCA 4L4YA 3AUFA 4AWXA 1P0PA 1GG5A 1U4SA 2EJVA 2RARA 3OM9A 1PWYE 1I3CA 3EWAA 4PZEA 3VJLA 4BKQA 4EKEA 4HRAA 3EMKA 1HGXA 1V9LA 1E2EA 3CUYA 4EB0A 5L7TA 1Z56C 2OVFA 3LM8A 1W0JA 4WUVA 2IVFA 5AKHA 3C43A 3PFWO 2F8TA 1CQXA 3LCJA 3PR2B 3WGUA 3ZX5A 4BRWA 4KN9S 2W4IA 4GBMA 4IQFA 1XVVA 3CBGA 4Y6LA 2Q7OE 3ZU2A 5E7QA 3TN7A 2CXHA 2RONA 2DPGA 3O83A 4BZXA 1L4FA 2G17A 4RKEA 5H4GA 3DLBA 4L2IA 1ZITA 1P1FA 3KT3A 2WJHA 1N25A 4C0BA 1NXVA 2IV2X 1YMQA 3IKLA 4P4FA 1MAVA 2GLXA 3HRHA 2CHEA 1CR1A 1DEOA 1JS1X 4EHHA 5JWRA 3QYJA 1LWOA 3BICA 1E7YA 3OCZA 2ZVJA 2XUPA 3DVAA 1U2EA 4IILA 2OUKA 4L27A 5GY7A 1GZ7A 3S28A 5K0JA 4IFBA 3RBUA 2H9AA 5G1PA 2RK4A 3TRKA 4C4ZA 4L50A 1EK1A 3OFVA 5T4FA 5EHGA 3VNAA 1DAKA 1FVOA 3F4BA 1NN3A 4XD2A 2FEKA 4KXLA 2XMSA 1T5LA 1XMVA 2FEWB 3HWSA 4FFBB 2WA2A 3G7UA 5FI0B 4D0RA 5BQFA 2P9CA 3D59A 4X41A 5CT4A 5HUQA 2JAPA 1V5GA 3JYNA 4RD2A 3FPFA 1CUBA 2GPJA 2XWSA 4TROA 4J6EA 1QV6A 4HF7A 3UT0A 3I9KA 1G5HA 4ZPXA 3C1TA 2VLBA 4DR6B 3V8BA 4XLTA 1GDDA 1C8BA 2GXUA 2X19A 4B9EA 3QA9A 3OG9A 5T6MA 3CLSC 4RPKA 3DMNA 4XWGA 1JPUA 3MS4A 2PX8A 4B2IA 1FP6A 4YJGB 5JBNA 3UH0A 4UE6A 3IDOA 3PEWA 2OGTA 3L8ZA 5FEUA 1O95C 4U2DA 2PUVA 3FYCA 4CF3A 1VXOA 4KNYA 1QZ3A 1FX0A 3IBGA 2OKCA 3PRHA 1R0RE 1DCFA 3RT7A 5K3EA 3I42A 5AJUA 2EX0A 4R1NA 3E7DA 3VR5H 1KDOA 3R09A 5KVQA 4P81A 3M3DA 4RJ2A 4KFUA 5CM8B 3I1FA 3GQVA 5DYWA 1NAIA 1PS9A 3T8YA 4NZPA 1E5VA 4PTYA 3QIAA 1VMDA 3ENWA 5AJTA 1E7WA 5DLPA 4KTTE 5B1SA 1X9IA 4MV0A 4MS4A 3SFTA 3CXUA 2C4NA 1BA2A 2ZS9A 2OAGA 3LPLA 1WIWA 5TGDA 2JFPA 4GMGA 3NIBA 4LWOA 4PC7A 1DQSA 1Z34A 3BQ9A 1XXHE 3ZI0A 4GPBA 4YPOA 2ZTLA 5IAAA 3OLCX 4GAEA 4TV8A 1AZLA 3RSSA 5JQGB 4EJMA 2C8KA 2ZWIA 1OSNA 1KQNA 3ZJYA 4UHKA 4DV6B 2B7BA 4WLOA 3VTAA 2UVPA 4BN0A 5L53A 1IWBB 1ESCA 2DBZA 3VNUA 4FI3C 4RA9A 3MCWA 3OPYB 4HYEA 1DO8A 1PLJA 2QQEA 2IPXA 1JKJA 1VGRA 5HCIA 1FOEB 3VNBA 4DBZA 3KQOA 5DN9A 2X8JA 3PUYA 3VVCA 1BDJA 2QW8A 5BUQA 1FSFA 2I6FA 2FNAA 4K9NA 3FTEA 1I14A 2FZCA 4GIBA 4QBFA 1T5HX 