2YJTA

Crystal structure of e. coli dead-box protein srmb bound to regulator of ribonuclease activity a (rraa)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
158
structure length
158
Chain Sequence
KYDTSELCDIYQEDVNVVEPLFSNFGGRASFGGQIITVKCFEDNGLLYDLLEQNGRGRVLVVDGGGSVRRALVDAELARLAVQNEWEGLVIYGAVRQVDDLEELDIGIQAMAAIPVGAAGEGIGESDVRVNFGGVTFFSGDHLYADNTGIILSEDPLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Potential Regulatory Interactions of Escherichia Coli Rraa Protein with Dead-Box Helicases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase inhibitor/hydrolase
molecule keywords REGULATOR OF RIBONUCLEASE ACTIVITY A
total genus 45
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03737 RraA-like Aldolase/RraA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.40 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Ribonuclease E inhibitor RraA/RraA-like 2yjtA00
3K4IA 3C8OA 1Q5XA 1J3LA 2YJVA 3NOJA 2YJTA 2PCNA 1VI4A 1NXJA
chains in the Genus database with same CATH superfamily
4P4FA 4JVOA 3G23A 4JYWA 4C8PA 1CS0B 5F1YA 4CZ1A 3K4IA 4E5SA 2JBKA 3BI1A 4OC2A 1ZRSA 2EZAA 3TLYA 3T5MA 2E28A 2GP4A 2PVWA 2HROA 1C30B 1VBGA 1WVMA 2PCNA 4X3RA 3U1BA 4C9EA 3D7GA 3I74A 5F09A 1V6CA 4JZ0A 5F5XA 2XEGA 4C86A 4COBA 3IWWA 1ZL0A 4COGA 4KNGE 4OC5A 2AUMA 4W9YA 2XEIA 4C9AA 1C3OB 1ZYMA 4INJA 3I6SA 2EK9A 3FEDA 3VTAA 3FECA 3D7DA 4CDKA 2JBJA 1EZAA 3S9MA 2EK8A 3C8OA 5F9MA 5K99A 3EIFA 2D0OA 4CO9A 3T0TA 4OC4A 5IB9A 1DIKA 4C8UA 2OOTA 3SJEA 2DIKA 4NGPA 3T07A 4C8CA 4M8DA 4E94A 2YJTA 1VBHA 4OC3A 1CE8B 1VI4A 2XEFA 3KRVA 2C5QA 1R61A 1BXRB 3D7HA 1EZBA 4C84A 4C8FA 4OMEA 3FF3A 3SJFA 3BI0A 4C9RA 4OC0A 2C6CA 4C9UA 2EZBA 4TJVA 5D29A 4H1HA 1CX8A 3ICUA 3TLCA 3TLBA 3S9NA 1GGOA 3S9LA 4P4EA 4MI1A 4TJXA 5FD8A 3T05A 2HWGA 2MP0A 2R82A 4C8AA 2PVVA 5JVLA 1A9XB 2B0AA 3IIBA 3K9TA 4C9VA 1KC7A 3BXMA 3FEEA 3TYXA 4P4IA 1XF1A 4MCQA 4YN3A 4P4DA 4NGRA 1Z8LA 2AUNA 4NGNA 2CIJA 4MCSA 3TLAA 4MJXA 3KASA 3SJXA 2HI6A 4IIXA 3GJZA 3EZBA 3RBUA 3TLEA 2C6PA 4C99A 1NBWA 2XEJA 1JDBC 4OC1A 5JYBA 1KBLA 2C6GA 4NGTA 1M6VB 1NXJA 4C85A 3D7FA 4EYSA 4P4BA 3EZAA 4MCPA 2YJVA 3NOJA 2D0PA 4MCRA 2X0SA 1T36B 4LQGA 5ELYA 2EZCA 4P4JA 4TWEA 3SJGA 3SR3A 2OLSA 4C8TA 4J0NA 4CDJA 3TLGA 4NGMA 1J3LA 1DE4C 1JDEA 4P45A 3BHXA 2OR4A 4NGSA 1Y9ZA 4NGQA 1Q5XA 4P44A 5IR2A 3TLZA 2FM4A 1KEEB 3TLGB 4IIYA 3EZEA
chains in the Genus database with same CATH topology
