5F5XA

Crystal structure of s116a ba3275 with amp bound
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
344
structure length
344
Chain Sequence
AMLIKPKRLQAGDIVATVSPSWGGAGDSEIRWRYEQGVKRLEEVFGLTVVPMPNSLKGSEFIYNNPQARAEDLMTAFQDTRVKAIIANIGGQDSIRLLPYIDFNAIRENPKIFMGYADVTISHLFCHKAGLSSFYGPAILTDFAENVEMDPYTVEMVNRTLFSNEMIGEIQPAPEWTSERLEWIEINKDTRRTMQQNNGYELLQGSTTVQGRLIGGCIEVLEFAKGTELWPEKKHWEDSILFFETSEDHPEPSYIKYWLRNYAAQGILQKAKGIIFGKPKDEMYYEEYKHEILQVMKEHNLEDLPILYNLNFGHTEPKFILPYGSMAEIDCENGSFSILESGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords MccC family protein Ba3275
publication title Crystal structure of Ba3275-AMP complex from Bacillus cereus ATCC 10987
rcsb
source organism Bacillus cereus (strain atcc 10987 / nrs 248)
total genus 108
structure length 344
sequence length 344
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02016 Peptidase_S66 LD-carboxypeptidase N-terminal domain
A PF17676 Peptidase_S66C LD-carboxypeptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Class I glutamine amidotransferase-like 5f5xA01
3.50.30.60 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 LD-carboxypeptidase A C-terminal domain-like 5f5xA02
4E94A 3TYXA 4MI1A 3TLYA 1ZRSA 3T5MA 4E5SA 3TLBA 3G23A 3GJZA 5JYBA 3U1BA 5F5XA 5FD8A 3TLCA 3TLZA 1ZL0A 4IIXA 3TLGB 4H1HA 5F9MA 5K99A 4MJXA 5F1YA 4JVOA 3TLEA 3SR3A 2AUNA 4EYSA 3TLGA 4INJA 2AUMA 4IIYA 3TLAA
chains in the Genus database with same CATH superfamily
1PT6A 2JZNA 3DOIA 3G1TA 2IT1A 4UPVA 2GK3A 2VHZA 3PUWA 5DXFA 3E5RA 3L4KA 4ZYYA 2PS0A 1NBOA 5FUBA 1H5QA 4RH0A 2VA8A 2Q9UA 1JAZA 2A0XA 1L5LA 1ACLA 4FYIA 1Q1BA 2I03A 2YXDA 1XTTA 1FUIA 4G25A 2EBUA 3WQHA 5EE9A 1FSGA 3RRBA 4D57A 1T9KA 2IS6A 2JASA 2WB2A 3L7OA 4MCIA 1Z3CA 4D4HA 1BDMA 1ZSNA 2WV9A 1C2TA 3GZNB 1J39A 4FD2A 4EPTA 5I7RA 4PAQA 5A06A 4Q12A 2DQZA 3SPXA 2AC4A 3IMGA 5AHXA 4PQYA 4I66A 4TSKA 3R9KA 5LQAA 1KOGA 3NDBB 1MP0A 2IPAB 2ZAIA 5AJYA 5E3IA 4GPAA 1J42A 1VOTA 5JAMA 2YHBA 4US0R 3M5PA 4GMHA 3RE1A 1K06A 1XL1A 4HRVA 4L4RA 4E09A 5DTJA 1FFXA 2AQ8A 3BH0A 1Q74A 1DTWA 1QAOA 1YZYA 4DM7A 3SM9A 4H3VA 4UPDA 4EEKA 5A4JA 1X9HA 3NS7A 1E5XA 1YQGA 3Q7TA 4LMBA 3O4FA 1HK7A 4W63A 3V7NA 1W35A 1ZRMA 4XQ9A 4NPAA 3W1EA 1ZGBA 3NHMA 3E9EA 3AY0A 5ICEA 2WICA 1VFPA 2JLQA 5I48A 5SV2A 1AB6A 2E4AA 3AEUB 3TQCA 3UJPA 4N40A 5KSZA 1DIGA 2CUKA 1SQSA 3OEWA 4P4SB 3IODA 3WKBA 4IIEA 2V45A 1ZOLA 4K03A 1FFGA 3S5JA 4L4ZA 5BVGB 3CVUA 4WY5A 1VDMA 1QZZA 2QZPA 1FX1A 4G5FA 5AMXA 4E2XA 2PUWA 4H18A 4G0YA 1P75A 3PDHA 1UBLS 2VATA 2EFGA 2B9EA 2P9ZA 4AJEA 1YTLA 1LDEA 3D3EA 1WZEA 4BUJA 1PBTA 3FXAA 4F46A 4P54A 3L7KA 4TTJA 1WXQA 4JJGA 2ZBRA 3TLXA 3LQ4A 4LVNA 5H9VA 1WV1A 3TLKA 2VAWA 1B26A 2CNKA 2YIJA 3RPEA 3C6QA 3X2EA 2ZM5A 3JATB 3HL0A 2WU1A 3M8KA 2C6PA 2ZTHA 4A8HA 1KNQA 3K2QA 1DHTA 2NLOA 2WM9B 4K9QA 4ND4A 4OHVA 5I9NA 3ADPA 3OE7D 1G9XA 4REMA 4EIWA 5JBQA 4OK3A 4G01B 1E66A 2M6LA 1GILA 4J4BA 4R3NA 1L6IA 1QMPA 4GGPA 3BRSA 5FYQA 4LXUA 3I04A 3LAWA 5K3FB 1EQ2A 4OUKX 4LYJA 1TIBA 5AK3A 1JS1X 3JD3A 3KQYA 5DX8A 3FCCA 5AVJA 1F2TA 1OFVA 1BE8A 4Z9XA 3OY7A 4FFDA 1CEEA 1EFRA 3E9MA 4CZ1A 4AMUA 5UKDA 4RJKA 5J2UA 3OUTA 3HEBA 3X0DA 4I9HA 1DBQA 3GJXC 2V7WA 4P9NA 4XYEA 5LA6B 1GDDA 2P65A 3L05A 4QGFA 5EA2A 2IYQA 3IIIA 5FBHA 1ULSA 3H2BA 1KI9A 2H3EA 3RV4A 3E0QA 4BFZA 2VTBB 2JCSA 1UOPA 3T3DA 4H60A 4ZK2A 1YXMA 2C8VA 3ADBA 4KMMA 1Z22A 1Z83A 4YAUA 5ICMA 1UZLA 3FD8A 3G2LA 4ZGBA 1J9EA 1JNYA 1LFDB 3GO4A 4Q3NA 2WT9A 1SXIA 2HREA 5CLFA 1A8PA 4RK7A 5F3DA 3E03A 4ILEA 2ZE8A 2JA1A 3VC3A 1I6KA 1O8BA 3MJVA 1BS2A 5GONA 1I94B 1K7SN 4K9SA 2A5DA 1WY7A 3GGJA 2YNMD 1Z26A 1ES9A 2P6MA 5IF9A 3SDBA 4NFHA 1I4EB 4XJTA 1ZK1A 2LUOA 4DJ5X 1WCIA 3B20A 3WLMA 1EM6A 1ZI6A 4HDCA 3S2SA 1PZEA 2YWBA 1RPZA 4C8TA 4C7KA 2E5WA 3MWJA 1DBWA 2YWHA 1TCAA 5JWHA 3CF4G 3S1AA 1XMIA 3CFYA 3AF6A 1G7SA 3TTSA 4B9EA 1J1ZA 4I1UA 3ZXUB 3FNIA 4DRXA 1P1BA 3USCS 2C42A 2R97A 1RLJA 5E3HA 2I66A 3RR2A 1FOEB 2B2CA 1TT5A 4TKUA 3HVJA 5L4LA 2HXYA 3ABSB 1ECGA 3WYEA 4RCVA 1FX0B 2BGJA 1XEXB 1S8FA 2IOQA 1A4RA 2QMZA 4NYIQ 5IHPA 3E23A 3EQZA 2Q99A 2GERA 3GOQA 1R6TA 2B4KA 3UMGA 3JRWA 1I1QB 4X1YA 4YAOA 2IEYA 2OGUA 4GZ6A 1GG2A 1E79D 2ZTMA 5DT2A 1W48A 2CNLA 2RC5A 4R9UC 3U60B 2C7PA 4Y0NA 2YJNA 2WRZA 1HYGA 1AQNA 1UJMA 1ULHA 2OZKA 3EDRA 2HJVA 4DABA 4DSZA 4IZHA 1V43A 2QW1A 4GMGA 4KB5A 5AW0A 3G23A 1GUZA 5CIWA 3GQBB 4WEQA 3GJ7A 4J0FA 2K2WA 3HA2A 4NJOA 3ER8A 4YI5A 5A3QA 3HYRA 4QLOA 2OCGA 2WF7A 5FWXA 1ONPA 3TIFA 3U40A 2F4VB 5A5DA 4DMFA 5C18A 1QGDA 5DHQA 2IOFK 3I9MA 2XSZD 3KE9A 4PHCA 1G3QA 3LPDA 1QLHA 3RODA 3DVQX 1BW9B 1Z8LA 3DEFA 2BFCB 2PMBA 1SXJE 3CNBA 1Z5WA 2ZEJA 2NZXA 2VRNA 2COKA 5JTUA 2OV8A 3KSBC 5CCXA 1IAQA 2CKDA 3TR6A 1TEZA 3DEYX 1OXTA 3OAAD 5DGDA 1XUOA 2VXYA 4Q15A 3VVBA 4B6SA 1KIMA 3N8IA 3EGWA 1CUGA 3AV3A 3HBJA 3JY6A 1I7PA 3P4XA 3GEHA 3QKRA 2ZREA 4MQEA 5TPZD 1EE9A 3O9MA 1OWNA 4CMGA 2ACEA 2GN1A 5BRAA 1QTIA 3FUWA 4G0MA 1J8FA 1KBZA 1RKVA 1T2CA 5IC4A 3LO5A 3V1TC 1W85A 4EHBA 3LI2A 4J7UA 1WXDA 3F9CA 5IP5A 4BKUA 3B5EA 3L6DA 3AQ4A 2JFYA 3WVNA 3AFHA 3LHFA 5FOSA 1UK6A 4Y9TA 2VH2A 2N47A 1DC4A 2H07A 1I2CA 4NQZA 1DAFA 1I2AA 2X3YA 4XFJA 2QOEA 3SM3A 1RYBA 5BYBA 3RBZA 1T6XA 4AC9A 1LTQA 5BYJA 