2YJTA

Crystal structure of e. coli dead-box protein srmb bound to regulator of ribonuclease activity a (rraa)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
158
structure length
158
Chain Sequence
KYDTSELCDIYQEDVNVVEPLFSNFGGRASFGGQIITVKCFEDNGLLYDLLEQNGRGRVLVVDGGGSVRRALVDAELARLAVQNEWEGLVIYGAVRQVDDLEELDIGIQAMAAIPVGAAGEGIGESDVRVNFGGVTFFSGDHLYADNTGIILSEDPLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor/hydrolase
molecule keywords REGULATOR OF RIBONUCLEASE ACTIVITY A
publication title Potential Regulatory Interactions of Escherichia Coli Rraa Protein with Dead-Box Helicases.
pubmed doi rcsb
source organism Escherichia coli
total genus 45
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03737 RraA-like Aldolase/RraA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.40 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Ribonuclease E inhibitor RraA/RraA-like 2yjtA00
1J3LA 3K4IA 1Q5XA 2PCNA 1VI4A 2YJVA 3NOJA 2YJTA 3C8OA 1NXJA
chains in the Genus database with same CATH superfamily
1A9XB 4MJXA 3BI1A 1KC7A 3SJFA 2HROA 1GGOA 1CE8B 1EZAA 2XEJA 4P4FA 4EYSA 2XEIA 2EZCA 1M6VB 2YJVA 3SR3A 3C8OA 3FF3A 4E5SA 4C85A 3KRVA 2C5QA 4C9UA 4KNGE 4C99A 4C8TA 3FEEA 5FD8A 3D7FA 3EZBA 2EZBA 2EK8A 1CS0B 1ZRSA 4W9YA 3T0TA 1NBWA 5JVLA 4LQGA 4OC1A 1KBLA 3T5MA 4C8CA 3S9NA 3K4IA 1R61A 2R82A 4MCRA 4COGA 3KASA 3ICUA 2EK9A 3TLAA 4OC5A 2XEFA 3IWWA 1ZYMA 2CIJA 3D7HA 4C8PA 2C6GA 2JBKA 4NGRA 4NGSA 4CDJA 4C86A 4C9AA 2AUNA 4P4JA 3SJGA 1J3LA 3SJXA 3S9LA 4TJVA 3TLGB 3NOJA 4OC0A 4TJXA 2E28A 1NXJA 4P45A 3K9TA 2GP4A 2DIKA 1WVMA 2D0OA 2MP0A 3TLEA 2PVVA 4MI1A 4CO9A 4IIXA 2X0SA 4NGTA 4P4BA 4NGNA 2FM4A 4C8UA 2HWGA 4P4DA 3T07A 5JYBA 4H1HA 4COBA 1EZBA 4JYWA 4JVOA 4C9RA 2HI6A 1Z8LA 4NGMA 1C30B 4C8FA 3TLBA 3BI0A 2C6PA 4C9VA 4C8AA 2PCNA 2B0AA 4OC4A 1CX8A 1Y9ZA 3TLGA 3TLCA 3GJZA 2PVWA 3D7GA 4INJA 4C9EA 2OOTA 1Q5XA 5F5XA 4P4IA 4TWEA 2XEGA 5ELYA 3BHXA 4M8DA 5K99A 2OLSA 3S9MA 1XF1A 4MCQA 4CZ1A 4NGPA 1DIKA 4J0NA 5F1YA 3TYXA 2OR4A 4OC3A 1BXRB 1VI4A 1DE4C 2EZAA 2YJTA 3EZEA 3SJEA 1VBHA 3VTAA 3I6SA 4P44A 3FECA 4E94A 3I74A 5F09A 4C84A 3TLZA 1KEEB 4MCSA 5IR2A 3BXMA 3RBUA 4OMEA 5F9MA 1ZL0A 2D0PA 3TLYA 4CDKA 3EIFA 3G23A 4JZ0A 4NGQA 4X3RA 5IB9A 3U1BA 4YN3A 1VBGA 4P4EA 1V6CA 1C3OB 3IIBA 3EZAA 3FEDA 3T05A 2AUMA 4MCPA 2C6CA 3D7DA 4IIYA 4OC2A 1JDBC 5D29A 1JDEA 2JBJA 1T36B
chains in the Genus database with same CATH topology
