2YJVA

Crystal structure of e. coli regulator of ribonuclease activity a (rraa) bound to fragment of dead-box protein rhlb
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
158
structure length
158
Chain Sequence
KYDTSELCDIYQEDVNVVEPLFSNFGGRASFGGQIITVKCFEDNGLLYDLLEQNGRGRVLVVDGGGSVRRALVDAELARLAVQNEWEGLVIYGAVRQVDDLEELDIGIQAMAAIPVGAAGEGIGESDVRVNFGGVTFFSGDHLYADNTGIILSEDPLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor/hydrolase
molecule keywords REGULATOR OF RIBONUCLEASE ACTIVITY A
publication title Potential regulatory interactions of Escherichia coli RraA protein with DEAD-box helicases.
pubmed doi rcsb
source organism Escherichia coli
total genus 50
structure length 158
sequence length 158
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2011-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03737 RraA-like Aldolase/RraA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.40 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Ribonuclease E inhibitor RraA/RraA-like 2yjvA00
1Q5XA 2PCNA 3NOJA 2YJTA 1J3LA 2YJVA 1NXJA 1VI4A 3K4IA 3C8OA
chains in the Genus database with same CATH superfamily
5JYBA 1C3OB 5FD8A 4C9RA 1KEEB 5ELYA 5F09A 4C8FA 1DE4C 3BI0A 3C8OA 5D29A 2PVWA 5F5XA 4CDJA 1M6VB 2YJTA 4P4BA 4OC4A 1CS0B 3I6SA 1JDEA 2XEIA 3G23A 3KRVA 3I74A 4H1HA 3GJZA 3D7DA 2JBJA 1WVMA 2XEJA 3ICUA 2R82A 2B0AA 4C84A 4P4FA 4C9UA 1J3LA 1VBGA 4C8UA 3KASA 4LQGA 2XEFA 3EZAA 2FM4A 3TLGB 4EYSA 4MCQA 1BXRB 3S9MA 4C86A 4X3RA 2EZBA 2C6GA 2HI6A 3K4IA 2AUMA 3D7GA 3K9TA 4C8CA 4CO9A 4MCPA 4OC1A 3FECA 4TJXA 2C5QA 4MCSA 4NGMA 1A9XB 4P44A 2OLSA 4OC5A 3IIBA 4COBA 3TLGA 3S9LA 4C8PA 4INJA 4TJVA 4JVOA 3T0TA 3U1BA 4NGNA 3T05A 4IIXA 4C8AA 3S9NA 1VI4A 1V6CA 2E28A 4COGA 4E94A 4J0NA 4JZ0A 4NGQA 2AUNA 3FF3A 4NGSA 2EZCA 1Q5XA 3D7FA 4MCRA 2EK9A 1EZAA 3IWWA 3SR3A 4NGPA 3SJGA 3EZEA 4C8TA 2HROA 2EK8A 2D0PA 3SJEA 4OC2A 2DIKA 4P4DA 1Z8LA 2OOTA 1ZRSA 4CZ1A 3TLAA 3TLCA 3BHXA 2PCNA 3VTAA 2HWGA 1XF1A 4C9EA 5JVLA 2EZAA 3T07A 1DIKA 2PVVA 5IR2A 4YN3A 2C6CA 3TYXA 2X0SA 2C6PA 3RBUA 1R61A 3SJXA 4P45A 4C9AA 1CE8B 4P4IA 1EZBA 4OC3A 2XEGA 3FEDA 1C30B 4IIYA 1CX8A 1T36B 1ZYMA 4NGTA 1Y9ZA 1NBWA 1GGOA 4MI1A 4W9YA 3BI1A 4NGRA 4P4JA 2D0OA 2CIJA 1ZL0A 4CDKA 2GP4A 3TLZA 1VBHA 4TWEA 3EIFA 4P4EA 5F1YA 3TLYA 4C85A 2YJVA 1NXJA 2MP0A 2OR4A 4C99A 4M8DA 3BXMA 1KC7A 4MJXA 3SJFA 4E5SA 3NOJA 5K99A 2JBKA 3D7HA 3TLBA 5IB9A 3EZBA 4OC0A 3T5MA 4C9VA 5F9MA 1KBLA 4OMEA 1JDBC 3TLEA 3FEEA 4KNGE 4JYWA
