2YJVA

Crystal structure of e. coli regulator of ribonuclease activity a (rraa) bound to fragment of dead-box protein rhlb
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
158
structure length
158
Chain Sequence
KYDTSELCDIYQEDVNVVEPLFSNFGGRASFGGQIITVKCFEDNGLLYDLLEQNGRGRVLVVDGGGSVRRALVDAELARLAVQNEWEGLVIYGAVRQVDDLEELDIGIQAMAAIPVGAAGEGIGESDVRVNFGGVTFFSGDHLYADNTGIILSEDPLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Potential regulatory interactions of Escherichia coli RraA protein with DEAD-box helicases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase inhibitor/hydrolase
molecule keywords REGULATOR OF RIBONUCLEASE ACTIVITY A
total genus 50
structure length 158
sequence length 158
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2011-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03737 RraA-like Aldolase/RraA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.40 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Ribonuclease E inhibitor RraA/RraA-like 2yjvA00
2YJTA 2YJVA 3NOJA 2PCNA 3K4IA 1Q5XA 1VI4A 3C8OA 1NXJA 1J3LA
chains in the Genus database with same CATH superfamily
1ZRSA 3G23A 1DIKA 4OC5A 2HI6A 4C9UA 1XF1A 2C6GA 3FECA 4OMEA 4IIYA 3NOJA 4P45A 2B0AA 3BI1A 5F09A 3T05A 1VI4A 5F9MA 4YN3A 3D7HA 3FF3A 3TLGA 5K99A 2YJTA 4C9RA 2XEGA 3SJEA 5IB9A 3T5MA 4P4IA 1Q5XA 3U1BA 1JDEA 1J3LA 2EK8A 4IIXA 3I6SA 4MCSA 3SJGA 2AUMA 3EIFA 1JDBC 1DE4C 4CDKA 2D0PA 4OC3A 2JBJA 4P44A 2MP0A 3IWWA 5D29A 4C9VA 3TLEA 4J0NA 4OC0A 1KEEB 2EK9A 4COGA 1KC7A 1NBWA 2EZBA 3D7FA 1C30B 2PVVA 4OC2A 4EYSA 1A9XB 3SJXA 1Y9ZA 2DIKA 3S9LA 2HROA 3KASA 3VTAA 4C8PA 4P4EA 4C99A 1GGOA 3BHXA 2XEFA 4JZ0A 4M8DA 5JVLA 1VBGA 4OC1A 2OOTA 3TLYA 2C6CA 3K4IA 4C9AA 4C8FA 4MCRA 4NGNA 1KBLA 4C8UA 3C8OA 2CIJA 1EZAA 2XEIA 4CZ1A 3D7DA 2HWGA 1ZYMA 3FEDA 3I74A 4NGPA 4P4FA 3T07A 1M6VB 4H1HA 4NGRA 2AUNA 1CX8A 2GP4A 4P4DA 1ZL0A 5F1YA 4LQGA 3T0TA 3TLAA 2EZCA 3TLZA 4NGQA 4NGSA 3IIBA 1C3OB 3TLBA 3TLCA 3ICUA 3K9TA 4C8TA 4E5SA 3S9NA 2D0OA 4CDJA 5FD8A 3EZBA 4C8AA 5IR2A 3EZEA 4MCPA 2E28A 1R61A 4TWEA 3SJFA 4C8CA 1CS0B 4P4JA 3TYXA 4TJXA 5JYBA 1CE8B 4JYWA 3S9MA 4CO9A 4P4BA 3D7GA 4E94A 3GJZA 2PVWA 4TJVA 2C5QA 4COBA 4OC4A 1EZBA 4C84A 1BXRB 2R82A 4MCQA 2C6PA 1T36B 1NXJA 3RBUA 4C86A 5F5XA 2EZAA 4C9EA 2PCNA 4INJA 3FEEA 3KRVA 1V6CA 2OR4A 4MI1A 2OLSA 3BI0A 1Z8LA 2FM4A 1VBHA 4KNGE 2X0SA 2XEJA 2YJVA 4MJXA 4W9YA 4JVOA 4NGMA 2JBKA 3SR3A 3BXMA 4NGTA 3TLGB 1WVMA 4X3RA 4C85A 3EZAA 5ELYA