1J3LA 3K4IA 1Q5XA 2PCNA 1VI4A 2YJVA 3NOJA 2YJTA 3C8OA 1NXJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J3L A;  3K4I A;  1Q5X A;  2PCN A;  1VI4 A;  2YJV A;  3NOJ A;  2YJT A;  3C8O A;  1NXJ A; 
#chains in the Genus database with same CATH topology
 1A9X B;  4MJX A;  3BI1 A;  1KC7 A;  3SJF A;  2HRO A;  1GGO A;  1CE8 B;  1EZA A;  2XEJ A;  4P4F A;  4EYS A;  2XEI A;  2EZC A;  1M6V B;  2YJV A;  3SR3 A;  3C8O A;  3FF3 A;  4E5S A;  4C85 A;  3KRV A;  2C5Q A;  4C9U A;  4KNG E;  4C99 A;  4C8T A;  3FEE A;  5FD8 A;  3D7F A;  3EZB A;  2EZB A;  2EK8 A;  1CS0 B;  1ZRS A;  4W9Y A;  3T0T A;  1NBW A;  5JVL A;  4LQG A;  4OC1 A;  1KBL A;  3T5M A;  4C8C A;  3S9N A;  3K4I A;  1R61 A;  2R82 A;  4MCR A;  4COG A;  3KAS A;  3ICU A;  2EK9 A;  3TLA A;  4OC5 A;  2XEF A;  3IWW A;  1ZYM A;  2CIJ A;  3D7H A;  4C8P A;  2C6G A;  2JBK A;  4NGR A;  4NGS A;  4CDJ A;  4C86 A;  4C9A A;  2AUN A;  4P4J A;  3SJG A;  1J3L A;  3SJX A;  3S9L A;  4TJV A;  3TLG B;  3NOJ A;  4OC0 A;  4TJX A;  2E28 A;  1NXJ A;  4P45 A;  3K9T A;  2GP4 A;  2DIK A;  1WVM A;  2D0O A;  2MP0 A;  3TLE A;  2PVV A;  4MI1 A;  4CO9 A;  4IIX A;  2X0S A;  4NGT A;  4P4B A;  4NGN A;  2FM4 A;  4C8U A;  2HWG A;  4P4D A;  3T07 A;  5JYB A;  4H1H A;  4COB A;  1EZB A;  4JYW A;  4JVO A;  4C9R A;  2HI6 A;  1Z8L A;  4NGM A;  1C30 B;  4C8F A;  3TLB A;  3BI0 A;  2C6P A;  4C9V A;  4C8A A;  2PCN A;  2B0A A;  4OC4 A;  1CX8 A;  1Y9Z A;  3TLG A;  3TLC A;  3GJZ A;  2PVW A;  3D7G A;  4INJ A;  4C9E A;  2OOT A;  1Q5X A;  5F5X A;  4P4I A;  4TWE A;  2XEG A;  5ELY A;  3BHX A;  4M8D A;  5K99 A;  2OLS A;  3S9M A;  1XF1 A;  4MCQ A;  4CZ1 A;  4NGP A;  1DIK A;  4J0N A;  5F1Y A;  3TYX A;  2OR4 A;  4OC3 A;  1BXR B;  1VI4 A;  1DE4 C;  2EZA A;  2YJT A;  3EZE A;  3SJE A;  1VBH A;  3VTA A;  3I6S A;  4P44 A;  3FEC A;  4E94 A;  3I74 A;  5F09 A;  4C84 A;  3TLZ A;  1KEE B;  4MCS A;  5IR2 A;  3BXM A;  3RBU A;  4OME A;  5F9M A;  1ZL0 A;  2D0P A;  3TLY A;  4CDK A;  3EIF A;  3G23 A;  4JZ0 A;  4NGQ A;  4X3R A;  5IB9 A;  3U1B A;  4YN3 A;  1VBG A;  4P4E A;  1V6C A;  1C3O B;  3IIB A;  3EZA A;  3FED A;  3T05 A;  2AUM A;  4MCP A;  2C6C A;  3D7D A;  4IIY A;  4OC2 A;  1JDB C;  5D29 A;  1JDE A;  2JBJ A;  1T36 B; 
#chains in the Genus database with same CATH homology
 1J3L A;  3K4I A;  1Q5X A;  2PCN A;  1VI4 A;  2YJV A;  3NOJ A;  2YJT A;  3C8O A;  1NXJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...