chains in the Genus database with same CATH topology
1Q5XA 2PCNA 3NOJA 2YJTA 1J3LA 2YJVA 1NXJA 1VI4A 3K4IA 3C8OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q5X A;  2PCN A;  3NOJ A;  2YJT A;  1J3L A;  2YJV A;  1NXJ A;  1VI4 A;  3K4I A;  3C8O A; 
#chains in the Genus database with same CATH topology
 5JYB A;  1C3O B;  5FD8 A;  4C9R A;  1KEE B;  5ELY A;  5F09 A;  4C8F A;  1DE4 C;  3BI0 A;  3C8O A;  5D29 A;  2PVW A;  5F5X A;  4CDJ A;  1M6V B;  2YJT A;  4P4B A;  4OC4 A;  1CS0 B;  3I6S A;  1JDE A;  2XEI A;  3G23 A;  3KRV A;  3I74 A;  4H1H A;  3GJZ A;  3D7D A;  2JBJ A;  1WVM A;  2XEJ A;  3ICU A;  2R82 A;  2B0A A;  4C84 A;  4P4F A;  4C9U A;  1J3L A;  1VBG A;  4C8U A;  3KAS A;  4LQG A;  2XEF A;  3EZA A;  2FM4 A;  3TLG B;  4EYS A;  4MCQ A;  1BXR B;  3S9M A;  4C86 A;  4X3R A;  2EZB A;  2C6G A;  2HI6 A;  3K4I A;  2AUM A;  3D7G A;  3K9T A;  4C8C A;  4CO9 A;  4MCP A;  4OC1 A;  3FEC A;  4TJX A;  2C5Q A;  4MCS A;  4NGM A;  1A9X B;  4P44 A;  2OLS A;  4OC5 A;  3IIB A;  4COB A;  3TLG A;  3S9L A;  4C8P A;  4INJ A;  4TJV A;  4JVO A;  3T0T A;  3U1B A;  4NGN A;  3T05 A;  4IIX A;  4C8A A;  3S9N A;  1VI4 A;  1V6C A;  2E28 A;  4COG A;  4E94 A;  4J0N A;  4JZ0 A;  4NGQ A;  2AUN A;  3FF3 A;  4NGS A;  2EZC A;  1Q5X A;  3D7F A;  4MCR A;  2EK9 A;  1EZA A;  3IWW A;  3SR3 A;  4NGP A;  3SJG A;  3EZE A;  4C8T A;  2HRO A;  2EK8 A;  2D0P A;  3SJE A;  4OC2 A;  2DIK A;  4P4D A;  1Z8L A;  2OOT A;  1ZRS A;  4CZ1 A;  3TLA A;  3TLC A;  3BHX A;  2PCN A;  3VTA A;  2HWG A;  1XF1 A;  4C9E A;  5JVL A;  2EZA A;  3T07 A;  1DIK A;  2PVV A;  5IR2 A;  4YN3 A;  2C6C A;  3TYX A;  2X0S A;  2C6P A;  3RBU A;  1R61 A;  3SJX A;  4P45 A;  4C9A A;  1CE8 B;  4P4I A;  1EZB A;  4OC3 A;  2XEG A;  3FED A;  1C30 B;  4IIY A;  1CX8 A;  1T36 B;  1ZYM A;  4NGT A;  1Y9Z A;  1NBW A;  1GGO A;  4MI1 A;  4W9Y A;  3BI1 A;  4NGR A;  4P4J A;  2D0O A;  2CIJ A;  1ZL0 A;  4CDK A;  2GP4 A;  3TLZ A;  1VBH A;  4TWE A;  3EIF A;  4P4E A;  5F1Y A;  3TLY A;  4C85 A;  2YJV A;  1NXJ A;  2MP0 A;  2OR4 A;  4C99 A;  4M8D A;  3BXM A;  1KC7 A;  4MJX A;  3SJF A;  4E5S A;  3NOJ A;  5K99 A;  2JBK A;  3D7H A;  3TLB A;  5IB9 A;  3EZB A;  4OC0 A;  3T5M A;  4C9V A;  5F9M A;  1KBL A;  4OME A;  1JDB C;  3TLE A;  3FEE A;  4KNG E;  4JYW A; 
#chains in the Genus database with same CATH homology
 1Q5X A;  2PCN A;  3NOJ A;  2YJT A;  1J3L A;  2YJV A;  1NXJ A;  1VI4 A;  3K4I A;  3C8O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...