2ODWA 1LQUA 3HJRA 3QUQA 3ZWCA 1M1YA 4C84A 3IHWA 1GR1A 1ZNWA 5HIKA 1RBMA 2Y6VA 1I36A 2AF4C 4AICA 3VPHA 4DLXA 2EZTA 2XUAA 3L0IB 3O0TA 3NVDA 4JKYA 4IOJA 5B1EA 5I7EA 1TEHA 3K4QA 3QW4B 4WLFA 5GV8A 3UA4A 1R12A 1JIXA 1XTKA 2BGRA 3I6IA 2EDCA 4MB6A 4MZXA 4K88A 4W7SA 1XTQA 4Y6RA 3RSOA 1UWLA 3ND9A 3DMRA 1W1IA 4X7MA 4Y67A 1QRTA 3RYFB 3SQXA 2FX3A 4HB4A 5IH7A 4MVJF 1RHKA 4CMIA 3ZVMA 2JGIA 1UBKS 3NRJA 3LXMA 3EZNA 5EJGA 1W87A 5JU6A 1WUTA 4HSEA 5CH5A 1E18A 4X84A 1O9BA 4MV8A 4Y2TA 2JS7A 2OBNA 3QFSA 1QR6A 1VMDA 1L1RA 1Y9DA 1JTFA 4B2YA 5IYZA 2YJZA 1MO5A 4W8GA 3RVOA 1U8FO 2RH4A 3SHWA 4TYMA 4RJTA 1E8MA 4KGDA 5FLYA 3A1VA 4IH9A 1YH3A 1SQGA 1FSZA 1M2FA 3GLHE 2CFIA 1E6LA 3AHEA 3OZFA 4LKRA 4RTJA 4HOYA 5AQ1A 4MGIR 5E6RA 2YHSA 4KFUA 1QQAA 5TJHA 2DU8A 3D6TB 4YC7A 4FC7A 4GR5A 5LU9A 5SICE 2WD7A 2QUIA 4LS3A 1A9ZA 5DNUA 3U7JA 1FS4A 5BR7A 1KORA 1ISGA 2Q5CA 4TWJA 1IOVA 1AY0A 1VGRA 3IV7A 4YYEA 3ZE7A 1YVPA 4DMKA 1T0UA 1OJ7A 2ZYDA 4P8RA 4XTRA 1K75A 4Y8VA 2CUNA 1YZQA 3E9RA 3V5NA 1VCIA 1P7ZA 5HE9A 3UMCA 5FADA 2H31A 2K7ZA 4YCMA 2GZAA 3NIFB 5K6RA 4KRFA 1VBGA 3VDNB 4YRLA 2QRVB 2XT9A 2WD8A 2PIAA 1C7FA 1T2NA 2Z2ZA 3RRFA 3KV3O 3TM5A 3TRJA 1OVMA 4WFIA 1KI7A 2C59A 2AN9A 5AM0A 3KUCA 1FRQA 3PPIA 1SXGA 1WDMA 1CQIA 1WF6A 3WIEA 5I9BA 4JLJA 5AVSA 3GEIA 1ZUWA 1F8UA 2IYOA 1FJHA 2WAAA 3LY9A 4J91A 4O4JF 5EOVA 2VTVA 1WXXA 2YN4A 4J4TA 3V4LA 2I3GA 2C5QA 4OX9Y 1P62B 2QTVA 4UOQA 1ISPA 1USVA 2QTRA 4RH3A 4BGIA 1C0EA 1JQKA 2G07A 4JLDA 4UW9A 2GN8A 4B71A 5ADWA 3E5HA 4LDNA 1DKLA 4DDWA 2XW6A 1TM2A 4K2HA 4P33A 3JQ8A 2JFGA 3CUVA 5HQJA 4H0FA 4L4UA 4DM3A 2C97A 4EZBA 2WDPA 5MDHA 3T1TA 4XWWA 4QVIA 3HMQA 5K7SA 3OKCA 3LOUA 4FINA 5E0KB 2BHTA 2PYIA 1SC1A 4NOJA 4BE7B 2PZAA 4K1LA 3W9SA 5CVTA 5H59A 4YJ2F 1FA9A 3A7EA 2XCLA 3S2YA 3K71B 2R11A 5CFMA 3ZC3A 1RU3A 2Y2VA 2C4KA 2Y4NA 2ZJ3A 1CG6A 3N0RA 4BKPA 1MAVA 3OWOA 4RO0A 4R1QA 3WADA 5CXSA 2A67A 4Q9IA 4YECA 1VGVA 2WWVD 2PZEA 2R25B 4HZGA 4HQNA 4RVSA 2EJTA 4KE7A 4XCXA 4CHTA 1DG1G 3I6BA 3AKZA 2BI4A 1MJGA 3S70A 3H1FA 4XTCS 5SYAA 3SVZA 3H1TA 3TAUA 3U9LA 4L1KA 4YRNA 3H4MA 2PRIA 2VJMB 1IXKA 2K6GA 3PJGA 4WK6A 3WB2A 4BKMA 5L51A 2H4FA 1VG0B 5TT1A 1P6XA 2CNWA 1BS1A 3MB5A 3PWKA 4YRIA 2D8MA 3RS9A 2PZFA 2WT4A 4II7A 5CB8A 2QDXA 2R66A 3BYZA 1YDHA 3KD2A 3JYQA 2YY7A 3T54A 2FRXA 2I4OA 2JIZD 2BT4A 5GMOA 5LDGA 2Y4OA 1OY1A 4OV6B 3VDQA 1XEWY 3AERA 1CTQA 2YJTD 1JR3E 1IATA 1JTVA 3NVMB 3CVWA 4D9EA 4X1KA 1QG2A 4FCCA 1YRYE 4QBIA 3HB0A 1ENOA 4TZKA 3DTVA 5JADA 3L6RA 1KO4A 3K0AB 4LOHA 4KXUA 4N7JA 4TTQA 3EARA 4U2CA 3BM5A 3K5PA 3T3OA 3PK0A 3NJ4A 3ZBPA 4KREA 1YMVA 2AMVA 4IIXA 4JODA 3WXBA 1S2MA 1X9IA 3UB3A 3ZI0A 5HGXA 1ZSVA 3WMWA 5JZBA 4QYWA 1Y5RA 3PXGA 1RI4A 5H3CA 1M54A 1NXWA 2O48X 1GTRA 1ITZA 4MMXB 4MEAA 2VUHB 2FDXA 2GZRA 4U5XA 1LA2A 1BDJA 2WZBA 3Q8XB 1OAKA 1L8XA 1OI4A 2B37A 5F76A 4ZJUA 2XQGA 2FPGB 4KQ6A 3DKVA 2PMDA 4KO8A 3UPDA 2ZSBA 3HBAA 3KKLA 1EA7A 2O2XA 2H29A 5DJ5A 4B34A 3MFQA 3B85A 3LY8A 3H1PA 1C14A 2ZT5A 3HV2A 1I32A 1L7QA 2B25A 4LHSA 4XOUA 1HYEA 3RFFA 4EZEA 4ZAWA 5K0SA 3QVSA 1EFUA 5E7QA 4MVJH 3RD5A 3VV2A 5MF6A 2NTNA 3RYIA 4A8JA 1T9HA 2D1SA 1EWKA 2F4NA 4WGFA 2X5OA 1M67A 3IQHX 1U28C 4FLEA 3I9KA 3WI7A 4QPNA 2H08A 3HM9A 1GNTA 1YS7A 1UJ4A 4K9DA 1W5TA 3CGWA 3DTTA 3ROEA 1HFJA 1G6Q1 1NYLA 4C2AA 3ZJVA 4LF4B 2XDQA 2TYSB 2VKQA 4ALLA 2QG9A 2YV2A 2JI6A 4PO1A 1SOWA 4RQUA 1NOJA 5TMDA 5H70A 4B81A 4BMXA 4C01A 5MGNA 1E2MA 1OF1A 3FYUC 3LCVB 1DOAA 3UGJA 1KEVA 1GR0A 3EUAA 4B82A 4ZQCB 1TVCA 3M4NA 3FOEC 2YJGA 1MX3A 1IXZA 3PDIB 4K86A 5CFPA 2QE6A 3U6BA 3EVCA 1HZZA 4AIRA 3U7FB 5IABA 1JFFB 4HH4A 1F9EA 3MW8A 4N8DA 3W5HA 1ODIA 1KFEB 2BF4A 3UW3A 1W76A 1CKEA 1T0BA 1NNEA 5D2CA 5IAJA 2EFEB 1IXRC 2AVDA 2GDJA 1FCJA 4ZYWA 1THTA 2ACKA 3BFKA 1XZFA 3NTXA 3W34A 1N33B 1HL7A 1XCGB 2M32A 3LLMA 4NMMA 3U0BA 4FI3C 4KDFA 5DW3A 4F5ZA 4XGKA 1NQOA 3FOWA 4M1TA 2W6IA 5EMNA 5SZKB 4RV5A 5G0WA 3EXIA 1G19A 1N2IA 3DBOB 4QDXA 4CMKA 3HDHA 5IZCA 4WKNA 1GPUA 1T9GR 2XOEA 2Q0XA 3U56A 4L15A 3QBDA 1B41A 1IOWA 1GL9B 3DVAB 3G2KA 3I04M 1CF2O 2A57A 3H5NA 3NOVA 4NH4A 2HLDA 2I2WA 3DE1X 2F8LA 2RI1A 3PC6A 3P9SA 4JT8A 3T3PB 4BP1A 4CIBA 5LP6B 2IZ6A 3NTLA 4G4SP 5J2TF 4LNHA 4N82A 4A6XA 3TUIC 2OCDA 4XX0A 3T1NA 3IHKA 4CLOA 2A58A 1N8NA 3FLAA 4MV7A 3AVVA 3M5DA 4IGFA 3HR4A 5BV0A 2J31A 1HDRA 4H7JA 3Q7IA 1GCIA 4IF4A 4TWRA 1SXJA 4MPJA 1U7HA 3OECA 4YEDA 3KU4A 1AF4A 4CT0A 4HTFB 1VL5A 2ONZA 4PLFA 1BGWA 4L95C 3ASUA 2X9QA 4B85A 2ON6A 1XCOA 3AF3A 1MX9A 3BSFA 1E9VA 1SBTA 4RELA 2DH6A 1FVHA 2VPPA 1QO0D 4DY4A 4QBFA 3QMVA 4D6PA 2IELA 2F48A 3K35A 4M1YA 1XR3A 1ZIDA 4RTNA 2R00C 2DPGA 1XFAA 2GVZC 2XHZA 2NV0A 2WHQA 1FVXA 3QMWA 1CT9A 4H4DA 2J3EA 4CM7A 2FPPB 4EVQA 5A9SA 4JR0A 4RABA 3CSSA 2I2CA 4DCCA 3CSDA 4IZ6A 3ZX4A 4L72A 2N3ZA 1LX6A 4K6GA 1J24A 1IEQA 4MNTA 4ZYZA 2BDEA 1OPXA 2BIFA 3ORYA 1CX9B 2YZMA 4L0CA 4MDYA 5IMBA 1U2QA 3ZCUA 5LMZA 1PV4A 1ZJ6A 5JJLA 3WA7A 3ZDYB 4RCYA 4TZ6A 1PS8A 4MA4A 4UE2A 4CETA 1QBKC 5ILQA 4IZOA 3SMVA 1C1DB 1T25A 1FQWA 4LDPA 2YWGA 5CNKA 5CPBA 5EFZA 3REQA 1ECFA 4YR7A 3P2EA 4R2JA 4KUGA 5BYAA 2B1GA 2WEKA 2XTMA 4TM7A 3O3CA 3KO8A 2GCGA 2R62A 2HJWA 1Y98A 1Q7BA 3OJEA 1QQ7A 5COQA 3DLBA 2CBGA 5BOSA 5IB9A 3VTFA 2K2QB 2DCMA 1LI4A 1P61B 2IW3A 1NUQA 3V33A 