3K4IA 3C8OA 1Q5XA 1J3LA 2YJVA 3NOJA 2YJTA 2PCNA 1VI4A 1NXJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K4I A;  3C8O A;  1Q5X A;  1J3L A;  2YJV A;  3NOJ A;  2YJT A;  2PCN A;  1VI4 A;  1NXJ A; 
#chains in the Genus database with same CATH topology
 4P4F A;  4JVO A;  3G23 A;  4JYW A;  4C8P A;  1CS0 B;  5F1Y A;  4CZ1 A;  3K4I A;  4E5S A;  2JBK A;  3BI1 A;  4OC2 A;  1ZRS A;  2EZA A;  3TLY A;  3T5M A;  2E28 A;  2GP4 A;  2PVW A;  2HRO A;  1C30 B;  1VBG A;  1WVM A;  2PCN A;  4X3R A;  3U1B A;  4C9E A;  3D7G A;  3I74 A;  5F09 A;  1V6C A;  4JZ0 A;  5F5X A;  2XEG A;  4C86 A;  4COB A;  3IWW A;  1ZL0 A;  4COG A;  4KNG E;  4OC5 A;  2AUM A;  4W9Y A;  2XEI A;  4C9A A;  1C3O B;  1ZYM A;  4INJ A;  3I6S A;  2EK9 A;  3FED A;  3VTA A;  3FEC A;  3D7D A;  4CDK A;  2JBJ A;  1EZA A;  3S9M A;  2EK8 A;  3C8O A;  5F9M A;  5K99 A;  3EIF A;  2D0O A;  4CO9 A;  3T0T A;  4OC4 A;  5IB9 A;  1DIK A;  4C8U A;  2OOT A;  3SJE A;  2DIK A;  4NGP A;  3T07 A;  4C8C A;  4M8D A;  4E94 A;  2YJT A;  1VBH A;  4OC3 A;  1CE8 B;  1VI4 A;  2XEF A;  3KRV A;  2C5Q A;  1R61 A;  1BXR B;  3D7H A;  1EZB A;  4C84 A;  4C8F A;  4OME A;  3FF3 A;  3SJF A;  3BI0 A;  4C9R A;  4OC0 A;  2C6C A;  4C9U A;  2EZB A;  4TJV A;  5D29 A;  4H1H A;  1CX8 A;  3ICU A;  3TLC A;  3TLB A;  3S9N A;  1GGO A;  3S9L A;  4P4E A;  4MI1 A;  4TJX A;  5FD8 A;  3T05 A;  2HWG A;  2MP0 A;  2R82 A;  4C8A A;  2PVV A;  5JVL A;  1A9X B;  2B0A A;  3IIB A;  3K9T A;  4C9V A;  1KC7 A;  3BXM A;  3FEE A;  3TYX A;  4P4I A;  1XF1 A;  4MCQ A;  4YN3 A;  4P4D A;  4NGR A;  1Z8L A;  2AUN A;  4NGN A;  2CIJ A;  4MCS A;  3TLA A;  4MJX A;  3KAS A;  3SJX A;  2HI6 A;  4IIX A;  3GJZ A;  3EZB A;  3RBU A;  3TLE A;  2C6P A;  4C99 A;  1NBW A;  2XEJ A;  1JDB C;  4OC1 A;  5JYB A;  1KBL A;  2C6G A;  4NGT A;  1M6V B;  1NXJ A;  4C85 A;  3D7F A;  4EYS A;  4P4B A;  3EZA A;  4MCP A;  2YJV A;  3NOJ A;  2D0P A;  4MCR A;  2X0S A;  1T36 B;  4LQG A;  5ELY A;  2EZC A;  4P4J A;  4TWE A;  3SJG A;  3SR3 A;  2OLS A;  4C8T A;  4J0N A;  4CDJ A;  3TLG A;  4NGM A;  1J3L A;  1DE4 C;  1JDE A;  4P45 A;  3BHX A;  2OR4 A;  4NGS A;  1Y9Z A;  4NGQ A;  1Q5X A;  4P44 A;  5IR2 A;  3TLZ A;  2FM4 A;  1KEE B;  3TLG B;  4IIY A;  3EZE A; 
#chains in the Genus database with same CATH homology
 3K4I A;  3C8O A;  1Q5X A;  1J3L A;  2YJV A;  3NOJ A;  2YJT A;  2PCN A;  1VI4 A;  1NXJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...