5F5XA

Crystal structure of s116a ba3275 with amp bound
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
344
structure length
344
Chain Sequence
AMLIKPKRLQAGDIVATVSPSWGGAGDSEIRWRYEQGVKRLEEVFGLTVVPMPNSLKGSEFIYNNPQARAEDLMTAFQDTRVKAIIANIGGQDSIRLLPYIDFNAIRENPKIFMGYADVTISHLFCHKAGLSSFYGPAILTDFAENVEMDPYTVEMVNRTLFSNEMIGEIQPAPEWTSERLEWIEINKDTRRTMQQNNGYELLQGSTTVQGRLIGGCIEVLEFAKGTELWPEKKHWEDSILFFETSEDHPEPSYIKYWLRNYAAQGILQKAKGIIFGKPKDEMYYEEYKHEILQVMKEHNLEDLPILYNLNFGHTEPKFILPYGSMAEIDCENGSFSILESGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Ba3275-AMP complex from Bacillus cereus ATCC 10987
rcsb
source organism Bacillus cereus (strain atcc 10987 / nrs 248)
molecule tags Hydrolase
molecule keywords MccC family protein Ba3275
total genus 108
structure length 344
sequence length 344
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02016 Peptidase_S66 LD-carboxypeptidase N-terminal domain
A PF17676 Peptidase_S66C LD-carboxypeptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Class I glutamine amidotransferase-like 5f5xA01
3.50.30.60 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 LD-carboxypeptidase A C-terminal domain-like 5f5xA02
4E5SA 3TLGA 3TLBA 4MI1A 3TLAA 4IIYA 4MJXA 3TLCA 4INJA 3U1BA 5K99A 4JVOA 1ZRSA 3GJZA 3SR3A 4IIXA 3TLYA 3G23A 2AUNA 3T5MA 3TLEA 4EYSA 5F5XA 5F1YA 4E94A 4H1HA 5JYBA 2AUMA 1ZL0A 5FD8A 3TLGB 3TYXA 3TLZA 5F9MA
chains in the Genus database with same CATH superfamily
4E08A 5AKHA 2FH5B 2ZJBA 3IEUA 3KOMA 3Q0EA 3WBBA 2WHPA 5AOBA 3FSGA 3CEHA 1XSEA 1GPNA 4UBJA 1GY8A 4CFYA 2P30A 3CKLA 3BK7A 4IUCS 3BD9A 2FI1A 3M6MD 3FWZA 1QYVA 1JJFA 4CMKA 4LC0A 1Y6RA 3NASA 3G2HA 5JCXA 3B9PA 3I2GA 3IBSA 4D98A 1M2NA 4B48A 3SC6A 3ECAA 3ZXXA 2NQ2C 3EODA 1HX7A 2QV7A 3RVMA 1O5OA 2K5UA 3ND6A 4YUVA 3NC0C 3L40A 4A03A 5IN4A 3T1QA 4EHBA 2J5RA 5IN5A 1US8B 4BLUA 1DIRA 2I0FA 1G5HA 2JFPA 2ZDHA 4M9ZA 3T6KA 2NO9A 2UYYA 2NZWA 4EHAA 4EPXA 2CUTA 2R6HA 3BMOB 3MILA 3OIWA 1T9KA 2F59A 1NYTA 2GZRA 2XUDA 3NWBA 2I3DA 3K0FB 1PIWA 4LTNA 4JU8A 4K9NA 2CVZA 2ECPA 3REGA 1NTOA 4RJLA 4A1OA 1BE8A 1GUYA 4CKZA 1PJQA 4XTCS 3ETJA 3ESXA 4OH7A 3NOOA 1FLAA 1GQOA 3UFBA 5T3UA 5IMBA 2DUUA 1OKKD 3TMAA 2XUAA 2BR3A 2BPOA 3DFZA 4PZEA 2WFZA 5KWSA 3D4BA 2Q5IA 3X3HA 3RVRA 3VU9B 4IDFA 2FPIA 4I6EA 3TZQA 4AMZA 4NCAA 4AFNA 2OZVA 1HLGA 4MVJH 1EGQA 1NW9B 4Q01A 5D87A 3RI3A 2EFCB 1XC7A 2A9JA 3OLYA 4KQFA 5EWMB 1DADA 5EUMA 3BXGA 2FX3A 3DM5A 4PIPA 2H48A 3RLIA 3ZIAD 3KYDA 1PS0A 2ZE8A 4GSKA 4UPDA 4C2TA 5A1JA 3PKIA 3W5UA 4MGKR 2X4DA 3TR5A 3K0AB 1MNAA 4XB2A 3VOAA 4C0LA 1YQDA 5DCLA 1PZXA 5BMVA 2Z98A 5TPWA 4V0NA 5LCXA 2DXIA 3DHEA 2AWNA 3T7TA 3RM3A 3ZNPA 3THYA 4U7DA 4JBGA 4Q1AA 1WPQA 3PE4A 3U26A 3K5HA 4CLXA 3GJ3A 1N2XA 3GUUA 4OBEA 1J8YF 3QFRA 2JDIA 5L40A 3QENA 5LZ9A 1ZHOA 3ANXA 1BD4A 1U90A 2OAGA 5GONF 3OOYA 1JQ3A 1ORIA 4XM1A 5CA1A 3AM1A 1G42A 1DQSA 2EV9A 3QHAA 4NQRA 4DEYA 2EKLA 1E4YA 2AN5A 4B4WA 4YV7A 3PYLA 1A4XA 3ORHA 4N0DA 1YA6A 3OA2A 3ZD8A 2A0XA 1R0CA 4AXXA 1FBTA 3Q6NA 1AKMA 1K6XA 3P0JA 4GD3Q 5ALDA 1XZMA 5EXEA 4AKGA 2BHNA 2YVLA 4Y2PA 1JLSA 1MO4A 1SKYB 2F4VB 1BDMA 2W0SA 3CPHA 3PSAA 1HYGA 2XQJA 4GLLA 4YCDA 4TV8F 5DF1A 4POOA 2P9FA 3JASA 3JAMA 3ROFA 2O06A 2AYZA 3K4HA 4IVQA 5E7QA 2J59A 3G23A 4Y30A 3HDVA 3KJIA 3WIEA 3AU8A 4MS4B 5KNCH 4FYHA 1LGYA 3BFPA 3BWBA 3VU9A 4RIFA 4HQFA 1XDUA 1TMOA 3A6JA 5LMUB 3IS3A 2ZITA 4I9UA 1WXHA 3HWRA 4LRQA 1PJ3A 5G1PA 3ZBPA 3OMLA 3P9NA 1QH1B 1CUEA 4RY9A 1TE2A 3FN4A 2XADA 1AGYA 1BX3A 2ZS7A 3OQOA 1I0LA 2NT3A 2Q3DA 1Q3HA 2ZT6A 5T5QA 1E58A 5DI9A 5HFAA 1HEIA 3BMOA 4X8HA 2X7HA 4MEBA 4V3CA 3W9UA 5CFLA 2JBJA 3E58A 1KGSA 4QO7A 4Z0HO 3OUTA 5A1TA 1QHGA 1O95C 4B82A 2ZUCA 4EBBA 1RLIA 1I5OA 1SVSA 3A1UA 4ZQHA 4C0HA 3CH4B 2NO7A 3BD7A 3DEZA 5K8IA 2IOFA 3LNCA 2BFWA 2GSWA 2RAUA 4TLDA 3FPEA 1WMBA 4J1SA 3P9IA 2NACA 4KPGA 4IDHA 1UDBA 1YCFA 4KR7A 1E2HA 4HDQB 1GHTA 1U8XX 5I7HA 2WWFA 1AKWA 3DEAA 1JDNA 3OQIB 1QLWA 5EIBD 1TM4E 3ETHA 2NTYC 3IDZA 4GMXA 1SBNE 1H2WA 1MQAA 4AB1A 3P9SA 1Z0ZA 3RWMB 3FPLA 1UPFA 2J3DA 3JQ8A 3V2GA 2F1JA 2PRZA 1T4CA 3IIBA 1MENA 5HG0A 2J4FA 3UAZA 4DJEC 4H60A 2OGZA 3GRZA 3H1AA 1W0JA 5AK4A 3FSEA 3R5JA 2G5CA 3NALA 5LYJA 2YHUA 4KTTE 5B1EA 1IE3A 1E61A 3MAAC 3QYJA 2PTHA 4OAPA 4YAOA 4BVGA 2OWDA 4OA8A 4DANA 3ZJUA 5F5NA 4HSEA 3PBKA 4MHOA 5DOZA 2Q07A 4HATA 4OQLA 2BUCA 3OCWA 1E9DA 3N0RA 3BERA 3H42B 5G53C 5IDVA 1HZZA 2D1FA 3SFVA 3VSEA 1GGJA 2J9FA 3ZV6A 2Y6VA 4CTJA 3OC0A 1AV7A 1XT6A 3N1UA 3OU2A 1QUEA 1USWA 5D86A 3VH4A 1THMA 2YQZA 4KW7A 5ESRA 4KDRA 3DULA 3VR0A 5ICFA 3FPAA 1W6RA 2VF4X 1XU4A 4Z2YA 1T5TA 2X41A 2M6RA 5H81A 1PNTA 2JLBA 3EAGA 4EI9A 5ITVA 3ZWNA 2H2DA 4BQRA 1E7WA 3DUFA 1RXIA 4E5UA 4DR4B 3ZDDA 3PE6A 5FF9A 2WKQA 4R1NA 2PO7A 4RTQA 2WUGA 3EF1A 1W4ZA 1AQIA 2WNIA 3COZA 4FDVA 4FVTA 3EIFA 5FWXB 4GWKA 4BGIA 1PVVA 4BZWA 4AKEA 3E9MA 2R66A 2WB4A 4Y0VA 2R7LA 4HBZA 3VYRB 1FZQA 1RJFA 3L92A 4FI3C 4S1PA 2XOKD 4PYKA 2DQ4A 3Q7PA 1DELA 4OP3A 5TPWB 1ESDA 4MARA 1L7QA 5JHHB 3SJZA 4ZYTA 2AJBA 4BGEA 1DEHA 2J0UA 1Y63A 2UV8A 3IPCA 4WTOA 1FE8A 2VHWA 2XXJA 5JMWA 5B3LA 4RKYA 1E9FA 3U7IA 1T24A 1ORVA 2CN1A 2ZUWA 1FMLA 3DMTA 2FUG6 5C8YF 4NZPA 2QJWA 2JBAA 3DWFA 1GL6A 4QPNA 5JOQA 3CW8X 