4IIXA

Structure of mccf in complex with glutamyl sulfamoyl guanosine
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
338
structure length
338
Chain Sequence
PLLAAPLAVGDTIGFFSSSAPATVTAKNRFFRGVEFLQRKGFKLVSGKLTGKTDFYRSGTIKERAQEFNELVYNPDITCIMSTIGGDNSNSLLPFLDYDAIIANPKIIIGYADTTALLAGIYAKTGLITFYGPALIPSFGEHPPLVDITYESFIKILTRKQSGIYTYTLPEKWSDESINWNENKILRPKKLYKNNCAFYGSGKVEGRVIGGNLNTLTGIWGSEWMPEIRNGDILFIEDSRKSIATVERLFSMLKLNRVFDKVSAIILGKHELFDCAGSKRRPYEVLTEVLDGKQIPVLDGFDCSHTHPMLTLPLGVKLAIDFDNKNISITEQYLSTEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of MccF with substrate analogs
rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords MccF
total genus 117
structure length 338
sequence length 338
chains with identical sequence B
ec nomenclature ec 3.4.-.-:
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02016 Peptidase_S66 LD-carboxypeptidase N-terminal domain
A PF17676 Peptidase_S66C LD-carboxypeptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Class I glutamine amidotransferase-like 4iixA01
3.50.30.60 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 LD-carboxypeptidase A C-terminal domain-like 4iixA02
4INJA 5JYBA 3GJZA 5F5XA 3SR3A 3TLGB 3TYXA 5F1YA 4EYSA 4IIXA 4MJXA 4H1HA 4E94A 3TLEA 3TLBA 4MI1A 3TLZA 1ZRSA 1ZL0A 3TLYA 3T5MA 2AUNA 4E5SA 5K99A 3U1BA 3G23A 3TLGA 4JVOA 5FD8A 2AUMA 3TLAA 4IIYA 3TLCA 5F9MA
chains in the Genus database with same CATH superfamily
1J7JA 3UAXA 3DE1X 2PA3A 3JALA 4Z1MA 4K81B 4U7WA 4C0HA 1H8EA 2AJ8A 2HWXA 3H5NA 3NYWA 3BH6A 5HE8A 3KQUA 1BWRA 3KSRA 4O59O 4PZYA 5CHEA 2WWIA 2J07A 1ISIA 3VUEA 1Y8RA 4HDOB 4ZVSA 2NOAA 2YWRA 3HU3A 3IESA 4LC9A 3ICVA 1MV8A 1RRGA 2ZFUA 2J5QA 2MINB 3ICQB 3SVLA 1KS9A 3PRHA 3WB2A 4U63A 4L72A 4DLYA 1VRCA 3JAWA 4NBTA 2GJKA 3WYCA 3U80A 3D3JA 2OPBA 1CZKA 2R60A 4JMPA 1T5LA 1ZR4A 3QVOA 4OX9Y 1BE8A 3L1UA 4R7GA 2R1UA 3ZDQA 3IKJA 5CBKA 2GN2A 3DB2A 5D3MA 4EMTA 1PYDA 4I6GA 4EA7A 3RS9A 2HDOA 5BSHA 4OHCA 2WC1A 3C8DA 3B6JA 3LT4A 4YAFA 5ETJA 1EFAA 4UUMA 4LSMA 2O6LA 2BI8A 4JC8A 1ZH8A 4RGQA 4AKTA 1JB1A 1R15A 5EMLA 1KAOA 2W2OA 1XSEA 1DIKA 1J2TA 3N59A 3HTXA 4HZUA 1K68A 1L4KA 2PNFA 3WGGA 5IH7A 5BN4B 4C5CA 2D0OA 4DVGA 3LUBA 2XMCA 4KIJA 2RC6A 1Z68A 4CCAA 1DBQA 3H1TA 3DBLB 3WLPA 2ODQA 2Z2KA 4GS5A 1U1DA 3ITEA 4JAVC 4LOLA 1T25A 3BM5A 3SIPA 3HRHA 3TFQA 2DHRA 5LIRA 4FFMA 3C6XA 1N2GA 1C7IA 3AFMA 4RCZA 1SXJC 1NXXA 1ZK2A 4N3CA 4Y6OA 3ZUGA 4CMEC 2QN6A 5KYVA 2HRDA 4E51A 4Y9TA 4D8UA 1DLJA 1AX9A 3P9SA 2Z5FA 1XPRA 1Y4ZA 3QU7A 5EP1A 2PMCA 3U0VA 2YWJA 4IG4A 4EB6A 2VF7A 3JX9A 1NU8A 4I1UA 3NIWA 1L5KA 1TAUA 1PFVA 1N2IA 1XA4A 3DOHA 3IVAA 5JFTA 2GD2A 2JGIA 1GT91 3JSXA 2PE5A 4MR7B 2VIIA 1V39A 2PZMA 4Y2UA 1XRLA 1U0FA 3PBKA 4WX2B 4RJLA 1HL7A 1PR5A 1ZMXA 2LWIA 2F43B 3L7MA 3UUFA 3ZIAA 3OETA 3WXBA 2HMTA 4B3MB 2Q6TA 1RBYA 2UYQA 1WUJS 2A67A 2XVXA 2ZVJA 5JVLA 1OJLA 1CUAA 3KKNA 4B74A 1HYQA 2E5FA 1N77A 1IG3A 2GBCA 3TLBA 1NP7A 4F5EA 4GU5A 1YQDA 3PG5A 4O2AF 1PLKA 3F97A 1AG9A 2JA2A 1E3JA 3P19A 1W4LA 4M53A 2HA4A 2DOKA 2P5YA 3FUCA 3N2KA 3W6PA 3M70A 2QRKA 1UBCA 1W85B 4KXLA 4BX3A 1QVZA 1O03A 3I74A 1GGMA 1QRRA 3EUFA 3I8SA 1PR9A 3RB8A 2RI0A 5A7FA 4OC3A 2V6JA 3RADC 2Z95A 4WJLA 2WSSD 1QIGA 2A57A 4BCDA 4Y8VA 1J49A 2O8FA 3VJKA 4FN5A 3CVJA 3KNZA 1YMUA 5L6LB 1QVAA 5CJ2A 4BUZA 5IRCD 2F1RA 2IEYA 3M0EA 3RSGA 2GP4A 3CN9A 3QE4A 5E3JA 5HCIA 3LCRA 1AQ6A 3TOCA 4DLBA 4EFMA 1E2UA 2BR4A 2VTKA 4K8OA 4NMHA 3RAFC 3E7XA 5I7RA 4V39A 4O2BF 5B30A 5L9AA 3AP3A 5I48A 3FHOA 1Q1QA 1NMSA 4O8CA 2JRLA 4Q3KA 4XTCS 2CJXA 2J6CA 2Z8YM 1GUDA 4P22A 1JMVA 2PRJA 4IIHA 2YMLA 1JDJA 3KR0A 1CJVC 1SXJB 3G9UA 4CR7A 1PQUA 3WGZA 5DWQA 4F9FA 4URWR 5LQNA 3QIVA 3HU2A 3CVUA 1KOGA 2V0NA 4UE2A 5KVAA 2ZWOA 4YN3A 3BTSA 2R97A 1ABBA 2O8FB 1WHSB 1N7JA 3F6SA 3T3HA 4JT9A 3W2HA 4CG0A 4N3GA 3P20A 1VZ2A 2I9PA 5DLQC 1KKLA 1TK2A 4JI8B 2J67A 1QLJA 4KLAA 2JG3A 1LSOA 3CISA 3ELYA 3HU1A 4MV8A 3BGDA 2CXRA 2B0JA 2W5UA 1M72A 5ARDA 1EBBA 5FWYB 5THKA 1HQDA 5DNCA 1J8VA 3LWBA 4JI3B 2VF5X 4TSFD 1O3YA 3J81k 1MTOA 1XZNA 4DM4A 2IYWA 2MSLA 1U7UA 1X8JA 1Y5IA 2EOAA 1N2JA 2XTJA 5FUXA 1R0KA 1HNXB 4AJ4A 1QYIA 1JZSA 4HH1A 1XPUA 4MS3A 4MVWA 4EM6A 2W0MA 4ZEVA 3RVNA 3C8MA 3HSYA 1CUYA 5JDIC 4Q1BA 2CNNA 3HYSA 1FP2A 4W7HA 4F93B 1RDFA 2BFEA 4JP8A 1MC8A 2EBUA 1RQPA 1PWYE 5AI6A 1B3BA 3WX0A 2HWYA 1PJCA 3DE5X 2PN1A 5AJHA 3HL4A 3KD2A 1LBHA 1HF3A 4XIIA 5FH9A 1H9CA 2Y6VA 2ZJ5A 4EZBA 4CM8A 4O4LA 3GRVA 1HT3A 2I6UA 2LZ0A 5ER9A 4PG8A 1ADGA 5GQSA 4NFLA 3MWLA 3AEKB 1DBRA 2KLHA 1WJGA 4UZFA 4KN5A 3SJZA 3LP5A 4W1SA 1FFWA 3J81A 2CSXA 2VXBA 2NSLA 5DCUA 1VYVA 1IOZA 2AI2A 3FWKA 4KE9A 3GV0A 4IINA 2JIDA 4CKCB 1PYOA 4KGZA 2JCYA 3GNQA 1JLHA 1RRKA 5ALEA 4U2BA 5EKSA 3PVSA 3UC9A 3VVMA 1QGUA 2V65A 3BMOB 4NTZA 5I4IA 2EIHA 1EUDA 2XH8A 3SXUA 3G59A 1IZ8A 2E4AA 