2Q3EA 5KNBD 1SRRA 2GPSA 1H6DA 1UKYA 2BF4A 3ICUA 2J5BA 4JBYA 2J0UB 4WKPA 4XLZA 1O95A 2QIPA 3GD7A 5AWFC 1M34B 1DADA 4BDSA 2R44A 4BRSA 3V00A 1TQ2A 4BNHA 3BFXA 4TT8A 3IUYA 2D7CA 2M6RA 2UXDB 4CMGA 1BCRB 5DKFA 4M38A 4MULA 4MPJA 2OFOA 2C7BA 5JFGA 1SCUA 4I9UA 1WXQA 4O08A 3BD7A 4ZCPA 2HIAA 3HUTA 4JEIA 4DAEA 1I3NA 4QE3A 4RMGA 2PUCA 1ZMBA 1XLUA 1AKMA 1P9NA 1N9KA 2I99A 1FQKA 3WDMA 3CQ9A 5BV8A 1U8EA 3G89A 3ZDBA 3SC2B 5CMLA 4AO6A 3ER6A 1IUKA 2IHNA 1QGUB 4MWCA 1MPTA 3TVDA 1A2QA 1YVDA 3DSRA 2B6NA 3BB4A 1M10A 2D4HA 2ORIA 3M89A 1QYXA 4Q48A 3IHTA 4TQAA 2C5EA 3ES9A 2IE8A 3IQIX 3JY6A 2YQZA 1HT1E 3PHGA 3Q0EA 3B9PA 4FE3A 4IG4A 1Y1QA 4IVNA 3ZWKA 5CA1A 3IDZA 1QTQA 5AUOB 2ATVA 4FUTA 1VFNA 4I7EA 4UEKA 4AN0A 3B53X 1V35A 1Z6ZA 1J5XA 1OFVA 2BMJA 2FHSA 4V3CA 2W2NA 5LA6F 4DV3B 2J9FB 5LR6A 3I5MA 2AX3A 1TE2A 4OGWA 2HA6A 4O1IA 3IR7A 1SC6A 1SK9A 1LLUA 3Q3VA 4HDCA 4N03A 2H52A 2BGRA 2IDMA 4P4GA 3IPAA 4KX5A 3ROQA 4GE0A 3MCZA 1Q0TA 2RJOA 4LGCA 4XW2A 1U7PA 5LU8A 1SURA 3NTXA 1OX4A 5LCXA 1ISJA 1T9ZA 4QUEA 4BLTA 1E9RA 4M8IA 4NNOA 4II2A 2WHPA 2P4UA 3MQ4A 1Y63A 4NGRA 2DVMA 2XXJA 2CVPA 3L0BA 4QXQA 3W3AD 4OYRA 1JL3A 5FV4A 1P74A 1RQXA 1OYOA 1CR4A 1XTPA 3DLIA 3WO0A 4BO2A 2QGZA 4PC3A 2XCRB 3PUVA 4GVXA 4JUAA 4ZJPA 1XRLA 1OFIA 4XGRA 3Q41A 4YDSA 5DM0A 5F51A 3F8SA 3AONB 1KXJA 2VNAA 3RJ9A 2LDBA 1AO0A 3WAKA 2D59A 1V6SA 1QF7A 1RKQA 2C59A 1O03A 3BRSA 3C8UA 1XEXA 3HU5A 4R31A 5F35A 3EVDA 2R48A 4A0FA 5JS1A 3FCUB 3K7EA 3HFGA 1NW4A 4Z0TA 2JJ2A 1F0YA 5C7LO 1BWSA 4WKBA 4JB3A 1RI4A 3ETEA 3JD0A 4X61A 2JGJA 3M3HA 1X80B 1L1FA 4ZYTA 3I9OA 1QHYA 2BR4A 4NPHA 2C2ZA 1TO1E 1FRFS 5LIPA 2RHGB 5MGNA 3K0KA 1TLFA 1JEOA 2XW6A 1ONSA 1GTG1 3UKJA 2XNHA 4RNDB 1SKYE 1ZCAA 1MGOA 4EPTA 1M6HA 5KYXB 4OAQA 2WHXA 1UZMA 4ZZ1A 4QGAA 3FHOA 2FQWA 4H17A 4KK3A 4GKJB 4ZRNA 2AR0A 2F6RA 4P3PA 3R7LA 4DJAA 3U61B 3TIGA 3ZWVA 3CB4A 3PFNA 4HDSB 4BO6A 2HJGA 2ZBGA 1UXGA 1G5FA 2AVDA 1WB6A 1RJEA 3LOQA 3OLVA 3P97A 4J0KA 5AM0A 5H5JA 3UJBA 1OI3A 