3MK31 1CY0A 4MYUA 1RXWA 2YWEA 1DAGA 1AGPA 1JHOA 2CFOA 2O7VA 4DSTA 1VKOA 4A5OA 1IBCA 4MI6A 5KQRA 5F52A 4XVCA 3IMFA 2XZOA 4TWAA 3WP1B 3BF7A 1P72A 4YMLA 2C82A 1SC3A 3HBLA 2DHDA 3C6BA 3GLHA 4XSHA 3TLZA 4LBZA 4B6EA 3EQ6A 3HDGA 4B7XA 1ZUD1 4HNSA 1UH5A 2ZSAA 3EY9A 3FPHA 3FSRA 1P91A 3PGKA 4JYPA 3VOAA 5HXAA 2HHAA 1JDBB 2HA0A 4CQMB 2BMFA 4FWTA 3U1VA 2X86A 1YWGO 3SZOA 5ALZA 2JKVA 2HFJA 5JYEA 2XXAA 5ALQA 2FLVA 3NHUA 3ROFA 5EXXA 1GPBA 1SEVA 1VLVA 2OB2A 2XH8A 1EWYA 1DSSG 1PZFA 5JIBA 1YDMA 3JQAD 1WE2A 3E61A 1CDEA 2GH1A 4MQUA 2UU9B 1NMQA 4NRDA 5F9FA 4YJFB 2AI1A 3BE4A 3NHJA 4IIFA 5FOQA 2D74A 4RIHA 3RT9A 1T4MA 1S96A 3FB4A 4DBLC 5C81A 1OLXB 3I8XA 4FQ5A 4EGFA 3WYBA 2X76A 2ZJ8A 1XLTC 2FW6A 1WEKA 3ETNA 2Y93A 4MRNA 2NVUA 1D6SA 4MV5A 1XZHA 1E63A 1ULAA 2IVFA 4KWEA 2G70A 1VBMA 1YIAA 3IQIX 2PT9A 4YACA 3NHPA 4JUIA 4AN1A 2O5EA 2ZWOA 1SM4A 2QZ9A 3B5IA 1LD3A 3GFTA 4RU1A 3UHOA 4DUZB 3FNQA 2JBHA 3DBLB 1M66A 2B7LA 1L4YA 3G1UA 4PG5A 4POAA 5CDFE 2H5JA 3ZD7A 1GQOA 1CHNA 3OJLA 5ALTA 2UUBB 2ABWA 3T38A 3TD2A 2O1EA 2QR3A 1NVMB 3MS2A 1DUVG 2I7CA 2AOWA 4IR7A 1JKJA 3ACBA 2NTEA 4KXQA 4ZEOA 1ZFNA 4KX3A 1CQZA 3ZCXA 4EKEA 3PZRA 2HF7A 2V7XA 1CVIA 3DEHA 3QVKA 4V03A 5C1PA 4Q21A 3WLNA 1Z56C 4IDFA 1OGIA 3SZMA 3VJKA 1GT6A 4GLBA 5C4GB 1EUYA 3ACCA 3OM0A 4UVGA 1NVEA 4YRTA 5TB5A 2QXYA 4BMSA 3PHBE 2BHLA 4L85A 2XBLA 3DDWA 4O4HA 4LXXA 2ANCA 2AZ4A 4AQDA 3X2FA 3GNLA 1NASA 2N0SA 4Y98A 4YP0A 1GQQA 1WX1A 2GPYA 1DJMA 3V8VA 3LV8A 1QK3A 4YV2A 2XCIA 3L93A 1WIWA 3HGQA 1XDWA 3PGLA 2O3TA 1SOUA 2VSFA 4Q19A 2OV2A 3S5UA 3WGTA 2Z1NA 1ZMRA 2LKDA 2QD4A 1RI5A 2V5AA 2X8LA 3JX9A 2IXFA 3VZRA 1H4QA 2GKGA 4PF1A 5JFOA 1T8YA 1SVIA 2J6IA 4R84A 5JVDA 5K2MA 3ZJUA 3VOTA 4CM6A 1R3DA 3I76A 1TVMA 1E4EA 1O96A 1S5PA 4MKHA 4N1AA 1N25A 4I5DA 3ITEA 4G3XA 4M7WA 5CT5A 4ABYA 4BKOA 4E5VA 3K96A 1JR3A 1WDLA 4MCQA 3MM4A 3RWOA 5EQTA 1T6ZA 3CPHA 1WZIA 1C3EA 1O08A 2JGDA 3TOCA 4F04A 2FJPA 4YJHB 3V55A 1DKPA 2UVPB 1A5SB 1JDPA 2J6HA 1J90A 4TLBA 3UFBA 4DE5A 1U4OA 4LYGA 1O6BA 1O6GA 2X8AA 3H2YA 5F9HA 3AXTA 3D5QA 4KVAA 3T7EA 3SG0A 3WS7A 4V3BA 3K30A 5FL3A 1OYOA 3TCNA 3DXYA 3CRZA 3IULA 2OILA 1VPVA 5EJ2A 1ZCJA 3HM2A 3MT0A 2CJPA 4MJ3A 4QNNA 1E3DA 2D6FA 1TLLA 3GF4A 4UU7A 2CL0X 4PLYA 2CNBA 3TK1A 3LZCA 4QSMA 1YONA 1V95A 2AI2A 2QZZA 3CNEA 3ISTA 2VBFA 5JNTA 4CLRB 3K6RA 3CSUA 1OXUA 1YVEI 3KTAA 3LCCA 5AKXA 5KYWB 2SHKA 3I9JA 4PBTA 5A1JA 1TB4A 3HKEB 2X9LA 2A9RA 1JG3A 2YC4C 1U8UA 4TTAA 1WL8A 5JCOA 5LMNB 4HB0A 4O08A 4DIMA 4MVJG 5AYVA 2HNBA 2PQ2A 3P94A 4KFTA 1DRKA 5DRYA 4B5LA 4HYTA 5C0OE 1IUKA 1HBJA 3NGLA 2YN0A 1ZIXA 3JAKB 3LRXA 4FSDA 4MS4B 5CLJA 2JL1A 1IRIA 5G53C 2PWBA 3KALA 4NU8X 4RETA 421PA 2GF2A 2VAVA 3GZTB 2I33A 2AQIA 5A02A 3UA3A 3PJDA 5KOJB 1Z4LA 2HRZA 1OTXA 2QTFA 1UXOA 3ZDEA 1OCEA 2I1VB 1KC7A 4CXMA 5JJKA 3QF4B 1OFUX 2GYUA 4Y6OA 1WU7A 4LC9A 2HSEA 2PIDA 2IZZA 2YXEA 3FFBA 1EK5A 3S3TA 4DRXB 4G4JA 2HCJB 4MIKA 1DRWA 4RY2A 3TZHA 4COGA 1SCBA 1XX6A 3LL7A 4RS3A 3T5TA 1TIKA 3W5BA 2A9OA 4RZXA 3EDMA 4JUDX 5LYJB 2DFPA 1NNLA 4PTLA 2OLJA 3VNVA 5AW7A 4IUDS 2IYWA 2ZU0C 3AUJB 1YS2X 1I4LD 8MHTA 2Z9DA 2X9GA 4GNRA 3SEAA 4P45A 1ODSA 4RGYA 4EHDA 2VHUA 4HT3B 4BVHA 1VB3A 1KGDA 3MS4A 4IHJA 3R5KA 3AK4A 4BFTA 4BTLA 3ILXA 2QTTA 3S1LA 4G5HA 3HCEA 2KE5A 3H99A 4CJXA 5A03A 5KNCD 4QDJA 4L6IA 4EG6A 1I9GA 1UC9A 1Q15A 1UDWA 3B9RA 2ODNA 2QTAA 4D9HA 4E2ZA 3GLGE 3IMEA 2W2LA 4OBEA 2C0PA 3A3PA 3PFGA 3DZBA 4JELA 4B6FA 1DEHA 1PR4A 4IRXA 3L5OA 5KDOA 2WFLA 4ZCQA 1CS0A 1TU0A 1V39A 3TOVA 2ATCA 4AJ4A 4OX9B 2V54A 3V8RA 2IYTA 4FZJA 3I5YA 2UDPA 1EUQA 2CEAA 3QFCA 2JIDA 2IIQA 2RK4A 4MHSA 4ZU6X 4WESB 3KZNA 4LJYA 2XYVA 3P0EA 3AI2A 1PJLA 4NCAA 1YZKA 2L69A 1AQYA 2H00A 3BCSA 3IPCA 4P34A 2DR2A 3FMGA 4M7OA 4R31A 1L5OA 2PX8A 2LTAA 2WWHA 3SJGA 1AC5A 5LZ5A 3EISA 1W44A 1M34E 4H1WA 5A4AA 4N48A 4KWCA 4WQMA 1G5QA 1N6OA 1F3OA 1XAIA 3HC7A 3IQFA 2D4AA 3S28A 2OFXA 2VAPA 1YDFA 3OTOB 1E61A 2J6BA 3E7DA 1HI9A 4KAAA 5HCNA 1HLDA 1KR2A 3EZXA 2F3SA 1RXVA 5L53A 1U80A 5ALKA 2B2NA 3LDFA 2UVDA 5ENDA 3ZWMA 4OAQA 4L3OA 1IMJA 2VF8A 1Y7LA 4HDOB 4KGXA 3BWVA 1GSOA 1ZN2A 4M53A 3OH8A 3VR5A 1NBME 3FAKA 1YCDA 2RHMA 1BRTA 4MVWA 1Z2OX 2C4UA 5KS2A 3TLGB 2YC2C 2QMYA 1Y3BE 3VH4A 5FHQA 1PNOA 4NBTA 4R9RA 2XVYA 4HNRA 3JR3A 1ZAYA 3NMUF 1EXDA 3E2MA 1FDSA 1HDEA 4PONA 3D3NA 4ANFA 5LM3A 2O2SA 2XUJA 1MLDA 1E9EA 4L74A 1IFXA 5LB2A 4KK3A 2GNPA 3IALA 1SCDA 2Q6LA 4G89A 3G59A 3WRXC 2C5LA 2EWVA 3FZGA 5JO9A 3LYUA 3IUQA 2P2YA 1U0BB 3MGGA 4CTJA 2SKCA 1PR1A 2EVWX 1BIFA 3AILA 1GPH1 1PL6A 3UK7A 4LY9A 2FXIA 2X4DA 2ZJAA 3CWZA 3AUFA 4B3CA 5J9FA 4F38A 1PJ4A 2VYNA 5C31A 4F3KA 2XUHA 4ID9A 3T3HA 4OLAA 1D04A 4PLVA 3KT8A 1GN8A 2PJZA 3NIGB 3HCCA 3EIEA 3KAQA 3OTWA 2CK3D 3K0CC 4Z8YA 1U1EA 1CY6A 3AYXB 2E0IA 3THXA 2EK8A 2GAFA 2YWJA 4O4LF 5H82A 3L0DA 4MWOA 3ADDA 4ND7A 3EYWA 3RI3A 1N9KA 5EKDA 2WWWA 3DEJA 4HQKA 4M8NE 3VU8A 2AOUB 1U1FA 2HH9A 2ZJ6A 3OPQA 1JLRA 5TGTA 1PYOA 1C9DB 2X9NA 3C3AA 1ST3A 4TYQA 4HG2A 2QL5A 1UBUS 1SUSA 1AKWA 3EZYA 5AH0A 4BRSA 1YNOA 4P2GA 2IZ0A 3SY8A 3B8EA 1UDCA 1VXOA 2B92A 3JD4A 4KYIB 1V3QE 4IKPA 5C1IA 5K9ZA 4PXYA 4QM7A 1RYFA 2FZLA 3B9PA 4ZMSA 2Z6QA 3ESRA 1ZOOA 1AIPA 4D0LB 5TJ9A 1NQAO 5AVVA 2XQIA 4WNCA 1IZ0A 1ZYUA 1BGVA 1TAHA 3QU2A 1XTVA 