2I7XA 4RTRA 2DY1A 4X93A 1BU5A 1ZWKA 2FQXA 2WSBA 4HKTA 5EKXA 1QHHB 5KYKA 4UHFA 1OLUA 3PDWA 4IBOA 3GK3A 4TS4A 3ELUA 4NR0A 3W05A 3LQKA 3AT1A 4MUMA 4EHLA 1G17A 4F8YA 1VL1A 1AQNA 4DKJA 5J43A 1KFKB 2AC7A 3ZDXB 2GVZC 1KVTA 1DWPA 1FNMA 1G9TA 4L76A 3TLGB 2OP0A 5J4LA 1U7OA 1XQ1A 2PLRA 3OPNA 4PG6A 1VCNA 1MJGA 5FTLA 3HRIA 4UHHA 2L2QA 4QOJA 2H7CA 3R9XB 5M7EA 5EKUA 1FVHA 3KJGA 2WE8A 5JCPA 3L93A 1KXZA 3TQSA 3CLUD 4KFCA 5DHTA 1Q7CA 1ULTA 1UT8A 3F6BX 3I0MA 3D6TB 3GFBA 5AQ1A 2Q28A 3EFBA 3NIBA 4HUTA 4B6RA 3GGSA 1NPDA 1U9YA 4UAGA 4TWJA 3AM3A 5HFNA 1SZJG 4MK4A 1Z0SA 3ESQA 3ZJ5A 3OTOB 4S1OA 3TOVA 1UQTA 3E1SA 3B7PA 1JDSA 3LCCA 3O3OB 4BQOA 4DRXB 4QAJA 5ILOA 1OV4A 3D2AA 3JAWB 1P45A 1SCJA 2C84A 1YZHA 3JQFC 3SDSA 3TSWA 3EUWA 3ZWQA 2UVPA 3I61A 2PMKA 3INRA 3OM0A 1LB1B 1VI4A 1E2GA 3ZCPA 2AQIA 4E08A 3HJCA 3W5UA 4K9PA 2GERA 3Q7SA 4OD0A 2DJ5A 4MUEA 5DULA 3LYHA 4FEYA 3AUFA 5ALHA 2LKDA 4M1MA 2BEVA 5BQOA 4DR4B 1QDEA 2J9FB 5K6AA 1ILEA 4KTVE 5EUMA 1P4JA 3N58A 2KX7A 4GBJA 4IV0A 5JSHA 1AKMA 3SFVA 1JEEA 4MRVA 4OQ4A 3IDSA 2INGX 4ARUA 3QBTA 2G04A 5FUQA 4IZIA 1W2HA 2V97A 3QUBA 5AJYA 5CPBA 2WWRA 2BKAA 4TV8A 4F85A 4HAZA 1CR4A 3BTVA 5F3WB 1GYPA 3PHJA 4C30A 2IRWA 3DEJA 2CHFA 3R77A 1PJTA 4L5YA 5EWLA 2BSAA 1RPZA 4J07A 4TRRA 2QTFA 3SK0A 2GKSA 3OJOA 4RSHA 2H8GA 3SXUB 2BSQA 3D7DA 4Q16A 2NW6A 1KH3A 1VLQA 3P4XA 4WBNA 5KU7A 3PGMA 1EG7A 1QANA 3K0FB 2QD1A 4JENA 1ZM4A 4ZI7A 3EVBA 3SPXA 2OWEA 4JP2A 4CTKA 1JIKA 5K2MA 1XVVA 3IIMA 1XRNA 4ZDJA 5KX5B 4QRDA 2OV8A 3O9MA 1M7BA 1N5DA 3PIRA 5BRNA 3OIYA 5AKYA 3OIDA 2NU8B 2Z9CA 3W9YA 3H5WA 3P2EA 3W7AA 1XMIA 4IMRA 1RYFA 4N0EA 4TYMA 3S28A 1U8XX 1M6EX 1R8YA 4GKJB 2NVWA 4BQNA 2WPDD 4JUIA 3PD7A 3ZXSA 2XQVA 4GAEA 2PMBA 1N4DA 1ZVKA 2GJ8A 5DV9A 1XKQA 3TS1A 4AURA 1E1LA 4P35A 1T9GR 4UCQA 5K8CA 3EIEA 2JARA 4O3MA 2GUWA 1QE0A 4FOPA 2JK0A 1MC1A 3F6EX 1ECGA 4E70A 1OVMA 3GLFE 3T95A 4P4SB 4U7DA 2HJGA 4C03A 4P7FA 3GZ4A 1KEEB 2QSYA 2AYYA 2GTIA 2PPVA 3GRPA 4JLVA 1YAJA 5KSPA 5C5CA 2YYAA 2WKSA 3I09A 1JBEA 2C31A 1YU9A 1IPFA 2JJYA 2PZAA 3HUFA 1M1ZA 3KYDA 4JJZA 5EJGA 3TMYA 1B00A 3FUXA 3L06A 4H16A 2QZPA 4GDFA 4BJHB 4U00A 3WJ1A 4B76A 4RMGA 1HBJA 4H1HA 4CM7A 5LQMA 2P5SA 3ZHYA 2VO1A 1KAGA 4IJVA 2H11A 1PWZA 2ENUA 3I05A 4E13A 2W37A 3M1AA 3MLBA 2EP8A 3QKSA 4R1MA 3JZAA 3GUYA 1KMHA 1XVTA 2UYYA 4JASB 3S8MA 1GOTA 3C2QA 4C7OA 1QP8A 5FT9A 3WLNA 2IEIA 2ZRNA 1LLDA 3D8RA 1MEOA 1YU6A 2I1VB 3GFVA 3VYSB 1ST3A 5HUQA 2XCOA 2QK4A 4WLOA 1EXVA 2BEJA 3RR2A 1YZFA 3BIXA 4XX0A 5JANA 6ADHA 2BGGA 1OH6A 2BEWB 1HSOA 2F3RA 2FK7A 3ET4A 4ZQCB 3FYHA 2RJ3A 2WTAA 5J2TF 1OLSB 3C8HA 4DTCA 4YX9A 1T9DA 4OSOA 4NE7A 2GXQA 4DA6A 2H59A 1OXBB 2WDPA 1RRMA 2P79A 4ZYYA 1VHJA 4OHKA 4PHCA 1RBQA 2TMDA 3FJOA 4ZVRA 2Q6IA 2OBXA 2OCLA 4KXXA 4DXDA 2J3QA 5I7SA 2IU3A 3QFTA 5ERYA 3DT8A 1Z26A 4ZOLA 3UYKA 1U9IC 3GJSA 4JLMA 4ZQFA 1E8DA 1O6CA 2Z2XA 2VHYA 4AYXA 4WLNA 5FI1B 1P19A 1QKIA 1EBFA 2ONKA 1J07A 1GQRA 5F7ZA 2CYCA 4IGKA 5SZIA 2YYYA 4B7ZA 1I8TA 1N0HA 4CCWA 4EB3A 4YT8A 3HKEA 3GPDG 4UHJA 2E82A 5TARA 5EIFA 1XN1A 3RHTA 1PVVA 3P96A 3WK5A 5JNTA 1IZ0A 1UL1X 1Z25A 2IBMA 1DKRA 2V5VA 2YMPA 4RL6A 3LXRA 1CK4A 4QDKA 1PSWA 5FPHA 3HV0A 3RJ5A 4BQIA 3Q2KA 5IULC 1Q1ZA 5U1PA 4JGGA 4JI5B 2FX2A 4DAEA 2R87A 3PQ4A 2WY2D 2WZBA 4O4JA 2FKAA 3Q2OA 2ODNA 3IQZA 1PEKE 3UAGA 1OIVA 1F0PA 3IAM1 5ESXA 1GL3A 2ZSJA 2DPXA 1N5KA 2D06A 1ZK1A 3AHDA 1KO4A 5EWMA 4K0KB 4DARA 1H1LA 4RIGA 4L9AA 9GPBA 4X9XA 2PKWA 4IIYA 4RETA 1D03A 1MAVA 4FZRA 4Q3BA 1L5VA 3TUZC 4IWYA 4B6OA 1FJGB 3VNRA 1CJKC 1YVDA 3AKDA 3EIHA 3PC4A 1EJBA 4IX1A 3WWDA 3W5AA 2UAGA 3TI9A 2B8JA 4K28A 3WTCA 2E0IA 3NWBA 1FS6A 1K6MA 3ASVA 3D4BA 5IUNC 1Y6FA 3STWA 2O8EB 2AX3A 1UBKS 2ZRFA 4C04A 3SXPA 1Z39A 1NVKA 2C2KA 2UUOA 3HDYA 3MFQA 3OQIA 4QT0A 3BIOA 5HKKA 1QHNA 4MKFA 3OX4A 1KY5A 1E64A 5KNDA 1GTRA 1VA5A 2XB4A 5CVVA 4NK4A 3YASA 1YS9A 3JQ9C 2Z8XA 3INNA 4X7RA 4QXRA 2HRRA 1ZGZA 4D0SA 4EUEA 3ZV6A 2H52A 3RREA 1DC8A 2DKNA 2QLNA 2JI4A 4E5PA 3HLKA 2ZAOA 1OFGA 1NNLA 2XF2A 2JHAA 1RM4A 3BZWA 1KQOA 3FPEA 3QH4A 2PZGA 3Q88A 2VJOA 4QBKA 2H51A 2R7AA 3GD7A 4H7JA 4KPUB 3IRVA 1USIA 1XTKA 3EZLA 4N0PA 3X1KA 3IP6A 5JQGA 1GZ4A 1R00A 4DR5B 5TPWA 1U3UA 1JIJA 4TMTA 1P4SA 3CNLA 3DAHA 3GLHB 3PUKA 3P8ZA 1VJTA 5EJ9A 1WNTA 3UA4A 4LSGA 3BRSA 3MFYA 4LBZA 4UUQA 1PGPA 4EKGA 2CE2X 3O0DA 3IB6A 2FZVA 4XGKA 3NX4A 4PWZA 1RZVA 5ALGA 5F7JA 4DG8A 1ISFA 3DE2X 2NV0A 3UENA 2FGJA 4I9FA 2VRWA 1OPXA 4B6PA 4N4AA 5MHTA 1OBOA 2NZWA 3L77A 3WLSA 1DXQA 3GPCA 3F7OA 2PUDA 2QL6A 1E2KA 2FLVA 2Q8PA 2QU8A 3EISA 2ATVA 4JVLA 4X95A 5CB0A 1MEEA 5IBQA 1Q0TA 2VDRB 1CRWG 2EQAA 2N1BA 1NRIA 4HZUB 4RPHA 4UMVA 3H11B 3I5UA 3DXZA 3R1IA 4FMPA 4KBFA 3EZBA 3UW3A 4I1YA 4KO4S 3EXIA 2DH6A 4DM7A 1OD6A 1KA9H 1Z2OX 1EK0A 3PEYA 1IWPB 2WABA 1RQ2A 2R1TB 3O4GA 4E2YA 4OXYA 4L5BA 1ZUD1 2C7BA 2WPNA 4LDQA 1UDRA 