1YF3A 4ILKA 3AF5A 1XZIA 4EKGA 3PGVA 2J6IA 1U8UA 2VN8A 2YX1A 1Z17A 3IP7A 4TS3A 4L6IA 1JHAA 4XYGA 1T43A 4YJ2B 4ZANA 5LLTA 4V1CB 1RMYA 5I9LA 4G0ZA 1RYZA 4N6GA 3DZKA 2QXTA 4MYUA 4WLFA 1KOJA 5DP2A 4P7KA 1LS1A 5EZ5A 2VQ6A 1E8MA 2R1UA 4F7DA 4NGMA 1U0OC 4EABA 3GMDA 1N5DA 1Y37A 2QMEA 2ESRA 4AZ3A 3PFFA 2JI8A 2WWVD 4DQUA 1RZ3A 4B4UA 2VHYA 3IX7A 5IK2A 2H1SA 3JRXA 1OZGA 3KU1A 1WKCA 1W5FA 2W2LD 2E5FA 3H75A 3K9FC 3EY4A 3IGFA 3VGPA 2A5FA 4X64B 4GG1A 5EGSA 1EQ2A 4DNFA 3L9XA 4E0BA 1AUVA 1C14A 3GJZA 4QGFA 4V2IA 5I9BA 4XB6B 2INGX 3Q5DA 3EPJA 1Y8CA 4QUDA 4CPDA 2O14A 3H1AA 4U6SA 4WOKA 1RHMA 2WIKA 4LS3A 4OXXA 4E51A 2AWNA 1S8NA 1MB4A 4MQ4A 1CRLA 2QRGA 3BXPA 3ND6A 1HC7A 4PYOA 3T54A 4QG7A 3IPCA 2CLKB 3GW8A 1EK5A 2R62A 5DYGA 4DDHA 4B6PA 3L7LA 4DNOA 4KAAA 4KPYA 4QRHA 5ITZA 2V98A 3PFBA 1X1DA 3ZWOA 3TVTA 4NFHA 2FF7A 4MUNA 1DIAA 1UZLA 5AOAA 5E6SA 1TCAA 3P0JA 4L5BA 3IELA 4BMDA 2ZBPA 4H1UA 3BL5A 5J5CA 2ZCJA 1YR1A 1FPMA 1T6XA 2GCOA 1EKXA 4KFCA 3B1ZA 1IXYA 1J6UA 1NF9A 2HXSA 2WRZA 3JQDA 3HRIA 3KLBA 3FUTA 5FYDA 4BMZA 2B4QA 1NIPA 2P3LA 1JQBA 1ECCA 1CJKC 1H9AA 1P7CA 4HFRA 3T1OA 3MINA 5IAGA 4AUNA 2BEUB 4J1SA 4L4RA 2VWQA 3DE4X 3CMCO 3VZBA 4BZZA 3F5DA 4H7DA 5I7FA 3K53A 3UJ3X 2CLIB 3DPIA 2Q3DA 1YVPA 4BNDA 2ZUCA 2XYQA 3F73A 4QL3A 3AM4A 3VU9A 2NZXA 4Y7DA 1P45A 5F9MA 1C2YA 2G6TA 3DL2A 4XX0A 3KBBA 4QM6A 2W4MA 4QTYA 5FTJA 1AGPA 2J3DA 2G5GX 2QLMA 4UFOA 1KPIA 1UMBA 1SXGA 4J03A 1Y4ZA 4XFDA 1JDSA 4DLYA 2YJTD 1THZA 2VWHA 2FWJA 2JHCA 3VKWA 4O4IB 3KKZA 2D1SA 4X6UA 5AVOA 1XCJA 4LTNA 3DCJA 3EF3A 4X65B 4MUIA 2CJWB 2I65A 5AVTA 4ENVA 2W6QA 4YCBA 4F4IA 1FFBA 1R7RA 2ZFUA 5DM60 3NVDA 5TMDA 3ZHRA 2EFGA 1JR3E 1QIMA 5IYZB 3BORA 4OTZA 2FG7C 4E1BA 1SBQA 3ETNA 3GVCA 3R4CA 2B4AA 2P41A 2QTRA 3G9TA 3KWFA 4FGZA 3EIOA 3X2SA 4YJHA 2J9YB 1M2KA 2AW5A 1J21A 2OO3A 2YJGA 4X1YA 3U2QA 4JQOA 5TQ0A 1D1QA 1Z0ZA 1F3OA 2GCIA 4ND6A 1D2NA 2I76A 5HILA 1EFKA 3RD5A 3N9IA 4CI0B 4GS5A 1B8OA 2I7XA 1UXHA 2I54A 2PUHA 1GSAA 4K9SA 