2YJVA

Crystal structure of e. coli regulator of ribonuclease activity a (rraa) bound to fragment of dead-box protein rhlb
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
158
structure length
158
Chain Sequence
KYDTSELCDIYQEDVNVVEPLFSNFGGRASFGGQIITVKCFEDNGLLYDLLEQNGRGRVLVVDGGGSVRRALVDAELARLAVQNEWEGLVIYGAVRQVDDLEELDIGIQAMAAIPVGAAGEGIGESDVRVNFGGVTFFSGDHLYADNTGIILSEDPLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REGULATOR OF RIBONUCLEASE ACTIVITY A
publication title Potential regulatory interactions of Escherichia coli RraA protein with DEAD-box helicases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase inhibitor/hydrolase
total genus 50
structure length 158
sequence length 158
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2011-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03737 RraA-like Aldolase/RraA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.40 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Ribonuclease E inhibitor RraA/RraA-like 2yjvA00
3K4IA 3C8OA 2PCNA 3NOJA 2YJTA 1VI4A 1Q5XA 1J3LA 2YJVA 1NXJA
chains in the Genus database with same CATH superfamily
2E28A 4TJXA 4MCQA 3S9NA 2R82A 1Z8LA 1CX8A 1ZRSA 3BI0A 2YJVA 3ICUA 2EZAA 4M8DA 1A9XB 1EZBA 5FD8A 3GJZA 4MJXA 4IIXA 4C9AA 4OC5A 5ELYA 5D29A 3EZEA 3D7GA 4TWEA 1ZL0A 2GP4A 3G23A 3I6SA 1XF1A 4OC0A 4LQGA 4CDKA 1VI4A 1R61A 1CE8B 1Y9ZA 4C8CA 4MCSA 4TJVA 1WVMA 4X3RA 4INJA 4C8UA 2HI6A 3D7FA 1Q5XA 3VTAA 4OC3A 1JDBC 3TLAA 4NGNA 4P45A 3S9LA 3EZAA 5F09A 1VBGA 4YN3A 4W9YA 1JDEA 2AUMA 4EYSA 5K99A 5JVLA 2FM4A 2XEGA 2EZCA 3KASA 3NOJA 4C9VA 4COBA 4P4JA 2B0AA 2OLSA 3FEDA 1BXRB 2D0OA 3FEEA 4OC4A 3BI1A 4MCPA 5IR2A 4C8FA 3D7DA 2PCNA 4CDJA 4MI1A 4C8TA 1T36B 3SJEA 3EIFA 5F1YA 3T05A 4COGA 1DIKA 1KC7A 4J0NA 2XEJA 2EZBA 4OC2A 2OOTA 3T0TA 1VBHA 3T5MA 2AUNA 4C84A 1KEEB 2JBJA 2OR4A 4NGRA 4C8AA 2D0PA 3RBUA 4C8PA 3T07A 4OC1A 1GGOA 1CS0B 2PVVA 2X0SA 4OMEA 3TLGB 4H1HA 3TLYA 3TLCA 4P44A 3KRVA 3I74A 2YJTA 4NGSA 4MCRA 4E5SA 2XEFA 4NGMA 4P4FA 4CZ1A 2MP0A 3U1BA 3TLGA 3TLZA 4IIYA 4P4BA 4P4EA 3SR3A 3BXMA 4P4IA 3K4IA 4JZ0A 4C86A 4E94A 4C9UA 5IB9A 4JYWA 2C6GA 3SJXA 4NGQA 1J3LA 2PVWA 1C30B 3S9MA 3FF3A 1C3OB 4C85A 1V6CA 2CIJA 3BHXA 5F9MA 3C8OA 4NGPA 3IWWA 3TLEA 2C6CA 2EK9A 4KNGE 1ZYMA 4C9EA 2C5QA 5F5XA 1KBLA 3FECA 2EK8A 3D7HA 3K9TA 3SJFA 3TLBA 1EZAA 4C99A 1DE4C 2DIKA 4P4DA 3TYXA 1NBWA 1M6VB 2JBKA 4JVOA 2HWGA 4C9RA 2XEIA 4NGTA 3EZBA 4CO9A 5JYBA 2HROA 1NXJA 3SJGA 2C6PA 3IIBA