1HE1C 1V1JA 1OC2A 5FWYB 2A9FA 5HZKA 3L82B 1E6WA 2IBTA 3TG8A 2VR1A 4YAFA 3PHGA 1SUFA 1G8FA 2ZI6A 2BKXA 3D3KA 3BXMA 1PYDA 1G8KA 5EJ6A 4BY9E 1PWXA 3FKSD 4X6XA 3AM1A 4H6VA 4NFSA 3NEAA 3V7WA 3PI7A 1M2OB 5FWNA 1AQJA 1E4OA 2AEMA 2F59A 2RJOA 4OL9A 4UJ3A 4BGDA 2GNOA 3KXLA 5CFLA 5BR4A 5MHTA 1N0VC 4PLPA 3IYLW 4R2MA 4WE3A 2OCKA 1MX1A 3O6VA 1B8VA 4LG1A 2W8BA 4MVJI 5FHRA 3WLHA 2ES4A 3DMNA 3QBVA 2JBJA 5DMHA 3B52X 2RK3A 4M86A 2G5GX 4PN3A 2PCNA 2Q8NA 4JL8A 4HCJA 4FOSA 3RC8A 1G1AA 3PC2A 2QROA 4G5SA 5EC8A 3FNHA 3K1JA 4UHJA 2IH5A 1J09A 1EWVA 4FKZA 2MMCA 1R0WA 1NDUA 2ZU6A 4U2EA 1PWEA 4X6UA 4BZQA 4R0NA 1ZQ9A 3H5RA 3G2MA 1J5PA 2GZSA 3GT3A 2Z6VA 4HDRB 4ZYLA 3DL2A 3D8UA 1YR6A 4BAZA 2FMHA 5IDWA 3DT6A 3I01A 4V0OA 1DJPA 1KI8A 3BXFA 4INPA 2IU6A 3QLVC 2OBBA 4LHWA 1FFDA 1AXGA 4LFCB 2Q3DA 3T15A 2FG5A 5HP4A 1JQAA 1X7YA 4KV7A 3QEMA 1FQJA 3H11B 3IT1A 1EX7A 2XIJA 2QVGA 1M6VB 2YMPA 5AJHA 3BORA 1BSVA 3THSA 1ZD5A 4IJMA 4WXMA 3U61B 3LL4A 4P3KA 2VSNA 3BCUA 3SZ3A 3TNJA 4YXWA 4TQ9A 4YJDA 4HGZA 4RTRA 1NLYA 1L7EA 9GPBA 2HCRA 1NOKA 1KMQA 1JG6A 2C9MA 2HM7A 3DUFB 4KXXA 2F6RA 1MOQA 1H2YA 3GK3A 3HY3A 4ALNA 1BXRB 2GF9A 4C89A 4CU5A 3STYA 1U5BB 3TFOA 4RPGA 2ZVQX 3PQ2A 1NAHA 3QWHA 2AEFA 4K6KA 4KIFA 3W9YA 1JEQA 3QQ5A 3QZUA 1YMQA 1I7LA 4ZVUA 2HZBA 3SC2A 2O8DB 3OKPA 3MSXA 1OZFA 1E8NA 4D4JA 2DPMA 1YGYA 1UMBA 3D2BA 3QX9A 3K6SB 2O05A 3MS7A 4JLUA 4V0LA 4D7AA 4LUCA 2AKEA 3PR1A 3BJRA 3EH1A 3TX2A 4IS3A 1U04A 2FPOA 2AN3A 1N3YA 2EFCB 4BQIA 4C2UA 3WGQA 1RM4A 2I3DA 1T8SA 1L5WA 3DZCA 3H83A 4NP6A 5FFMA 5ECWA 3DAGA 3KQUA 3O4JA 3TRFA 3SZUA 2CB0A 3L2OB 4EATA 8ADHA 3CLUC 1ZIYA 5KYXA 1YO6A 2EYUA 2H57A 4PCAA 5KCZA 1U7OA 1UBNA 1NYRA 3N0WA 5DMXA 1WDKA 5TQ0A 5JDIA 3WL8A 2ZUUA 3PD0A 3SJUA 2XMPA 3ULKA 5L3ZA 4NZMA 5AM5A 3CW9A 2C04A 1V9LA 4HN4B 3DOOA 3DS8A 4XUDA 5IXSA 1Y6RA 1UPXA 3R3HA 2BEUB 1SUWA 4KR9A 3ZZNA 1VP3A 1GA6A 3AHFA 1PDWA 3T1YB 1JWBB 2BFFA 3OM9A 3ZE2B 1KWGA 1U0HC 1H2FA 2J30A 5FPQA 4WVFA 2MCFA 3ZHCA 3E9ZA 4MRVA 1YT5A 1G60A 3NM4A 4DYHA 4ZEMA 2Z6UA 4HDMA 3D0KA 2FVXA 1JAIA 4D56A 1O6CA 2BY4A 2WWXA 2Z5FA 4IKEA 1E2GA 1E64A 1E1CB 1OX5A 2DF8A 2YZ2A 4KYUA 4QYIA 4BJ1A 2GRAA 2IHYA 4L0QA 1UMDB 5JUWA 3QBEA 5AW4A 2XGSA 3ONEA 5H3LA 1FDVA 3QJGA 2QD3A 2JFFA 4TMZA 4RVNA 3W06A 1B43A 1GZDA 4JC0A 3WRYA 3Q7PA 4B73A 4QYSA 4TROA 2BR5A 4S04A 4YP7A 1YR8A 1SVOA 3DV2A 1M5TA 2HA7A 1H3EA 3HN7A 3IQGX 2XV1A 3A9VA 4XR9A 3FKJA 3AR4A 1PZGA 1P0IA 3BXGA 4XD7A 2GYWA 4XWGA 4YAJA 2OQVA 5GOTA 4EUEA 3JQQA 4YMHA 5CB4A 2BM9A 1UFVA 2EG5A 4L5JA 2PGAA 3HB7A 5B1YA 1XTBA 3O8CA 2PVVA 1X7WB 2OZLB 2CXUA 3DD5A 2A0FA 1W5AA 4R16A 5PNTA 3ERCA 3T7RA 2JKYA 3RB8A 2ACWA 1SZDA 2POCA 4X1IA 1ZVMA 3S2EA 1GM5A 1NFFA 3DKIA 1O95C 2XX3A 4R7GA 3UJNA 2QRKA 2X22A 1DFIA 1ZQ1A 4O4IB 3DVRX 2XDWA 4D6YA 3ZWKA 1D5WA 3S68A 4RJLA 1WMFA 4UTOA 3Q6MA 3ONFA 2BR4A 4YMWA 2GKOA 2GBIA 4LZPA 3GFVA 2VTDA 2C4NA 2V9ZA 3KPWA 3MRVA 3CQ9A 3W90A 3ZJ4A 4ETNA 4ALIA 2CHFA 5IT9A 2Y68A 3C8OA 1YJAA 1FFEA 2RGDA 5DRTA 2YBEA 2X0DA 3DV9A 3WGYA 5LQRA 2H4ZA 5F78A 1EEXB 1LV8A 3GLGA 2QT0A 1GZVA 1O87A 2C57A 1ADCA 3CUYA 4TWZA 2M98A 1S3FA 2GTPA 2GCOB 2NTYC 3RTEA 4AWBA 5JZOA 1ZN9A 4ZI7A 1P1IA 4MB2A 3DM9B 4ZOEA 1VKHA 4F3RA 1BJKA 2Q8PA 2HZ7A 2CY0A 4OP2A 4Z4GA 3WZ2A 1A8HA 4IWXA 2RGGA 1FNNA 1P29A 2H2HA 3U09A 3BWEA 1X87A 2W2KB 1WB6A 3P32A 5JRDS 4L6CA 4Q7JB 4XI9A 3EC1A 2Q6KA 4U2BA 3D7GA 1OX6A 1Z4MA 1YZUA 3LH5A 4I3GA 2JC3A 4NBSA 2W6ZA 4FOPA 3PX2A 1R0ZA 5H80A 4D4IA 2XEIA 2AQHA 2XECA 1T2FA 1KARA 4WLNA 4MWGA 1M34A 2J59A 1C2YA 4LDAA 1OBCA 4Z2AA 1DEOA 2DWPA 2GWHA 1Q2XA 2B5VA 2G1JA 4P7FA 5B3JA 2F1IA 1DV2A 1MAUA 5SZJA 4EB0A 4QX6A 3SEQA 1H6BA 1BQ4A 3WL6A 3L3BA 4E22A 2NZUG 3KEOA 3ZU6A 4UDOA 2HHJA 3EDQA 3OPYA 4YT4A 5ITZA 2E7ZA 4GVXA 3SVLA 3W3AA 3ZZTA 4N3GA 1QLJA 2AOTA 3FWPA 1HFKA 4KPGA 3PJRA 1KZYC 4IS2A 4LHEA 1FFWA 3B53X 1JLHA 2OECA 3WMEA 3PVCA 7AT1A 1V5GA 2N9UA 4DN6A 1GAEO 2R96A 3AU9A 1KZ7B 4P93A 5IAEA 4BVAA 3LJKA 1NBMA 4P4GA 4XDYA 1UUFA 4FGUA 1O77A 3V8EA 3EUEA 4DT1B 4K40A 2VDOB 4KHPB 2ZJOA 2OO5C 1CNMA 4L51A 2QIOA 4UCQA 4YQZA 4LQLA 5BSUA 5EPEA 1V1RB 2QL9A 4XX1A 5DN9A 1FLNA 5LIPA 2QSYA 5LJLA 1J56A 1XK6A 4O4HF 3FB1A 2H5IA 2I2XB 3DCYA 3QE3A 4H35A 3DDSA 2I6FA 4CCSA 1JWAB 1KC1A 1P7YA 4PCVA 5EERA 1YE8A 4QBTA 2CD7A 3OQMA 2J0UB 2IXBA 4ZVNA 3CG0A 4D4GA 2Y66A 1ZGGA 1YI8A 4AZ3B 4FHFA 1O9HA 3EGDB 1VL1A 3ENQA 3VNBA 3UHPA 1B93A 2EJBA 3IWWA 2CZQA 3MG9A 3P9QA 3QOWA 4G81A 2BPOA 2BMAA 5EKSA 2VYQA 3MA0A 1JHXA 4PNHA 3ROGA 4MWTA 3IQZA 5JVDF 2QK4A 4CTMA 3DUWA 3FBWA 1UQUA 1N2CE 1P39A 1SOVA 1VL2A 2G63A 3AKYA 2XB6A 2XODA 3SBDA 5LDDC 3BQNB 3IP1A 1E0DA 2O8VA 3ZZ0A 2HV8A 1KJWA 3E8SA 5KYTA 2GESA 2GXAA 2C7VA 1XMOB 1ZVJA 3PXEA 5EP2A 4YCBA 4LOAA 2UYQA 1HYQA 4UM8B 2GZ2A 4HSGA 4NZPA 1YJ8A 4Y3UA 4OKSA 3TRDA 3A9WA 3GQVA 2FN9A 3C3XA 1ZZGA 2ZYSA 4YJKA 2B8TA 5M3BA 4X61A 1T10A 4EJSC 5DTEA 5IUJC 2WU8A 5JLJA 4KQXA 1VHJA 2UZAA 3B6JA 3TUZC 1KAOA 2AX3A 1VE6A 1K2VN 4MAAA 4ZT5A 3T4EA 3KSAC 1G2IA 3V42A 2ATIA 4EY5A 1N0HA 3CZ9A 3NPMA 4U02A 4ZU3A 4PZPA 4TKLA 5KVVA 3VGJA 2J9RA 2W48A 4ZMRA 3FAZA 2DETA 4V24A 3IGFA 2YFKA 2NO7A 2ZYVX 1CVRA 4O1HA 4EYKA 5A5FA 1XNGA 5BMVA 3ZQJA 4F91B 3CLTD 2B1QA 5EJ9A 4KNWA 5ALPA 2NUTA 1NL3A 3DE0X 4TVOA 2VOJA 2OC9A 5T5QA 3U13A 