1MA0A 1UXKA 4K6KA 4DBVO 4H77A 4ER6A 1TM3E 2FSSA 1KAEA 4YAIA 2EX4A 1OWMA 3FTEA 1E9EA 3OLYA 2QSUA 1UODA 4IR7A 4LA4A 4NYJR 1ZK3A 4EHDA 4CUZA 4EW3A 1EVYA 4NHOA 2XCRB 3A3NA 3ABRB 4G24A 2FZEA 3CT6A 3BQ9A 1SIBE 1PEDA 3K4QA 4N5LA 2DY0A 4AP5A 2ZJ6A 4M8DA 2IXFA 4QVGA 3FVTA 4IYJA 2VJMB 3Q6IA 3THOA 1NE7A 1YTLA 1QF7A 4UBNA 2OXFA 4JLUA 4BHTA 3AHIA 3GPLA 1I5RA 3QUSA 2I4NA 1YBAA 2R65A 4TSRA 5LB2A 1C4XA 3KHSA 1H8ED 2FMTA 2JLRA 3SDBA 3PHHA 1JYEA 2XBUA 4FR5A 3S4YA 3UK7A 4CV3A 1MGOA 3SYLA 2PTHA 2DPLA 4LVOA 2JGEA 1AUQA 3FTNA 3A58B 4QUEA 4AY2A 4I5EA 5ARBA 2EKZA 1J99A 4MVJF 4OHOA 6NULA 4PX2A 3KHKA 4GHWA 4DLLA 2RGBA 3AHFA 5K51A 3P9KA 1RC0A 1BXGA 4NBSA 2GLUA 1D3AA 4ZYVA 2UXCB 1VHLA 5FR1A 3V8RA 4BE7B 1G5RA 2QX6A 3LYAA 3MTIA 5G1OA 4F04A 1AQJA 4NBLA 4NEHB 1ZVVA 4IIUA 3BBLA 4R51A 2DBQA 3V42A 1JSZA 4B32A 2CL5A 2P2GA 3PITA 1M73E 2CXOA 4WK0B 4BQPA 3CW9A 3K1YA 5INTA 1SCNE 3JQ8A 4HVAA 4D3DA 4NGQA 3CLHA 5A7HA 1MNQA 2AEMA 3PLRA 5GAJA 2A6PA 4J0FA 5GZ6A 4HN2A 3TKLA 3VC7A 5K4GA 4P7JA 2BTEA 1F51E 1V9LA 1DMSA 1DRUA 4GW3A 1L1RA 4II2A 1Y98A 1W4AA 1SBNE 2ZI7A 1L7MA 1YDFA 5DTRA 5BMVB 1XZHA 5C3UA 2H08A 3CY6A 4IRMA 1EK1A 4R1SA 5ECWA 4DSOA 1UKCA 3SBEA 2Y71A 3KPWA 1KU0A 1G98A 1EVIA 1VE1A 2RKOA 3I37X 1C4WA 2XAAA 4JB0A 2R1TA 4KXQA 3Q3JB 4ENUA 3G9ZA 3K92A 3ZQUA 4CODB 4I3GA 1WLSA 4TSKA 1DI0A 1NA5A 1YB2A 1U3DA 2L18A 2WT8A 3QLTA 5B2EA 3ZBQA 4FYHA 1X94A 3L0DA 2I9KA 1S7GA 3UGQA 2IHNA 3LLCA 3HBAA 1INLA 1E0JA 2H0QA 3KWLA 1DB3A 3QXSA 2XRZA 3LOQA 4C4RA 4MTLA 3NXSA 4I50B 3HKCB 2WPDA 3LT2A 2R6AA 3Q85A 1JECA 1U6KA 2B7LA 3B2QA 3KXKA 4OL9A 5CNIA 4DNPA 3IE2A 4K6MA 1USWA 3CTMA 3PPVA 4GQAA 2BLNA 3H84A 4OUDB 3CG4A 4N6GA 3DTTA 4S24A 2UXDB 3A9RA 3BI1A 1ZW1A 2CMHA 4HWOA 3B1FA 2EZ9A 4D9BA 1AQUA 3BF8A 1WX1A 3LA6A 5EXDA 1MO4A 2PVCA 3T3MB 2WAOA 3M1YA 3K1ZA 1AA6A 1U8UA 3BRWD 4C0JA 3E05A 2QQEA 4NJMA 1A9XB 3H3FA 1M0WA 3TRHA 2VYCA 4WA8A 1S8OA 3KKLA 4KWCA 2FUEA 2V8BA 5KTSA 4RW0A 4XWYA 1G8SA 3E4CA 3L92A 3V2GA 2QD3A 3DM5A 1L4NA 2AOXA 2HHCA 3T9DA 1I7DA 3IEUA 4AZ0B 4EP1A 4NU6A 1WDTA 3AR9A 3IUYA 1G3IA 1GTMA 2G5GX 1SBZA 4ETIA 1PCXA 5KOJB 3OFVA 4XD7A 1CE8B 3T3GA 3I52A 1FYVA 3L6BA 3LO8A 1ZBQA 1T0IA 3CPJB 3DZCA 4PSAA 2PYDA 4QGSA 5LMNB 3NRCA 2W42A 5KSOA 2B4RO 2WYOA 1FNCA 4Z1MD 2I2XB 1XF9A 2IEAA 2EJBA 3PQ8A 1ZJZA 1R8JA 2GN0A 3N0RA 3ZWKA 4ZZ1A 5CLLA 4NK5A 5K01A 3FDZB 3W5JA 5JASA 2BHLA 4X6LA 5EUBA 4CKBA 4GVPA 5KPDA 4NZNA 5IM5A 1EX7A 1XU7A 5A4MS 2FN4A 1MIOB 4NDNE 4Y2QA 3FB1A 2Q1YA 2GF2A 2V3VA 1XC7A 2GARA 3DDSA 3ZTTA 4WKPA 2NUBA 2BHTA 2PKYX 1ZSYA 2NZVG 1EK2A 2RGYA 2CHUA 5JAHA 2J0SA 2ZKLA 5AKEA 1CR1A 1XP8A 4OHVA 1XB2A 2AXEA 3R5HA 4RPGA 5GM2A 2PQ6A 1VG8A 3PIDA 1LI7A 1RVV1 3R7WB 1G8PA 1RWBA 1ZZEA 4IFIA 2JLQA 3IKTA 1H42A 4OJMX 3KETA 5CAEA 2J09A 4CKXA 3V4VB 1CRLA 1QG2A 2OD9A 4ZRNA 1OWNA 1PJ3A 1H0HA 4FT4A 1UFKA 5JSQA 1Z34A 2XJ9A 1VC2A 5IEJA 2XQGA 3JYNA 1HQKA 1Z12A 2OAP1 1MB9A 4QJ3A 5EHNA 2P5UA 1CZLA 1MCZA 4UEKA 1I0ZA 3DD1A 5L7WA 4IJWA 3RYTC 2GVDC 3C87A 2G1UA 2DAPA 4O2LA 2EEPA 4A0QA 1P7ZA 1NNUA 3FVWA 1DAPA 3I6SA 3KU4A 4ZOEA 2G8LA 1HLDA 1T1RA 4YXWD 3VSCA 3RTAA 4ZHSA 3E53A 1BE6A 3GPBA 2VBIA 1IY1A 1XEXA 2Q2VA 2D59A 4RZSA 3F8SA 5BO5A 1T5SA 1UT6A 4G65A 2OKCA 2RIPA 1PJRA 3F71A 3F74A 2WJPA 5L7YA 1RI5A 2CLLB 4RU1A 5IC4A 2GD6A 2G5CA 5FORA 1BDBA 4I2NA 1T4CA 3LHSA 3VYRB 3FDJA 3KYIB 1OTYA 1RLJA 3D4IA 3H2YA 4Q47A 1Z63A 1FRZA 2V6MA 1ZFNA 2ZJ7A 5ALPA 3TCXB 1Q5PA 4QOIA 1M10A 1BDJA 4WOPA 3T3NA 2R7MA 1ZGBA 5A9SB 4XQGA 1VZ3A 3BMNB 1P5HA 1L7VC 3OZSA 4MPJA 1V9SA 3F4BA 1LJLA 1A9QA 1D7AA 4MJXA 4BLQA 1EXDA 2X7HA 1C7EA 3OQJA 2XMBA 3SYMA 2XVMA 3UJ9A 1EDDA 1PFKA 1ISHA 3GQBA 2C2OA 3AI1A 4WZAA 1DAIA 1Q3KA 4FC6A 3MBOA 5DNEA 5AVSA 4MINA 3H8VA 1Q57A 5JBQA 4BMXA 2IDKA 1DAMA 1ZLXA 5FOTA 2IX3A 2WIKA 3EJWA 4JLOA 4QDJA 1VA4A 1WB5A 2OCXA 3DOFA 2A14A 3I83A 4JMLA 1JHXA 5FKJA 5BSGA 5FWXB 1OXUA 4UNQA 1Z08A 2OQ2A 1Z45A 3TLCA 4YRTA 3TVTA 1R4MB 2VSOA 3AFHA 3URKA 1CYDA 4RZ3A 1YCDA 2DFKB 2IYNA 2Z6VA 4NI5A 3RJTA 2X14A 3BA6A 3A2LA 3UKJA 2UZ1B 2FG5A 1OU0A 3OTQA 4WNAB 4ENPA 3A8TA 3R9KA 2WIDA 4AM8A 2IHUA 1E4VA 3RPEA 2QY9A 5GTDA 1JKJA 3PGVA 1WHSA 5AQEA 3JYOA 1B8PA 1S2MA 4FGSA 4ROTA 5CDFE 1QH8A 1SVOA 4MTCA 4QM7A 4ZC1A 3FGOA 1KI9A 5A5GA 3I5MA 5EJ6A 3A7DA 2QX7A 4RLSA 4BNHA 4PGMA 1F48A 3C6YA 5LJIA 4F96A 4G0MA 4J0EA 4D4HA 1UINA 3NHJA 7GPBA 3T3OA 3S27A 4MQFA 1F5NA 4GEGA 3ZEAA 1TQDA 3BMCA 3DAPA 4FS8A 5CR9A 1GG9A 4LF8B 2PVVA 3PI6A 1D6MA 3HSKA 5AW7A 1L4EA 1YL6A 2GYVA 3BICA 3QQ5A 3LF1A 1L5MA 3NG1A 5C8YF 4O4JF 1MXHA 3TR5A 2GRAA 1Y6GA 1JIXA 3H2GA 3X43A 2BKEA 2OEPA 4HMQA 1U0EA 4AWXA 1Z4LA 4X5OA 3T1VA 3EA0A 5ADWA 1A3CA 3B60A 3RVOA 3H83A 1QS0B 4LDZA 4XEHA 1DWQA 3G9XA 1RLOA 5FHQA 4KR6A 1RE0A 1PGOA 4WA7A 5DOZA 2CKMA 4LWZA 4PZ0A 4XM0A 4C6SA 4MRNA 1WV0A 4RORA 1EAMA 2VPXA 2XGOA 4IRUB 4GL2A 1D07A 2WICA 1E2MA 