2JD2A 2NZJA 5AK6A 5DBOA 4DILA 1MA3A 1NF8A 4BWVA 2IRWA 4P3OA 3INGA 2WF5A 1NNEA 1XL0A 4IDPA 2PUDA 1BCSA 2OQ2A 2PUCA 1ZD9A 4Q03A 5BYAA 1VMDA 1NMYA 2FPSA 5ITWA 5BR8B 2D00A 4EZIA 1TFUA 1TD1A 3L0ZA 4HC4A 4UDYX 3AHIA 5JMOA 4IZIA 1AUVA 3B20A 3WB2A 2RAFA 2X6RA 1C3EA 2RHTA 3S55A 3WG9A 4BNTA 2P67A 3BE6A 5TIIA 4QLOA 3ZU2A 1Z8FA 3UGTA 5IRCD 1Y7IA 3CUYA 2BGGA 1FP4B 1EJ0A 1YB4A 1PV2A 3NTQA 3OT5A 4M87A 4ON9A 4BU1A 4DLTA 1VIYA 2I2XB 1YA4A 3M6AA 4JOCA 3UYLA 2F90A 5CVTA 1EVJA 1II8B 2G8LA 2VWHA 4FBGA 1U6JA 3JD1A 4WJKB 4Z8YA 1CDEA 1XWFA 3BGOS 2P65A 5EMNA 4KPUA 1V7QA 4U7WA 5JMPA 4QAQA 1JL3A 3FUCA 2O7RA 2IZ6A 2PZMA 4IIHA 4NEQA 4R8RA 4ACAA 4EFMA 2O0MA 3CTPA 2C2GA 2ZI7A 3FI9A 2WU1A 3NWOA 3WXBA 1HRDA 1Y4AE 1XQVA 1JLMA 4QASA 3WB1A 3H16A 4EGFA 4HYEA 5IYZB 5E0OA 5F3DA 2CMDA 2OHGA 1DAMA 1YB2A 4FEYA 2VDNB 4KFCA 3TAUA 3KXKA 1DUVG 1Q20A 3K9CA 1AB6A 3IYLW 3BD8A 3O26A 4OUDA 2FPMA 4R7GA 3QRWA 2PMEA 1YDHA 5BSTA 4D0RA 3W2FA 2QY6A 2HWWA 1Q50A 3HFJA 2QU8A 1IUPA 2QTHA 1NVDA 1DZIA 3Q87B 4CM4A 3HCFA 1P45A 1W1WA 3IP5A 3UIEA 4RLFA 5IXYA 3PUXA 2RC6A 1A8PA 1EGHA 4MIEA 2HHHB 1XQ9A 1QO0D 1PKXA 3FRJA 3TM5A 4DXHA 2I34A 1Z6XA 4HGPA 3KL4A 3OA0A 2YFYA 5E6RB 3LO5A 2BCJQ 4M1QA 3CBQA 4QEKA 2PKWA 4A26A 5BY2A 1TKBA 3SFZA 2N0SA 3IOCA 4IRUB 3K53A 1HF3A 3G2PA 4ER0A 1FA9A 4OHCA 2JI4A 2PY6A 3CRQA 1OZ0A 1XHFA 2QAGB 1YQGA 4GQAA 4EK9A 1WKBA 1YS6A 3NPMA 4TYYA 3H8WA 1OAAA 2WJYA 2BCEA 1YB1A 1EUDB 2IY8A 3KSZO 3O2QB 3OH8A 5AI0A 1G3IA 3HLYA 3ZGLA 5EJ8A 1R3DA 4IILA 1IBCA 3A9RA 3VU0A 3G17A 4BLVA 1PD1A 1BH2A 1SNYA 2VUUA 3NIFB 1W5TA 5FYQA 3UW1A 3JX9A 4BKPA 4EX6A 5CDHA 3VH1A 1AHIA 4J0QA 5T7BA 4H7IA 1V2GA 3I4LA 5JS7A 1Z74A 2LZ0A 4TVOA 4O2BF 4HS4A 3FHCB 3HPRA 2PXAA 4OL0A 5HZKA 4II7A 3KAPA 3HSSA 2VP0A 3KZNA 4RAQA 3K32A 1MO3A 3BF8A 3L8FA 2FHPA 3RT7A 1Z26A 3VPCA 1PDOA 1RBZA 3MYRA 4MAMA 4P54A 1DFGA 5CX4A 5SZIA 1ADGA 3ZYZA 5BQ3A 5JQGA 2GNPA 2JCSA 4D8TA 2PWAA 1EXVA 4F91B 3C7TA 1PV4A 2JGJA 4HY3A 4DQLA 3PVSA 2YJNA 1DIAA 2ORIA 1JBEA 3NKVA 2FKAA 5E4FA 5E8RA 1OFVA 4Z53A 4KNGE 3ESZA 2WAXA 2DWOA 3FYUB 3VPHA 2REQA 3F1LA 4OA5A 9ATCA 1DE4C 2JGRA 1TL7C 3GJ7A 1KJJA 4TQAA 5BUCA 4XIYA 2JS7A 1U5CA 2RAVA 3C8UA 5FT9A 2RHHA 5IJ0B 1SB8A 1Q7EA 1Q95A 2EJCA 1VG9B 2B35A 3C41J 1J8DA 1N2GA 3OZGA 2P9TA 2Z95A 2ZBFA 1Q0UA 3IOYA 4IDDA 3ZWOA 2YXNA 4PIMA 4ZVOA 2AFHA 5HTOA 1OH8A 2MOKA 3CZRA 1LS6A 4MTLA 4X66B 2NUBA 4MQ4A 2V9CA 3AI7A 4FGZA 4NONA 4DLUA 1C1DB 2IVZA 3RVQA 1KJZA 3AR7A 1RPZA 2XUPA 1PS8A 1XP5A 4MW7A 5AICA 3AUXA 5FBZA 2QYSA 1SVNA 2DH6A 3RVOA 4WBXC 3W5IA 4I3GA 3F46A 3LQKA 4NI5A 3KQNA 2HQ1A 2QV0A 3VU3A 2B8JA 4OHVA 5DNDA 5A0FA 5B30A 1QMPA 2H0QA 1TZJA 2PX0A 4MUKA 5ALJA 1CIJA 4WJLA 1PJ4A 3WRXA 1XD8A 3WGJA 1FJGB 4KG7A 1XJWA 3RUCA 2ZJ5A 1H23A 1WTAA 2VO1A 2Y0PA 3JWEA 4XQ0A 5A5DA 3EAQA 3AF6A 2C4HA 2WNHA 3PT5A 1HO3A 3HLTA 1P2GA 1MRSA 1X1RA 1N0UA 4NJMA 3RS9A 3NUQA 3VISA 4BRZA 3TNYA 3NAZA 3KTFA 4J1NA 3E7FA 3GRYA 4RXUA 1MOSA 5EHQA 2IF2A 1JMKC 4EI2A 1Y8RB 1T5LA 5JD4A 3IAM6 2V6MA 2R6R1 3BMNA 4AYXA 1DO0A 5C1IA 5TJHA 3FLEA 1I7SB 4HO1X 4IO1A 1DXYA 1TZBA 2QW0X 1XPUA 4KGZA 3ZE8A 5DHAA 1L1RA 3TOZA 1OGYA 4PPFA 2GPWA 3R8XA 3H2BA 5CW2A 3BJZA 1ML4A 3DDCA 1PO7A 3AG5A 2FPRA 2O0KA 1AA9A 4CVNA 3U9SA 3PUHA 4MEJA 3ROEA 1UQRA 4MQEB 4S35A 4M0MA 4D9KA 3LVFO 2LIPA 4UOQA 1M2OB 3FVWA 4E30A 3MM4A 2PXXA 1QRDA 2N1MA 3RJ9A 4B32A 4E5KA 4C4YA 1QVVA 4G1MB 1YVEI 1TM5E 2QUZA 4RS4A 5DLDA 5A4DA 2Z8ZA 5BSUA 4E2WA 2J30A 3ZY6A 1Z6GA 1T5HX 3BS4A 3LE8A 3LPMA 3TNLA 3IAS1 1AQNA 1JBKA 5TVGA 3BMNB 1XAHA 4KXVA 4DL9A 1HOXA 1PJCA 2HSZA 1NVGA 3PGLA 1O95A 4QUGA 4D9BA 4DJAA 4QA9A 3NHJA 2X58A 4OXXA 1SQ5A 2ZTUA 4JXXA 2NXJA 2H4XA 4LCBA 4MR7B 4QT0A 2WFMA 3DV2A 4MQ6A 1Q0PA 3P26A 3S2UA 1GCUA 4Q4CA 5JQWA 1BCRA 1N5DA 5JJBA 4KREA 1NUHA 1OA0A 3NVMB 4OOFA 3IBGA 4MV3A 2CNWD 3HGMA 4G6ZA 2A84A 4YJ2A 1EVZA 2OXEA 3O38A 3E2PA 1D6NA 1VKNA 4U0JA 1P3JA 4G5HA 4KX5A 5IUNC 5L51A 3CVUA 2BFDA 3P20A 3RGWS 1HQYE 2F3SA 1LRKA 1OW3B 3VSAA 3A6ZA 4JI4B 4W7HA 3R7NA 1GPUA 3ZNNA 1GU1A 4MUEA 2VRCA 4ZYWA 2ZBEA 3ZZUA 1LY1A 5L3VA 1C50A 2Z5GA 3GHYA 4FE3A 5BQ5A 2P2LA 2RCNA 2HM7A 5HX7A 2C5AA 4EMSA 3EIHA 3A6LA 2FSVC 2BRUC 4DAEA 1MF7A 4NH4A 2ERYA 3AVOA 1UMBB 2VRWA 2C54A 4R2JA 3RJ5A 2PJZA 2VZ0A 4MVJI 1R6UA 1YNSA 4OQFA 4WOKA 3IXQA 1N25A 4TTQA 1N6KA 1RW4A 3D7SA 5MN6A 1OTXA 3GG2A 3FPFA 4ZU6X 1BWSA 2AYXA 1K8YB 4K6MA 4E2FA 4A0HA 3MJEA 3PHHA 1UP7A 1PUIA 3EPRA 1T0UA 3CCBA 2OORC 2FPUA 2Z2XA 3WYAA 2WYOA 3E9NA 1PFKA 1ZD2P 3HV2A 4IIDA 4ER7A 1PRYA 4MWOA 1Z2OX 4BXOA 4B6JA 3CJRA 2QIOA 2BJHA 4QRIA 1P7ZA 3DOJA 4Q4AB 1MBZA 1XNRB 1IM5A 2BSAA 2YJ3A 4LOAA 1M6VB 3NBKA 2IU3A 3BWXA 2B83A 2JJ1D 3CMCO 1MC4A 1CZHA 1EP3B 2V8OA 4MW5A 2I9KA 3HR4A 4FFBB 3RASA 4NGMA 1V25A 2G5TA 1IZZA 4J49A 3OO1A 4ZYLA 3E7WA 4JLOA 1XEWY 3HN6A 1ODJA 4MJLA 4UASA 1YK1A 3UMMA 1QJ4A 2Y1GA 2PUWA 2HREA 3VSDA 2HHLA 2MYUA 2EIXA 4UBOA 1GG9A 1CUSA 4XYBA 1PGQA 2MSNA 3RC8A 3X1WA 3E7XA 3F6YA 4Y9SA 1KJYA 1OBFO 3NAGA 5KAPA 3MPOA 1VJDA 2G7MC 2Q0SA 3DMNA 5EC8A 2UUCB 3LQ1A 2M9MA 2OBNA 2PYZA 3CHYA 5JNWA 4Q3KA 1K5GA 1PWZA 1JECA 4WOJA 4K9OA 4X60A 2PRSA 4K6CA 1JYFA 3TH5A 2A33A 5CD1A 4IOMA 3D64A 2QN8A 3GROA 2GS9A 3K4PA 3H8SA 3QFTA 3QKUA 2HK7A 3SLRA 2DWPA 3NRCA 3VVCA 3LWZA 1J1ZA 2XDQA 