2FA9A 5CR9A 1ADGA 1UEJA 5FUMA 5A0VA 3CRMA 5TMBA 1ZPDA 5KMGB 2ODQA 2WKQA 2B8EA 1CUDA 3KUKA 5DM2A 2ZR0A 3BAFA 3W2HA 1TJYA 3NDJA 2FU5C 2JPDA 5KWJA 4UUQA 4YPVA 3UJ6A 5IJZA 3O1JC 4NEHB 4NZOA 1T13A 1VKRA 2BELA 2VHVA 4H0NA 4A3SA 4P44A 3OJFA 2QPAA 1QOPB 3L07A 4ZTUB 1R0YA 2PA0A 3D6AA 2ISSD 4C43A 4D3FA 3WICA 5A3RA 5GGXA 4C30A 2QY9A 4RDIA 1YZLA 2G9UA 2O4UX 4P4UA 3MELA 4D0RA 3G9TA 2J6CA 3ZBUA 4QARA 1WB5A 1QB7A 1E3IA 3EGOA 1CSEE 4HXEB 3PQ8A 3OC0A 1CJVC 5AOAA 4BGUA 5CMLA 4WJZA 4QUEA 1CNEA 4YMTA 1FLVA 1GYRA 4D9MA 4B0OA 2GSDA 1YHNA 1OGJA 2V1XA 3ZZUA 1ID1A 5B6PA 4OD0A 1O4VA 3QEOA 3FSJX 4Z7QB 5MN5A 2JHAA 5AJWA 1DAHA 3GUVA 4V1CI 4F7DA 4FJ0A 4CT4B 1OREA 2YDYA 4G2TA 3TS1A 1I1HA 1QYCA 3AP2A 1TCBA 2QLLA 4V0SA 3AW9A 2J07A 1GTZA 5TXGA 3DKKA 2YASA 1C30B 5G41A 2P1RA 3IT3A 1ZWLA 2WJGA 3HCDA 4H3KB 3Q9SA 3L6UA 4IHJF 3AL3A 3TECE 4HNGA 4OGKA 3FCXA 1RYHA 4P3YA 3HZZA 3D4LA 4YPOA 2XF8A 1BGXT 1WPRA 1OE0A 1W19A 2I4TA 1ODKA 3BH7A 4HDNB 4C0XA 4KLCA 1E20A 1XEFA 2XUOA 4BP8A 4A2QA 1SBYA 3VHXB 3O91A 3KDAA 5HKKA 2F55A 5GJBA 4A2WA 4D6XA 1ZGCA 2WPNA 3HCBA 3L40A 1PN3A 1BJTA 3M81A 3HYNA 1VXRA 2G83A 5LQDA 2VSYA 3GHHA 3GPIA 4XFKA 1BWPA 2HTEA 3KUUA 1RHUA 3FF3A 2IA5A 1ZMTA 1T5OA 4LRUA 2O19A 1I2DA 3VC2A 4BX3A 4NEGA 1C8KA 4ENQA 1IIBA 1ORVA 1UBOS 1Z0JA 3R0IA 1V16A 4UASA 3RJ9A 1Y3CE 3SX2A 4EA8A 4O1IA 2D1QA 2J5XA 3C3BA 5BSVA 1SOMA 4IV5A 2FOLA 2OD2A 4X3CA 4DMCA 3ELBA 3ER9A 1GITA 4KH1A 4XEUA 3VR1A 3ZWWA 4G4SO 3T9CA 4ZTZB 1EFRD 1K7EB 1N5MA 1XRJA 3WB0A 3RC2A 5C3UA 3ZU5A 3ANNA 3OU6A 2WIKA 1XQ1A 4RK5A 3KQKA 1OTYA 1DPGA 3R3ZA 1CJKC 5CA1A 3ROMA 5JAHA 5JI2E 3QFRA 5K0GA 1ABBA 1PVOA 2DUUA 4E33A 4R7TA 3PA8A 3VYSB 3H9UA 5EIBC 5G1OA 1ZA2A 2FB9A 1I7DA 1I80A 1SQ5A 4JCOA 2XGOA 2FSIA 2I3BA 3PUJA 4MR9B 5AKHA 5EZYA 1XZPA 4TXMA 2ROQA 2O8NA 3SJAA 3DLIA 5EWMB 5CA0F 3VPXA 4OGWA 1SZJG 4W6QA 4QSHA 3AQIA 1SUPA 4HI0E 1X8KA 3NTOA 4EM6A 5D5HA 3IH5A 3NB0A 4EO9A 3ANMA 2ZBQA 2AJ8A 1J0AA 4BMVA 2ZZNA 1GAXA 3PD1A 2JVKA 2QU8A 3OQVA 2XMQA 1HL3A 4IL5A 2FEKA 1H8HD 1SUCA 2WABA 4Y1GA 2CF5A 7REQB 3EMVA 1DX6A 1ORTA 4OHKA 2I78A 1QC5B 1E98A 2EFDB 3NASA 4CUZA 3SHFA 1H3FA 1WR8A 4ZO9A 5AVYA 3OFVA 3JQEA 2GN2A 4MS1A 4ND6A 1K9SA 4GMFA 3TE7A 1J00A 4KPFC 4C87A 4FS3A 4YX9A 2WIBA 1JHYA 4ZIRA 2OHOA 3EA4A 2NUPB 5DGIA 4C4TA 5BP7A 3W9BA 5IFKA 4N6OA 3AEYA 1L5HA 1CETA 1QMGA 4ZKDA 1VG9B 4NZYA 4YRDA 3GLFE 1XELA 2FRDA 3A36A 1YQWA 2DBYA 4GU5A 5AXDA 4E31A 2JB9A 2NZ2A 3TE6A 5EG5A 4G0PA 4U3JA 4KMOA 3ZY2A 2G06A 4CDRA 3VNUA 1D5CA 1NXTA 5IU6A 1SCJA 4H0CA 4QG7A 4TLAA 2ONJA 4WBNA 2GUGA 2OORA 2IHUA 3TRIA 5A6SA 2P77A 1HDYA 1DXOA 2DC1A 1HORA 1MW8X 1PFQA 4JR2A 1LNSA 2NXCA 3U2QA 3PWZA 1ZYMA 1M0TA 2JJMA 3HHEA 3JQGB 5ETJA 3LWBA 5IM4A 1VCMA 3OJXA 4PGHA 3FGNA 2C4MA 2L42A 4B3HA 4QBGB 3ESXA 4QATA 3ENZA 4ISCA 4KSYA 3TOZA 3ET4A 4L0DA 4MMZB 1T1GA 1CEXA 5B37A 4YJ3A 5HQTA 5KDDA 3L7BA 2Q3HA 2ZUSA 1KE1A 3SKXA 4BBPA 2W2VA 1Q0TA 3IEVA 2ZYTX 4BMPB 4XGNA 3T94A 5L9AA 3UMBA 4TYWA 3W5SA 3TNDA 1T9GS 4I4CA 3IUEA 4CTNA 5IBPA 4XPIB 1L5GB 4DPLA 4DDKA 5I7SA 2Z3WA 2MTBA 4LJ8A 4DV1B 4QXMA 1XWIA 3VVMA 4HGOA 4Q7MB 4URUR 1FU4A 1ONOA 3HYTA 3EPLA 1YOVA 2G1PA 4IUBS 4JXXA 2PDAA 4BNDA 2E48A 4ZAGA 1OX4A 2B8JA 2EV9A 2OKCA 2ZIAA 3MC1A 4M9UA 4WN9B 2H2IA 5FF9A 3SYMA 3NIWA 3N2NA 2C03A 1FTYA 2VUSA 3QFTA 1DI0A 1N0IA 2ARKA 5AT1A 1P60A 3D8NA 1X1RA 4CKCA 4K1XA 2AMYA 3HRHA 5AVKA 4NICA 2B7CA 3E7FA 4ZO8A 4IIJA 2JCXA 2F67A 3BXHA 1QOZA 1SWWA 3AB3A 3U7EB 4AUKA 5JWOA 1V5EA 2QZJA 4MQFB 3C48A 3CKLA 3DWIA 5B7QA 1HG1A 3SFVA 4FW8A 1PSZA 3CE6A 3QTTA 4OU5A 5EZSA 4L8YA 3UWPA 1LPNA 1NYQA 5B3LA 1Y33E 3R9XB 4XUCA 3DYBA 2KW5A 2AC2A 4NJMB 3EA5A 2R1TB 3KUXA 3E3LA 1FTSA 4DPKA 2G7ZA 1W93A 4Z4IA 4P0TA 4M1QA 4CQMD 2GEUA 1MEJA 4WSOA 3MTJA 1N2ZA 2Z1MA 3MLAA 3MWGA 2YZKA 4QELA 5IJAA 3W1VA 4PYLA 3HPQA 1G64A 2WHPA 5G1NA 4JJKA 1R5BA 2PGIA 3D59A 1RW4A 4QNMA 3V4VB 5IANA 4YJ2B 5A5GA 5JFTA 1PWHA 1BWSA 5T4FA 1DOZA 1PDVA 1YJXA 2C98A 1ENYA 5FEMA 1YJBA 2OZVA 1UWCA 1U6KA 5B2EA 1PG0A 3WJ1A 1WXGA 3RS5A 5CT9A 4ZDKA 5DN6D 1J5XA 4QBHA 1UDBA 1NN0A 5DHPA 1O94C 2ZROA 4NDAA 5C5DA 3ZXYA 1OBFO 4MP8A 4C6HA 1SCUA 3EOZA 4YUWA 4D45A 1GGKA 1XYVA 4DJEC 3C3KA 3BTOA 3RG2A 5LQSA 3M4ZA 2YWDA 1RPNA 1EK2A 2WUEA 1YS4A 3RIXA 3TSOA 1RRVA 5E7JA 4DYDA 4XSVA 4LPSA 1N2CA 4B3GA 2QNBA 2NU7A 3GDOA 1J07A 1G16A 4PRKA 2GAOA 1HDIA 2FFRA 1L7VC 4B6JA 4L78A 1SBIA 4X85A 4IDQA 2XB2A 1UBTS 4JBGA 4HB3A 3J81A 4MMYB 1U8TA 1M9NA 3KQPA 2NP6A 3BWDD 2PLAA 5IKOA 2IXDA 2XZDA 2NW6A 4HDKA 3WFIA 4LF8B 2VHYA 4EB6A 3V1UA 4F1KA 1I2MA 5B4VA 4JYCA 2H52A 2B21A 1GGNA 1ZGAA 3CKMA 3EQ2A 3N2GB 4N3CA 4F8JA 4EKYA 4CL8A 1N8SA 1XSEA 4PZEA 3NTRA 3SEFA 1RHRA 3LBIA 3AVXA 1LLFA 4C0LA 1P3DA 2UYYA 1E1QA 1JJFA 4K2AA 1P2UA 4LZJA 5ABPA 4P6VF 1CR6A 3TMAA 7MDHA 3HYCA 3PRJA 1IXSB 2GARA 1OV6A 1VE9A 3SHOA 3SSNA 3MT8A 4Z3KA 3R0JA 4DA0A 4ZYVA 3Q8KA 1RAGA 1U0LA 5CCBA 1J99A 4K0RA 2YMLA 4WNAA 2G36A 3AVYA 1UP6A 3NM5A 5IKMA 3NNSA 2C5AA 2HJGA 5JD4A 1JXOA 1SB9A 1U3GA 1D4OA 4WZBA 1GAWA 1W36B 1GQYA 2DMRA 3IR7A 2MHCA 4YRMA 1YA4A 4V0RA 1UXKA 1YB2A 3HSYA 4J0CA 4OXXA 4CV2A 2OFPA 1E3WA 4DLSA 4NV1A 1R1DA 1SHLA 1NMZA 3K9HA 3AR5A 3QQPA 4U8HA 5HCIA 1U2RA 1ZH8A 2J5QA 4RIEA 3JVVA 4X20B 5DOZA 4XYLA 1XVUA 5G0TA 1QU2A 3HCWA 