2YJTA

Crystal structure of e. coli dead-box protein srmb bound to regulator of ribonuclease activity a (rraa)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
158
structure length
158
Chain Sequence
KYDTSELCDIYQEDVNVVEPLFSNFGGRASFGGQIITVKCFEDNGLLYDLLEQNGRGRVLVVDGGGSVRRALVDAELARLAVQNEWEGLVIYGAVRQVDDLEELDIGIQAMAAIPVGAAGEGIGESDVRVNFGGVTFFSGDHLYADNTGIILSEDPLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REGULATOR OF RIBONUCLEASE ACTIVITY A
publication title Potential Regulatory Interactions of Escherichia Coli Rraa Protein with Dead-Box Helicases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase inhibitor/hydrolase
total genus 45
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03737 RraA-like Aldolase/RraA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.40 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Ribonuclease E inhibitor RraA/RraA-like 2yjtA00
3NOJA 1VI4A 2PCNA 1Q5XA 2YJVA 1J3LA 3K4IA 1NXJA 3C8OA 2YJTA
chains in the Genus database with same CATH superfamily
1KEEB 1M6VB 2R82A 3KRVA 3VTAA 4MJXA 1VBHA 2EK9A 4INJA 4C8UA 4C8AA 3NOJA 2XEGA 3D7HA 3BXMA 2DIKA 4P4DA 5ELYA 3TLGA 2OR4A 3SJXA 1ZYMA 4TJXA 4MCRA 3SJFA 3BHXA 5D29A 5F5XA 4C9UA 3D7DA 4W9YA 3TLAA 2C6GA 2PCNA 4TJVA 4YN3A 3TYXA 4C84A 3T5MA 1NXJA 2XEJA 2PVVA 3S9MA 3TLCA 2OLSA 2MP0A 4TWEA 1DE4C 4P4EA 1EZAA 1EZBA 5F09A 2C6PA 4CZ1A 1BXRB 3GJZA 4M8DA 4NGRA 2JBJA 2GP4A 1CE8B 3TLGB 1GGOA 1XF1A 2HI6A 3SJEA 3FECA 4OC2A 3D7FA 3SR3A 1KC7A 2JBKA 1C30B 3I74A 4JYWA 3D7GA 3S9LA 3TLBA 4OC0A 3S9NA 4CDKA 4E5SA 1JDEA 2D0OA 4NGSA 1V6CA 3EZBA 4LQGA 3K9TA 2OOTA 3T05A 4IIXA 4CO9A 2EZBA 1C3OB 4NGTA 3T0TA 1CS0B 3IIBA 4OC1A 4C9AA 5IB9A 5FD8A 4P4JA 4NGMA 4COBA 4CDJA 1A9XB 1DIKA 4EYSA 3ICUA 4P45A 4JZ0A 3I6SA 5JVLA 4KNGE 4P44A 3FEEA 4JVOA 3C8OA 2AUNA 3RBUA 4OC4A 5IR2A 4C86A 4MCSA 1WVMA 3EZEA 3K4IA 4P4FA 4E94A 2C6CA 4H1HA 2FM4A 3FF3A 4P4BA 3TLYA 2CIJA 3FEDA 1Z8LA 1KBLA 1NBWA 5F9MA 2C5QA 4OC5A 1T36B 4NGNA 2YJTA 1JDBC 3TLEA 1VI4A 5K99A 2HWGA 3BI0A 4OC3A 4NGPA 1R61A 4C9EA 2HROA 3U1BA 1J3LA 4P4IA 4J0NA 4C9RA 1ZL0A 3BI1A 3EIFA 1CX8A 2EZAA 4NGQA 2EK8A 1Q5XA 2PVWA 4MCQA 4C8PA 5JYBA 4C9VA 3G23A 3KASA 3SJGA 4C8TA 4C8FA 2E28A 4MI1A 1ZRSA 2AUMA 2X0SA 3TLZA 4C8CA 1VBGA 2EZCA 4IIYA 3IWWA 4C99A 4MCPA 2XEFA 4OMEA 2YJVA 2XEIA 3EZAA 1Y9ZA 5F1YA 2B0AA 4COGA 3T07A 2D0PA 4C85A 4X3RA
chains in the Genus database with same CATH topology