5DP2A 4JZYA 3VQTA 1T5TA 3KSZO 3UATA 3NV9A 1SELA 2XHZA 2AEFA 4Q1EA 3WSWA 2D1FA 4KFRA 5B7GA 1Q44A 1EPUA 1MQ8B 4CMKA 2OD2A 1I01A 1YJCA 4Z51A 1AZWA 2C83A 2V59A 2YJNA 5AOCA 5B7PA 4QSHA 3V1KA 4YRQA 3BXXA 4D4KA 5F3DA 4DW8A 3Q9LA 4IOMA 3MTQA 1YQQA 2C2BA 2ZU6A 5DHQA 4MA0A 2AZXA 2P2ZA 2PX8A 4GPTA 4HPJB 4FINA 2SKDA 4EQ6B 3JZIA 1EZAA 3Q1LA 3QVLA 2R6GA 5E6UA 1K06A 4BVBA 1GTSA 1USVA 3QX9A 2ACEA 1MB4A 2O2CA 1IEXA 3AONB 3ECAA 1W4ZA 2CVFA 3LUAA 2I7DA 4UEQA 2X7XA 4E4TA 1GKLA 5EHGA 1L4YA 1JV2B 1GNSA 4C9UA 4OF4A 4AJLA 4O0MA 1XD9A 3N8IA 2ERYA 2PFSA 5AVKA 1LI5A 2B35A 1PGJA 1LK0A 1LQUA 2Z5LA 3NKLA 3FX2A 2HU8A 1QNLA 3GLRA 4WXPA 4XGNA 5EJ4A 3SZOA 1YKGA 3MOIA 5AVQA 2GYUA 4MRMA 1N1GA 4L15A 1WZEA 4KXMA 4E1BA 5KOHB 4L74A 3ADOA 4CV2A 4D74A 5EGSA 2BHNA 5AW8A 3CX8A 1O94A 2DWCA 1QFYA 1K1EA 1JDTA 1Y3FE 2XWJI 3ANTA 2PD3A 1O5IA 4G5RA 2RAVA 2I2CA 1KK0A 4RY9A 1KOJA 3EEFA 4HH3C 4NHEA 5TE9A 3OC0A 1RXIA 4XE5A 3AOGA 4QHTA 4WFIA 4BTLA 2R48A 4X8HA 7ADHA 5THXA 3DL7A 1UXHA 1XQYA 1PF7E 4OKIA 3QVKA 3H17A 2A86A 3NHLA 1YS2X 2QXUA 1V7PC 2XUGA 2E5LB 2PR2A 2HLDA 3DDUA 5ICCA 3OA0A 2QJTA 4M89A 5GV7A 3R7LA 5KC8A 5JS6A 5KINB 7MHTA 4DIKA 3BK7A 1H1DA 4E5DA 4ZYLA 4Q9JA 3HYRA 1AKYA 4XIFA 3O3CA 1NBWB 5EXEA 1UMDA 3AIOA 1K75A 3WISA 2XV1A 3ETJA 4BP9A 1GGVA 5LQUA 4HTAA 1XG5A 4MMZB 1QR2A 4UC0A 5IK2D 4IUDS 1JEQB 1TF5A 1ZO8A 3G8CA 3DF9A 3E4DA 1PYGA 3GL9A 4FFLA 4JN6B 3LW7A 2ZI3A 1X3LA 2PUCA 1LNSA 3MTDA 3OZCA 4QOSA 2F9LA 2BZ0A 1LLCA 1V8ZA 4J2TA 2ZRDA 4S1WA 2OCIA 4HBZA 4TYQA 3UMSA 5EYPA 4V1CA 2C3OA 1JJAA 1WHTA 2XUJA 3OX1A 4UBJA 4LXUA 2W4MA 4D4GA 1E2IA 1FFBA 1BFUA 2ODWA 2QN3A 2ZIXB 5TEWA 4A1OA 1YBVA 2HRQA 3C3CA 2IIQA 1Z33A 3F5MA 4TV8F 1JHMA 3V4ZA 1T9CA 2LV8A 4KR2A 1DU4A 3T5GA 4DWWA 2V7PA 1UQUA 1SXGA 4TWIA 4B6QA 2BWJA 2RAFA 2IGTA 4ZVQA 4ER7A 1LUAA 5BUZA 1UOOA 3AG6A 5AO9A 2PZJA 3P71T 4EW1A 4JDUA 3SHTA 4F86A 3A32A 3AL3A 3CLRD 4DCGA 1EGMB 2BPOA 4MWGA 3DO5A 3U9SA 4ZGGA 3UPTA 1QP0A 4L16A 5G3ZA 1K3TA 1QOQB 2W8BB 4WNIA 3AR3A 4BTEA 4OLBA 2MU1A 4YUXA 4DLXA 2IV3A 1EGAA 3VXKA 5MGBA 1YB4A 2C5BA 1TM5E 2B8EA 1W581 3DV0A 4FDVA 3EZAA 4OLJA 2O1SA 2QMOA 2HXYA 4XDHA 4BIIA 5JAZA 1QQAA 2D5IA 5IFLA 3HJRA 3ICOA 4KVZA 2Q5LA 3DKVA 1H8HD 3KKZA 4NULA 3RUCA 2E87A 1IVNA 1WTCA 5C1OA 3F3KA 4IIDA 3DPSA 4RPLA 3ZD7A 4JI0B 1VHWA 1NXTA 4JLJA 1P73A 2QD5A 3BCHA 3Q1KA 4N49A 3NANA 4RQTA 5KWJA 3AVTA 4XVHA 3PFHA 4ENRA 3UWMA 1YB5A 1LJ8A 1X0VA 3IQDB 2RHRA 3B3QA 1F0KA 2F1IA 2FN8A 4H0NA 5A1TA 2VDJA 3OE7A 2C0PA 5BR7A 1FFXB 3ESZA 1EESA 3G79A 1ZY2A 4Z4HA 5B64A 8LDHA 5KTPA 1FS5A 1MQAA 3HGTA 3ABQB 1L4LA 4FNAA 3G02A 1PG0A 1Y3CE 1G2OA 1A5TA 2AOTB 2CJYA 3D8UA 4FYYA 2CLEB 2VEOA 2PT7A 4HLNA 2VYFA 3KSUA 4H27A 4KKXB 4PO1A 4TS1A 4Q48A 3FOBA 4PINA 4XB1A 3REOA 5G4KB 2ISCA 5FUBA 3OTGA 4LQLA 3E9DA 4RWEA 4Z7NB 3PCXA 3MCWA 3EG5A 1L4MA 5CCEA 4JSYA 3SEFA 3KEGA 3TQFA 4JEMA 5D5QA 3GB9A 5LR6A 3VR6A 3DOEA 3BRCA 2I6QA 3UF0A 1ISMA 5FEUA 2JH8A 1ODCA 3GRUA 4GWGA 5IM4F 4X65B 1CU1A 5FADA 4WLVA 1ZH4A 3O1IC 2Y0PA 3NW9A 4NICA 4CLOB 1W47A 3CRMA 3OO0A 4R40A 4B8ZA 4KXUA 1L7DA 2BMDA 2Y3IA 3U5ZB 4BGIA 2X3FA 2P27A 1JX6A 3NBQA 1CQJA 2GRUA 5JARA 1XQ9A 4L4YA 2C1ZA 5JS1A 3UHFA 1FU4A 2ZXEA 4H1TA 5K2OA 1W1UA 2C2MA 2JAHA 1RQ7A 3PTAA 4IHJA 1DBSA 4DDUA 4GD3Q 9ABPA 4RD4A 4MV3A 4HXEB 3PEVA 4ENWA 1QU3A 3SLRA 3AHJA 3U3KA 1FMJA 3AKYA 1K5PA 2D1RA 3NASA 3KJIA 5ELMA 1UWCA 1M1UA 3OZWA 3UICA 3VSDA 4ZRDA 3WJ2A 1Z6XA 1M1NA 3C8ZA 1SKYE 1U90A 2ORED 3CXUA 3ZHUA 1JDPA 1NM5A 3CR3C 1SG9A 4PRLA 4UBIA 1NHGA 4ZEMA 2F55A 4L50A 1M8JA 1EWTA 3HXMA 2IYFA 3RVKA 5LMCA 1QHGA 4R2JA 1TIBA 3UWKA 2C58A 1LVGA 3I53A 1CJUC 3UPUA 3L6DA 1A7AA 2NTNA 1EHYA 3ILYA 3IKVA 4DRXA 3OZUA 2FWNA 2FDRA 4FFNA 2HI6A 3C16C 4FHGA 4AG3A 4LJAA 3FZQA 3NP7A 4S0ZA 2G40A 3HDGA 4Y0AA 1SVUA 1U2GC 4F2PA 4QFBA 4EPYA 2C4HA 4NV1A 2JVKA 1P0CA 1SQGA 3AJEA 2D2IA 5P8WA 1DC3A 3L6CA 2C4WA 4JA0A 5LZ5A 1E63A 1GGKA 1NJFA 1TMYA 5AHWA 2PUAA 3L05A 4CLRA 1SKUA 1W8DA 4UCWA 1G5PA 4QYSA 3OSUA 5CYGA 4WADA 4ENVA 1U4OA 3KQHA 3HKDA 2D7CA 1MV5A 1DFIA 1P2SA 2ZYVX 1GCOA 2CMDA 3CT4A 5SY4A 3C5WP 1ORRA 4B3DA 4M7RA 4GPZA 2HIMA 5SZJA 1M2EA 5BV1A 1YTUA 4F97A 1FFSA 1MX5A 2MT9A 2DECA 1MH1A 1JFVA 4M0MA 5TF0A 3U4QB 1DRJA 3ZCRA 2AV6A 5JATA 4W5RA 3DOJA 5IMBA 1T8UA 2AZMA 4J90A 4Y1GA 4EQ6A 4W4TA 2GHTA 3EWSA 2X9QA 5H4GA 2Q5EA 2GCEA 1NXWA 2HPHA 2C5HA 3DNPA 1ECJA 1E89A 4J16C 2GA9A 3D2BA 3ZGYA 4H18A 3UTCA 1FDRA 3ECSA 2SBTA 3PYMA 1THTA 3EHDA 3IXLA 1TQHA 4LEIA 4XD2A 3S99A 3T61A 3OQMA 4L6CA 4OXIA 5E8JA 2WJ6A 3EIUA 5G40A 1XNGA 2PGLA 4HWKA 4JBHA 3GVPA 4B81A 2K2WA 1XHEA 3ELWA 2FW7A 1JHZA 4G1BA 4NVRA 3JTEA 1ZD5A 2W0SA 1RAHA 1JA9A 1N2OA 1U7XA 1QGED 2V4UA 3WKEA 4A0HA 2ZCJA 4AN0A 1T13A 2VSQA 1BD4A 1VKNA 3R5JA 1TDJA 2OO5A 4EGQA 3GLIB 3U5TA 2PGJA 2ZQZA 3Q8XB 3U4CA 3NRBA 4WINA 1Z2CA 4D42A 4TTPA 2JGDA 1LPBB 3CUYA 