3ELBA 4BX3A 1RTKA 2V5VA 3UWSA 4I2VA 3ADCA 1ABEA 3FW1A 5AUNB 4JGBA 1E6LA 2OBFA 2VAVA 3ES9A 4G1FA 3ZGZA 1VLVA 5DCWA 4YRFA 2CDCA 3WA6A 2N75A 1JU3A 2XYRA 4QXOA 3G6WA 2WABA 3QJYA 5DZSA 4Q4JA 2AXEA 4TKLA 1MB2A 3EQ7A 2WQ7A 3GLFB 4P7GA 5J63A 3H65A 1VSQA 1T9AA 2VQDA 4DF3A 3FB1A 2C5GA 1NXWA 3ENKA 3NETA 4W63A 4UATA 4MQFA 2OILA 1GN9A 1NR5A 2IVFA 2ZJ4A 4N6GA 4ZTUB 4NF2A 5AHRA 3DAHA 3M4NA 4EUSA 3FOWA 4TX1A 1DIBA 3PX3A 3NVDA 4WUTA 1T1JA 1KDRA 5HIJA 3LDUA 5C3MA 3SJEA 3K1AB 4IF4A 5EE9A 1YS7A 3OLXA 5CDSA 1CHNA 1B3RA 2PQMA 4QJ5A 3RNOA 1QIMA 4YAKA 1Y7TA 4LZNA 1ZMOA 1NF2A 2VJBA 1VCMA 2J6HA 2OZKA 5AKJA 3T3PB 3I2JA 1XPJA 2R47A 3BH0A 2XX3A 3INYA 3ZD9A 5JTUA 1ZVVA 1CRPA 1UZLA 1E3MA 4BO3A 3FH0A 5B6PA 2JFZA 4X85A 4OSOA 4MYRA 3QKIA 5HCIA 3DW3X 1VKHA 3ZV7A 1RQ2A 4JJEA 5AJYA 5DEOA 4MLPA 1WQ4A 5F21A 3NHYA 2D2EA 5C7IO 5KYTA 3UMYA 3W9BA 2H59A 1UAAA 2MU1A 2OLSA 2HA6A 1I4TD 3DZ8A 4ZOLA 4ZEXA 3W6PA 4CODB 1VL6A 4MRVA 4B2LA 3AF4A 2B7LA 3DWIA 2BISA 4CMCA 1T6BY 1RCUA 2DLNA 3PA8A 2I9PA 3HCBA 1ZM3A 1F8FA 1Y48E 5KREA 5L7WA 2PSDA 4DV1B 2BFNA 1T26A 1WETA 3M1YA 3FUVA 1K7SN 1Q74A 3E3MA 1UM9A 1M72A 3F5QA 3WDMA 1T5SA 2PT7A 3ZZTA 4UTNA 4DV7B 1V71A 3LC0A 4HDMB 5HF9A 2NU6B 2C78A 4DKXA 2IS1A 1ND5A 1YCDA 2EL9A 2N9UA 4UXJA 1AKYA 4HN2A 2FGKA 3GCDA 1XEWX 1YMQA 2R5NA 3BEDA 1Z28A 2BWJA 1K1EA 5D6OA 5B7QA 4LF9B 1HTTA 3A7EA 1U02A 5C4IA 1AUQA 2UVDA 1YR2A 4LHZA 5AJWA 3VVMA 1ZAYA 1EZ1A 3Q7SA 3RBAA 2PGOA 2OV6A 5LQSA 5JSZA 1ECCA 3HSKA 2ZU6A 2RHCA 2RGAA 1J20A 1KC7A 3ZTWA 3WGTA 3N07A 3O2NA 4LA4A 3UOGA 2PZLA 3FDZB 1QZZA 4OHMA 3W5SA 4CJXA 5TT0A 2O7NA 5A2QA 5IWCA 3BMXA 3GJSA 2BM0A 2R85A 2OAQ1 2PQ6A 3C7AA 4ZPJA 4FPXA 4DMGA 1WO8A 1IB0A 4HGNA 2POQX 2YRWA 4DMFA 3AQIA 2IPXA 2XF2A 4NS1A 4BLSA 3BBPA 2B2XA 2Q3EA 5T67A 4BU0A 2HEGA 5L4SA 1JHXA 1PL6A 1BQ3A 1CB0A 3CEJA 4X20A 3VHQA 1SXGA 3TVDA 1MT0A 1JP7A 2G9UA 4G1BA 1PLKA 5I7UA 1YONA 3KU4A 4FE4A 3ANNA 3DJFA 3GDHA 3D81A 2ILTA 5KNDA 2EKQA 2IS4A 5EIFA 1SO8A 2P2ZA 2ZK7A 3IEIA 3GUVA 4A6DA 2FQ1A 1A7JA 4WLNA 1A7UA 2FPGB 3SOZA 1C7ZA 3OTWA 3R6GA 2AGVA 3BK1A 1FVHA 1QK4A 3DNPA 4G25A 4Y6PA 2ZTSA 3RRNA 4OU5A 2AN1A 4Y2XA 2FWBA 4YH1A 3L8YA 2F55A 2Y3IA 4RBNA 3JQAD 1N9KA 3TM4A 1JDJA 2CZGA 4TWJA 4LC9A 1QTRA 3QXJA 3K8YA 3KEFA 3WGNA 2A57A 2ZIWB 3MWEB 4OHZA 4CI9A 4OK6A 4F45A 3EQ2A 1ZKMA 1CUZA 1FFXA 4Q9AA 3PF9A 4RGYA 3FDJA 5CM9C 3H6KA 1QSGA 1YVUA 2WWGA 4QOSA 5IK2D 1JX6A 3E27A 1B41A 3QKSB 4W9MC 2FWPA 2R7NA 1YAHA 4BNNA 3D7RA 4PAMA 4MULA 5FTLA 1TKAA 1Z5OA 1JEJA 2SNIE 1ZRHA 2XB8A 1UDWA 2AK2A 3IE0A 5B53A 4B4VA 1QYXA 2H8GA 2ONYA 3WS7A 3ZV3A 1IHUA 1PGJA 1QGOA 3IVMA 4YLYA 5K0SA 4KFRA 4TVSA 4MWSA 4B7AA 5KX5F 1H9CA 3GJ5A 1TU3A 5CM8B 2EU8A 5HCNA 5KOYA 2GBLC 1Q57A 3CIOA 2BTOA 3BMQA 4DRZA 1Z4QA 1B73A 2R8YA 3W5AA 1FFEA 1MFPA 3FOCA 4HEJA 3DOFA 1NKTA 3IHLA 1TCCA 4PAGA 1MAHA 1NXVA 1RCTE 2JLAA 2VSOA 1EFVA 2PKRA 3B85A 2RGCA 4EPYA 1GFIA 2R1TB 5CJJA 5BQOA 3ESYA 3WKAA 4CL2A 1UOPA 1UAGA 5HCUA 2ZRLA 2VDQB 3FAZA 3MT9A 2IUUA 3ZHCA 3HE3A 4AO8A 2NPOA 5TNXA 3JZAA 5HIAA 3W5VA 1IQRA 3UUGA 2NZVG 1F2TA 2XQVA 1QYCA 4X1YA 1NQ5A 3HB1A 3C7CB 5JW6A 4YHBA 1QGYA 5KHAA 4EI7A 1X7WA 2QE7D 3W8DA 5CH3A 2QTVA 2EHDA 2F2TA 2HA0A 3VR5H 3FNGA 4AJEA 5DGCA 5DTQA 1P4GA 3R7AA 3EVNA 2GHIA 2YXPX 5C8VA 2I4LA 1J2TA 1WXEA 5DHRA 1NR1A 2DEUA 1A98A 2FMKA 2LCFA 1GGOA 1MEJA 3HJNA 4C0WA 4CT5A 3HJTA 1PTJA 3MBOA 1RTTA 4NBLA 1MOQA 1D03A 2O6HA 2O3TA 3AZQA 1N2HA 2FKNA 4FFVA 2PEYA 4GX5A 4KVAA 4AY2A 2REXB 4MGEA 4ODIA 1UM8A 2H5LA 3G7NA 4HTAA 4RKWA 5CK5A 5DHTA 3E4DA 3MG9A 3C8HA 3GNLA 3WL4A 4OC3A 3UAYA 5FL3A 4G4SP 2GK6A 5P21A 1IZYA 2C2ZA 3CZ9A 4FFWA 3HCPA 2G9ZA 4WJZA 1Y5IA 1OZFA 1Y89A 3PD0A 3N2NA 2RGUA 1J9EA 1RFGE 4H1UA 1XK7A 1NY6A 2CMHA 3SSMA 3T3EA 4I81A 3EC7A 3CXUA 2WD8A 2ZIAA 4C8CA 2PZEA 3PEWA 1NMEA 2XZLA 3H9CA 3DPSA 5CH8A 4GLOA 5K0NA 4PX3A 4MUBA 1GAJA 3JCZA 4FMCB 4BBPA 2W4QA 1G6KA 5JDCA 2JASA 3K0AA 5ER6A 5DGDA 1DJQA 1OAKA 4XVCA 4JQCA 1C3OA 4JYWA 3J81A 3M6VA 1RLTA 2FCAA 4Y1FA 1TQ6A 1X1AA 4ZA2A 2WFLB 3HNOA 3JU3A 4N7MA 4RCZA 4WKBA 1ZZGA 2CNWA 2EFGA 1D2AA 4KXLA 4U2CA 1KZ4A 4F5ZA 3IL2A 2XOEA 4KNYA 4LJLA 4S2UA 2AJCA 5GM2A 2JD1A 2XEGA 3TIVA 1LBEA 1UBGA 1BJTA 2PQ2A 3ABIA 3AK4A 2D2VA 2OBYA 2ZJAA 2VZ8A 3MQFA 3G2IA 4PG5A 3AEKB 2EGHA 2NXNA 3JZIA 3GEGA 3IUJA 2I1VB 1U1GA 2FZEA 1RAAA 4M1ZA 3QVXA 4L0QA 4X24A 1VLLA 3KOXA 3FCOA 3QV1A 3KLPX 4TMXA 5DHSA 5ALQA 3SX4A 4TYPA 4YJ3A 1O54A 2VJOA 3FMFA 1WY5A 3EFHA 1UBHS 4UMDA 4CEHA 2NQ8A 2IBSA 3NT4A 1V8DA 1E69A 5ISMA 1GZ4A 3I9LA 1IXRC 3KHSA 1G64A 3P0FA 2AVDA 1YJQA 3Q88A 2R751 4LIPD 4UUQA 4AJIA 1N0IA 1C3OB 2BFBB 2Y1CA 4UTPA 1D6JA 2X8JA 4LZWA 4DT1B 1KO7A 2B8EA 2BMEA 1T2VA 2DKNA 1XK6A 2KI5A 2QAJA 2VHQA 2VYFA 2YIMA 2YZGA 3FNHA 4J4BA 5TQ0B 4C05A 3AL0C 4H1WA 3PHIA 1JQLB 3GJ6A 4WCFC 4NHEA 3CLRC 5ALFA 1E77A 3MYYA 4FWIB 2QRHA 4FBMA 5I47A 4TLBA 2ZYDA 2OBLA 4JUIA 3G1WA 5GZ3A 5K0BA 2QN9A 4JEMA 1FYFA 3V2HA 1DC4A 4AM8A 2AHRA 2O0HA 3VNSA 4Z9FA 3RF7A 3MFYA 2C82A 2BP7A 3EZLA 4FMPA 1QF7A 2WM2A 4JGGA 3WMGA 1F4VA 2IWHA 1DVRA 2V7UA 2EDCA 3BL8A 4FFOA 3U3OA 2XGJA 4OHWA 5B1HA 3O73A 3RAFC 4C6TB 2VQSA 2GD1O 3THOA 3OZ7A 3QK7A 4C5CA 5F77A 3D6TB 4K3VA 5ECYA 4FB5A 3D7FA 3F3KA 3ZS9A 1BVHA 1OLUA 4ZAZA 2GP4A 2AE2A 4F3TA 3BGWA 1KQNA 4HGRA 