1KBLA 2LXNA 4PAOA 1M2KA 3THWA 1KY5A 3FYCA 3ZU3A 5C37A 4GH5A 5KX5A 4W9MC 2P6PA 2W2QA 3QWAA 3V2IA 5JS7A 1N5DA 2AG1A 3ZKAA 1G3IA 4MJLA 3G82C 3I62A 3RADC 4XDZA 4EFKA 5EWJA 4PXAA 1WABA 3ZWXA 1BX1A 4Y1FA 1JL3A 2P1DA 1JU9A 5F73A 5CB4F 2H2DA 1OB2A 1MB2A 3QF7A 3V4FA 4C9UA 1S3IA 2AJDA 3CVJA 5ERGB 3U4QB 1LZLA 3TZQA 4BMZA 2ODBA 1O0BA 1F8YA 1ZUNA 1DKMA 3UK1A 4URXR 3ET5A 1N32B 2I1WA 1VJTA 2YHIA 3KC2A 3M6UA 4JP3A 4CLHA 3KEFA 1TU4A 4IZIA 4ND8A 2Y0CA 4JDPA 4D8XA 2UXCB 1NSYA 3ME5A 2PLRA 2V3CC 4CCYB 3R0VA 5DCWA 1FYWA 4I1PA 2RHBA 3H6GA 5CLIA 1XU7A 5F9MA 4BIIA 1MAHA 3I1IA 5H9WA 1TECE 4OJQA 4OA8A 4N41A 1L7MA 5G3YA 3CO0S 2HBRA 1HDCA 4NC9A 4OJMX 4DUGA 1K92A 2QSUA 1JDJA 2PKQO 2QLJA 3QYPA 3QPWA 3ZE9A 3H17A 4AK9A 5KSYA 2J32A 3JTMA 4DA8A 3OESA 2C99A 3AF2A 1PF7E 5EKXA 2PMCA 2IBMA 2B9VA 3TW0A 4O25A 4ZOQI 5E38A 3UW1A 5FL7D 1XPJA 1PT7A 1P4SA 5D7NA 4DWJA 4D8UA 2GCEA 6PFKA 2O8EB 3H0KA 1EUCA 3CN9A 4MJ7A 4GSYA 5KTRA 4ZI7F 2REOA 2G6TA 2H0QA 3CLSC 1D1TA 4WFJA 3LMKA 1G5FA 4FYVA 2PMEA 5CM8B 3F5MA 5J2TB 5JTTA 3ZJTA 4MKGA 5JBNA 3KU1A 1ZR4A 2B2XA 1NR5A 3GAFA 4YROA 1TRHA 4Q7EA 3T12A 5BQPA 3OO1A 3MWDB 3BDAA 5LFAA 1VBHA 3CEAA 3WDMA 2VUUA 3NC1C 1QIFA 1KAMA 1RC1A 2RGRA 2YVAA 4IXWA 2PG3A 2I9KA 4KAFA 1B3BA 2IPMA 2DBRA 1EFPA 4OBBA 3M3DA 1C7RA 3FJOA 4RPKA 4CDJA 2BGMA 1ZNQO 1LV7A 3NO4A 4V2IA 5JNVA 1IE3A 2A5FA 4PHGA 1WJGA 4OQEA 4DRZA 4BNNA 1SB8A 3PI6A 4KI0A 4YRCA 1KMHB 3DWFA 1SHKA 2W7TA 1ZL2A 3PZBA 1CEYA 3NLLA 2FEOA 4BNWA 2IYFA 4CLXA 1FXUA 4ZOCA 3DZHA 1JXMA 3ILSA 4X1OA 5FFNA 5FBKA 1E2KA 1SD5A 4D80A 1CZLA 3V2GA 4NOLA 4BB6A 3AB7A 2OLSA 2NQ2C 3HBNA 1Z2AA 1LW6E 1IU9A 2HBQA 2V7PA 3E8MA 4NBUA 3OZTA 2A1TR 3E2IA 2D0OB 3P9NA 1K6MA 2PD3A 4GM4A 3EXG2 1QDEA 4L57A 5B1SA 3BSSA 1JF8A 1N1EA 2DRIA 4R9VA 1BG6A 4U7DA 2X2EA 2V74B 2R82A 4C8PA 1BHQ1 3MJ4A 5B1DA 3GMIA 2Y9PB 4BX8A 2CEKA 1RWPA 1M7BA 5TIIA 4B8YA 5AD1A 4P4BA 3RF7A 4KRGA 5ARBA 1I3MA 1GTJ1 3D8RA 3IPRA 1JIVA 4HXYA 1XPUA 1D07A 2XCUA 4H59A 5G0UA 1MEEA 5KVAA 2IUFA 3NANA 4D0NA 3BWBA 3DYVA 1E1MA 3D64A 3GLFA 4OO3A 5EMLA 3F2IA 3VPCA 1DTEA 1JSLA 5C32A 5KTTA 2PZ8A 3MYYA 4RBNA 3PT9A 3UMFA 2B7BA 2QORA 3CH5A 4K3UA 4M9QA 4QU8A 5CVVA 2OYRA 1IBLB 2FW8A 4MIOA 3R3JA 2WUWE 5CBKA 2ID8A 1M2EA 5DLYA 3KB6A 1FP6A 2NO4A 3EW9A 4N03A 3O4RA 4YALA 3RHSA 4AJIA 4F84A 4FNOA 4UU0A 1QVVA 1RPJA 4RVFA 2P2GA 2X15A 3FZNA 4UHDA 3V2HA 5JVLA 4YCDA 4HLQB 4KG7A 4PSUA 3KVNA 4U5QA 1QIKA 1EFTA 1OVGA 1Q6YA 1QPBA 2EL7A 4FP9A 4Q82A 5CW2A 3SQDA 1QB8A 2ZXFA 2FF5A 1TPZA 3AI1A 3LX8A 1TI7A 4MV1A 4S2EA 3A58B 2OK7A 3ZVRA 3VH3A 4FGZA 3PL1A 4HY3A 4YV7A 3T9FA 2ZWIA 3IBYA 3H86A 1Z9BA 3KWJA 4OL0A 4QGGA 1ECJA 2DM6A 4CLEA 3NC4A 3OM8A 4RYLA 2QAJA 4PR3A 5K0FA 1Y9AA 3KB2A 5C3MA 1YRHA 1SXJD 1AKEA 2VDWB 2WIGA 1XB2A 4J49A 3OOWA 2IWRA 3TW4A 2CLSA 2X0KA 4PWZA 5EIOA 4JWTA 3ZGXA 3GG9A 1ZCAA 2P2NA 4ASUA 3VR4H 1X0XA 1TQ2A 1TW3A 2ADOA 2RGWA 5CURA 1CQJA 1N2SA 4CG0A 2QTNA 4KYVA 1RE1A 4NABA 3WK6A 1RM0A 2FPIA 3ECSA 5EXTA 2IJGX 3F8SA 2PKEA 2AFHA 3WKAA 1QVWA 4JMPA 2BGIA 5BQ5A 1QIEA 5IULC 4U7HA 1HDGO 1RQGA 1V7ZA 2ADFA 3AUYA 3QA3E 2P8JA 3OUUA 3QEAZ 4Z4HA 2PCLA 4HGRA 5KZMB 1RTTA 3CLTC 1T0HB 2EBFX 2QRLA 3ILHA 2C3OA 3MPOA 2ASEA 2RMKA 5DGTA 2BUBA 1GARA 4F9TA 2F1RA 4IG4A 5HK9A 4J3NA 2WW8A 3QK7A 4UM9B 3PDCA 2FFHA 3C7DB 3GLKA 3JARB 4FSHA 4R6WA 2OYSA 2P0EA 3E4DA 1RNLA 3KKKA 4FHEA 2J7KA 2UZIR 3G0GA 1EXWA 1N5JA 1TKCA 3H5WA 4TTVA 4ZALA 3I61A 4CM4B 4GKAA 4EL0A 1TT7A 4UDYX 2A33A 2XMBA 1SOAA 4BL5A 4PQFA 3B1VA 3PICA 3D7HA 3AEXA 5FA8A 3S2FA 1DIOB 4HWGA 1RR6A 4HEHA 5KSPA 3WK7A 3WLJA 4EVIA 1W4RA 1G98A 1ECCA 1UM8A 4F6RA 3IKTA 2J3HA 2ERCA 1CP2A 1TQ8A 1JIUA 1Z17A 5HF6A 4ALKA 5K0CA 3OZGA 4DWWA 1WZNA 1M2GA 2R6HA 1SKUA 3AR8A 1GU0A 3CW2A 4JQYA 4MUAA 2WSBA 4NCIA 5CM9C 5IJXA 3TNLA 1V8ZA 1PQPA 1LPPA 5FI3A 1CRLA 1OUMA 1MJHA 1KR5A 1SZCA 5CFZA 2CV0A 2VEOA 4C6TB 1X1CA 3GVPA 2P68A 3H3FA 3NBZC 5H1YA 2QTMA 3ZG6A 4J0NA 2YHAA 2OOSA 4L2IB 3RVBA 3T52A 4UU1A 3VKFA 1JMKC 3RS3A 2XMZA 3TLEA 1IWPB 1K97A 1FL9A 4QVGA 3OM1A 1LF5A 5ALGA 1S2NA 2C2MA 1D3AA 3NRCA 1NVFA 4U39A 1QCCA 5G0VA 4JT4A 1P9NA 3U44A 1GV1A 4OB8A 5FWXB 3I73A 3BHMA 1ZD9A 1OA0A 1S02A 3NXSA 2RFLA 4AKTA 3TB6A 3BJZA 4LFBB 1CVLA 3F46A 1HT0A 4W5NA 2VP2A 4NMLA 1Q22A 5FTLA 2QJWA 1DUIA 2QB5A 1E2UA 1XDSA 3ZV5A 5DP2A 4MSUA 1K6IA 3W3AH 5J1TB 5CA1F 2PWZA 3EXEB 1TVKB 3AL0C 1MG0A 3PE4A 2DX7A 1J20A 5JISA 2QRUA 3LNCA 2P1ZA 3SFZA 4MQEB 3QKRB 4DADA 2FZ4A 5JXWA 3A4MA 1CUXA 1Z63A 3GRPA 2RAFA 2XWSA 1X1AA 2IX3A 1OZAA 1JECA 3C87A 3CN7A 2R6FA 1UBFA 1XJ5A 3O9VA 2ZI4A 4QM6A 3ZNPA 3LVQE 4RCZA 1BMFA 2GPWA 2XWPA 2WG2A 4K46A 3ZDCA 3SBOA 3COPA 1ZMBA 1LW7A 1NSFA 3BRWD 2VF5X 2BKLA 1RXEA 1Y81A 3I9NA 3LC1O 3NEPX 4B4KA 2PL1A 1Y5NA 3AF0A 1XTSA 1OWLA 1J0CA 3IL2A 3GP5A 5HQ3A 2OXTA 1I24A 1OXMA 4NU5A 2OYCA 2ZR9A 1BFDA 2N1MA 2Q8QA 3Q7RA 1K0FA 1LVGA 4EG4A 4YIHA 3ROQA 2P2ZA 2CB9A 5F64A 2FRVA 3IAM6 5TE9A 1JEEA 3N2IA 3T61A 2ZIWB 3HABA 4F3YA 3PXXA 1MABB 3IBGA 4MA0A 3QBTA 3W8DA 1Q19A 4KIGA 4N5NA 1XU9A 3C3MA 1DBRA 3I1JA 3CT6A 4KQMA 1Y34E 1ODJA 3GRRA 4JJAA 1H93A 4URWR 4BO1A 2O1SA 1QH8B 1ZGHA 4AG3A 1NI4B 4EF6A 3M6AA 3L7IA 1IN5A 5LCXA 2GFQA 5BPHA 3MYRA 3N6XA 5KKAA 2NPOA 4COKA 3BCHA 3OWXA 3QVMA 4LN1A 4GFDA 1WCYA 2JEZA 1B6TA 3PYMA 