2DIKA 1GG5A 4FGKA 4U5QA 2AFIB 5DWVA 4MYDA 4LGYA 1G6OA 3NU1A 1JXAA 1EHCA 3C97A 3PC8A 4IDEA 2YMQA 4KDEA 4O2AA 5KYGA 2N42A 3ZE0B 2PRIA 1M34E 1DDOA 2ZP1A 4NU8X 5AI9A 4UM9D 5K8TA 2XXAB 1L7OA 1I80A 3KDSE 4OOEA 3NNNA 2IPAB 2QRNA 3QSGA 3DUFA 4CO9A 2VZEA 3QU9A 3BH0A 3R7NA 1QMGA 4ZQBA 2J3JA 1IDOA 2QLBA 3A9CA 3THWB 2IQIA 3R6WA 2A94A 1FBNA 3T7RA 1DWOA 3PR2B 5JLAA 1YL7A 3V3KA 2O48X 1ZH6A 4WUVA 4WNCA 3CSDA 4PHHA 4DJDC 4RFSB 3RVBA 4YCLA 4BLUA 4BLPA 1K08A 4TMZA 4UPEA 4FWIB 5JXGA 3FF3A 3EQ9A 2H48A 2I76A 4D46A 4XWKA 3ADCA 2XNSA 1LPSA 1OTXA 1Q16A 3GRFA 4XDYA 2KMLA 1MVOA 3I1YA 4X7PA 4DQUA 2OZKA 2NZ2A 3CEMA 5AW9A 1GQQA 3NHYA 1Y42X 1RLUA 3JVEA 5HILA 3SYRA 4J3FA 3TSZA 3USCS 3V8EA 2G6BA 4TVOA 2NU6B 3OQHA 3U4QA 4DDVA 4B80A 4EGJA 3ACBA 1EEHA 1C9NA 4DQ0A 3LQQA 4JOCA 4S1TA 5CX1A 1A9YA 5EE0A 1DXHA 4JU8A 2X7JA 3WP1B 4W5JA 4OA5A 2WFZA 1N8SA 4GGMX 4HD8A 1SD5A 3QVTA 4OQMA 4FW9A 5HRAA 5HFAA 3O2NA 4QDZA 5KTMA 2BE9A 1RADA 1QHYA 2IUYA 3PA6A 5D7NA 3M4YA 1LZKA 2AHOA 3HXKA 3U7QB 2UUAB 4MQEB 3OPXA 3NEAA 1FQOA 2IK8A 2J1LA 2QZZA 2O06A 3FPFA 4HP8A 3JD2A 3CX7A 4POAA 4YACA 1M5TA 4E2WA 1AK2A 3AOEC 4R3NA 2XB9A 3RIXA 3NEJA 2KS6A 2J9RA 2KE5A 4J7UA 2ZRJA 2XLCA 1RM5A 4DLKA 2XE6A 1NVUQ 3HDQA 4QUIA 1DC7A 4MEAA 3LUFA 3KKEA 1GKUB 1JG7A 2BEUB 4A8JC 1QQ7A 1TF7A 4OHRA 5JEEA 4DF3A 5JDCA 2F8MA 2VQFB 2XYQA 3RAGA 1YZKA 2ZKIA 1K7YA 4WACA 4BFSA 4L0CA 2XNCA 4J76A 3BWYA 3AEKA 2RHLA 3ONDA 4DB4A 1ID8A 2X19A 3O03A 2HIGA 4UFNA 4E1AA 2NU9A 1D5CA 1O9GA 5EXTA 1G64A 4WZAB 4PQYA 2NVBA 1SEPA 5K8JB 5CA0B 3H9CA 4BU0A 2F67A 1RFLA 1DKUA 3E9RA 4RHXA 1IHPA 2EKBA 4UEOA 4BFXA 2CF5A 1NW3A 1KJYA 3EFOB 4CU2A 2OGSA 1VP9A 3A10A 1Z62A 2WWFA 4NOLA 1CUXA 1X86B 1Y4AE 2GM9A 1D2GA 1UK7A 4PO9A 2AKYA 1R4MA 4LZPA 1E3WA 3I1FA 2HLDD 3BULA 4JNKA 1GSIA 2BGRA 2YBDA 4R2HA 4GOKA 3TTYA 1ZGAA 4QYWA 4KGVA 1TCUA 1IUPA 2GT1A 2IZ7A 3JD0A 3N9IA 3OCYA 4N9WA 3BHMA 1D8TA 4OB8A 3OZFA 3T5CA 2W2QA 2Y93A 3L1VA 4FB5A 1TADA 2AVDA 2MOKA 5IEBA 4GBED 3HZRA 3PX2A 4DQDA 2C3MA 2ZJZA 5CXXA 1OYYA 2Q1UA 2VAVA 5IBPA 4P38A 3QVJA 1WY7A 1IXKA 2PZKA 5EPOA 5KDLA 4EI7A 2BJWA 5IC5A 4YLGA 1JHOA 3I8OA 3CMCO 1PG2A 3BXOA 1ZMOA 1WPQA 3R0QA 3ETLA 3EVFA 3B1XA 4Q3CA 2B99A 2YNMA 1NTOA 4RD6A 1PZMA 1Q7EA 3OCVA 4XPIB 3L7LA 2ZRIA 3W1VA 3PD1A 4MRSA 4CG2A 2JAPA 4JLWA 4JX9A 2MINA 3VR4D 4RJTA 1NC1A 1R5BA 4NZOA 3TYXA 1I13A 5KYWA 1Z18A 3E48A 5FNVA 4BECA 1VGQA 4B4VA 4CT4B 3PDCA 4EJSB 3EQ6A 1LU9A 2VPPA 3MWFA 4YALA 2NZUG 1HLGA 3QEKA 4NENA 4BU1A 8ABPA 4RM2A 1BJTA 4LRYA 1E2NA 1GAWA 2IOFK 4L0DA 1KSFX 4RH1A 5FYQA 1I0LA 1IN6A 1KJQA 1ENOA 2HADA 5CA1B 1JG2A 3JYQA 1DIRA 4QYTA 5TPZD 3OVMA 2ECFA 4PSVA 3RRXA 4G1FA 4KX3A 4TKMA 2CLCX 5TXGA 2B4YA 4G5SA 2WT9A 3EDYA 1IBLB 3VU9A 3ZIAD 4D9MA 5E4JA 2VF2A 4PLCA 1PR4A 2O8BB 2WYUA 1XNHA 1FDUA 1VL6A 2PGAA 4MIEA 1G7SA 1ZD1A 2YV1A 4F4IA 1PZHA 3IUPA 2HRZA 4TV8B 1VLLA 1OILA 3AY7A 3BWEA 1U5CA 2QRHA 4L22A 3I2YX 4LDRA 4QGAA 4RESA 5HTOA 3GBVA 4OYLA 3KTDA 4HNUA 2OBLA 5F2KA 4RPKA 3PZRA 1E4YA 2IU6A 2KQUA 2H1LA 5AVWA 4KR7A 5K0EA 2PGNA 1TYDE 1JA0A 1XTQA 1Z6AA 3DBRA 4FYMA 4MQBA 4ER0A 1ORDA 5JAPA 5ENVA 4QDXA 2PX6A 1UDWA 3DHNA 3JALB 1SWWA 4BB5A 4BKUA 3HVHA 4AJEA 1M0TA 5B6IA 2PTGA 5GM1A 4MVJI 3E22A 3E7WA 4NC9A 1JHRA 1SGWA 3R3JA 5AVOA 5JS2A 1NMYA 2G08A 2VJNA 1HE2A 3ENWA 2N47A 3HEBA 3KYCA 4YRLA 1GKKA 1EFTA 1ELOA 1E1CA 1L8LA 2HBQA 2RK4A 1TYEB 4YUZA 5ARCA 4LW8A 1I4TD 1KFJB 2J3LA 2XZPA 5HX7A 2QIOA 1H93A 2BFFB 3RS8A 1D5WA 3ANLA 3QRWA 5AM1A 3USZA 2X15A 4JEUA 4UAJA 4YS6A 5CDSA 4QM6A 1BN6A 4YPFA 4FIZA 4BL5A 5TMPA 1A9XA 1JH9A 3H4IA 2X4LA 1J2RA 5C1DA 4AC9A 1RABA 4IDOA 4YREA 4G25A 5F7XA 3E35A 1F2UB 1WOYA 1MH9A 3DJFA 1DJLA 3CH7A 4QBFA 2PKEA 3UCFA 1XZLA 4ZICA 3Q0EA 5BMOA 1QIMA 1W4RA 3WIVA 3LWZA 3CWQA 3G5LA 1DTEA 1X42A 1OPRA 3WB9A 3C6QA 4M7PA 1W29A 4C14A 5ALVA 5FNVB 4X62B 2XVZA 1ZYUA 3U7EB 3IS3A 5ALDA 1M2KA 3GWZA 2REOA 4UVDA 4C21A 1HURA 1RD4A 4LOAA 2IS6A 3GLQA 2XR1A 3EWIA 5FBWB 4ZO4A 3HP1A 3LRXA 4WDQA 4LJ9A 3W9BA 2I2WA 3DAOA 3H8SA 1F60A 4M9ZA 2VDWB 4XYBA 1NFFA 3D6VA 4AP9A 4BB0A 3LAWA 5E6SA 4K6GA 3ZBPA 1CUHA 2A0XA 2A30A 5EQTA 2OO3A 2WJZB 1T4GA 4BVKA 2QT9A 1BMTA 4P3OA 2Z98A 4X1KA 4I3HA 2YOFA 3GLFB 3B1YA 5TMEA 2AG5A 1TYAE 1CR2A 3L46A 1NFRA 4R1OA 4J8PA 2FRVA 1FPMA 1OLXB 1TUBB 1DEXA 1R0LA 2X9GA 2Y4NA 1R0ZA 2CL0X 3HCDA 3I0NA 5F64A 4DXAA 3ZS9A 4W5TA 3GRKA 3T07A 4XQ0A 4BO6A 2PZBA 3OIVA 2VT6A 4K6CA 4NXNB 1E5QA 4PGGA 4NCBA 1OI4A 5BN3B 1SEVA 1QH0A 3IVXA 4LJYA 5K45A 4FUTA 4EG1A 3TEJA 5EYPB 4UU0A 3VSBA 1A9ZA 2R7KA 4O2BA 4A0GA 1O94C 1Z6TA 4PHTA 4U7GA 2B98A 2HMSA 3FNBA 4PC6A 1SRQA 4Y30A 3PUYA 4G3XA 3O4RA 4YMSA 3Q4GA 4N82A 1NJ1A 1S2DA 2XCTB 4DYVA 3WBBA 4NCAA 1DNPA 3WYGA 1IZ9A 1B1CA 3EZ7A 3IH5A 2EJCA 5JNLA 3W9SA 2JFXA 2HTFA 4AWAA 3UFXA 3HFSA 5HM8A 4KRYA 4QULA 4X63A 1T6YA 3V33A 5B5SA 2FHSA 5AKHA 1JAZA 2B1GA 1Z2AA 