2YJVA

Crystal structure of e. coli regulator of ribonuclease activity a (rraa) bound to fragment of dead-box protein rhlb
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
158
structure length
158
Chain Sequence
KYDTSELCDIYQEDVNVVEPLFSNFGGRASFGGQIITVKCFEDNGLLYDLLEQNGRGRVLVVDGGGSVRRALVDAELARLAVQNEWEGLVIYGAVRQVDDLEELDIGIQAMAAIPVGAAGEGIGESDVRVNFGGVTFFSGDHLYADNTGIILSEDPLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Potential regulatory interactions of Escherichia coli RraA protein with DEAD-box helicases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase inhibitor/hydrolase
molecule keywords REGULATOR OF RIBONUCLEASE ACTIVITY A
total genus 50
structure length 158
sequence length 158
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2011-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03737 RraA-like Aldolase/RraA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.40 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Ribonuclease E inhibitor RraA/RraA-like 2yjvA00
1Q5XA 3C8OA 1VI4A 3K4IA 2YJTA 1J3LA 2PCNA 2YJVA 1NXJA 3NOJA
chains in the Genus database with same CATH superfamily
2HI6A 3TLGB 2OR4A 4MI1A 4C9EA 2JBJA 3VTAA 3FECA 1C3OB 4TJXA 4EYSA 4C86A 3SR3A 5JVLA 2XEGA 3BHXA 4P4FA 4KNGE 4H1HA 4C8AA 1ZRSA 2DIKA 2XEFA 3SJEA 4COBA 1JDBC 2X0SA 3K9TA 4IIYA 4NGTA 3T05A 4OC3A 3TLEA 4P45A 4MCPA 3U1BA 1T36B 2EZAA 3IIBA 3TYXA 1DIKA 4JYWA 4M8DA 3TLCA 4CO9A 4COGA 2C6PA 3C8OA 3D7HA 3D7DA 4NGSA 4P4EA 4P4IA 2OLSA 4NGRA 4C85A 2AUMA 1XF1A 2R82A 2HROA 1EZAA 4W9YA 3TLZA 2D0PA 4NGNA 1GGOA 2C5QA 1Z8LA 5IR2A 3TLAA 4NGPA 5F5XA 3TLBA 4C8UA 1WVMA 4LQGA 4C99A 5K99A 1NBWA 3KASA 4OC1A 1CX8A 4P4JA 2GP4A 4MCRA 2CIJA 4C9VA 4C8PA 1VBHA 3T07A 2B0AA 4C9AA 1M6VB 3RBUA 2YJTA 3D7FA 3IWWA 5F1YA 1V6CA 2PVVA 1NXJA 4E5SA 3S9NA 2D0OA 1KC7A 3K4IA 3EZEA 4NGQA 1J3LA 3T5MA 5FD8A 3G23A 1CS0B 3BI1A 3T0TA 2EK8A 1Q5XA 5ELYA 2C6CA 4JVOA 4OC0A 5F09A 3FEDA 3BI0A 1VBGA 2XEJA 3SJXA 5JYBA 2AUNA 1Y9ZA 1CE8B 2EK9A 3GJZA 3FEEA 3KRVA 4INJA 4X3RA 1ZYMA 4C8TA 4CDJA 2PCNA 3ICUA 4P44A 3TLYA 4C84A 1KBLA 1JDEA 4MCQA 3EZAA 4OC4A 5F9MA 2MP0A 4C8FA 1KEEB 4JZ0A 4C9RA 4CZ1A 2OOTA 2EZCA 3I74A 1C30B 5IB9A 3EIFA 4C9UA 4OC2A 4YN3A 1EZBA 2HWGA 4MJXA 4OC5A 2YJVA 1ZL0A 4OMEA 3SJFA 2JBKA 4C8CA 2E28A 4P4BA 4J0NA 2FM4A 3I6SA 1R61A 1A9XB 2XEIA 3D7GA 4IIXA 3SJGA 2PVWA 3S9LA 1VI4A 3EZBA 4TWEA 2EZBA 4NGMA 3S9MA 3NOJA 3BXMA 5D29A 3FF3A 4E94A 4CDKA 4MCSA 3TLGA 4TJVA 4P4DA 1BXRB 1DE4C 2C6GA