4P1ZA 3LT0A 1GUFA 1KI2A 2LPMA 3IQGX 4QJ4A 2ZEJA 1LNSA 5CU7A 1QU2A 1VRCA 4WGFA 1TIBA 3OZDA 5JC1A 3ZGNA 2OHJA 3AHFA 4B40A 2V96A 4YTEA 1PS9A 2NSYA 3AKCA 3QBJA 3L7MA 3WGZA 1E6CA 2CGEA 2YH2A 3BF7A 4QDKA 2J3LA 5K6TA 1M10A 2CCJA 2IY9A 1L4EA 1MJGM 4Q9IA 5JSQA 3V4FA 1PR9A 2HYDA 4Q7QA 1GGEA 2AMLA 1E7MA 4NBTA 3B5EA 1WXDA 4OQQA 3OZFA 4RA9A 1JFFB 1ISHA 3ZVLA 4FYVA 2GN4A 2NU7A 5JNVA 3KJFA 2M98A 2WHEA 1J7JA 1VBFA 3MD0A 3LX5A 4OEHA 1C8BA 1F3OA 2OC4A 5H1YA 3TNDA 5G4KA 4H27A 2WY2D 1YI0A 1PL0A 2HDNB 3MJSA 4W9RA 2WVJA 5BSWA 5J2UF 4AI6A 4C8PA 5JRDS 2CV0A 2GZ3A 3WZ2A 1VG1A 1XLTC 3UY4A 5JLJA 4JI0B 2M1ZA 2PMBA 3PITA 4R8VA 5FH9A 3EEBA 4KH1A 4RETA 4XPIA 4N0MA 1NBWB 3SFTA 4ESOA 1HUQA 1KF0A 1NNSA 2YWGA 3K6SB 3MLBA 4R2HA 4DZTA 4RTNA 4JN6B 4WHMA 2CMFA 4R6XA 1O9BA 4OHPA 4CQMD 3W2EA 1WMEA 4REOA 4FZJA 3FMVA 2ZS8A 4HHEA 5MGBA 3ISVA 2HF8A 4DA4A 3MINB 5CB4B 2FETA 1TQ2A 4N3AA 1QZ3A 1H0SA 1NTRA 3JYQA 1G20B 1U94A 4QGGA 3QX3A 4J7UA 3WLPA 1EMDA 5C3UA 3DXZA 3HMKA 2RKOA 1N6RA 4WA8A 3UJ9A 1VGQA 5E1OA 4DBZA 3PEVA 4QRHA 2C2MA 2JIDA 3QLVC 4KIJA 5D5QA 4F85A 5JFOA 5KTSA 1FSSA 3H2ZA 3FRIA 3MJ4A 2CXPA 3GA7A 4JGIA 2AMFA 1ORDA 2WUDA 4V02A 4YCCA 1L7XA 3SIPA 5HILA 3DBHA 2RJ3A 4O4IB 1X94A 2DTXA 5JDCC 3RYCA 3IQWA 4NL4H 2WG2A 2CFRA 1YZKA 3OQHA 1Q7RA 3H2YA 4TJXA 2AZ4A 3KHKA 5DWQA 1E7QA 3TEMA 3H04A 4G0YA 4WZBE 5EUQB 4N6OA 4MO2A 3D1JA 1EFHA 5DPMA 3UA4A 1H94A 2MP0A 2BHTA 3AHDA 3EVBA 2OY0A 2V7XA 4HDKB 1Z4OA 5F4BA 3GLIA 1OB2A 1AXRA 1N7IA 2KLBA 1RJDA 1F4PA 2A5GA 2Q6OA 2WPDD 2Z83A 1X13A 3OFVA 4R1QA 4TT3A 4V0LA 2PKQO 5IC5A 3W05A 3O8BA 4MI3A 1F6WA 2JGDA 3AEYA 3MGKA 5TDHA 4AMBA 4KR2A 4JDPA 1FDSA 3GOHA 4GPD1 5DK4A 4OQDA 3PCRB 5D3KA 4J6FA 1OASA 1T0PA 1TCUA 3FTFA 2EK8A 3T5CA 4FKBA 2QLLA 4LXUA 5D7NA 5BSFA 3T1YB 1L0BA 3CKKA 1M2JA 1TYDE 3MA0A 3HPQA 4I5DA 3UC9A 1U1FA 3IBYA 1HR0B 1OXVA 3SYKA 2QW1A 2XQIA 3KVNA 1QKJA 1SKAA 1ORRA 3JALB 1P81A 2Y1EA 4GR5A 4M9QA 5CTAA 4GPBA 2DLCX 1GZVA 2RK3A 4GZMA 4PONA 3PPXA 5HSGA 4LJ5A 4N03A 5K7SA 4J9UE 1G0NA 1V2HE 1ZGHA 2J1LA 5DYIA 1AV6A 3WTBA 4OB8A 3L93A 4GC9A 4TMZA 5GGXA 4EH1A 5E2IA 2O59A 1NNUA 1KVUA 4JZ0A 3U7JA 1RLMA 1OH6A 5HJEA 1GPAA 3BCHA 1N9GA 5U4QA 1E3WA 2JI9A 5HA5A 1L8AA 3ABZA 4BBZA 5LR6A 1URPA 2JFXA 3PFFA 2HT6A 2JPDA 3Q41A 3DE5X 4IS3A 1W581 4YREA 4U6SA 3PB3A 3W4JA 4IQFA 2O4CA 3ZHTA 5BV2P 4KFUA 3R2JA 2Q4TA 1QC5B 1C8KA 3NHLA 1JPNA 3NIWA 4GLFA 4L4UA 4W8GA 5L53A 1YZ3A 1EU1A 2RJOA 3DSRA 3F2IA 4QPZA 1KIAA 2H3EA 4B09A 5B4UA 1FXWF 4B3RB 1RAIA 4YCLA 4ARCA 2QJFA 1KBOA 1UP4A 3NTOA 4M7OA 4CW7A 1DAHA 2O8BB 2OO3A 4NJOA 5FPQA 2K6GA 3AXSA 1JA9A 1JQ5A 4M0KA 1V4NA 3L1KA 3B70A 3FLAA 4KQXA 4RVNA 4HOYA 2J9GA 1L5QA 1RI5A 2VTBB 1EHCA 2C9BA 2O4UX 2FSVA 2GERA 1HYQA 3GIDA 3HHPA 5DHQA 3OF5A 4PZ0A 4L72A 3ML1A 5DT2A 1E9CA 1VE7A 2WLTA 3CR7A 2BW0A 1WHSB 2PZGA 1OZGA 1Y3AA 1E1RD 2JCVA 1SHTX 4MYCA 4D8VA 1RZ3A 5I7SA 2RD2A 4LRYA 3ZHVA 1Z37A 2GWRA 1CUYA 1YDFA 2FZLA 4B9EA 3PLAE 1RBQA 5A06A 5FDFA 3GN1A 1CZRA 2HN9A 2PLWA 3QNMA 3WP1B 4C99A 5C0OE 3QMWA 2Y68A 3OIFA 5DLQC 4ZTZB 1P3Y1 3PNLA 1X80B 1YBHA 2V5UA 4EX7A 3HACA 1G8FA 5TMBA 3U80A 3RK4A 4EVQA 1QOZA 4LK3A 2ETVA 4HDCA 4B6RA 2IXAA 3TS1A 2JCGA 2NO6A 4C21A 2A30A 5IS2A 4GMHA 4ND2A 1B0PA 3BZBA 4MS1A 4JXKA 5HBRA 4D92A 4NAVA 4ZCPA 1XF1A 2OWEA 1S3GA 3BL5A 5EERA 5IWAB 3SBEA 4P5PA 4FS8A 4KODA 1B6TA 2A14A 1TEVA 2VCYA 1VE9A 3GK3A 3HJCA 4RK6A 2HTEA 4R2LA 3H11A 1FXWA 4G4IA 3E9RA 4JK3A 3L4BC 3W0LB 3R7WB 1SPXA 1VHWA 2ZJOA 3QV2A 2HA2A 4JI1B 4EOGA 3ZWYA 3T34A 4YJFA 2H2GA 4MQBA 2OXTA 4BNKA 3UQZA 1CEYA 3ZYCA 1TAUA 1EFKA 2J7KA 4EY3A 4BWGA 1LX7A 1TTTA 1F0YA 2QVCA 4X65B 4K3UA 5L6MB 1ZH2A 4UNQA 2EL7A 2CHUA 3QVUA 4I4TF 3UATA 2IYVA 3QLTA 1JG7A 3BMCB 2GPSA 4XUCA 1NVAA 2OD9A 6GPBA 4WSOA 4EYSA 3ZNOA 5C37A 4NMHA 3IA7A 3K20A 4BO8A 1SCQA 5JADA 2R1VA 2ZBGA 2ZRGA 4Q48A 1JDPA 3VMFA 1XTIA 2OBMA 3QXCA 2YJ4A 1T0JB 4EVIA 4M7PA 3UAOA 2PK3A 3UJ8A 4F21A 1GDTA 2D0OA 3DCNA 4BNWA 4ER5A 5JU6A 2X4GA 3GMIA 1C4KA 2KSQA 1IXSB 4HK4A 4CZ1A 1N75A 4W5HA 1MO2A 1V11B 2QVBA 2ZBRA 4P3XA 4R4JA 1NIJA 1L7MA 3DAGA 3UJ3X 2FEWB 5C51B 2DQYA 1CE8A 2P7IA 1UWLA 3LCUA 3LGSA 1UWVA 4PHHA 5HIIA 3V00A 1ZISA 3WO0A 821PA 4TLEA 4S1WA 3AF1A 4F4CA 4E7OA 3TN7A 2O8EA 1CB7A 1NVKA 2HWUA 4KAXA 4ZN6A 2HMVA 1W94A 3LJKA 5INTA 2J0SA 3N2ZB 1MN6A 3H1FA 4LVCA 3VAZA 4PZDA 1F2DA 5DM60 4RTOA 3PQ5A 1HY3A 2XTAA 4G1UC 4ME6A 3BRWA 3PWSA 3SQMA 3QVWA 3WOHA 3VR6H 5KOHB 1PNOA 1RP7A 2FHSA 2LV8A 3B1YA 2BI4A 3VTFA 4HQKA 2JDID 3TPZA 4QXPA 3A3OA 1EWVA 3NH6A 3UV7A 3GLGA 3CGGA 3ZPXA 5L3QB 5A02A 1CFZA 5GIPE 3T8YA 1D1PA 4MGHA 3OKFA 4AJLA 3DR5A 2WTBA 3X0DA 5LDGA 2ZGVA 1A27A 2PYDA 2P90A 5JCJA 4BFTA 2QYOA 3UG7A 3HDTA 3D1VA 4BVJA 5GJWC 4P7JA 3ZU6A 1AKQA 4D3YA 3F7OA 1J0AA 2B5WA 1VCHA 2ON6A 4UZEA 1EDEA 3CSUA 4AD8A 4KMOA 3H75A 2ZYWX 2CL0X 2PX3A 4LQ4A 2NOAA 3BSFA 4U5XA 2EW1A 4F06A 4LRWA 4GU5A 5AVSA 2P2YA 4CV3A 2D5IA 5T4EA 4YV0A 1FTNA 4FYJA 1RM0A 2IP2A 1UJMA 4V03A 1O97C 4M1EA 3P2MA 4L3WA 3O9VA 5DWVA 1NP3A 3MIIA 2FR8C 4P22A 4DMKA 4DREA 2ZATA 4ZQIA 4MR7A 2HNBA 1YWGO 1XE3A 2O7SA 3I2HA 4US0R 1T5IA 3U5TA 1VPDA 5DBEX 1X7XB 1TO6A 2QTCA 1NLFA 4TWIA 3GGPA 2CDAA 2WJHA 3QVOA 1XZHA 1SBHA 2K2QB 1NPTO 1RPTA 5DXFA 1P5JA 2HDHA 4D3DA 3VR4A 3EQ8A 1A8QA 1TYBE 