1F2VA 2FEOA 4ANFA 2A4MA 1YJQA 1ZRMA 1NDHA 3BPSA 3EGXB 4KR0A 4OXKA 4WHMA 3TN7A 5K8IA 4PPQA 4WTOA 5HMMA 3TGPA 3GLIA 4P98A 4XJXA 1W85A 3CO5A 2ZTLA 2CCJA 3FOZA 1WVMA 1WXEA 1RHMA 4BNMA 1Z0KA 3L3BA 4YMUA 5L3QB 2HGZA 4DA9A 1C1HA 3BMCB 4I9NA 4KAAA 2AEJA 1XEXB 4R2KA 4WEQA 3MGCA 1H66A 1FSFA 2KM1A 2QW0X 2XTZA 4LECA 4W5HA 4NGSA 2TSYB 4Z5XA 3AUJB 3EVAA 1ZNWA 3GLUA 4Z4GA 2E4YA 3BREA 2DGDA 3DCIA 3JVIA 4QUDA 5SYMA 3QMWA 1KDVA 3SD7A 1M2OB 1U2ZA 3ROEA 4GVXA 1TO6A 2ZBVA 1E7WA 2A7XA 1D2HA 1CZUA 3B13B 2DJIA 2QZJA 1YJXA 3DFMA 4PSDA 2A35A 1NTRA 1YFZA 3IUBA 4P5PA 4ED9A 1PRYA 2OBFA 3LQ4A 4TXLA 3MJSA 3SYKA 3U7JA 4DMKA 2BRUC 3IO5A 2QX9A 4BEBA 3U3OA 5HKBA 1BHQ1 1YB7A 4MCRA 2FPSA 1RJGA 4RFSA 3IPLA 3AUSA 1E5XA 1PGQA 1SD1A 3DL0A 2J4CA 5HR5A 1N9GA 2Z83A 1JLRA 3QG5A 1KQ3A 3DOCA 4DMLA 1MENA 3QFSA 3AX6A 4Z7QB 2PLWA 1JVBA 3ZK8A 2Z2YA 1J00A 3BKXA 3SBDA 5C4GB 2ZSEA 2AOUB 1HT2E 1NKTA 2FPLA 2FQQA 1GNQA 1X7HA 1A72A 2BUBA 2WINI 3GMSA 3WWOA 3TOXA 2XEIA 1AO0A 1C9JA 2RHWA 3ZJTA 4LHXA 5DN6D 1GJRA 2WFMA 3CZRA 1K9VF 4IO1A 5DTJA 5FA8A 5K3DA 4A92A 1N1DA 3O93A 1YB1A 5K20A 1K8YB 3U56A 2ZWPA 3SC4A 1ZD3A 2R1VA 2YXEA 2I6SA 3JQEA 1FRFS 2OZPA 1A1SA 3FD8A 1EP9A 4YK7A 4EVSA 4G5QA 3FH0A 5KREA 2PT9A 3WVNA 4P7BA 4EB8A 2WM2A 4PX9A 3EAQA 4FOTA 3ROTA 5B3JC 4OQYA 1ZVQA 1G7RA 3KKPA 4K8RB 4G5FA 1N0VC 1E58A 2OPHA 4R1LA 3SLGA 2ZB2A 3K16A 4GZMA 4EQZA 4J0QA 1R64A 5HTKA 2ZM6B 1Y9DA 2RE8A 2J8ZA 1CERA 4MR7A 1LLQA 2BEUA 2CUTA 3ZU6A 1SVLA 4GRDA 5CIQA 3EG9A 1L7AA 4CL8A 5T6MA 2Q62A 2BIFA 1WUYA 2WTNA 3WTBA 3QVWA 2ZT7A 4ZTUB 3MNFA 3CR7A 3PQ6A 1JA1A 2ETVA 3LUJA 4J0KA 4JBLA 4XUGB 5FI5A 1NHWA 4PYLA 5FOWA 4ZCTA 3HWRA 3TZLA 1KI2A 4AMBA 3AJ9A 4MGEA 4MUJA 1TLLA 3ADBA 1USKA 1ZCAA 3F6PA 5TS2A 5ALZA 1G7CA 3O3MB 1MJNA 1OKKA 1RRPA 4XGQA 2HO5A 1NAIA 2E48A 2VT2A 1T2FA 6REQA 1BSVA 3N0VA 4R2MA 5JCJD 2DETA 3GMTA 1ADYA 1NASA 2EJTA 4ID9A 1H6DA 2Z3ZA 2WJHA 2HFKA 5HPYB 4LS3A 3CWCA 5JWOA 5G1NA 5BORA 3B1KA 2PFKA 3CRRA 1FS4A 3ZDAA 3CX3A 2HJVA 3KD3A 2NO6A 4JL6A 3GMDA 4L2IB 4NMMA 3KE9A 1RWPA 3GGGA 5LD2C 2C8JA 4QRHA 4JOQA 2ZAYA 2YQ5A 1D2CA 2FGKA 2X0KA 1V3TA 3UYLA 4RLQA 2B25A 3O47A 1ZNYA 2P2SA 3IP3A 3ESRA 3C3WA 3M7IA 3MSXA 4B17A 3D02A 1L5OA 2CCKA 1PD0A 1ZD9A 4YP9A 4CMBA 4TQ9A 5L53A 3WLJA 1V7CA 1UPXA 1Y8AA 1NV8A 2AL7A 2OILA 2QTVB 1XZJA 4I3FA 4RHFA 3AI7A 5M3BA 3WYNA 1K0UA 1VI5A 3QNMA 4AZ3B 1FYXA 3E9CA 5I4KA 4ZAZA 5LMZA 3WMEA 1D8AA 2H31A 3WLOA 2ACKA 5FPSA 1KP3A 5KYUA 1XVUA 2CV0A 2HZ7A 2NXNA 2WU4A 3GCZA 4B3BA 4ECAA 4LSWA 3CG0A 1ULZA 3D3WB 4M54A 2XIJA 4L7QA 3PNOA 2AE1A 2AGVA 3F46A 1KYQA 4RLFA 3WIUA 4BFVA 2HJSA 4GL4A 1OBFO 1BFDA 3GGPA 4DNQA 4HB0A 5JAMA 1JKJB 1U7ZA 3QNWA 3TRKA 2R82A 1SOMA 1H5QA 3WL8A 3QE3A 3A6KA 1GZUA 3QTLA 3A6ZA 3IJRA 3CW8X 4IO0A 4UW9A 3GGCA 3FYUC 2J5RA 2V98A 5JRDS 1O4VA 1DIGA 3T3DA 1KORA 4DBLE 2D6FA 1J0XO 1IEVA 2W6QA 3N6RA 3OU6A 4JCCA 4CQLB 4D8XA 1WMEA 4KLNA 5EQFA 1LTHR 1V26A 5CT6A 3G23A 4BTVA 2Z43A 3WY9A 2CLFB 1ZH2A 1A82A 3LDGA 1WNFA 4LPSA 3UMBA 4N41A 3V1MA 4D9FA 1VGVA 1I4OA 1U1CA 4HLUC 3L79A 3R6DA 1IY9A 3DEZA 3I1IA 3RS0A 1N57A 3M6LA 5CDTA 5HXAA 2R9VA 9ATCA 3U61B 2A9KA 4HDKB 3MVEA 5IAJA 4U2DA 4YYZA 5HJ7A 1O08A 1HDZA 1RM3A 4GPD1 4J9VA 3NH6A 2IPNA 5F21A 1D2NA 4CHGA 3AILA 3H7AA 1TMOA 2R62A 1XP5A 2PPLA 3UUEA 3WLTA 4EIWA 5KOIA 1WSBA 1TTPB 3E0XA 1UEXC 3HNRA 4R6XA 5EHIA 4Q93A 3D0QA 4LYFA 1T5HX 4E5SA 4R5HA 3TCNA 5HP4A 3EEQA 4MGZR 2GB4A 2AEEA 1JQBA 2F90A 2BM8A 3KJEA 2Z6QA 3UAOA 3QQPA 3ND6A 1SQ6A 3N5KA 4FYVA 3R7FA 4R41A 2HK6A 4INOA 1ZK4A 4WKGA 3WQQA 3UB3A 2N46A 1OLXA 1TUBA 3L0SA 1N34B 2XUOA 1MUUA 1R27A 1CDEA 1V37A 4MMYB 1BO6A 3BAZA 3TE7A 3GVHA 4J1QA 1EUDB 2DBYA 1TZBA 1E2JA 2IP1A 4IP0A 3Q72A 4NBUA 4CE6A 4YAOA 1ZAKA 1U2SA 4C1BA 5K5EA 3ZW8A 3I3OA 1I1QB 3KS9A 3VR4H 4O2BB 1COWD 4HGRA 3DG9A 5LN1A 4H7FA 4RK1A 1NVFA 1CEEA 4OG2A 3ZWNA 3IQXA 3WGQA 2IXAA 5LYYA 1O58A 3S5UA 2DFDA 1V16B 1YR1A 2AX4A 2CWDA 3G88A 1U5AA 3GVXA 4YP1A 5FPQA 2CNWA 3PR1A 2QNRA 2PKCA 3RQSA 1CZHA 1QVVA 2JJ8A 4LXGA 4M1SA 1EA5A 1WXWA 5EZYA 2VUIB 2CUZA 2AN1A 4TYNA 3ZX5A 1GNRA 4A73A 3HB5X 4B44A 1MVLA 4WCFC 2FX3A 4C4SA 2BW0A 1XWWA 3E0QA 3IQHX 1E1NA 2C1XA 4E11A 1SH7A 3C74A 4H2DA 3O8QB 4MI9A 9LDTA 3OKCA 2XVYA 5KOHA 1YS4A 2I78A 1WA5A 2GBIA 5CLGA 4G4JA 1Y8ZA 2W6OA 1HDRA 3PEFA 1T26A 4D02A 2PSEA 3E3AA 1L5YA 2E6UX 3TQIA 2DLDA 1FFAA 3OF2A 4PS0A 1FFGA 2X41A 1ONSA 4U8GA 4WKNA 5GJWC 1V11B 3ZH9B 1B0AA 1ESNA 3EMVA 3U17A 1THGA 2XX3A 5KTNA 4BNXA 5ITVA 1Z0JA 3OCJA 2PXAA 4HDSB 5AW3A 4MR8A 2EBWA 2IQ5A 5KQPA 4P3NA 1BQ3A 13PKA 3EHEA 4GXQA 2Q7OE 4BC0A 2G25A 2QTRA 4PRZA 1YR6A 2YASA 2JIBA 3BXHA 4GC9A 2YXNA 4RHYA 5C7IO 4RVNA 1EDEA 4HUQA 1WQ1R 4Z2AA 2Q1SA 4MWZA 1T3GA 2F17A 1DP4A 2OYSA 1CHNA 2ZDGA 3AUXA 2KWIA 2HPAA 3IAS1 1ZWLA 1SHKA 1TT5B 4L28A 1Z7GA 2DFLA 2WZQA 2GO1A 3WLMA 1J97A 3C3BA 3NJ8A 3EZ9A 1SUWA 