chains in the Genus database with same CATH topology
1Q5XA 3C8OA 1VI4A 3K4IA 2YJTA 1J3LA 2PCNA 2YJVA 1NXJA 3NOJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q5X A;  3C8O A;  1VI4 A;  3K4I A;  2YJT A;  1J3L A;  2PCN A;  2YJV A;  1NXJ A;  3NOJ A; 
#chains in the Genus database with same CATH topology
 2HI6 A;  3TLG B;  2OR4 A;  4MI1 A;  4C9E A;  2JBJ A;  3VTA A;  3FEC A;  1C3O B;  4TJX A;  4EYS A;  4C86 A;  3SR3 A;  5JVL A;  2XEG A;  3BHX A;  4P4F A;  4KNG E;  4H1H A;  4C8A A;  1ZRS A;  2DIK A;  2XEF A;  3SJE A;  4COB A;  1JDB C;  2X0S A;  3K9T A;  4IIY A;  4NGT A;  3T05 A;  4OC3 A;  3TLE A;  4P45 A;  4MCP A;  3U1B A;  1T36 B;  2EZA A;  3IIB A;  3TYX A;  1DIK A;  4JYW A;  4M8D A;  3TLC A;  4CO9 A;  4COG A;  2C6P A;  3C8O A;  3D7H A;  3D7D A;  4NGS A;  4P4E A;  4P4I A;  2OLS A;  4NGR A;  4C85 A;  2AUM A;  1XF1 A;  2R82 A;  2HRO A;  1EZA A;  4W9Y A;  3TLZ A;  2D0P A;  4NGN A;  1GGO A;  2C5Q A;  1Z8L A;  5IR2 A;  3TLA A;  4NGP A;  5F5X A;  3TLB A;  4C8U A;  1WVM A;  4LQG A;  4C99 A;  5K99 A;  1NBW A;  3KAS A;  4OC1 A;  1CX8 A;  4P4J A;  2GP4 A;  4MCR A;  2CIJ A;  4C9V A;  4C8P A;  1VBH A;  3T07 A;  2B0A A;  4C9A A;  1M6V B;  3RBU A;  2YJT A;  3D7F A;  3IWW A;  5F1Y A;  1V6C A;  2PVV A;  1NXJ A;  4E5S A;  3S9N A;  2D0O A;  1KC7 A;  3K4I A;  3EZE A;  4NGQ A;  1J3L A;  3T5M A;  5FD8 A;  3G23 A;  1CS0 B;  3BI1 A;  3T0T A;  2EK8 A;  1Q5X A;  5ELY A;  2C6C A;  4JVO A;  4OC0 A;  5F09 A;  3FED A;  3BI0 A;  1VBG A;  2XEJ A;  3SJX A;  5JYB A;  2AUN A;  1Y9Z A;  1CE8 B;  2EK9 A;  3GJZ A;  3FEE A;  3KRV A;  4INJ A;  4X3R A;  1ZYM A;  4C8T A;  4CDJ A;  2PCN A;  3ICU A;  4P44 A;  3TLY A;  4C84 A;  1KBL A;  1JDE A;  4MCQ A;  3EZA A;  4OC4 A;  5F9M A;  2MP0 A;  4C8F A;  1KEE B;  4JZ0 A;  4C9R A;  4CZ1 A;  2OOT A;  2EZC A;  3I74 A;  1C30 B;  5IB9 A;  3EIF A;  4C9U A;  4OC2 A;  4YN3 A;  1EZB A;  2HWG A;  4MJX A;  4OC5 A;  2YJV A;  1ZL0 A;  4OME A;  3SJF A;  2JBK A;  4C8C A;  2E28 A;  4P4B A;  4J0N A;  2FM4 A;  3I6S A;  1R61 A;  1A9X B;  2XEI A;  3D7G A;  4IIX A;  3SJG A;  2PVW A;  3S9L A;  1VI4 A;  3EZB A;  4TWE A;  2EZB A;  4NGM A;  3S9M A;  3NOJ A;  3BXM A;  5D29 A;  3FF3 A;  4E94 A;  4CDK A;  4MCS A;  3TLG A;  4TJV A;  4P4D A;  1BXR B;  1DE4 C;  2C6G A; 
#chains in the Genus database with same CATH homology
 1Q5X A;  3C8O A;  1VI4 A;  3K4I A;  2YJT A;  1J3L A;  2PCN A;  2YJV A;  1NXJ A;  3NOJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...