chains in the Genus database with same CATH topology
3K4IA 3C8OA 2PCNA 3NOJA 2YJTA 1VI4A 1Q5XA 1J3LA 2YJVA 1NXJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K4I A;  3C8O A;  2PCN A;  3NOJ A;  2YJT A;  1VI4 A;  1Q5X A;  1J3L A;  2YJV A;  1NXJ A; 
#chains in the Genus database with same CATH topology
 2E28 A;  4TJX A;  4MCQ A;  3S9N A;  2R82 A;  1Z8L A;  1CX8 A;  1ZRS A;  3BI0 A;  2YJV A;  3ICU A;  2EZA A;  4M8D A;  1A9X B;  1EZB A;  5FD8 A;  3GJZ A;  4MJX A;  4IIX A;  4C9A A;  4OC5 A;  5ELY A;  5D29 A;  3EZE A;  3D7G A;  4TWE A;  1ZL0 A;  2GP4 A;  3G23 A;  3I6S A;  1XF1 A;  4OC0 A;  4LQG A;  4CDK A;  1VI4 A;  1R61 A;  1CE8 B;  1Y9Z A;  4C8C A;  4MCS A;  4TJV A;  1WVM A;  4X3R A;  4INJ A;  4C8U A;  2HI6 A;  3D7F A;  1Q5X A;  3VTA A;  4OC3 A;  1JDB C;  3TLA A;  4NGN A;  4P45 A;  3S9L A;  3EZA A;  5F09 A;  1VBG A;  4YN3 A;  4W9Y A;  1JDE A;  2AUM A;  4EYS A;  5K99 A;  5JVL A;  2FM4 A;  2XEG A;  2EZC A;  3KAS A;  3NOJ A;  4C9V A;  4COB A;  4P4J A;  2B0A A;  2OLS A;  3FED A;  1BXR B;  2D0O A;  3FEE A;  4OC4 A;  3BI1 A;  4MCP A;  5IR2 A;  4C8F A;  3D7D A;  2PCN A;  4CDJ A;  4MI1 A;  4C8T A;  1T36 B;  3SJE A;  3EIF A;  5F1Y A;  3T05 A;  4COG A;  1DIK A;  1KC7 A;  4J0N A;  2XEJ A;  2EZB A;  4OC2 A;  2OOT A;  3T0T A;  1VBH A;  3T5M A;  2AUN A;  4C84 A;  1KEE B;  2JBJ A;  2OR4 A;  4NGR A;  4C8A A;  2D0P A;  3RBU A;  4C8P A;  3T07 A;  4OC1 A;  1GGO A;  1CS0 B;  2PVV A;  2X0S A;  4OME A;  3TLG B;  4H1H A;  3TLY A;  3TLC A;  4P44 A;  3KRV A;  3I74 A;  2YJT A;  4NGS A;  4MCR A;  4E5S A;  2XEF A;  4NGM A;  4P4F A;  4CZ1 A;  2MP0 A;  3U1B A;  3TLG A;  3TLZ A;  4IIY A;  4P4B A;  4P4E A;  3SR3 A;  3BXM A;  4P4I A;  3K4I A;  4JZ0 A;  4C86 A;  4E94 A;  4C9U A;  5IB9 A;  4JYW A;  2C6G A;  3SJX A;  4NGQ A;  1J3L A;  2PVW A;  1C30 B;  3S9M A;  3FF3 A;  1C3O B;  4C85 A;  1V6C A;  2CIJ A;  3BHX A;  5F9M A;  3C8O A;  4NGP A;  3IWW A;  3TLE A;  2C6C A;  2EK9 A;  4KNG E;  1ZYM A;  4C9E A;  2C5Q A;  5F5X A;  1KBL A;  3FEC A;  2EK8 A;  3D7H A;  3K9T A;  3SJF A;  3TLB A;  1EZA A;  4C99 A;  1DE4 C;  2DIK A;  4P4D A;  3TYX A;  1NBW A;  1M6V B;  2JBK A;  4JVO A;  2HWG A;  4C9R A;  2XEI A;  4NGT A;  3EZB A;  4CO9 A;  5JYB A;  2HRO A;  1NXJ A;  3SJG A;  2C6P A;  3IIB A; 
#chains in the Genus database with same CATH homology
 3K4I A;  3C8O A;  2PCN A;  3NOJ A;  2YJT A;  1VI4 A;  1Q5X A;  1J3L A;  2YJV A;  1NXJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...