4H1VA 5TPWA 5LP6C 4WBNF 1FIUA 1LRKA 3OC6A 4I1VA 2ZJ7A 1DEAA 4JOSA 3L1HA 2GCNA 4LY0A 2C58A 4D42A 1M6HA 1PSWA 3UMJA 3D3WA 1N3BA 2YYAA 1A9PA 4MDEA 3ZCSA 5KWSA 4I1IA 1QZUA 3H97A 5CYOA 4CYMA 3TUJC 1QP0A 3RAJA 1RQXA 2L18A 3MRSA 4Z0NA 5A0FA 3RREA 1N5OX 5IUKC 3WHKA 2EHDA 4NPCA 1NE2A 4LGYA 2YS7A 1QGOA 3M1IA 2UZ1A 5ESXA 2DERA 3EW7A 3KJFA 2WD7B 3CH4B 5IT0A 3KAPA 4BXOA 2WTAA 3KWLA 3CWQA 2W4MA 4YJ3F 5BR8B 2QU7A 4P5PA 1LRLA 2XZPA 1SEPA 3HG7A 4CKBA 3O83A 1ZNYA 2NUBA 1OLUB 3DAHA 1HX7A 3ELYA 1I7QB 4UULA 1E59A 2HQOA 1Q17A 1XXHE 1YASA 3BXOA 4OHOA 3RSZA 1PTJC 2FUG6 5EE5B 2HIGA 4C6RA 4UE6A 1XCJA 3QUCA 2Q1SA 2A9JA 3FG9A 3IURA 3GFRA 2A9VA 2WZDA 3K1ZA 1ZN7A 4BFLA 4I19A 3A0UA 5AK4A 1XDZA 4L4YA 4WCFB 3RC7A 1UMCA 2Z1DA 5T6MA 5CEJA 3N59A 2IIVA 1CQIB 3KFLA 1OYWA 1U28A 2EX4A 2QZ4A 1K08A 1WHTA 1X7DA 1W5EA 3BXEA 3GWGA 6Q21A 4IF6A 3R3YA 1N2BA 1FUKA 3QKWA 4MRRA 1L8QA 4ZOAA 5CAEB 3UV3A 1UFOA 3NM6B 1FW6A 2H7YA 4JJ6A 3VAAA 4URYR 4GBMA 4JBLA 5CX1A 1OH6A 5KTKA 5K8TA 3F7OA 5A5EA 1UR5A 1GPWB 3HDVA 4Q1VA 3KP1A 3W1WA 1X8LA 4KEAA 2XAUA 2VQ6A 2HQBA 2AZMA 1TAGA 1SU7A 2DR0A 1RD4A 3HJGA 1EVKA 1UKCA 2IEBA 2RKOA 3JQ8B 4P5EA 2H51A 3MCUA 4PPGA 1DIAA 4EMUA 1Z0KA 2FK7A 1QHYA 4OC4A 2RSLA 1EXNA 2OGZA 2Q4RA 4MV4A 2BM8A 4WINA 3OFNA 1RJEA 2IYZA 1ZO8A 3BDIA 3M49A 4KJZA 5FULA 3RASA 4Z54A 3LLVA 5HF9A 4LK3A 4ETWA 1OGYA 1TF2A 3FTNA 3VPSA 1AB5A 4W9YA 1DWUA 3QKTA 3BDVA 2TMGA 1RXIA 1VJRA 4PRYA 2YRFA 3NBMA 1YDGA 2YJ6A 1UJ6A 3FVWA 3K9QO 4KO4S 4MI3A 3S0JA 4AG6A 2WMDA 3DOHA 5J5VA 5A4FS 2OQIA 5C8ZA 2EK9A 1GZ3A 2Q2OA 4IOMA 1JDBC 2AYXA 1BYUA 3F4LA 4LWPA 4QQKA 2VNJA 4PZAA 3SJXA 1NJSA 1YRQA 2JGKA 2Q4BA 1SKYB 3NKFA 1T36B 4G9EA 4JN6B 4R1MA 4ZEXA 4F8YA 1OH5A 4DSNA 1ULTA 5KOHB 1UWKA 4UM5A 3JQ9C 4WFQA 3ETLA 1BWRA 4GXNA 4ZO7A 1Z6YA 5EMJA 4KLZA 4LJSA 3ZDDA 1STOA 1IUNA 1Z82A 5FPKA 3IO3A 4YHBA 4JFAA 1W9HA 3LGSA 4RA9B 2HA4A 3UK2A 2R7NA 4AP5A 4PO3X 3GNSA 2R85A 1J25A 2A4MA 4F2PA 4PRLA 3T1VA 4BN0A 2VK4A 2OV1A 2Q0SA 2Z98A 4DDMA 4ZJYA 4H7FA 2J48A 3VJRA 1VLHA 3KR2A 1CYEA 2ANBA 4TXHA 1XZ8A 1ZXLA 3QUSA 1Z8NA 221PA 3DTVB 4O4LB 4B84A 3W5VA 3AZOA 4B83A 5MFPA 1US8A 2P6UA 3CM0A 5JS8A 1QQTA 3UFXA 1GYPA 3HV0A 2R00A 3TTXA 2ZJ0A 3X1KA 3DTNA 3CW8X 1NTRA 4PYOA 3U37A 1E2NA 5EUMA 1Z0FA 2AG8A 2GM5A 1CUZA 2PH5A 3B5JA 3PNVA 1S9DA 3U4CA 1A8QA 3BCRA 1ZITA 3IBSA 2CD9A 3TLMA 1EFVB 3G7UA 1OFUA 4DIFA 3F6BX 4FR2A 3MTAA 4RESA 5EQDA 4G8CA 3U62A 4OC0A 4H77A 2BZ1A 4HMPA 3DF9A 5ENVA 5P21A 2FSVC 4PNEA 3N87A 1UC4B 3PUIA 5CW1A 4J03A 1ZXBA 3ADCA 2Z4SA 1VJ1A 5E4JA 3CZCA 4W5OA 4IH1A 2A0KA 3JVEA 2HSGA 4ZAFA 4K8OA 2PX3A 3CY6A 5DX0A 3FR7A 1RHMA 2R60A 3I1YA 3ZWDA 4LPKA 1XTRA 4C07A 3OBIA 2ZBVA 2ZP1A 1NPYA 3PHCA 4NCNA 5JY6A 3SQWA 1ZK4A 2CHVA 2CXRA 4M37A 3ZWNA 2RE8A 3KJXA 4DDVA 3ZBTA 4ZHQF 5KX5F 1ULBA 3CNHA 4BNHA 3H2IA 2VJYA 1GTSA 3QRWA 1UFQA 1OILA 2BTQA 4LXTA 2A35A 2JGFA 4INAA 2O0LA 1E6CA 1JFLA 1N7HA 3IKMB 3GT0A 2PJRA 3EPPA 4PE5B 1SZPA 3PQFA 4M8LA 3VR5D 4HNHA 4WKCA 4INOA 3O75A 121PA 1Z12A 5EP4A 4ZQHA 4F4IA 4GDFA 3WMGA 1YRAA 4H1HA 4RD0A 1THGA 3B2NA 3RLIA 2XRFA 4ZFNA 3FTFA 3ZZMA 1JSXA 2XUGA 4RE5A 1TZJA 2CVPA 1CPYA 3E1KA 2XDYA 3OZDA 1U0NA 4LCEA 1IJKA 1A1SA 3DNMA 1UJ5A 1P5ZB 3IEIA 4KQIA 1L7PA 1W4BA 2FF7A 3QXGA 1CE8B 4R81A 3O8QB 3TW8B 4E0BA 5LOVA 1XO1A 3RHTA 3G02A 3F6SA 4JB3A 1IQRA 1QKIA 2Y1DA 3HS3A 1PEYA 3OJ0A 2R2AA 4L02A 3AR6A 4KQFA 1I1NA 3HKBB 4DLRA 1IY1A 1USKA 5IDXA 3CRRA 1JDTA 2VDJA 1LX7A 5A05A 1PJ8A 2QD5A 3BPSA 1F5NA 2P4QA 3ZU4A 3CR8A 3GW8A 5TS2A 1PQYA 3AX6A 4B4DA 3AV0B 3LDGA 4DQ0A 3VZQA 2PLFA 2FTKE 8ABPA 2DG2A 5K0BA 13PKA 3CISA 3BXZA 3W5IA 6NULA 2G40A 3HFSA 1PD1A 3OE7A 4XUGB 3K16A 8OHMA 4G1UC 4IEFB 4PQGA 2XE4A 3CXRA 1GKLA 4K7JA 1J21A 5BXYA 4YS6A 3JR7A 1AS2A 2GILA 2G4LA 4AF8A 1M7HA 1OBVA 4RY9A 4N54A 3WZLA 3HO6A 4WHMA 4EHLA 4GUAA 5CCEA 2P62A 4N5MA 5HJ2A 5JMTA 1T34A 3EAGA 4H3HB 1WSBA 2C83A 2QGNA 4QUHA 3KYDB 3DL0A 3MJTA 4RD1A 4XX0B 4Y2YA 5JMPA 5J63A 2QF7A 3RSSA 4ZAXA 4XB2A 4D8WA 3T35A 1VPTA 1XQVA 1P19A 3E4CA 4WW0A 1G55A 1GKYA 5H5JA 3WOHA 1M74A 4U7GA 4R71A 1I0LA 3N3AC 1GY8A 4FN4A 3EIFA 2PYZA 4HXFB 1JZSA 1XG5A 2VXCA 2Q5LA 4OF4A 4ZT6A 2QKYA 3B7GA 1X6VA 3R5HA 2QBYA 2INGX 4I55A 4XCQA 6REQA 3BAZA 4KXNA 4QWWA 2GJ8A 1UK9A 3ND8A 1P2SA 2YRXA 4LZLA 4MO9A 3VBCA 1KWKA 2F43A 4AJPA 5GINE 5A04A 3KOXA 4FZ3A 4C3ZA 2G72A 3BC1A 4F4DA 9LDTA 2Q6VA 2HO5A 3PTZA 4KJXA 5KNBH 3A9RA 3EWIA 3F6YA 3K9GA 1WKCA 3W8RA 4S24A 3J7AC 1GGOA 1O9GA 5A1TA 1UZMA 1CUAA 1DQPA 3CCCA 3GPCA 1WVIA 4IHKA 5B36A 1QP7A 2GBCA 1U2DC 2IC5A 4GQAA 2V7EA 2VDNB 3NOQA 2IQIA 1UL1X 1DKQA 2ZJFA 2ZRNA 4M36A 3SC6A 2JD1A 3IB3A 4II3A 3FHOA 2BAGA 1E0KA 3WKEA 2X4GA 4MW0A 4WIAA 4MHOA 2PSJA 4C7OA 3WGLA 1D09A 4EDHA 2G5PA 4Z4FA 1K8RA 4QGSA 3FFWA 3WNBA 1KYQA 2R8OA 1N6RA 3DFUA 5E6UA 3W4JA 4ER0A 3IP9A 2W5UA 5BT8A 1L4BA 1GQFA 1SVKA 1U2TA 3PFBA 3DNPA 4FT2A 3ZY6A 3H5AA 1V3VA 4UAUA 5JYDA 1DQRA 4E14A 3D7RA 2EX1A 2H92A 1A27A 2VF4X 4NZZA 4RSMA 1UOQA 2X0FA 3SE7A 1S89A 3TZBA 3CCFA 4MRPA 3U3ZA 4AAYA 4IEIA 4PG4A 3WIVA 3QY9A 3OCJA 4B4WA 4LE0A 1NFRA 4L3WA 5LQKA 2BLNA 3H3JA 4IQ4A 2REBA 1I01A 1R9GA 2C2XA 4NEQA 4M0FA 1GNRA 1RJWA 3PP8A 4F6CA 1QVAA 2FUNB 4Y2HA 4BNGA 2P9HA 3GRZA 3B1WA 2FSGA 3GLHB 5EESA 3PFCA 3TDNA 1NKVA 4JFRA 1HNWB 