3NOJA 1VI4A 2PCNA 1Q5XA 2YJVA 1J3LA 3K4IA 1NXJA 3C8OA 2YJTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NOJ A;  1VI4 A;  2PCN A;  1Q5X A;  2YJV A;  1J3L A;  3K4I A;  1NXJ A;  3C8O A;  2YJT A; 
#chains in the Genus database with same CATH topology
 1KEE B;  1M6V B;  2R82 A;  3KRV A;  3VTA A;  4MJX A;  1VBH A;  2EK9 A;  4INJ A;  4C8U A;  4C8A A;  3NOJ A;  2XEG A;  3D7H A;  3BXM A;  2DIK A;  4P4D A;  5ELY A;  3TLG A;  2OR4 A;  3SJX A;  1ZYM A;  4TJX A;  4MCR A;  3SJF A;  3BHX A;  5D29 A;  5F5X A;  4C9U A;  3D7D A;  4W9Y A;  3TLA A;  2C6G A;  2PCN A;  4TJV A;  4YN3 A;  3TYX A;  4C84 A;  3T5M A;  1NXJ A;  2XEJ A;  2PVV A;  3S9M A;  3TLC A;  2OLS A;  2MP0 A;  4TWE A;  1DE4 C;  4P4E A;  1EZA A;  1EZB A;  5F09 A;  2C6P A;  4CZ1 A;  1BXR B;  3GJZ A;  4M8D A;  4NGR A;  2JBJ A;  2GP4 A;  1CE8 B;  3TLG B;  1GGO A;  1XF1 A;  2HI6 A;  3SJE A;  3FEC A;  4OC2 A;  3D7F A;  3SR3 A;  1KC7 A;  2JBK A;  1C30 B;  3I74 A;  4JYW A;  3D7G A;  3S9L A;  3TLB A;  4OC0 A;  3S9N A;  4CDK A;  4E5S A;  1JDE A;  2D0O A;  4NGS A;  1V6C A;  3EZB A;  4LQG A;  3K9T A;  2OOT A;  3T05 A;  4IIX A;  4CO9 A;  2EZB A;  1C3O B;  4NGT A;  3T0T A;  1CS0 B;  3IIB A;  4OC1 A;  4C9A A;  5IB9 A;  5FD8 A;  4P4J A;  4NGM A;  4COB A;  4CDJ A;  1A9X B;  1DIK A;  4EYS A;  3ICU A;  4P45 A;  4JZ0 A;  3I6S A;  5JVL A;  4KNG E;  4P44 A;  3FEE A;  4JVO A;  3C8O A;  2AUN A;  3RBU A;  4OC4 A;  5IR2 A;  4C86 A;  4MCS A;  1WVM A;  3EZE A;  3K4I A;  4P4F A;  4E94 A;  2C6C A;  4H1H A;  2FM4 A;  3FF3 A;  4P4B A;  3TLY A;  2CIJ A;  3FED A;  1Z8L A;  1KBL A;  1NBW A;  5F9M A;  2C5Q A;  4OC5 A;  1T36 B;  4NGN A;  2YJT A;  1JDB C;  3TLE A;  1VI4 A;  5K99 A;  2HWG A;  3BI0 A;  4OC3 A;  4NGP A;  1R61 A;  4C9E A;  2HRO A;  3U1B A;  1J3L A;  4P4I A;  4J0N A;  4C9R A;  1ZL0 A;  3BI1 A;  3EIF A;  1CX8 A;  2EZA A;  4NGQ A;  2EK8 A;  1Q5X A;  2PVW A;  4MCQ A;  4C8P A;  5JYB A;  4C9V A;  3G23 A;  3KAS A;  3SJG A;  4C8T A;  4C8F A;  2E28 A;  4MI1 A;  1ZRS A;  2AUM A;  2X0S A;  3TLZ A;  4C8C A;  1VBG A;  2EZC A;  4IIY A;  3IWW A;  4C99 A;  4MCP A;  2XEF A;  4OME A;  2YJV A;  2XEI A;  3EZA A;  1Y9Z A;  5F1Y A;  2B0A A;  4COG A;  3T07 A;  2D0P A;  4C85 A;  4X3R A; 
#chains in the Genus database with same CATH homology
 3NOJ A;  1VI4 A;  2PCN A;  1Q5X A;  2YJV A;  1J3L A;  3K4I A;  1NXJ A;  3C8O A;  2YJT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...