2QW8A 1SU7A 3UW1A 3K4PA 1J25A 1JTEA 3U44B 5T4FA 2C2XA 2CJWB 2G1JA 5D3KA 3K0EA 4P4IA 1QIKA 1G2QA 2DUUA 3FYDA 1V48A 3NBYC 4BFYA 2GWHA 3O8NA 4KDRA 2GEJA 3NORA 3BS4A 1EG2A 1QC5A 1ZMBA 3CLSC 5ED0A 3VBEA 1YA4A 2HBRA 1M1YA 4ZV7A 1FFCA 1RAFA 3LPMA 3DDCA 3OX2A 2C5QA 4JUAA 1C41A 5J40A 3SG0A 2A1TR 2Q8QA 2FH5B 4YCDA 4CDGA 2WA2A 4O29A 2ISSD 2F00A 1KZ6A 3DC2A 2DKOA 4QUJA 2F59A 1O77A 1KO1A 1V5FA 1W4BA 4PG7A 5JVDB 3WRVA 3AWIA 3STXA 4DLAA 1YZTA 2H29A 3K71B 2AOVA 2C0CA 2NYVA 1RYBA 1GYQA 4C3ZA 3A1SA 4OHFA 2NAPA 3PFGA 1NLUA 4R6WA 4BFZA 2XZLA 3FI9A 1MA3A 2VNAA 2ZI4A 1P17A 4IILA 1Z35A 1S3FA 2XKBA 3FVRA 5C80A 2OR3A 2SCUA 4J75A 4ZPXA 1R5OA 4YNBA 1XJQA 3G6WA 3ZBTA 1L3BA 1ST2A 2HRBA 1QRTA 1JDNA 1GNTA 1V8BA 2YHAA 4MV0A 3FAKA 4N8DA 5HWSA 1NDQA 1XDBA 3HRKA 3DKRA 5FBLB 2JCXA 3DT6A 4LX0A 3ER8A 1XU4A 1JDVA 1N9KA 1TB4A 4PLTA 2QU7A 5F77A 1PZXA 2CLSA 4XOIA 3IOCA 1ETUA 2FEKA 4CFYA 1T0PA 3KHTA 5REQA 3RBUA 3FDFA 1M83A 1ZEMA 1EE2A 1CG6A 3EASA 2B1JA 5G0WA 3ZD9A 7ABPA 5GJBA 1YRWA 2X1HA 3A3YA 1AHNA 3HDVA 4YJ2B 2YNMC 3A4TA 3NB0A 2JGMA 3OJXA 5DT9A 2W6MA 1SKYB 3A2NA 1UJ6A 3VKFA 1EINA 4BDTA 4TUYB 3UJPA 1Z4MA 1Z47A 4EPTA 2IEZA 2Y05A 1KO8A 2X0DA 2Q7DA 1QZUA 1OFHA 4DZTA 3EARA 3UHJA 4E03A 2MHCA 4MW1A 3N75A 1Z7YA 2F8LA 3OLWA 3LT5A 3FMVA 4FJ0A 4ONEA 4UASA 4C6RA 2B69A 3ZDDA 1BCRB 3OJWA 3ZOKA 2JJQA 3PXAA 1HY3A 1AQIA 3FZEA 3C3DA 4D0GA 4GMDA 1AMNA 4YRZA 1ULUA 4LZJA 1N2EA 1UBOS 2JAOA 3L1KA 3F90A 4P5DA 4UQPA 4BQEA 4ZAYA 4UDXX 2ZRCA 3DR3A 3L8CA 1A1VA 5KCZA 2GAFA 4MGHA 5BVGB 3E5RA 5HKKD 3LD9A 2NV2B 1G2IA 3QPCA 1YQEA 1ZIOA 2WQ7A 2QG9A 3RUHA 3OIUA 4QLOA 4ZP1A 3TZBA 3FNHA 3RUFA 3IAM6 1W5EA 3PT5A 1ZITA 4Q4DA 3Q98A 4WBSA 1NOKA 3CEJA 3EC1A 4JEIA 4LIPD 3LY8A 4Y2YA 4PR0A 1MAUA 3MGAA 4JR0A 1UAYA 3M4NA 1QV9A 1YSCA 4FYXA 5ICGA 5K0JA 2JLYA 1EVZA 2JFNA 5FOVA 4RTOA 3RC8A 1CUEA 2D0PB 2Q5OA 3A26A 1TVKA 3E1GA 3L8DA 3OLCX 1U7TA 2J31A 4GMGA 4QTTB 5E2AA 1MOSA 5A4FS 2ZVQX 4NBRA 3R5KA 3ZWXA 2I1LA 1WCXA 2OECA 1JILA 1IY8A 3KEQA 5CXUA 1L7EA 1LNQA 4LNAA 4DWVA 3GJQA 4XB6B 1L6RA 1W0CA 4B9AA 3ITKA 4ZMSA 1FX1A 2E37A 4ACAA 1FYWA 3KTFA 3R6GA 5E38A 5PGMA 4B83A 2EK8A 5JC1A 2ZUBA 3PUZA 3KE8A 3FRHA 5HRCA 3WDMA 2QRVA 4IQGA 4FGZA 4IMPA 1YA6A 2P9GA 5ER6A 3THXB 5COAA 1M1YE 4G1UC 4ND5A 3AERA 3U1BA 2VTBB 3ZK9A 4YJ3F 3A2KA 3IQWA 3KB1A 1MABA 4HUJA 2R85A 4FHDA 3H0EA 1EVKA 3E23A 5BUCA 3DLIA 2QUJA 1CT9A 1V96A 1XJWA 1ZA1A 2ID8A 3ZXXA 1X70A 1YZUA 4JY7A 1N6PA 4EMSA 2OZEA 3HVJA 4YT2A 4IQFA 3T1NA 4MV4A 4HQKA 3ZN2A 3MN1A 1S96A 2ZYIA 2ZJOA 3BH7A 1XE3A 3ZK7A 1X8LA 1U2EA 3TPFA 5I8WA 2JBHA 2PL5A 1Z0DA 1KAHA 4B6FA 3R6TA 4EJ6A 1BX0A 4X8LA 2ZOSA 4EX7A 2E2WA 1Z15A 1VBKA 4IDDA 4B6GA 2RHOA 1UEIA 2C7PA 1DUSA 4GE3A 3AR4A 4BC1A 3PKZA 4O3FA 1IMOA 1V0JA 1QORA 3DR5A 3BFVA 3DBHA 1C9KA 4BZQA 2PSSA 2VR1A 1J39A 3E6AA 1X8KA 4E5KA 3DTVB 4OKNA 5A6SB 1ZMTA 4OCZA 2QLMA 5A06A 3PRKE 1Y7HA 2G4CA 3GP8A 2JLBA 3JRWA 3U4IA 1JR2A 4PLVA 3AJAA 3PNYA 5FL7D 2MMGA 4Z2YA 5L3SB 1ZLYA 4M99A 1SVSA 5FI3A 3GEDA 1N8NA 2I5PO 3CH4B 3I04M 3ROXA 4RF2A 1O0BA 5BQFA 3LX5A 4QLAA 1WXFA 3N87A 2HY7A 3TOSA 1HZJA 1S3SA 5CM9C 4ZCIA 4D97A 5IU6A 1CUIA 3EXHB 4HN9A 1X7XB 3I32A 1K66A 3AKEA 4ARAA 9LDBA 3L6RA 4RHEA 2PS1A 3Q3CA 2FA9A 2D0PA 4FOLA 4HH0A 4RDXA 4EG6A 3GN1A 2ZTMA 4L4ZA 2VI5A 4BO0A 3SVTA 5GIPE 1IJEA 2EF0A 1FTNA 4L3OA 1G59A 5CIYA 4KMOA 2YNMD 1IXRC 2VSXA 1FZTA 4FEGA 2VUHB 3TBHA 3B3JA 3LT0A 1DIOB 3MMNA 2Y76A 1ZH0A 3LY5A 4PZCA 2X0IA 3VFDA 5LZ7A 2NPIA 3ANSA 4J0GA 2VHTA 3UBTA 4JB2A 4AUEA 4RH3A 2FN3A 1M54A 4ABYA 3L07A 4AXXA 3QMPA 4OAPA 3DSRA 4QFDA 3W8RA 4FYJA 1QZZA 5BQ3A 5MFZA 3A1FA 4F6RA 5KNLA 3HCPA 4WXYB 4PRYA 1E61A 2QI9F 2CNWD 4JBIA 2YC4C 3WBJA 4GOOD 4ZO6A 1EK5A 5LQJA 1DQPA 3C1UA 3A27A 4Y1RA 2XWQA 3HI4A 3MT8A 4H9GA 4A2CA 1SVNA 2O1EA 2A0WA 2IDJA 2VDPB 4TT8A 2Z9DA 3ZI7A 5LFAA 2B30A 4I50A 5IAKA 1FLDA 3M6MD 2G07A 2WR8A 1R0XA 1TQ2A 4DCVA 1UPTA 3TNFA 1TO1E 1NR1A 4FFOA 3WLEA 2VP6A 1Y81A 4Q9KA 3I4FA 4F21A 2O7NA 3EPLA 4AY3A 4CKEA 2NM0A 1T2NA 4MDEA 4EHIA 5FDFA 4AKGA 2M6RA 1EWRA 1R8QA 4XOUA 3ZV3A 3RVLA 4BQSA 4R1QA 4YRCA 3OMXA 1PP4A 5KOJA 2P5TB 3KCNA 3V32A 2ZRKA 4CQJA 4QYMA 1K7FB 4IDQA 4K1LA 3UMGA 2DHEA 1GPLA 2OKGA 2H7VA 4YONB 3WIDA 4XW2A 1V6AA 3BL8A 3MPOA 4JJFA 5B37A 2WU0A 1YMQA 3Q3HA 4HK4A 4NAVA 3GHYA 3O90A 5EQJB 4AJHA 4P0TA 1I6WA 5HKAA 4Q66C 3SC3A 4CFZA 4P3XA 2Y1GA 2LGJA 4R3UC 1FDSA 1NUPA 1PNOA 1AKWA 3SBXA 1C2YA 1PL8A 3G0OA 2YFHA 3REQA 1WW2A 3E9ZA 2AF4C 4DRYA 1OB2A 10MHA 2Q50A 4H3KB 1H3FA 4I4LA 1DG1G 3VZRA 4FMCB 2V6FA 2AC2A 3C3YA 2XDWA 2FEPA 2ZRPA 4RFLA 3LX8A 2OOTA 3FMPB 2H1OA 2XDQB 3R09A 4U2KA 4HFMA 2I66A 2QIPA 1AXGA 1T1IA 4CT5A 3OWHA 4YMIA 2HUNA 1HDIA 3L0PA 3MBKA 2W6ID 2YJTD 4GGOA 3I9LA 2DHQA 2JAWA 2QN2A 2IPLA 1P4RA 2HNAA 2ZYDA 2O4CA 2OXCA 4S12A 5B3JA 4CV1A 3IBGA 2J3DA 4G63A 3I2JA 1U4SA 2YRWA 3G7UA 3NJRA 3QEJA 