3ZK8A 3L43A 3GAMA 3LZDA 1WXWA 3DF9A 4YDHB 5ENVA 2KMLA 4QJ4A 5LB4A 2Q8QA 4E14A 1V3TA 3NALA 1S2OA 3QKSA 3HKCA 3KR0A 1TTTA 4JP2A 1PR4A 1ZLYA 4N1AA 4RSHA 4Y2RA 4IBOA 3JZMA 4XQCA 3ZKAA 1Z7YA 4H6PA 4ALIA 4EFDA 4GX5A 4XPZA 1WKVA 2PZGA 1QANA 4NBRA 3CZCA 1J9ZA 2LV8A 2VDLB 1YACA 2FCAA 4TV9B 4MLPA 1EESA 5TPWB 4JJ7A 5LQDA 3ILYA 2FMXA 3R7AA 4KUEA 1EYZA 3DTVA 3G88A 4F5WA 2NT4A 4DXDA 4UJ5A 5TDHA 4BVBA 4KXUA 2ZW9A 2QQGA 1KK1A 4X7BA 5FUXA 3WZLA 2FMIA 6CHYA 3ST7A 1I7QB 3HEBA 3MGAA 1L7EA 4RVSA 1SXQA 3C97A 3TXAA 4DA7A 2XA2A 4PW0A 3I83A 4NMMA 1UH5A 3PICA 3L46A 2DZDA 3H2GA 1ZU5A 4QBTA 3BWYA 4CV2A 1Q95A 2VSOA 1RI1A 4M89A 3DLCA 1NTRA 4NCHA 1MVOA 1DXOA 1UMDA 3IR6A 4RH0A 3C5WP 3TQOA 2X5OA 4IIUA 4P93A 2NSJA 1RCTE 1PNOA 3AJ8A 1DB3A 3DKPA 4JLAA 2EFEB 4NX2A 1F38A 3V32A 4J16C 2JVKA 4AY3A 1KMNA 1MORA 2XTMA 4UCWA 5FUWA 4HATA 1JSXA 1RWWA 4GEKA 3LQRA 4Q66C 5BQPA 3TLZA 4EL5A 1RM5A 4UE2A 1SOVA 1TZKA 3OEEA 1ZUD1 3A4YA 5F7ZA 5JD6A 1JDUA 3N28A 3MJDA 4B73A 4XVCA 1M73E 6REQA 2IKSA 1YZUA 1ZM9A 3USES 1GTL1 2W83A 2HOQA 2X3YA 1ZS9A 1EWVA 4DCJA 4J07A 1XQ1A 4G0MA 1ZVJA 5L95A 3L6OO 1EUZA 3PP8A 1TAHA 1S8OA 2R11A 4HH4A 2JLZA 2CWWA 1BD3A 1NC3A 1KZ7B 3ZR4B 3R7FA 3S8MA 4KCGA 4PN3A 1R0ZA 3UUGA 4YCNA 3URKA 1QLHA 4BBJA 3HDYA 2G7ZA 4TJXA 3R9XA 2C2OA 2GDJA 4Q3BA 1Z7BA 1K2WA 4C4AA 4TZ0A 3L4EA 2QR5A 1V48A 4JYBA 4W1SA 2ZSFA 2VHXA 2XKKA 2OLSA 2FW8A 5ELLA 2ROQA 3ANTA 4KE8A 5AXAA 4ZZ3A 4ITRC 2L19A 1ZD2P 1HDEA 4P84A 2A9KA 5IT0A 2ZUWA 5JEDA 1Q57A 3UXMA 3D6UA 1EZBA 1FTSA 4ZOLA 2ADOA 4DA9A 4S04A 4R9NA 3GJTA 2AHRA 4LHSA 4DNQA 5B7NA 4PLGA 5EEGA 3SR3A 1UBUS 4ZCSA 3BS4A 2GRAA 3GRFA 3T3HA 1M2WA 3RDPA 2PZMA 1EIWA 1W2WB 3QNUA 2BZGA 1FP4A 4ZD6A 5DE3A 3ZVLA 4OH1A 5A5VA 2ORYA 2AS0A 2XB4A 4NJOA 4JLKA 1GL9B 1HLPA 3FPCA 4XJVA 4AUMA 4L2IB 4C0KA 4J1QA 3H2HA 1TXGA 3DDOA 3KUXA 5JE8A 1UBRS 3AIKA 3S99A 3PCRB 1EG7A 5F5XA 4J16A 2Q5EA 4HV4A 3TSZA 1RHKA 3DVAB 4MVJE 1R88A 1W85A 2JLAA 3VPBA 3PPIA 5CDYA 4YLEA 5AT1A 4W5TA 3FWKA 