2YJTA

Crystal structure of e. coli dead-box protein srmb bound to regulator of ribonuclease activity a (rraa)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
158
structure length
158
Chain Sequence
KYDTSELCDIYQEDVNVVEPLFSNFGGRASFGGQIITVKCFEDNGLLYDLLEQNGRGRVLVVDGGGSVRRALVDAELARLAVQNEWEGLVIYGAVRQVDDLEELDIGIQAMAAIPVGAAGEGIGESDVRVNFGGVTFFSGDHLYADNTGIILSEDPLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Potential Regulatory Interactions of Escherichia Coli Rraa Protein with Dead-Box Helicases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase inhibitor/hydrolase
molecule keywords REGULATOR OF RIBONUCLEASE ACTIVITY A
total genus 45
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03737 RraA-like Aldolase/RraA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.40 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Ribonuclease E inhibitor RraA/RraA-like 2yjtA00
1NXJA 1VI4A 1Q5XA 2YJVA 3NOJA 1J3LA 2YJTA 2PCNA 3C8OA 3K4IA
chains in the Genus database with same CATH superfamily
3KRVA 4P4JA 3KASA 3SJGA 2HROA 1Q5XA 1ZL0A 4MJXA 4NGPA 3BI1A 4CDKA 3EIFA 4EYSA 4C8UA 4IIYA 4OC5A 4C9RA 3U1BA 3IWWA 3EZEA 4P44A 4OC2A 3TLCA 4X3RA 2YJVA 4C84A 2E28A 2PCNA 2EZCA 3FECA 3S9MA 4JYWA 1JDEA 3TLEA 3D7GA 4NGNA 4C9EA 1DIKA 3SJEA 4LQGA 3T05A 4OC3A 5IB9A 3FEDA 4OC1A 5K99A 1M6VB 1CE8B 1GGOA 4J0NA 4MCSA 4E5SA 4COGA 3VTAA 4H1HA 1EZBA 3K9TA 3GJZA 3NOJA 4C9VA 2YJTA 3T5MA 4NGTA 4TJVA 2B0AA 4C85A 2C6PA 3TLBA 3S9LA 3TYXA 1Z8LA 4OMEA 2C5QA 3TLZA 4P4IA 4C8PA 5JYBA 2HWGA 4NGSA 3TLGA 5F9MA 3S9NA 4C8TA 2D0OA 4MCRA 2HI6A 3I6SA 5F5XA 1BXRB 4C86A 4C99A 1V6CA 3G23A 3FF3A 1XF1A 1WVMA 3EZBA 3K4IA 4P4EA 3TLYA 4C8AA 3I74A 4TJXA 4JZ0A 4INJA 2EZAA 3T0TA 4C9AA 3D7HA 3BXMA 4MCPA 5F09A 2PVWA 4IIXA 1KC7A 2PVVA 2GP4A 2XEJA 3D7FA 4C8CA 4CDJA 1EZAA 1JDBC 1VBHA 4NGMA 4C9UA 1R61A 2JBKA 3TLGB 2OR4A 2MP0A 4P4FA 4W9YA 1C3OB 2JBJA 2EK8A 4E94A 1NBWA 1A9XB 1Y9ZA 1KEEB 3SR3A 2C6CA 2AUNA 4OC0A 3RBUA 1CX8A 2C6GA 3T07A 5ELYA 1VBGA 3SJFA 4COBA 2D0PA 1ZYMA 2CIJA 2DIKA 4M8DA 4MI1A 3C8OA 2R82A 2XEGA 3EZAA 4NGRA 2OLSA 4KNGE 1VI4A 2AUMA 4JVOA 5F1YA 3IIBA 3ICUA 3SJXA 2FM4A 1T36B 5IR2A 2XEIA 5FD8A 4NGQA 3BI0A 4MCQA 4CO9A 2X0SA 1J3LA 3TLAA 4YN3A 1KBLA 2OOTA 3D7DA 4P45A 2XEFA 1DE4C 1C30B 4P4DA 4C8FA 1NXJA 4CZ1A 4OC4A 2EZBA 4P4BA 1ZRSA 3FEEA 4TWEA 5JVLA 5D29A 1CS0B 2EK9A 3BHXA
chains in the Genus database with same CATH topology