2YFKA 4WW0A 2I7VA 2QZ4A 1T2NA 2W2XA 4FMDF 4DJJA 4ZHQF 2UUAB 4UHEA 1YRAA 1M1NB 4WCDA 4PANA 4Q34A 2FE4A 4EAQA 1D6MA 2HPHA 3X1DA 4C0KA 1I30A 3LS2A 3AEQB 1ADBA 2Q50A 1YRYE 3JARA 3MCWA 1JG4A 2YZNA 1W0KA 2J6BA 3O92A 4TWBA 4BQIA 4D97A 5D1NA 3GX1A 1REQA 4KNVA 1XUOA 1YC2A 3OJ0A 5CTJA 4JNKA 1AQ6A 3OJOA 2ZVPX 2RBGA 5IDXA 2OSBA 3C6QA 4BMCA 3IEMA 2YHSA 1LLCA 3SLKA 5E9QA 4DWOA 2YN4A 3JVDA 3QXSA 4WFIA 2PMFA 1CR4A 1FS4A 3D5QA 3JALA 3JVVA 4EITA 1SK9A 3KDAA 1FFBA 4BFUA 2HJVA 5LQNA 1LC0A 4W9NA 3G9XA 1BH6A 4WZBA 4P9NA 2ECQA 4UTZA 4L51A 4P84A 4JEIA 4Q1EA 3W3ZB 1Z12A 2CNOA 4JR1A 1U7TA 4IWXA 1FFWA 2EFJA 5A4KA 4BO4A 1IXYA 1JAYA 3GFQA 1OTHA 4KGVA 3FROA 1RWOA 3NXKA 2PUAA 3H0CA 2WNSA 3BDIA 4QUAA 2HTFA 1PD0A 1NONA 1UXOA 5K6RA 1K6MA 1MO6A 2ZSEA 3AFHA 4IY1A 1VPLA 4RESA 1YDMA 3IE1A 2N3ZA 2YY6A 3LX4A 1M8PA 3FYCA 4HRVA 4K88A 2IDJA 2R84A 1OXBB 3DAPA 3LVQE 1UFKA 1BVUA 4ZKEA 4C30A 1Z06A 4DXAA 2II6A 2P9ZA 3GD7A 4L6CA 4A3SA 4JSRA 2BEVB 1YBAA 4FC7A 4XWYA 4NIMA 4MV1A 5TLSA 5JXGA 1P6QA 4OMEA 1P80A 4KKVA 3SEQA 1B00A 1C1DA 1VHJA 3MAJA 4A0GA 2Q5FA 3PHGA 1FJXA 2IXDA 3HI6A 3L8HA 2P9CA 4GKAA 2YJTD 1DFIA 1SKQA 2GM9A 2OAP1 1J33A 2ENUA 2CYAA 3ECSA 1Q0HA 5CB0A 1RZUA 3SHTA 1VL1A 4XTRA 5IT0A 3QWIA 3RSOA 1P4HA 3LQYA 2YMMA 1Y81A 1HZZC 4BRSA 3KB2A 1V8FA 3RIXA 4FIDA 1YU9A 2OV2A 4PBTA 3WIUA 1EXMA 1SY7A 2WSLA 2WYUA 3DMDA 1ZR2A 1KH2A 1YZHA 1M75A 1KMQA 1WABA 3RKUA 2WTEA 4UQOA 1YDGA 1DV1A 5TEVA 5EVCA 5BXYA 5KYWB 4U2KA 5LNK6 3UO8B 3HKBA 3ZDAA 5MFPA 1JR3A 3GLHE 3VNVA 5C4MA 4MWZA 3RC3A 4ZI7F 1G8SA 2FG6C 4NJEA 2NVUA 3HXQA 3GCXA 2AI2A 5E4TA 2ZKIA 1PW7A 1WP4A 4EPTA 5I5GA 4BRUA 1SWVA 1QVWA 1XVTA 3PUYA 3OG9A 5FPSA 1L5SA 1D9ZA 2AFIA 3STVA 1QG0A 4ZO7A 3HKCA 2QG4A 3GJZA 3DTVB 4MH0R 1N6LA 3M2TA 3WWPA 4US2R 3QLUC 3CLSD 3D4OA 3N2GB 4RHXA 2XD9A 1X7ZB 2WTUA 4TYWA 4KRGA 2RI6A 3RCBA 1C8VB 2PT6A 2IU6A 4WY5A 2O07A 3E5HA 4LTDA 3V7NA 3R41A 5BWCA 1N5RA 2VAXA 1NWHA 3N2YA 3TVTA 4I0WB 1MABB 1Y7LA 1GQYA 4GM0A 2B8TA 5GINE 4MAFA 4XJTA 4ZVTA 4JODA 4JLDA 4XOUA 1X19A 2C0QA 4Y2SA 4UFPA 5BVGA 5J4HA 5JYDA 1ZJ5A 1KYQA 4BAGA 5JJLA 4RDIA 3PXDA 9MHTA 1N32B 2ONZA 3V8EA 3PIRA 4G3XA 1L5MA 1VI2A 2JIQA 4MR9B 1QAQA 3OOHA 5C8ZA 4IXNA 1RE0A 2ZAMA 1MTOA 3EGXB 4XPZA 4I50F 4Y6SA 1W59A 3X1MA 1IZ7A 1DAGA 2WZCA 2YW9A 4CR8A 3KASA 4LQGA 3OFSA 1XD2A 1R5OA 3LRXA 4QDTA 3VPGA 4EB6A 1Z7BA 5ES4B 5E6SB 3K0KA 4ES6A 5FCDA 1G63A 1L5KA 3KT6A 4C6TA 2IYLD 3FPBA 4I4TA 3ZVRA 5E6UA 3QFSA 1HYEA 2BOVA 3SJGA 4Q1BA 1L7RA 1ZNWA 3COJA 3CW9A 3ROXA 4ALIA 2NYVA 2FEPA 4ZYVA 3ESDA 3HBJA 3EMDA 2WA1A 3OM9A 1QDEA 2QRKA 3OMXA 4LGMA 3DLAA 2EC5A 1ISPA 3TL3A 4R84A 3X1YA 3KT3A 3W2TA 2BE9A 4LJKA 2ZTLA 3LQQA 2G0TA 3M0EA 2G40A 1ESEA 3VVLA 4GVXA 1TKRA 4KR0A 4EHIA 3KUXA 4PRKA 2RHWA 3J81k 1L7DA 4N4AA 2EJUA 1TPYA 4DDWA 3TLJA 1NJ1A 4R9VA 1KYXA 1HKHA 1SGWA 3CFYA 2XKBA 5FHQA 1NUAA 4EW1A 3ZWCA 5K8UA 2P9EA 1OX5A 2PFKA 4FR2A 1BD3A 3G85A 4K9KA 5FOWA 3CIFA 4ENTA 4OK3A 3TSYA 3I9KA 1HPLA 3B3AA 2VXOA 1CJSA 1K3TA 3FPKA 1YC5A 1M5UA 1Y3BE 5AKLA 5HMMA 3U1TA 1L9KA 4UARA 1HLFA 1G3MA 4GPZA 2NP6A 2DTDA 3JQBC 2RI1A 2BFPA 1KO1A 4U4AA 1Z5VA 3V2UA 4LMBA 3N28A 5CB4F 2V8BA 5KYKA 5F2KA 4JT4A 3C97A 2Q2QA 3HCNA 1JJ7A 4UBMA 1ZX1A 3AM4A 1OJ7A 4IJMA 5IU6A 4G5YA 1DTEA 1KO8A 1DTWB 2VEOA 3C70A 2PV0A 1XTUA 3K9QO 5H8WA 4P35A 1PVDA 3Q7IA 2Q5LA 1AKVA 2XUQA 3DC7A 3QHQA 2BBWA 1C7JA 4N7JA 1GTL1 3CUSA 4IZ6A 4DXDA 6ABPA 1Q11A 3M6WA 1D2CA 1XRPA 2OKGA 2P62A 1Y6GA 3N6VA 5T4FA 3D7HA 1W35A 1SXQA 3RS7A 1M73E 3I61A 1JI0A 1UIMA 1U7XA 5ALTA 1PWHA 1DOZA 1XVIA 2IYOA 2X4IA 3IUNA 3TRIA 1NI4A 1ST2A 3RREA 5CLFA 5I3ZA 3PJRA 5FWXA 5IT4A 4ZOQI 1DX9A 3OF2A 2Q4EA 3BL6A 4G24A 4TXLA 2D1QA 5KNBD 5CJPA 4Z9YA 1ZIPA 3PWKA 1JIJA 4YI3A 3QA3E 2BH9A 2I1QA 3RAPR 1ETHA 2LKCA 3DUFB 2PH1A 3JZFA 1HE4A 1I4EB 2HF9A 3HCOA 3PQ8A 4D96A 1K6IA 4P5DA 2CZCA 1DG3A 4MRAA 3FUWA 1VXOA 3VPAA 5AW3A 2BGUA 1JR3D 1J5XA 1G8AA 1L3BA 1KJNA 1EGVB 1JIXA 2QR5A 2MIIA 2WU3A 1Z5ZA 4I9GA 4MV8A 4OXQA 3K0EA 4TROA 5C5DA 1XBTA 3IUMA 5TGZA 3U3JA 4UU0A 3HCAA 3JQ7A 3WNQA 4LC1A 2TRSB 5DV9A 1RC0A 2P9JA 1POXA 3SNKA 1L5OA 4NYJQ 4UQPA 3UXMA 4DWWA 1QIHA 4BEWA 2HQRA 2EWMA 5F2NA 4YA6A 2YWHA 3RS4A 2IA5A 2QXYA 3GCWA 1M66A 4QYIA 3UKDA 3ZGVA 4CBVA 4DQXA 3GMSA 2W6PA 3LUGA 4RA6B 4D0LB 4NH0A 1M1YB 1BGWA 1YZYA 2P1DA 3P9ZA 1WPRA 3I6BA 4EW3A 4RPLA 4QQ8A 4C9UA 4E88A 1G3QA 5FAXA 4FQ5A 2WQ6A 3OQ6A 4Z9AA 3ETCA 1MHPA 3FZYA 2VH2A 4CF7A 4AUKA 3ITDA 4BNFA 1Q83A 1XCGB 3SPXA 4JMPA 1XCPA 4DV5B 2WSYB 5CG1A 4G89A 4RPCA 1RYHA 2YR0A 4RZHA 1TAGA 3OWOA 4DCCA 1STOA 2WOOA 2R1TA 2XMSA 1D2GA 3UXYA 4OX9B 4JI6B 5IT5A 2I33A 3NWEA 4IIGA 4LECA 1FEZA 4XIJA 5AUQA 4R0MA 4XWTA 5M34A 4MUYA 4GT1A 3OQIA 5E2BA 3M7IA 3SMVA 3NP9A 4K5QA 1BS1A 2G6BA 3I64A 2ISSD 3TK1A 3MHTA 4K9RA 3UUWA 3CNOA 4N5DA 4FFRA 3V8RA 5LQKA 2OEPA 3IMCA 4ENPA 4DUGA 3C4VA 1KEEB 4CTMA 5C7LO 1GNLA 1PR5A 1ZNQO 3P0RA 2OGSA 4KGXA 4XSVA 4MI1A 2VF2A 2IEZA 5BV1A 4IIYA 3G8BA 4Q00A 4ZFNA 1Y1PA 1YULA 1H6BA 1DV2A 3FTPA 4JSTA 4NMMA 5LU9A 5FPPA 3CG0A 5DMXA 1OVGA 2EP7A 2REBA 2YWFA 3KU1A 4WFJA 2GK3A 2PS9A 1NNLA 1Y3FE 3CWZA 3MBIA 4M36A 3T9DA 3AQ4A 1MW8X 2ZZNA 3DT8A 4FGKA 2VZ9A 5CAEA 1E2IA 4NGRA 3ZKAA 1WDTA 3M89A 1H3NA 4GXNA 1IY8A 1ZBQA 1B26A 3A0RB 4OOEA 4CMEC 1W76A 