5G3ZA 3S9MA 3TQQA 3O38A 5BQFA 1ORDA 1OFTA 1WAMA 3JWEA 4QUAA 3B9BA 4A5SA 4K6OA 2NOAA 2R0QC 4YMIA 2BZ0A 2ZIXB 5KC9A 4FX5A 4B1FA 2XSZA 2WHRA 1GVHA 1Y48E 2YRWA 4ZPJA 1XRMA 2OGSA 3AGQA 4M0PA 4TL6A 2Q4TA 3VYUB 3GGPA 4A1FA 3T8YA 4E5KA 4KODA 3OQ6A 1E2PA 4CEIA 2ZJ1A 4FQ8A 4PGGA 4YRZA 4YAWA 2AUNA 4F85A 5A4DA 4CL3A 3KSRA 4HHEA 1NF8A 3OAAA 4B3DA 1JKIA 1E92A 1C3OA 2EKBA 4YB8A 4A9AA 3S99A 1ESNA 2ID4A 4K26A 1UIMA 2JZCA 4KE6A 4ZVPA 4LEIA 4US2R 2D00A 3O8NA 1T0PA 1SK8A 2MR5A 2XQKA 1ORHA 5TGZA 1UXHA 4X7RA 1TD1A 3BQ9A 1F14A 1O6ZA 4JLVA 1ECBA 1CUHA 1A1VA 5K05A 1IHYA 1VSQA 1XF1A 4KQCA 4HUQB 2OCXA 5FR1A 1N8KA 2Q5IA 3L41A 2A30A 4HQ0A 4BFYA 3T5CA 5DM70 4EYOA 1EJ2A 4F4JA 1AQLA 1U9ZA 5JY1A 3Q3EA 4W4TA 4QZVA 1U0TA 3U48A 3NT5A 1PIWA 2ZPAA 4P1ZA 1RMTA 5FYDA 5L7YA 5HX7A 2DT5A 3F9RA 1RQLA 2DSTA 2V7GA 3CCBA 5T4EA 2HNKA 4BZXA 5FH9A 2OOTA 4A4DA 1P0CA 3TQHA 4CNQA 5I7OA 4BX2A 3LUAA 4G26A 4OI0A 2Q4EA 4MDHA 1Y3IA 2QY6A 4P31A 8GPBA 5EJAA 2JGRA 1QJCA 2O2EA 2WOOA 2YICA 3NV9A 4OXYA 4QRHA 1W9MA 3PC4A 5H0IA 3WKCA 1UBSB 2J9FA 1JYEA 2JAWA 1CY7A 1FSSA 2ZIGA 4AN4A 4DY6A 1AZWA 1AF7A 1DDOA 2DKNA 3KQVA 3NTVA 4FW9A 4KAXA 2FEWB 4NULA 1V48A 5G02A 1K89A 3LPNA 4M8SA 2QGFA 3Q7QA 4J94A 4YPFA 3D81A 3T3GA 3UHFA 1HE3A 3IIMA 3O92A 3WE7A 4URVR 4O4HB 5CBPA 3IMKA 1WBDA 3SJFA 1Q1AA 4BFWA 1T1IA 1NRJB 3VAZA 4CBVA 4NS4A 1AGYA 3ORFA 4XYGA 2JCVA 3QGMA 4U8GA 2AFIB 5FPSA 5AKYA 1H42A 1IIRA 3CVXA 4AFNA 1OH8A 1RWOA 2GEDA 1F6DA 3GIWA 3H18A 3SF8A 2XA1A 3BZBA 4WXRA 5CNJA 4IIVA 1EX6A 4ZO4A 5AKEA 5FBZA 4CI9A 3JYOA 5A62A 3COJA 5JVDB 5EAIA 3C97A 3H04A 1XU4A 2WG0A 3MCVA 2QRPA 3GNTA 2VQEB 1HYBA 2PX0A 5JYCA 1Y80A 1LRJA 4OSPA 3W8EA 1UT6A 2NZVG 2GBFA 1OU0A 3K8ZA 4HR7A 3UK6A 3UEOA 1DVRA 3UJ3X 4BQEA 3R77A 4C85A 2F7SA 3TVTA 4JP5A 2JGDB 2D0IA 5AK0A 1NPDA 3W05A 1H2WA 1T4CA 1ZCBA 1Z3IX 2XRMA 4LY3A 2J1LA 2QX9A 3QOXA 3UY4A 1QUFA 1QF6A 4QXPA 2D7CA 2HF2A 4HX2A 3CF2A 2FEXA 1A72A 3VNRA 5G0SA 1JIJA 1VLLA 2BMJA 1U1GA 2AL7A 2OOKA 3ZV7A 2FWIA 1MG5A 4QREA 4LBVA 5EYPA 5LMCA 4KXFB 4ITUA 3TO5A 1T0IA 3U4IA 4LHXA 4PYNA 3KZKA 3PFKA 1WMDA 3E22A 4FEAA 2Z8YA 4P98A 1JH8A 2EGHA 2E4YA 1SC6A 2H4HA 1QHIA 3OPVA 4AG5A 4LBWA 4M1OA 2VRBA 4PG8A 1X2BA 3WTBA 1DIHA 1FRVA 1TJ5A 3UUEA 3VJLA 3ROPA 1TZCA 2EQBA 4Q6BA 3PB3A 5E1DA 4P3PA 1CZRA 4HVLA 3BKWA 3DE6X 3SIRA 3A04A 3OJWA 4PIVA 2R65A 2JFHA 4DREA 4NCBA 3SLGA 3EBOA 4ZRNA 4X8HA 3RJTA 2UYGA 3B1KA 4Q6WA 2XCTB 2ZUBA 4LOJA 4KW7A 5ENZA 1A2BA 1ST2A 1Z7BA 4I9GA 1P4AA 2QQEA 3IE1A 4FYHA 4QBKA 5H4HA 5D3KA 2YVUA 4TWBA 5D51S 1KDYA 1JHVA 3DF7A 1IZ7A 4HNVA 4LF6B 1JSCA 1A69A 3RF6A 2J33A 3ANLA 4IFIA 2F90A 1HDXA 1P0QA 3CS3A 3P4YA 4EQ6A 2ZJ5A 3HWSA 3FRIA 4JYWA 4MCAA 1RWXA 2YZNA 3UO8B 3I2KA 1M2VA 4EO4A 2Q3BA 4PRZA 3S8MA 3HXOA 3U3KA 2VK1A 1HV8A 2QX8A 5JR3A 1EK0A 1RYNA 3RU7A 5D6NA 3A4YA 1H3NA 2G5TA 3EYAA 3QNWA 1IG3A 1N1DA 3N2KA 4X93A 3K0CA 3H87A 3ZHSA 3M1YA 2V3WA 3VI4B 4DR6B 2QJRA 4TWIA 3A6KA 3C1TA 3KS9A 4FZ5A 1I10A 4IYRA 4Y2RA 1DWOA 3P9XA 1TUIA 2KPOA 4ZXPA 5BN3B 1Y6FA 4NXMB 4NARA 4PLWA 2B98A 1D2NA 3E35A 4GX2A 3L02A 2JIZA 2KLHA 4E4TA 5EJ4A 2VH5R 1E9CA 3N8KA 4HAWA 4IHJB 4KX5A 4O5OA 4TT3D 3VZBA 2D0PB 1W36D 4YRQA 4CDKA 5AW5A 2Y1KA 2YJTA 2PO5A 2BCEA 1YD7A 4NG4A 2XB4A 3EY4A 4EFDA 2QD2A 5K3OA 3FMFA 1CY4A 1N0WA 3D2CA 1Z2DA 4QO7A 2WK1A 4KVZA 4AD8A 1U7DA 3LUGA 4GP6A 1B23P 4ZTBA 3G9QA 4JQCA 4MINA 2XUFA 5HRCA 1J9GA 1CS0B 1DLJA 2VTEA 3FCOA 2HU2A 3X1MA 2R5NA 5TRTA 3TAXA 3URKA 5IKXA 1ZONA 5JSHA 1KJNA 1N6KA 3W9UA 1HLPA 3QP9A 5ESRA 4G1BA 5BW5A 2RI0A 1L4UA 2CDCA 1PKXA 3WLEA 4A8PA 3A26A 4BX9A 5I51A 2GLXA 1NJ6A 2R7MA 4P84A 4Y0VA 4Y2SA 5E6SB 4JOBA 3ILYA 4OJNA 2GRJA 4GZ3A 1Y7HA 4R2IA 2FSSA 2NXJA 5LBTA 1WXEA 5AO9A 3PE6A 1PG2A 1L5QA 1Z4JA 2ZQZA 3R0XA 1DQYA 5JSKA 3BB1A 4AS3A 3EH2A 2KSQA 5DBEX 4R3WA 2C84A 1FPMA 5TMEA 2HLPA 3RFXA 3L7DA 3PNKA 4JKOA 4MUKA 2YXLA 3RYCB 3FMIA 1APBA 3N2LA 4Q9KA 5KYUA 1M75A 4M0UA 2RG7A 3FNRA 2X6RA 4W8OA 2C4HA 2ZXEA 3DLCA 5I3CA 2C92A 4NWIA 2CYAA 3OPMA 3QLVA 1I13A 1DRJA 1TCCA 4FI3F 5ARDA 5JCJA 4RQAA 3R76A 2F3TA 4LRQA 2FI1A 3UQZA 5BV1A 3HE3A 2EWWA 2QXUA 2ZT7A 3LLCA 3UH0A 5AIBA 5K5EA 4CT5A 1DTSA 3PCXA 2YXBA 4R5MA 3ABQB 4EARA 1NW5A 1GRCA 1YL7A 3NHBA 3GRVA 4U6SA 5C7LO 3L4JA 4HLNA 3AINA 1JJBA 1Y0BA 1JEYB 1NXSA 1LBIA 4FNAA 3CRQA 2X23A 2RB4A 4QLAA 5L3QB 4K5QA 4I99A 1HDOA 5IDQA 1X7XA 1PTKA 1Z5ZA 5HG0A 2CJFA 4WK2B 3DFMA 4C0KA 2ZFUA 5ALYA 1B1CA 2FWMX 2ZATA 3AEQA 3UQYS 3AC0A 1T5HX 4GLLA 2GD6A 3UC5A 4D81A 4ONEA 3ZW7A 2BGGA 1JEAA 1XEWX 1V6SA 2ZI9A 4UAJA 4Z1OA 3STHA 4AO7A 3SXUA 3TWOA 4FB4A 2IKQA 3BERA 3P9YA 4JP8A 5HUQA 3F71A 3EG9B 1KTVA 1RRMA 3MBKA 3QKIA 4QGBA 5FJIA 4EKNB 5LUAA 1FFSA 4DV4B 3WTCA 1H4VB 1BEEA 3ZEIA 4AJ1A 4RDHA 2OXEA 4BNIA 3UV6A 3DA8A 2O07A 5IAKA 3PTAA 5LD2B 1TGYA 3OSZA 1N6NA 3FDZB 1G21E 5GTDA 1U1DA 3Q72A 1ETUA 3Q3JB 3LPAA 6GPBA 5ICGA 4KBFA 2MYPA 2KM1A 4P08A 4XM1A 3T0FA 5TLSA 5AVWA 4WZZA 3RHFA 4GAEA 4TV8A 2AK2A 1Z6XA 4XGRA 4XW2A 3H5TA 1NNI1 5B58C 1FFAA 3BFPA 3FPCA 3K9CA 4LSGA 4M76B 4R5HA 3BMCB 4MP6A 5KVSA 1QO0A 2P5SA 1GADO 3I0ZA 1M2NA 1ZIOA 5EP3A 2WKPA 4B4UA 4FBGA 3OTQA 1FNSA 5IEBA 3EODA 5DYNA 1RZ3A 3HH8A 2OV3A 1EBFA 1R4AA 1HE8B 1HY3A 1M73E 1Y9JA 4N6NA 5ECDA 5K09A 5E8JA 4ATNA 1FFYA 5AVZA 2WNIA 4RORA