2QROA 2HPHA 3EQZA 2OCPA 3ODPA 2Q6VA 4I9HA 4U3JA 3PT5A 2XQJA 2GN8A 3KQUA 3ZLJA 1GTRA 1NSYA 1UKCA 1OXKB 4R2HA 4UXHA 4EG4A 1U2SA 5ALFA 4B84A 1VBGA 3LBIA 3T5CA 4PO3X 4Y9RA 3NW9A 5C52B 4MKFA 3FKSD 3EMVA 4NH4A 4G4IA 3HDGA 4IDNA 4QEDA 4TVBA 3SI7A 4HGNA 5DRTA 1YR3A 3AVXA 4TTQA 4ZRDA 1LLCA 2NO4A 2P6NA 2D6FA 3D8HA 2QN1A 3UK0A 4YWJA 1YI1A 2UYCA 1W88A 2E4VA 4PS0A 3VHLB 2G9NA 1B26A 5AI5A 2D00A 2GPBA 3JAKA 1TZCA 3WQRA 1UOOA 2W8BA 4RF5A 3DS8A 1WZIA 5E38A 4YT4A 1KIFA 2EZUA 3ELWA 5ES3A 1CT9A 1JILA 2AG6A 4UU8A 1WXXA 1G9XA 3VKUA 3ZGLA 5DDIP 3ZWWA 3GLIE 2CCKA 3TOZA 3F71A 1PYGA 1ZL0A 4GGPA 3JRWA 3OFKA 4RMIA 1U98A 1DC8A 2ZRAA 3EFEA 1U7XA 1ZK4A 2UZIR 5D84A 5KB3A 2F1IA 4FFMA 1JLMA 2HMAA 1P2SA 1RAEA 2P77A 2WM9B 2FQ1A 1YBAA 4HFMA 4MDEA 3KV1A 4X62B 4C9BA 1TJPB 2I7TA 1WW8A 3RWOA 3V8VA 4CN8A 3S9MA 3QVMA 2ZBEA 2YC4C 4I1IA 1YUNA 2IHZA 5I4KA 1MVLA 2HRRA 4MIEA 1WCXA 2J67A 2JFBA 4KVZA 4EGSA 4JHXA 3RG8A 4YRFA 4HN4B 4C7VA 2WICA 1JXAA 2PS1A 4INOA 4MS4B 4BIIA 1OILA 1GKKA 1ZLXA 2GNOA 3U16A 4BBZA 2W22A 4URZR 1GL6A 4CUZA 3OCJA 4Q6WA 1NMEA 1LFDB 2GK6A 2VUSA 3AUSA 4NS1A 4QU5A 4TV8B 3X1MA 4KXNA 3A9CA 3RTGA 3ZE8A 3I0MA 3OF5A 4B34A 2BFBA 2OD9A 2GPNA 5GZ1A 3PTLA 4RF2A 3ZG6A 1JEYA 2DHDA 1FMCA 2EP7A 2UVPB 3LRPA 3TR0A 1ZGJA 2YZKA 3QUBA 4RA9B 4C4TA 4ZZ0A 1KMCA 1CC1S 3K09C 2QR2A 2QV7A 4H3HB 4PFQA 3UYLA 4FFPA 1M2HA 1ADGA 3M6FA 2ZWOA 4GR5A 3D4LA 2XQVA 3BEOA 1XRSB 2B69A 4HAIA 3GGGA 4QWWA 4UTZA 3AEUB 5UKDA 3TYXA 3O03A 3EXHC 3FWZA 1SGWA 1P7YA 4LYEA 3GVIA 4BX8A 1JAXA 4PPFA 4Y6RA 2YY5A 3HDVA 4IEEA 4DV4B 1V8OA 2YV1A 2UZ0A 4Q7LA 4K6HA 2JKZA 4XVUA 1KFEB 4XWWA 1QR6A 4FGKA 2O2ZA 5JNTA 5KX5A 1R0KA 4LYYA 3C2QA 3SSOA 4FONA 4HC4A 1P2GA 5G2OA 4B40A 5B3KA 1A0OA 1KZ6A 1SCUB 2P1ZA 4F9GA 1RC1A 1WCIA 2FSIA 2HHJA 1QYDA 2FG6C 4TLEA 5K0SA 3E5RA 4H1WA 3ROEA 1TIBA 3PHCA 3P71T 4UNNA 4LZWA 2D1TA 3WNVA 3GEPA 5FBLB 3WIVA 5C80A 1Y5LA 3PRYA 3VZPA 2WTUA 1AGRA 3EVAA 4PPYA 4KUGA 4WNIA 4EVIA 1CUAA 1VE3A 4G0VA 3AUXA 4YCAA 