2FLKA 2GK4A 4Y6LA 2A5JA 4MW4A 3MWEA 4PX2A 3CW2A 2RHBA 4JZYA 2I6XA 4INZA 4F2DA 5FTNA 3CZMA 5D01A 2Q28A 4GZ6A 5AI6A 4YS6A 1K4MA 4L8GA 1JZTA 1WVGA 4WLVA 3H19A 1OJLA 4Q19A 5ELYA 1ZK4A 2QXUA 2JCYA 3JQPA 4MVWA 5JJ5A 1OFGA 1FXSA 4DSUA 4DA6A 2Y99A 2XB9A 5CXQA 1R5NA 3VR4D 1JALA 1SHLA 1EESA 3NATA 3EXEB 3K35A 2O5RA 2C5QA 4EYEA 3LQRA 2QUKA 3F98A 5CYOA 3LI2A 4BRWA 4V1CA 5H0IA 5IUJC 2CSXA 1Y1LA 2VP2A 5EYPB 3KWMA 4NHOA 2HRCA 3A4YA 2YWRA 4XD7D 2Y4NA 5EE5B 2GF9A 5BYJA 4ITRC 2WU4A 5DOVA 1C7IA 2BC9A 1KEVA 4JB3A 1WXQA 1OTYA 3SEZA 2FUKA 2OZEA 2W5UA 2Z2IA 3DZCA 1S4QA 4JB2A 1GRQA 4UVHA 1RNLA 1SB9A 2B20A 4IJUA 4JIMA 3OCZA 4A9AA 4N65A 1ULBA 4NZYA 2F48A 3OEHD 1XMIA 3AEUB 1BU8A 5DULA 4ZVVA 1BYUA 4OK5A 4TYQA 4F3CA 1PBNA 2GA8A 2H4JA 4L1KA 2A35A 1TGYA 4EPWA 2H9AA 1AG9A 1YZGA 2JARA 4D8UA 3TPFA 3THYB 4DR6B 1CU1A 4BUJA 3AY0A 3S8MA 3FHLA 3KV1A 3ONNA 5EMJA 2PG3A 1E18A 4IDEA 4Y67A 3IUYA 3BHMA 4GX0A 3BFKA 2QT9A 4UXIA 4CKWB 2DR0A 5IJ9A 3H05A 3TE6A 4GKKB 2WAAA 4FD3A 3CLSC 5JAOA 1Q21A 3O31A 3E6AA 1E4EB 4V0RA 1DRJA 1GPH1 1VKJA 2VH1A 1II9A 3W5JA 5AW4A 2OCPA 4M83A 3EGXA 2VHTA 1N7GA 1PEDA 3WIOA 2RC5A 5FFNA 5KNCA 1RMQA 4WNAB 2C7VA 3FKSA 3KR2A 2WVAA 4YUZA 1QGED 2ODWA 2VJQA 1I2DA 2GESA 4AKSA 5JXIA 4DV0B 1YACA 3BE5A 1D1QA 1NW4A 2A59A 5D3MB 3WQRA 1F1BA 3NX4A 1XPOA 3TD6A 3LPAA 3Q9SA 1IBKB 2OOKA 3URKA 4DLAA 2APJA 3LYAA 4F2GA 2YCLA 4RD2A 4ZOLB 3USZA 2R2GA 4DLZA 3IJRA 3GFTA 4KQ2A 1SVMA 2ZB8A 3OZWA 2PVCA 4B6SA 3QUTA 1P18A 4I7EA 5CEEA 4ACBA 1U0EA 3MTDA 1QJCA 3HZZA 2YASA 2Q6KA 5CCDA 4UAVA 4RHYA 4U8HA 3UAGA 4PQGA 1M83A 3G1TA 3GH3A 3G59A 4W9NC 3U3RA 1UUFA 4PLFA 3BH7A 2Z4TA 1GQFA 2Q4RA 3K1AA 4ER3A 3U1BA 2Z6VA 3C98A 4Q9LA 2CLEB 2I67A 2VHXA 1NWCA 4QOEA 5KDDA 1KWGA 3H3JA 1I1HA 2GSDA 2DBZA 4C29A 4MQFB 2HHJA 2WG1A 4G5RA 4P3NA 5CEFA 1W73A 3LZ6A 1U7UA 3ZJ5A 4CDJA 2I6SA 3B7GA 3NEYA 1H2ZA 4HDNB 1YZFA 4QPJC 2V6FA 4ZAFA 2V6GA 5EJ5A 4FEAA 2VXBA 5BW6B 3JPWA 1SFRA 1CVIA 3GYGA 4FJ2A 4PBRA 3TZBA 4AZ0B 3EX7C 3AUAA 1P5FA 1F8GA 1YXMA 4GKVA 1B8UA 4TS9A 1I6LA 1X8XA 1U99A 1EA5A 1HDZA 2JAWA 5BSEA 2BMDA 3QVKA 1DT5A 1ZINA 2P9HA 2M6SA 3MMNA 5JCPA 3EGDA 4GOKA 4GS5A 1U9JA 3DCIA 1ARZA 4KDEA 4K28A 3S9NA 1FP1D 4IFIA 4NOKA 1R66A 4RL6A 5FJJA 3ZOZA 5BN3A 4NGPA 3GDFA 4HEA6 1B15A 5FWYA 4WDQA 4JOQA 1V5WA 3LW8A 3LRPA 3U81A 2I6QA 3FNEA 3PL1A 1EK2A 1L8LA 3JV7A 1UZUA 4QBGB 4P36A 3HO1A 1ADFA 1JN0A 3QW2A 4JUAA 3THSA 3G8AA 4GMFA 5IVIA 3U40A 3A4VA 3O7WA 1PV1A 3AC0A 2Q5OA 5CHYA 1SC1A 3VUEA 1VPTA 4OM7A 4GOMD 2R1UA 1QB7A 3BI0A 3IMFA 2QGFA 1ODIA 1J00A 5KVSA 4OQNA 1S5PA 4UJ5A 4N12A 3AF5A 1JSCA 3MWKA 4E5SA 1BKYA 5IH7A 3WL6A 4B46A 1PFWA 4CG0A 4DABA 1VGRA 1VIDA 3JAKA 4PO9A 5KZMB 1Q6ZA 3NGMA 4FLMA 2EG5A 2AZDA 1I6KA 4LNAA 4GIBA 3RYIB 1L5HB 4W99A 1DCMA 4DVGA 1K7XB 2UKDA 3QQ5A 1EDOA 1L1QA 3PC8C 2GWHA 2VA9A 1TFRA 1ZU5A 4XGQA 5H3HA 3T12A 3TZ6A 4G85A 4BN4A 2YVKA 2FOLA 4OX9Y 2ZAGA 1CZNA 1U8AA 3FDZA 1N1DA 3NOXA 4YAUA 4BE9A 3C3MA 2D0PA 3RRJA 4CTKA 4BFLA 3MSXA 1VCOA 1BMTA 4G5QA 4HB0A 3SJ7A 1K88A 1XWIA 4BN0A 4N76A 5AM3A 1K75A 1ZJJA 2OECA 3EC2A 1YZVA 2YWXA 4V2IA 3Q72A 2Z3ZA 4B4OA 4TKZA 4BX8A 1L8OA 2AN4A 3NBAA 3ITNA 3RC2A 1A2KC 4R3WA 3P32A 4Q7EA 1Z83A 4RPGA 3CO5A 5KSOA 2OENG 5C80A 2NADA 4WVFA 1SOAA 1Z75A 1XDZA 1D4ZA 5L3SA 2HJGA 4TL8A 2R25B 1E92A 2WA2A 4WE3A 1KI1A 3RRXA 3QFFA 4RSHA 3SF0A 2IXBA 4AF7A 3MLAA 3C4JA 3H7AA 5DBFA 4WESA 4DDUA 1P2SA 2NSJA 2DF8A 1VGVA 3MHPA 5K6AA 1YI1A 2DAPA 2GEFA 4L73A 5SYMA 3ZHQA 5ARBA 1LPPA 5THXA 4ECEA 5B37A 2YXLA 2XOXA 2FUCA 4OQYA 1NXOA 4R7ZA 3RRZA 5HZMA 1I2BA 2BDUA 2ZTMA 4PLZA 5AOCA 1F7UA 3U7QB 1GO2A 1AGRA 3WC4A 2X42A 2BKLA 1EP9A 3GBSA 1YR6A 3BIOA 3KJNA 3OQBA 3P0IA 4FIZA 4Z1OA 2XKKA 4RJKA 2OUIA 2VYCA 3ZK8A 4P44A 3I23A 1PJLA 5DTMA 2XCRB 1G6HA 2XAUA 4MW9A 3VAAA 2P69A 4EG6A 3OO0A 3L6DA 1GPLA 4RXMA 1CZOA 1XEFA 4PLTA 1VZ3A 4GICA 4LJ9A 4HUJA 3UHPA 5AKZA 5EIWA 4N9QA 4A82A 2MR5A 3A37A 2IHYA 2VR1A 2XT6A 1VMAA 5AWFC 1QDLB 1C29B 2VDVE 3X1KA 2ZI9A 3EZYA 4DGSA 3C5VA 4KAJA 1N7HA 5PGMA 3WSTA 2DPXA 2HO4A 1BRMA 1FRNA 2ZRQA 1MRZA 1U3FA 3DE6X 2JA1A 3QU4A 3A3KA 5FNVB 2FEMA 4ND3A 1T8SA 1DDGA 1IEWA 2WKRA 2YRXA 3QMVA 5HM6A 1ZRNA 3L84A 2Z1MA 1ZUNB 3H2SA 3O7MA 4WERA 2Q5HA 3OQ1A 4O2BA 3HUUA 4OHKA 3V80A 1QTQA 2JFVA 5ALLA 3UICA 3L7JA 3R74A 3VYSB 4J2OA 2RGEA 1KBLA 1IK4A 2YHAA 5ICEA 1USUA 4KXFB 5LBTA 2O8EB 2QLMA 4KQMA 4QBIA 3TB4A 1SC6A 5BSMA 3GNTA 2EX1A 2QU7A 3C6YA 1H2EA 1I01A 1HI9A 5DTJA 3TZEA 3U3KA 1CIPA 2WWWA 4X1KB 2ONJA 3SJBA 2XVYA 3DBVO 4YRSA 4XYMA 1EWTA 3RUFA 5JR3A 1OLXB 2BEUB 2I3AA 2WLSA 3KJQA 5CVJA 4U7GA 4RF2A 1E1QA 5B2ZA 4DIEA 3RYCB 1SG0A 2ACEA 1JLHA 5B7PA 2JIZA 3CBGA 3D2BA 1YBFA 4I4NA 4YRLA 4BNLA 3QEBZ 3W3AD 3E82A 3G82C 1D2NA 5J23A 4YMHA 1E79A 1EH5A 4N1AA 2B69A 1MO5A 3EWAA 2QKYA 4NPHA 3CX6A 2IPAB 4AJKA 1BXRB 2D0IA 4UNPA 1F6BA 1NRIA 5FBWB 4J90A 1Z4PX 3GFPA 2XDAA 5I4KA 4MRMB 1CV2A 1D07A 1NUTA 3RTBA 4P08A 3VNQA 5FL7D 3CPSA 4YRNA 3MWDB 2XYQA 5J1SB 1JH8A 2VH5R 4KQEA 4IH4A 2GN0A 1DNPA 3MIZA 4P4DA 1UFRA 2GEJA 2SBTA 3UF0A 3UOAB 3MRVA 4M46A 4ZC1A 1OWOA 5KPJA 2ZSKA 4DMMA 3TFOA 2CFSA 3ZX5A 1QRRA 5DEIA 4CIVA 3QEMA 3PNBA 3TRFA 4CMEA 3I3SR 4TMFA 5EWLA 4DNFA 3IDAA 2C7OA 1CERA 4OL9A 1U8TA 5E7MA 5AT1A 5FOVA 3IQHX 2XNDD 1XZ8A 2WYIA 2ZUSA 