chains in the Genus database with same CATH topology
2YJTA 2YJVA 3NOJA 2PCNA 3K4IA 1Q5XA 1VI4A 3C8OA 1NXJA 1J3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YJT A;  2YJV A;  3NOJ A;  2PCN A;  3K4I A;  1Q5X A;  1VI4 A;  3C8O A;  1NXJ A;  1J3L A; 
#chains in the Genus database with same CATH topology
 1ZRS A;  3G23 A;  1DIK A;  4OC5 A;  2HI6 A;  4C9U A;  1XF1 A;  2C6G A;  3FEC A;  4OME A;  4IIY A;  3NOJ A;  4P45 A;  2B0A A;  3BI1 A;  5F09 A;  3T05 A;  1VI4 A;  5F9M A;  4YN3 A;  3D7H A;  3FF3 A;  3TLG A;  5K99 A;  2YJT A;  4C9R A;  2XEG A;  3SJE A;  5IB9 A;  3T5M A;  4P4I A;  1Q5X A;  3U1B A;  1JDE A;  1J3L A;  2EK8 A;  4IIX A;  3I6S A;  4MCS A;  3SJG A;  2AUM A;  3EIF A;  1JDB C;  1DE4 C;  4CDK A;  2D0P A;  4OC3 A;  2JBJ A;  4P44 A;  2MP0 A;  3IWW A;  5D29 A;  4C9V A;  3TLE A;  4J0N A;  4OC0 A;  1KEE B;  2EK9 A;  4COG A;  1KC7 A;  1NBW A;  2EZB A;  3D7F A;  1C30 B;  2PVV A;  4OC2 A;  4EYS A;  1A9X B;  3SJX A;  1Y9Z A;  2DIK A;  3S9L A;  2HRO A;  3KAS A;  3VTA A;  4C8P A;  4P4E A;  4C99 A;  1GGO A;  3BHX A;  2XEF A;  4JZ0 A;  4M8D A;  5JVL A;  1VBG A;  4OC1 A;  2OOT A;  3TLY A;  2C6C A;  3K4I A;  4C9A A;  4C8F A;  4MCR A;  4NGN A;  1KBL A;  4C8U A;  3C8O A;  2CIJ A;  1EZA A;  2XEI A;  4CZ1 A;  3D7D A;  2HWG A;  1ZYM A;  3FED A;  3I74 A;  4NGP A;  4P4F A;  3T07 A;  1M6V B;  4H1H A;  4NGR A;  2AUN A;  1CX8 A;  2GP4 A;  4P4D A;  1ZL0 A;  5F1Y A;  4LQG A;  3T0T A;  3TLA A;  2EZC A;  3TLZ A;  4NGQ A;  4NGS A;  3IIB A;  1C3O B;  3TLB A;  3TLC A;  3ICU A;  3K9T A;  4C8T A;  4E5S A;  3S9N A;  2D0O A;  4CDJ A;  5FD8 A;  3EZB A;  4C8A A;  5IR2 A;  3EZE A;  4MCP A;  2E28 A;  1R61 A;  4TWE A;  3SJF A;  4C8C A;  1CS0 B;  4P4J A;  3TYX A;  4TJX A;  5JYB A;  1CE8 B;  4JYW A;  3S9M A;  4CO9 A;  4P4B A;  3D7G A;  4E94 A;  3GJZ A;  2PVW A;  4TJV A;  2C5Q A;  4COB A;  4OC4 A;  1EZB A;  4C84 A;  1BXR B;  2R82 A;  4MCQ A;  2C6P A;  1T36 B;  1NXJ A;  3RBU A;  4C86 A;  5F5X A;  2EZA A;  4C9E A;  2PCN A;  4INJ A;  3FEE A;  3KRV A;  1V6C A;  2OR4 A;  4MI1 A;  2OLS A;  3BI0 A;  1Z8L A;  2FM4 A;  1VBH A;  4KNG E;  2X0S A;  2XEJ A;  2YJV A;  4MJX A;  4W9Y A;  4JVO A;  4NGM A;  2JBK A;  3SR3 A;  3BXM A;  4NGT A;  3TLG B;  1WVM A;  4X3R A;  4C85 A;  3EZA A;  5ELY A; 
#chains in the Genus database with same CATH homology
 2YJT A;  2YJV A;  3NOJ A;  2PCN A;  3K4I A;  1Q5X A;  1VI4 A;  3C8O A;  1NXJ A;  1J3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...