4MYCA 2CDAA 2X9LA 3H0KA 4CV3A 2PU7A 4GC5A 1BS9A 3CRRA 4BNFA 5CA1B 3L4JA 1N0HA 4QDXA 4CQMA 1V47A 1PJLA 1IZYA 1RRKA 2CW5A 3GHYA 3K5PA 3M1LA 3M81A 3EXG2 2AE2A 1GZSA 1NI3A 2B61A 1FUUA 1NULA 1EFTA 2XE6A 3CGWA 2PL9A 3L0PA 3K09A 5I01A 4GXRA 2H63A 5CNKA 1XDDA 1LRJA 1WEHA 2PQ6A 3BB3A 4AKTA 3RUFA 4Y67A 4UU0A 1K5GA 1SWWA 3GNSA 4LZZA 4QFCA 5E4JA 4XX1A 1BU5A 2I6XA 5F2KA 1OX4B 3Q98A 1QIKA 3ZK9A 1DJQA 3IULA 3EXHA 3NFRA 1FFHA 1DZIA 2IYFA 2WFAA 2WHPB 3LX5A 1E2UA 2OXIA 4CIWA 4DC9A 1JPVA 1LH0A 2AR7A 3ZBUA 5FFNA 3VX3A 3ET5A 1WBBA 4MWTA 2NWQA 1BVRA 1NBWB 3CCCA 3T3OA 4UBMA 2VBCA 3KR1A 4O4LA 2IBMA 3BYZA 3I6BA 2WWXA 3IUQA 2O0KA 3KM0A 3TZHA 4MWEA 4XCVA 3KEFA 4NYIR 3P20A 5TMEA 2HF9A 2R5WA 2DGDA 3W1EA 4N3GA 1LEHA 4QKQA 4EJ2A 3E9RA 3DZCA 2JF0A 3CMMA 2ACEA 1KJNA 1XEXB 2H16A 3FN4A 3P2OA 4MLCA 4OH7A 4WOBA 1J1IA 3FPSA 1JR2A 3WGQA 3ZY6A 5IUNC 1P0QA 2Q46A 1GCUA 1GLGA 3F6EX 3F8TA 3I09A 3M6VA 5L3VA 3U3XA 3C3DA 4UU1A 1ZOPA 3QMPA 3EDOA 2PL1A 4YAWA 3UCFA 1G16A 2BFWA 2FEMA 2VPWA 4ASUD 2I3BA 4BQPA 4DMKA 5HQ3A 1NLZA 1JQAA 3PUIA 1KETA 1XROA 3RUHA 2A58A 2XEXA 5ADVA 3IHWA 3CLRC 3LLUA 5T7BA 3KQHA 1ECJA 1C9NA 1B74A 3A05A 2B1GA 4PF1A 1CERA 4QJ5A 3KQYA 5JCPA 2HJRA 3DZBA 1MEEA 4HGOA 1Z4QA 3T5MA 1TVMA 1L5OA 3A3OA 3ANYB 1ZN2A 4WK0B 3H7IA 2PNFA 4Z49A 1A8UA 3N74A 2J1LA 2PLRA 4ZDIA 3GLFA 3FLMA 1GRRA 3TFOA 4XUCA 3TIXB 1GGEA 3C8HA 1IY8A 2G8LA 1TF5A 4UEWA 2HPZA 1SVOA 1XZHA 2P4EA 2GEJA 3L6UA 4B4DA 4DJFC 1BXGA 1PT7A 3ETLA 4N0EA 3W9SA 3ZXIA 3WL5A 1ITZA 1N8TA 3UXEA 4B4WA 1XJ0A 5FJIA 4RTJA 4ADSG 2H59A 3GL9A 5EKSA 4LOHA 1CJUC 1L5RA 5LD2B 2HU2A 2ZBUA 3NKFA 4C4PA 3NOXA 4YC7A 3MSXA 1GILA 1LBQA 2CKMA 4BVLA 1Y6RA 2H0QA 3JXEA 3L6EA 4HUJA 4Q7MB 1FP1D 1FP7A 4GDMA 3TLAA 5T64A 1OYYA 2Q3MA 1EUCA 4MEAA 4I1SA 4U9HS 2JFGA 2QAGA 3U9LA 1ORWA 4AZ3B 3WDSA 1PK8A 3NBKA 4H7JA 1SVIA 4GX1A 4PC6A 4WL0A 3H13A 2QT0A 4J49A 5FWYA 3DZHA 1A8PA 1R9GA 2AG1A 2Q6LA 2J0SA 1YKSA 1AXEA 2GPAA 4Q3NA 4UHEA 1WWKA 3NTOA 1YFZA 2RHWA 4BDTA 