1L7NA 4AQ7A 2XNCA 1OHHD 1WCYA 3GVPA 4JQOA 4M49A 2BJVA 3PJGA 4P32A 4KV9A 2X5NA 1MW9X 4O8CA 5AW2A 3UEOA 4Z4FA 5DX0A 4QIHA 2A86A 3H5WA 3HBNA 3UPTA 1CJBA 3SQNA 2HMTA 3EDRA 5I7FA 3N3BC 1KY2A 3ZS8A 1XCMA 4BMVA 3KRTA 3QFCA 5AQ1A 3B48A 1BHJA 4I66A 1TB4A 3GVCA 4TMKA 4E21A 4CMJA 1DEKA 2IZOA 3HJGA 3IHWA 2OGTA 3AEXA 4DLXA 5ERYA 1I3MA 4EVSA 3OJCA 1YUNA 1M34B 3K72B 4HGQA 2C03A 2BMVA 2SICE 4ZV7A 4YV2A 4MMYB 5K4AA 3D6NB 3GT3A 4KK4A 5LA6B 3CUVA 2Q3CA 5IAGA 3F3SA 5CLIA 1Y8ZA 2B82A 2DM6A 4HNGA 4K81B 3H9QA 3L43A 1B2RA 3D31A 3TQRA 3V55A 1EUYA 3FOZA 4PPGA 1P2VA 3DT9A 2GJ4A 4K1LA 1DT3A 4PM4A 4ZT2A 3ONEA 4JI3B 1GGKA 4CM8B 2CCGA 4OKIA 1E99A 4RA6A 1N36B 2KMLA 1HK7A 1Q14A 2XRMA 3NDRA 1HDIA 4LWZA 2ZI6A 3UXEA 2J07A 3R8CA 1R12A 1NULA 4HTFA 4UPVA 4P53A 1KPGA 3QF7A 1C1XA 1NVFA 2RGXA 1ZK2A 3W78A 7ADHA 4JNCA 2YJTA 2I71A 5ALXA 1C30A 1ABFA 3FPGA 3HWWA 4XCVA 3DBLA 1SU6A 1A69A 2X86A 4PF1A 2ZJ7A 4D99A 2PM8A 5KYUA 5BMOA 1DCTA 1P3DA 1PFUA 5CVVA 3VTAA 4D25A 2QAGA 2XGMA 4GLBA 1M2HA 3RRYA 4ARVA 4QDZA 4I4IA 4UUOA 3C0KA 4NG5A 1QS0A 4QDJA 4MVXA 1EINA 1AN0A 2CUNA 1P2UA 2RK4A 3AINA 1QDUA 1IATA 2C07A 1M7HA 3EF0A 5IAOA 5B7GA 3NU1A 4NEGA 3TQSA 2CV2A 3Q1LA 3ICUA 1P77A 5A05A 4EKIA 2J41A 1W48A 3L82B 4C4TA 1HNNA 2DHQA 3N0XA 5G41A 5AW6A 5HQ3B 2YVAA 4TRJA 2QX9A 5BR1A 2WM8A 2GETA 3BG5A 3DCYA 1KH3A 1I36A 1NHGA 4IJ6A 3RTGA 4IIEA 1RHRA 4RTJA 3RABA 5FUYA 3RSCA 1ZH8A 1KY5A 4NDZA 4CHGA 5LKAA 3AJEA 2AQIA 5AM5A 5FEMA 2AKAB 3EYWA 3RR2A 3F8WA 4C3ZA 1OPXA 5IYZA 2I2CA 1KK3A 3NMUF 1U0RA 1EX7A 4R2XA 4N5MA 4QGHA 3DBIA 4BNJA 4ERNA 1QFXA 1UANA 2Y76A 4GM1A 3BDVA 1NFQA 3PVCA 10MHA 4U00A 1H42A 1FMFA 5TPZD 2VDKB 3ZY2A 3DXXA 3DZFA 2VSQA 1XZNA 2JGNA 2JGDB 3LHFA 1ND6A 1QHEA 1AQLA 3IBTA 3OQVA 5ESDA 1OPRA 2HSDA 4M86A 5EJ4A 2CVQA 4OLFA 2Y67A 5EESA 2G36A 3GLIB 1WLYA 3I9V6 3EN0A 3F5SA 1LK5A 1VZ2A 2GJSA 3E8MA 3AGPA 3AHJA 3HFGA 4UU7A 4BPRA 2CCKA 2CHVA 3LYUA 3R7BA 4BOYA 5JZMA 5MDHA 3B36A 3IAUA 2HU8A 3P52A 3WJ7A 5K45A 1GM5A 3RNLA 2GZHA 1C9NA 3L1UA 1MQ8B 5JMTA 4UMVA 1A82A 4BB9A 1BMDA 2FPPB 3R3JA 1RRFA 3X2EA 1CUXA 4UHJA 4G0UA 3PFWO 2DMRA 3DEKA 1L8QA 4D56A 2F7SA 4H7DA 3M4YA 3V42A 1GNRA 4LJ4A 4C7OA 4WN9A 4YASA 4EY6A 2O8FA 3QVVA 3JQEA 1GUAA 1GEGA 2UUBB 1WF6A 1KVRA 4O08A 3SD7A 2EZAA 2W6MA 2B1QA 3TDMA 2XTNA 3EY4A 1XZEA 3K5IA 4AO6A 5I51A 2QRQA 4O59O 1QF9A 1J4AA 3F90A 3TLGA 4D9FA 1CK4A 2GLUA 1NI5A 2J48A 3CLKA 4FDMA 1I4LD 1SIOA 3MC1A 4HNAA 4YK7A 2Q45A 2BI8A 4IFBA 3TB6A 2QT1A 3UMCA 3BXOA 3RJMA 1VQ1A 4UM9D 1JEQA 1NQAO 4BAZA 3V9AA 1GTRA 4LJAA 1XLTA 1Y98A 2YMLA 4KO1S 3SR4A 2R3SA 4XPIB 3GNQA 4E4YA 2X1MA 1OXTA 1NX6A 1QVZA 4RV5A 4RVFA 3SX0A 3F4KA 5JO0A 3BT7A 3TRDA 3ENNA 1JDTA 3FPCA 1DWOA 3CPJB 2DJIA 4G07A 4GQIA 2J9YB 1RQGA 3VJKA 4GH5A 4DYVA 4X94A 1FDOA 1OX6A 3NRBA 3HYTA 4BP9A 3PNVA 2O50A 4ZD6A 1QAMA 1E3JA 1XHLA 4F3KA 3L7CA 3SIXA 4TQUS 1WDWB 2J33A 4CIWA 2HUNA 1IOWA 3BB4A 3PZRA 4KPYA 4DM3A 2V7BA 5LSAA 3B1KA 1UWCA 2I3ZA 3R3HA 3OAAD 4G8CA 1XEAA 4IRMA 1L5RA 4J0FA 4HQ6A 3GQVA 2GT1A 5JE8A 4G67A 3C48A 1CQPA 1EKXA 4D0GA 2JZCA 4D9CA 3E84A 4U9HS 4M1WA 1S4MA 3C6KA 4HX2A 4Y6OA 1LFAA 3IX7A 1BE1A 3CRRA 5F33A 2P5TB 3BTVA 2QVGA 1M2VA 3A6DA 3VZRA 5K6AC 4D4MA 2WTMA 4DSZA 3VKWA 1U2ZA 3HRIA 5ARDA 4BE4A 4Z4IA 5EUCA 2QM3A 1LLDA 1YS2X 1RM3A 1ZD1A 1BW9A 3H9EO 2JEYA 3QPDA 4YQEA 4BYGA 4HNAB 3OCVA 4EMBA 1EFRA 2AXPA 1QF6A 2CBGA 1LTQA 5PNTA 4F9GA 1FDTA 2PS0A 1A7AA 3E9ZA 3GNSA 4L8VA 4NV1A 5B1DA 3TTTA 5LPNA 4JXZA 2XW6A 4IDNA 5HRUA 1UODA 4X8MA 2FMFA 2I78A 2IZ5A 1NBMA 3E22B 3DGFC 5I9BA 3TLKA 2IU4A 4MYHA 3TVYA 4ARSA 2IHJA 3UZUA 1POWA 4C7OB 3PP8A 4QGSA 4FKZA 5I8WA 4RMGA 1ZM2A 2FXVA 1SJ9A 1XTTA 2XUIA 4PYOA 1K8ZB 1PT5A 1SVKA 3KK0A 2XECA 3KOUA 3H3XA 3P9QA 3Q3JB 4J03A 3DMPA 3ICCA 4PZZA 1R0YA 1Y37A 1ZLYA 1K06A 5D29A 1TEXA 1QG6A 5TQ0A 1XNHA 2PPVA 2XMCA 3L4EA 1RQRA 2MJLA 4CU2A 5JVDF 1JAIA 2BZ0A 1JU9A 2ZJ1A 4O2AB 4K2AA 1KZGB 3E18A 3FPSA 4JX9A 4M0EA 1ODFA 2FP4A 5AVJA 3WBJA 2Y1XA 4H3SA 1P2FA 1O96B 4XD2A 4RK0A 5AHOA 4B44A 4CF3A 1PJAA 5EJ9A 3B89A 2WJGA 1KTIA 1O5TA 1BXZA 1SELA 5HKKD 1QQBA 2QJOA 2RGRA 1T2FA 3PGA1 3ZHZA 5DN9A 3I5UA 3OE7D 1L6RA 3MCAA 2GLXA 2ZI4A 1B7GO 3PVZA 1GV1A 4P7BA 1DLJA 1QV7A 3HGTA 2XUKA 5LDDC 3ZLBA 5IAEA 2VDOB 3RYHB 5IJWA 5DLPA 2OCAA 2VIIA 5IR2A 1B16A 1LFDB 1RM4A 4FLFA 1M9NA 3OPYB 3PYXA 4J29A 1EUQA 3JYPA 4JBXA 2WRZA 1U3DA 3AVVA 3IAFA 2AKEA 2FWNA 4QHTA 3TR0A 4GXTA 1V6CA 1KDYA 5J59A 2PMWB 1EJ2A 1JW9B 1UZMA 1Y42X 2AEMA 2ZI5A 3JR3A 3QH4A 4X92A 2DUMA 1BWPA 2EX0A 4IWNA 4DCSA 3DDUA 4BE7B 5C7OO 1EX1A 4B5LA 4IHKA 4QOIA 6AT1A 3NDBB 3COVA 2KLHA 1JEOA 1JHVA 3VPBA 1NVVR 2FW0A 2DBRA 3N6RA 5LLTA 1WPGA 2HUPA 3KDSE 4P81A 4PSKA 3W34A 4B7CA 5DNUA 4A6PA 1S9HA 2XDYA 3DZBA 4EJ6A 4TXHA 4QAJA 3KUDA 4OMCA 2C98A 5D3QA 3PQ3A 1QORA 3AEQA 4HMOA 3RYTC 1W36D 2XWBF 4U2DA 1QHFA 4D81A 1KPHA 2M6LA 4M0PA 2VS1A 2JJMA 1A8HA 1CWUA 1G6OA 5EZ6B 3VR5D 1RFLA 1E6UA 2XUHA 4BWFB 4DNXA 1ZZEA 2ASVA 1QIIA 2R65A 3A31A 5HJ7A 3MJHA 2O8DA 2F1OA 2VBGA 3VDMA 1GG5A 3HCDA 4C89A 5KYUB 1LBHA 1GXSB 1QX3A 4V0QA 4PWYA 2XR1A 4XIFA 4EY8A 2YOGA 1G1MA 3MS4A 1ENZA 4PC2A 3A7DA 3CH6A 1TA0A 4FYKA 3T5GA 1EHIA 5KOJB 1CRQA 4EBFA 1MIOB 1C1XB 3B82A 5AK0A 4N49A 2HXSA 3BC1A 1PJ2A 3T5MA 4OJYA 2XBUA 4WD3A 1ILEA 