1NXJA 1VI4A 1Q5XA 2YJVA 3NOJA 1J3LA 2YJTA 2PCNA 3C8OA 3K4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NXJ A;  1VI4 A;  1Q5X A;  2YJV A;  3NOJ A;  1J3L A;  2YJT A;  2PCN A;  3C8O A;  3K4I A; 
#chains in the Genus database with same CATH topology
 3KRV A;  4P4J A;  3KAS A;  3SJG A;  2HRO A;  1Q5X A;  1ZL0 A;  4MJX A;  4NGP A;  3BI1 A;  4CDK A;  3EIF A;  4EYS A;  4C8U A;  4IIY A;  4OC5 A;  4C9R A;  3U1B A;  3IWW A;  3EZE A;  4P44 A;  4OC2 A;  3TLC A;  4X3R A;  2YJV A;  4C84 A;  2E28 A;  2PCN A;  2EZC A;  3FEC A;  3S9M A;  4JYW A;  1JDE A;  3TLE A;  3D7G A;  4NGN A;  4C9E A;  1DIK A;  3SJE A;  4LQG A;  3T05 A;  4OC3 A;  5IB9 A;  3FED A;  4OC1 A;  5K99 A;  1M6V B;  1CE8 B;  1GGO A;  4J0N A;  4MCS A;  4E5S A;  4COG A;  3VTA A;  4H1H A;  1EZB A;  3K9T A;  3GJZ A;  3NOJ A;  4C9V A;  2YJT A;  3T5M A;  4NGT A;  4TJV A;  2B0A A;  4C85 A;  2C6P A;  3TLB A;  3S9L A;  3TYX A;  1Z8L A;  4OME A;  2C5Q A;  3TLZ A;  4P4I A;  4C8P A;  5JYB A;  2HWG A;  4NGS A;  3TLG A;  5F9M A;  3S9N A;  4C8T A;  2D0O A;  4MCR A;  2HI6 A;  3I6S A;  5F5X A;  1BXR B;  4C86 A;  4C99 A;  1V6C A;  3G23 A;  3FF3 A;  1XF1 A;  1WVM A;  3EZB A;  3K4I A;  4P4E A;  3TLY A;  4C8A A;  3I74 A;  4TJX A;  4JZ0 A;  4INJ A;  2EZA A;  3T0T A;  4C9A A;  3D7H A;  3BXM A;  4MCP A;  5F09 A;  2PVW A;  4IIX A;  1KC7 A;  2PVV A;  2GP4 A;  2XEJ A;  3D7F A;  4C8C A;  4CDJ A;  1EZA A;  1JDB C;  1VBH A;  4NGM A;  4C9U A;  1R61 A;  2JBK A;  3TLG B;  2OR4 A;  2MP0 A;  4P4F A;  4W9Y A;  1C3O B;  2JBJ A;  2EK8 A;  4E94 A;  1NBW A;  1A9X B;  1Y9Z A;  1KEE B;  3SR3 A;  2C6C A;  2AUN A;  4OC0 A;  3RBU A;  1CX8 A;  2C6G A;  3T07 A;  5ELY A;  1VBG A;  3SJF A;  4COB A;  2D0P A;  1ZYM A;  2CIJ A;  2DIK A;  4M8D A;  4MI1 A;  3C8O A;  2R82 A;  2XEG A;  3EZA A;  4NGR A;  2OLS A;  4KNG E;  1VI4 A;  2AUM A;  4JVO A;  5F1Y A;  3IIB A;  3ICU A;  3SJX A;  2FM4 A;  1T36 B;  5IR2 A;  2XEI A;  5FD8 A;  4NGQ A;  3BI0 A;  4MCQ A;  4CO9 A;  2X0S A;  1J3L A;  3TLA A;  4YN3 A;  1KBL A;  2OOT A;  3D7D A;  4P45 A;  2XEF A;  1DE4 C;  1C30 B;  4P4D A;  4C8F A;  1NXJ A;  4CZ1 A;  4OC4 A;  2EZB A;  4P4B A;  1ZRS A;  3FEE A;  4TWE A;  5JVL A;  5D29 A;  1CS0 B;  2EK9 A;  3BHX A; 
#chains in the Genus database with same CATH homology
 1NXJ A;  1VI4 A;  1Q5X A;  2YJV A;  3NOJ A;  1J3L A;  2YJT A;  2PCN A;  3C8O A;  3K4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...