1GUBA 3G8CA 4EUEA 1K0FA 4LF7B 5HGJA 4BS9A 1TYAE 5EZQA 3COWA 4IZIA 3E3AA 1SBTA 4MW4A 4XUEA 4K46A 3IT3A 1O77A 3A6FA 3CVYA 1H94A 1D8TA 2NW6A 2PT7A 2YVQA 4Q12A 4YIKA 5AM2A 1E7MA 1K6EA 3C70A 4JD5A 3KJHA 2OB2A 1AY0A 3FF1A 3QEKA 3ZS8A 1W4CA 3NFYA 3KYJB 1ZQ9A 4M98A 1QE5A 3ZY5A 1LSUA 5ITZB 1ZOOA 3TZQA 1EFLA 4U00A 4Z4FA 1HT2E 1BOOA 2E55A 1BMFD 1LBEA 3C4JA 3EQ6A 3NV9A 5E6SB 5EJAA 4LDZA 1ZVMA 4D0LB 1D2CA 4K1XA 1VL6A 3GT4A 3GPCA 3BQMB 1ORRA 4NAVA 5EZSA 4BFYA 5A4KA 3IE1A 1FFCA 1YL7A 3N0RA 1DS6A 4I4NA 5DGXA 3V3KA 1O9BA 1QE3A 4DMGA 3U19A 4OPMA 1G6Q1 1WOYA 1H3FA 4GXTA 3WQBA 1PNQA 3QG1A 1L7MA 3DULA 3KDSE 2AXPA 4BMSA 3FOBA 1UC8A 2YJ5A 3MINB 4L5AA 4NE7A 1C9JA 3S6JA 1L5WA 4N76A 4EI7A 1DL5A 1TT7A 5CHEA 3LPNA 1WF6A 5JTUA 4ZC8A 3K5HA 3FSGA 3ANSA 3BA1A 3OSUA 4OQLA 4D8UA 1K68A 2HBRA 3CO5A 1IQRA 1CZHA 5K0LA 3VU9B 1GNPA 4BNDB 5FPQA 3V1MA 5U9CA 4LHZA 4XX0B 5IVKA 3E9EA 3GRAA 2PIAA 2NLOA 3P0HA 2Z3VA 3D1LA 1PJ2A 1UMBB 1VYHA 3D5QA 5DTJA 5TQJA 4N47A 4ZFNA 1EZAA 1R66A 4OFXA 1TM5E 2CJYA 2VHUA 4I5EA 5CT5A 3ZWAA 4Z1MD 2XCTB 3B1YA 3F3SA 4HRYA 2VH5R 4FYMA 4BB0A 4ZYVA 3I5UA 2HUPA 1C3VA 3BL6A 1EAMA 2Z5LA 4DSNA 5L3QA 2Q4OA 2CY0A 3PE3A 4AVYA 5LQNA 5KTMA 1X94A 4FYXA 4JFAA 4CMBA 2A14A 1GPH1 1WD7A 2B4YA 5K0TA 2HA0A 3HCDA 1D5CA 1ULBA 2AMFA 1Z0JA 4B43A 2GYWA 5F9FA 4OHVA 1XHFA 1JG2A 1KY5A 4NOLA 1Q12A 2Q5HA 3ZCPA 5I7RA 1KS9A 5HRUA 4Z86A 1K5PA 1XRJA 1E9BA 1H93A 1AKNA 1TJNA 2ILTA 1K63A 3FTCA 4LE0A 4X1YB 5TQ0B 4F91B 4Y2GA 2C2YA 3ZOZA 3ZHSA 2YFYA 3RVSA 1PZFA 4ZVMA 4I1PA 1OREA 1NBMA 3HG7A 4HTFA 1AO3A 2X8AA 4QTXA 1TC2A 4JHLA 4C30A 3G2QA 2G06A 4YV7A 1IY2A 1NIJA 2NGRA 4OXNA 2ZAMA 4BNIA 3IR5A 1X1QA 1FFXA 1OV6A 3GR6A 4JJGA 1YI0A 2IC5A 4URUR 2JH3A 4Q7QA 2V1XA 2OV8A 5BN1A 4NCAA 3V6MA 4BX9A 2Z9CA 4GR9A 1K4YA 2Q7DA 2ADFA 2OK8A 3B2EA 3EZXA 3I9LA 4QDOA 3SJCA 5IHPA 4FP9A 1Q14A 3PS9A 1MX1A 1NFQA 2UAGA 4J7AA 5DCUA 4A6EA 1P7ZA 3FR7A 1ZUHA 3G6KA 4JCOA 3DTVB 2WKWA 3GRCA 3PNMA 4Z4CA 1QPGA 4EI2A 2UUCB 4MJ7A 4OC4A 