1DQRA 3WK5A 2IHVA 1VKZA 1WMAA 4WCVA 4Q37A 1EXDA 2HBQA 3EH2A 4NPCA 4NOMA 5AVXA 1WDMA 2PUTA 3KRVA 5UKDA 1NRWA 4X9XA 3MXOA 5IXSA 3BJRA 4EHDA 1J7KA 1G5QA 4NV3A 1ULSA 5HYVA 1G98A 5CFMA 2BAGA 1U4OA 4YMSA 2HU7A 3C8DA 3C45A 1PW5A 4FILA 4PN7A 3GFOA 3HKEA 4RX1A 3JQFC 4JL8A 4EA6A 4AX8A 5IZ4A 2Y2VA 1HTWA 3RIEA 5LLDA 2BLLA 4Q47A 2QI9C 3FA2A 4JELA 1IMOA 4PW0A 4G09A 3TL6A 2WM3A 3AO0B 1T1EA 4WUVA 3ILVA 4M7RA 4AWXA 4LF7B 4IRXA 4PC3A 5IM4F 4TSKA 1E0DA 2WM9B 3ZEAA 1AUXA 3CPEA 5DE3A 3L7OA 4B8YA 4E5DA 1XALA 1NRXA 1OXSC 2GYUA 1YIOA 1DBPA 3C7DB 4QREA 2QTLA 2GPBA 1C41A 2CJPA 3RU9A 3EZXA 1BXKA 3KWFA 3ZI0A 2Z2YA 2FMHA 1VI5A 1C9JA 1YS1X 5TC4A 2CDRA 3UYKA 4JITA 5LMNB 1XQ1A 3PQEA 4BUZA 4OU4A 2YS6A 2VTVA 1OC4A 4YBZA 2G9RA 3THWB 2F9FA 2R6GA 1F20A 2YZKA 4H08A 1BDBA 2RARA 3H1TA 1U80A 4IMRA 4JU9A 4AF6A 4Q3BA 4RO0A 4YUWA 1W2HA 2D0PB 2I22A 4MZDA 3RLFA 3W8FA 5BW8A 4CGZA 4OC0A 1NN0A 4NGQA 1OF1A 1WUKS 5ILQA 5BO5A 2FSPA 3B78A 4BVBA 1JEYA 2GEBA 4C0AC 2DWCA 5JALA 1JIQA 1N6NA 2ECKA 3FNFA 4FGLA 1RM5A 2BFEA 1A9XA 2FR0A 1U4SA 3QUCA 3QEKA 5CG2A 1DCFA 2WAYA 3GARA 3BMCA 4QJ3A 1UOEA 2UYHA 4PLPA 1KDPA 3QF4A 4P6VF 4JKYA 3C3CA 5FNVF 1EDDA 2D62A 4OC4A 3HL4A 3PLRA 4G5GA 3TG2A 1V7PC 2FN8A 1GRRA 2NTEA 3ESBA 1Q44A 3L7KA 3R6LA 2D2XA 3PNMA 1UJ4A 4L74A 5EIXA 3ED5A 4PGHA 1E1DA 4Y18A 5T4BA 3N2EA 1I14A 4I6GA 4BV8A 4EO9A 4WWHA 5AM1A 1FZTA 4L5JA 1HMPA 3LAWA 2VZLA 3MT7A 4DA9A 2HNKA 3ZBQA 1JLRA 1EIZA 4MLCA 1T8UA 5TARA 4NYMQ 3RS3A 5KKNB 1F8YA 2DWQA 1I8TA 1WXGA 2AYYA 5EHIA 2UXDB 2FM4A 2XVAA 2NUTA 2QW8A 3WGMA 2H0RA 1LWNA 2BEWB 1A97A 4HDOB 1UFQA 2FR8A 2H2FA 2UZ0A 4MVJG 4NSNA 1U4NA 3VC3A 1V1RB 3ESCA 4DQDA 1O94A 1N3BA 4R5HA 4ZP1A 5ADWA 2J09A 3LKVA 1HT3A 4Q3CA 1O6FA 1NE7A 2GPTA 5DCYA 4BIMA 1XXHB 2LIVA 3RK1A 1WULS 3QVGB 5CBPA 4R68A 1RWKA 3MQ4A 4HDNA 1GZ7A 4E31A 1I4DD 4QWWA 3N74A 3FOBA 1A88A 3ZCSA 1KZ6A 2HQBA 1E9SA 1MTZA 8ATCA 5AVRA 2H5JA 3NG1A 4UZSA 3JWJA 4MUXA 3FGZA 4MVJF 2DZDA 4P4NA 4I08A 1ZYMA 4ZT4A 4Y2QA 2CL6X 2XYHA 4PNZA 3TO5A 1KOGA 2VK8A 3OAAA 1AVTA 3CMMA 2QTNA 3LUHA 4G1CA 4TTPA 4WNIA 4YO8A 5I7VA 3BSWA 3JAWA 2VPPA 3ZWXA 4RKRA 3KXPA 1UJ2A 2JFFA 2YYAA 1S2IA 3EVCA 3RV3A 1QLHA 1NNI1 3E48A 5BWLA 1JYSA 4WL0A 4BGVA 2VHYA 2VTBA 2YV4A 5DCUA 5IARA 2FZKA 3FZGA 6NULA 1GAEO 5J40A 2PGDA 3GR6A 4FBLA 3UWDA 1CKEA 3BGSA 4NU0A 3ZCVA 2VQFB 2JHGA 2ATXA 3EDOA 2OMKA 4XM0A 1Z8LA 1Z6AA 1TC2A 2ADOA 4DPKA 2Y2UA 1V5GA 1NPDA 1N78A 1BMFA 1QC5A 2Y0DA 1T6YA 4FE7A 4PZLA 4YCBA 1XYGA 1T1SA 4QATA 3SYLA 1SZJG 5T64A 2XUZA 4B2PA 1JIIA 3AIKA 2D5BA 1NL3A 3LY9A 4I1YA 1OBOA 2GASA 2DECA 2K2WA 4LUCA 3SZOA 2ZE7A 4ZZ1A 2KX7A 3O94A 1NBEA 5G0SA 1CR2A 4GMDA 3VPXA 3JSXA 4BWYA 2X0JA 3PFBA 1GV0A 3ET4A 3JQAB 2C29D 4KI0A 3T0IA 4NGNA 2SCUB 2PZBA 4FT4A 4V0OA 4EW6A 1BWQA 4R69A 1TTQB 5ICMA 2AOUB 3PCTA 2NP7A 2RI0A 1DU4A 3L4BA 2ENWA 4MICA 2XUJA 4HN9A 2NTVA 5JWHA 5LKRA 1JFRA 3PR1A 4D41A 2GBIA 4C3OB 2ZOSA 2W6NA 3EVAA 1E2MA 1FVOA 1GT91 2HIMA 2OM2A 3DO6A 1QGUA 4JQSA 4NECA 4PR3A 4NS4A 1HFWA 2RMKA 1I24A 3P9YA 4IF6A 1YKGA 1Z38A 5AW5A 3EQ9A 5A5GA 1MX3A 3EFOB 3FPJA 1TUEA 4BJ6A 1IWOA 3TBHA 2X6QA 4WI1A 3VX3A 4X1IB 3T9EA 3L6BA 3OHSX 2FG5A 3UT5B 1PQYA 1U28A 5AHKA 4DHEA 2I29A 3HXKA 3IDQA 3GEDA 1BXGB 4B33A 3GZJA 4PG7A 3IMGA 1UKCA 4RHEA 4ZVUA 4EGSA 3JAKB 2WMYA 2ATCA 4L9AA 3P1JA 1PEYA 2CLIB 2VC2B 1XG5A 3KQVA 5DTRA 4MQLA 3N8IA 2CE2X 4L78A 5H5JA 1VJCA 2OHFA 2HMUA 2IIBA 2VJMA 2WWYA 3DA8A 1H6AA 3F6PA 1O77A 3KSUA 2Z8YA 4LRSB 2XUFA 4WK0B 2QP3A 5EYPA 2CXOA 1EFPB 5FRDA 5AK3A 5CDYA 3L7DA 4RY2A 3HYSA 1FVXA 1PFVA 5EHNA 3R9IA 3T7CA 1EFDN 1UBFA 5BN4A 2D7DA 5LJIA 4BJHB 3C1TA 1JTFA 3DVSX 2JIMA 4ZC8A 1N34B 2X1VA 3QJ5A 2BM9A 3MGCA 4NZ9A 4IJWA 1T25A 1CJKC 2HJRA 2VYND 4M0CA 5CIWA 1ODTC 3ZDQA 4DUZB 2C5SA 4RPHA 3RQSA 3OQMA 3UBTA 2DU8A 2CLFB 3AR9A 5DO9A 5D6NA 4X3CA 1DQZA 1EQUA 1R6XA 1ISGA 3I72A 4EQ6A 2DJ5A 4YAGA 3GQBB 1YE5A 3NLLA 1XKLA 2YWJA 3UWPA 4HYYA 3EIEA 1L4KA 4AZ0A 3DZHA 1Z4NA 1OFTA 4BNDB 4C2BA 2BGIA 4TN5A 4KGDA 1Y8QB 2RGBA 3ASVA 4QUEA 5EEHA 5LXTF 4CKBB 5ABPA 1Y3DE 3DBRA 3O9ZA 3JQ6A 1KC1A 4CN8A 4C84A 3FNIA 4CG2A 4ALLA 3BSSA 1F0NA 2DPGA 2P0EA 2C83A 1X2BA 2I62A 2WINI 2ZWOA 1UMCB 1Z29A 2QRJA 2ST1A 3OM0A 2HJWA 3U49A 4EG8A 4TZKA 3GCGA 121PA 3EE6A 4KYVA 4MKXA 3DVLA 5TVKA 5E0KB 3A6KA 1J3LA 1H3FA 2Y1FA 2OR4A 4FW9A 2UZIR 3W4IA 1HT2E 2JLWA 3GFBA 1NVBA 4N6NA 4EFKA 4BPBA 1DBQA 1MC1A 3I62A 1E79D 2FG7C 1SZDA 2XVMA 4NWIA 2BCGY 4P80A 1KAEA 1T1RA 3ZDFA 5IB9A 1VIMA 5SYAA 2JIZD 2FB9A 1UC4B 1SBCA 3HZHA 1YHNA 2FOIA 2IOFK 2B1GA 5I7RA 2AF4C 3B52X 4WBSA 2PZJA 3DKPA 2P6MA 2CJXA 3RFXA 1SQ6A 2FZ4A 4GI3A 2HLDA 4YMUA 2R4TA 2LWIA 3ICPA 5H3CA 1UOQA 4UPEA 3KQSA 4RK1A 2GMWA 1KK2A 1N1EA 1NW7A 1R6AA 2DHCA 3PXXA 3Q3EA 4FDLA 1FPMA 2NMVA 4QOFA 1TVCA 3EVEA 1YD7A 3DYBA 3GEIA 4FT2A 4QQNA 3SKVA 4DG9A 6Q21A 4JVLA 3T3GA 1A3CA 2JRCA 4YMIA 1IYZA 1V1JA 3AL2A 2JFBA 4OG2A 4B3FX 3TFQA 4MIKA 4X00A 2HPAA 2N1BA 3EXHA 1JJAA 1PFGA 3P2OA 5EPEA 3TLMA 4DB4A 5FQNA 3KCNA 4ZVQA 3EBOA 1EFTA 3KOYA 4MPDA 5KOJA 1IPEA 1KKMA 1WUHS 2BGMA 4XARA 1ZESA 1KYYA 2C00A 3D7NA 3R7LA 2DUWA 3OU6A 2OP1A 5J9FA 3FHTA 1KR5A 4BQQA 4PYRA 3DMFA 3O0DA 1H69A 3DL7A 3HN7A 4US1R 3WYEA 5KTRA 2VPQA 5LDHA 5AOAA 4RY8A 1VLJA 4HLDA 1L4LA 1SD2A 1DZ3A 5EGSA <