3RVOA 1X1RA 2EXXA 2FQYA 1K6XA 4L76A 3C3PA 3I6IA 2OAEA 3QWAA 1NXPA 1T1RA 3G8DA 4MARA 4FLFA 2R97A 4NBUA 5G02A 1QHHA 2QIOA 4BO4A 4AG6A 5EJ7A 1E1RD 1RTTA 1A2OA 2YHBA 3SC6A 1V5WA 1WS6A 4OO3A 3QBTA 1O94D 4EARA 1G18A 3P45A 3SN6A 5KYUB 4HEA6 1FS4A 2F8LA 2JKVA 1OTHA 5AR1A 4ZJUA 1YRLA 4JYWA 3V42A 4LYGA 4QXOA 2G4CA 5DYNA 2P0YA 4U2KA 5KYUA 3H5LA 1KZ4A 4G3XA 4D1YA 4FFNA 3F90A 1DJLA 5BN5A 3AHFA 1F2TA 5CVUA 1G5IA 2C4HA 3B6MA 3KHKA 4LXIA 1W29A 3PQEA 4DDKA 2OBLA 1HKHA 1L5GB 2PX2A 1XEAA 3T12A 5BSKA 3ZHVA 1G20A 4G0PA 4I1UA 5LLDA 5K09A 1LPBB 2EG9A 2JLYA 1TIPA 1DTWA 1JHUA 3CIOA 1I6WA 3SJGA 3EVGA 3LT4A 3ZUPA 1PKXA 3AY0A 1DRWA 4FD2A 4F8JA 5BT8A 2PUAA 4P0QB 4NNPA 2XEIA 1QGZA 1KDYA 2YZNA 6REQB 1F1BA 2DWQA 2RIPA 3N1UA 5CIQA 4C3ZA 2JA1A 3FWYA 2Q9UA 1R4AA 3UWPA 2WHQA 2HF7A 1N2EA 3HFJA 5KWVA 1TUBA 3S55A 2GHTA 3GAAA 1IAQA 4EWLA 1GFZA 1MN6A 3MUEA 3G5MA 1TU3A 5J2UA 1USGA 3WRVA 3HVRA 2G8NA 3OT5A 1OFUA 1JFLA 3L7YA 4B3SB 3I0NA 4KSYA 1BAPA 2DFTA 3OZRA 2Y2VA 1V16A 2ZPAA 3MBOA 1ZRMA 4C04A 4PBSA 5LA6A 3AWDA 1SIUA 5E95A 1X1AA 2PL3A 2L0XA 4KWCA 1UDRA 3EIQA 4FPXA 1PGOA 3KQVA 4HDOB 3IEUA 2FX5A 2B8NA 2Y1WA 3KZCA 1HO3A 3DL7A 2DFNA 3OCVA 4PLYA 1G19A 1VLJA 3OESA 1O97C 1GG2A 1HSOA 2A78A 4IX1A 2FI1A 3IBCA 1K89A 3KXPA 4HWPA 4PNZA 5E8JA 2WPNA 1UKVY 2M2IA 4ZT7A 1B93A 1TX4B 1TF2A 2Q5QA 4YY3B 5GVSA 1KI4A 2O7SA 1FP4B 3BMQA 1M5TA 1U2GC 4IQ0A 3QE0A 1MEJA 1MB9A 3O1JC 5A7HA 4OHZA 5LP6A 1EWKA 2DWUA 3PFCA 4G6ZA 2DJ5A 1YONA 3Q9SA 3SFVA 3U4QA 5TEWA 5J1SB 2VOJA 3CY6A 3SG0A 5BR8B 4W5QA 2P2DA 2REOA 3LD9A 3DBHA 2R2GA 3S7TA 5TQVA 1PNVA 3HCPA 4XTRA 4A36A 3QA3E 5CM9C 3ZZMA 3HR7A 3DOFA 2ZTMA 3QPDA 1SG9A 3FUUA 1LS6A 1SVLA 1UBKS 1W85B 4DSZA 3G2OA 4C7OA 1HFEL 3F5QA 2R6AA 1K3UB 1NFRA 2C83A 2R7NA 3G9QA 1U2RA 2B1JA 3ESDA 1PSDA 4G36A 3U4QB 3PCTA 4OHMA 1Y9JA 3I76A 3BD6A 3O93A 4JR0A 5L6LB 3C4VA 3AVVA 1Y9DA 521PA 1FDWA 1P60A 3HXMA 4JYMA 1KYZA 5JV5A 3NGMA 4Y2HA 2FDRA 2Z9DA 4P4TA 3SPXA 5K8IA 3CINA 3VHXA 2BSXA 4R1TA