4JT4A 3BHNA 1LCIA 1F2TA 1YQWA 2VRCD 1CUCA 3STHA 4BLTA 1DOZA 3CZQA 4CDMA 2PQ2A 1IM2A 1G55A 1X7ZB 2HL6A 2YQZA 3L4SO 2O14A 2XAUA 2ZRLA 4OVKA 1KIMA 4FLMA 2AFHA 1YASA 1QQ5A 4FI3C 4IWXA 3UTDA 3MB8A 4YLEA 4LYGA 3ICPA 2J0UA 1BE1A 2H2WA 4YJHA 2B21A 4F9GA 1P0QA 3AK4A 3CN7A 2BM0A 4DVJA 4X64B 3VH2A 4FZJA 3AHEA 4OQNA 4CM1A 3PXCX 2Q41A 4HTFB 1K86A 4CMAA 2KPOA 2QLTA 1YVRA 3JATB 4PBRA 2REXB 3QZUA 2ADFA 4BX8A 4CMIA 4DG9A 4Z7OB 4RIIA 2V55B 3B6EA 2RH9B 4N47A 1OJ7A 2IS1A 4EY6A 3AVQA 4WQMA 5LA6F 3ZW9A 1J8YF 2I1WA 2JS7A 1J5EB 2MIIA 2ECOA 3NVDA 3TZKA 3KR1A 4A9AA 4Z4EA 4QUHA 3S68A 2BELA 1SQ0A 1GGFA 1JQAA 2E9SA 3MUOA 4X6YA 5I9MA 3WK9A 3OZGA 2IDMA 1DAGA 3WV4A 2XIQA 2PQ0A 1PFWA 3NPMA 3SJFA 2JFFA 3KUKA 4AS2A 2IELA 3K0CC 4TOIA 4QU9A 1W34A 5KYNA 1N6LA 4GM0A 2OBMA 3FPSA 5ENDA 2Q49A 3BWCA 2H5LA 2Y1CA 3GJTA 3IVMA 4ND7A 5TT1A 2HSZA 4ZODA 5EMNA 4E0BA 1N1EA 1KDZA 1VBHA 5JJIA 4FUQA 1D1SA 2W2LD 2PVSA 4YT5A 2GFQA 3QY0A 4P54A 2P40A 4QJBA 3K6SB 4AX4A 3MHPA 2PY6A 4HGNA 4BP1A 4ND4A 4NJEB 3W06A 4Y6LA 4TLAA 2FI1A 1GGHA 1EE1A 4ZO8A 3LLSA 4RE6A 5A4DA 1YUNA 5F2OA 4CNQA 2FSHA 3EXEB 4QRIA 4XPZA 5U9CA 2CMGA 5JMOA 2OHHA 4PAOA 1E3QA 4XUDA 1NG9A 2A9OA 3H1FA 4WN3A 3HP4A 2DWQA 3UFBA 3P9RA 4PTLA 2O5RA 3JYHA 5I9LA 1CKEA 2RHDA 5FTWA 1OH5A 3MTJA 1B6GA 3KWJA 1WW3A 4FBGA 4KGXA 2GFHA 1AHIA 1SUFA 4DQLA 5BN3A 1HV8A 4Q01A 1C30B 1PZNA 2W48A 1J7KA 1P80A 2QQ0A 1SO8A 3CURA 4Q4HB 4EK9A 1M7GA 2ZBQA 2LRHA 2HJHA 3DLTA 1NZJA 3ZLUA 2GBLC 3O7MA 2JD0A 4L5CA 3O1LA 3U39A 1QHSA 3IX7A 5F1YA 1GARA 4DSNA 1TI7A 5LQRA 4PHFA 3B1ZA 2GN4A 1E0SA 4Q5IA 1UM9B 2NTVA 2BTQB 2V7GA 3VPDA 2YL2A 1ESEA 1R9NA 4UUAA 2UZ1A 3EAFA 1SB9A 1KI8A 2NZ8A 3VPSA 2QD4A 5T8KA 4LV5B 1GA6A 1KOLA 3LOUA 1LJUA 4RNCA 4TRNA 4G97A 1NYTA 3ONWA 5GVSA 2FPPA 3MJTA 2ZZNA 3CNQS 3FEEA 1RBMA 1P61B 3EOZA 1FVXA 1SUPA 3OZXA 3TSAA 3LE8A 3I6IA 3UMCA 4UQLA 2FU5C 2GYYA 2Y68A 2V6GA 1GPAA 4TSFA 1XQVA 3OTWA 3WL7A 5KHOC 2P8SA 2GM4A 2W6ZA 1PW5A 1Y1PA 3EVCA 4I4TF 4Z99A 4RAOA 5DXFA 4A8HA 2ARKA 3P0FA 1Y3HA 3G2IA 3CLTC 4FHEA 5EG5A 3QOYA 3UK2A 2AD1A 4KIUA 3TF5A 3VKHA 3DXYA 5AJVB 1XA0A 1NBMA 1U9ZA 3CNHA 3KZXA 3AVXA 3LBHA 2RGNC 5D1HA 1ZSVA 1NATA 3A37A 3G0GA 3J7TA 3V9PA 2PZEA 1V3QE 1LPAB 3EZNA 1UKVY 4RK6A 4DFDA 3DZ8A 4IDAA 1P9WA 3MWYW 4NDZA 4D79A 3GLIE 2WSIA 3A28A 1C7ZA 2VT3A 5AHXA 4YQEA 1I4WA 4TLDA 2PV0A 4UTRA 4DV2B 1B0PA 4GSLA 3C7CB 3FECA 3PL1A 4V2UA 1R0SA 3B82A 4J9UE 2OCYC 4PX5A 3CNBA 1K98A 4JQZA 1CNFA 4B2IA 1YHYA 3W9UA 2YV2A 2NADA 4PYNA 5FF9A 4ITUA 4DAOA 3SEAA 3CGWA 4EMBA 4NIMA 2DUJA 2QRUA 3BJMA 3TQTA 4R2IA 5KWEA 3KZCA 1XRJA 3FCXA 5CVDA 1RAEA 1HH4A 2VCHA 2A88A 2H17A 3RIMA 3M8KA 4DLUA 3WK6A 3RSCA 4M2LA 3G13A 3JQPA 3ONEA 4FW8A 4I50F 3FUVA 1JTFA 1H8HA 2K4MA 3LTNC 2QPTA 3GX1A 4PO3X 3V9AA 3VDQA 4B3IA 1QYVA 3RJ9A 4E4YA 3L8EA 4FEAA 2PD4A 4S2EA 2A84A 4LNUA 3UGKA 1Q91A 1G7TA 4O1HA 2X1MA 1ZCJA 3D64A 4IW3B 4DR7B 3H8JA 4QQNA 4ER3A 1RWQA 3VHRA 1TM7E 5K7SA 3BL5A 1LDGA 3H7IA 3T9FA 2JIQA 1TEZA 2CDCA 3DWGA 3VVLA 3NVKI 1UBFA 4UPVA 1KP9A 5HBRA 1G19A 4EKYA 2EV9A 1VLJA 2H2HA 1Y9ZA 2RGDA 1XAJA 3SEZA 4GQBA 2YR0A 1W52X 1NNSA 3H6HA 2VATA 4PVCA 4NXMB 1XALA 4GECA 4N5HX 1E99A 3A0UA 4HSGA 4OJQA 2G9VA 2F1HA 3LP6A 4UARA 2PWAA 2YOGA 4WRRA 5EJAA 4DA0A 4EARA 2J30A 1YULA 2FMHA 2GSWA 3Q7RA 2GHQA 1M5RA 3GEMA 1UPAA 1LBSA 4K9MA 3BIWA 1GAJA 1GKIA 1K2WA 3RYHA 3ROPA 1BNCA 3ZHSA 2JD1A 4C3OB 1JXOA 1VMKA 2ZT8A 3JQRA 4MYSA 2C5EA 4LHYA 4OLAA 2GHIA 3M6XA 3RYFA 1L7PA 1YJ5A 3B51X 1G3MA 1YFKA 1AQYA 3NWPA 4GX5A 3HPQA 3OQ6A 4LY3A 5ALXA 1CUWA 1G5FA 4LVNA 4TLMB 1L5NA 3TL3A 4B31A 1M6VA 2VJBA 3MT7A 3PX7A 1OHHA 3A6DA 2BV3A 2PWZA 1L3IA 4NWIA 3ZWPA 1U0JA 3RJMA 3ELDA 1DBWA 4GYJA 3N70A 3CEAA 1AS0A 5DGCA 3TQHA 5C9ZA 1L7XA 1CFJA 2QMQA 4QTUB 4CMEA 4Z4QA 1H0RA 1F8FA 1TCAA 1WHTB 3FGPA 3VZSA 2NTEA 5K05A 4OQFA 2ZE8A 2A0YA 1O95D 4DR6B 3ZQKA 3ZHRA 4KACA 5FWDA 3SOZA 4WK6A 1L8OA 3AEUA 3R41A 3N2LA 4X8OA 5I6DA 3HVIA 2VHWA 5H0IA 2GCPA 4E2FA 2ZBFA 1CUBA 1MG5A 4RL4A 3ETEA 1SC9A 3L1IA 5E4YA 1K5GA 3U4HA 1EVQA 4E5YA 5AVTA 1B76A 2XUIA 1NXSA 3W7BA 1TMGE 4MITA 3JQAA 1X0XA 4OHZA 3VGJA 4TS9A 3HJAA 4V1CI 1U2TA 2DEUA 1IEQA 2AWOA 1FUIA 5ANRB 5COBA 4AX8A 1DMRA 3BCSA 4C9BA 4L8FA 4X90A 2E18A 2B4QA 3C1AA 3IV6A 3RC7A 3D7MA 3I04A 4KQJA 5IKEA 2DUWA 3C7TA 3OCWA 3RV4A 1YOBA 2CW5A 2V9CA 4PLWA 4E12A 5AW0A 4L4RA 1ZOSA 3L04A 1UXGA 2AQKA 1L5GB 4LBVA 4GMXA 3MWDA 3SMVA 5IX8A 1KDTA 2OK8A 3ZE8A 5JXIA 1PIWA 2FPMA 2V03A 3A4VA 2P9BA 1SBIA 1M2VA 3FZYA 5KQSA 3AJ8A 5KJ6A 3A05A 1KZ7B 4DB2A 5FFFA 3T4XA 4Q4AB 4OP1A 5IVDA 3D6HA 4L07A 4CPDA 2R00A 4NU5A 2HU7A 2PXCA 4BV8A 5C4MA 2RHTA 2QYSA 2AOTA 1QYXA 4R8RA 3RFTA 5AK6A 4BKOA 3ESAA 1BIFA 2XLBA 4KXNA 2DQYA 4O4HF 3E18A 2P3LA 1RCTE 2HWGA 3FYTA 2AKAB 3T1QA 1SBCA 3FTQA 2NYRA 2ERXA 4EECA 5CMLA 2GUGA 2HA2A 1XZBA 1WSAA 1WKBA 3DM9B 2Q99A 1WLYA 3LV8A 5IZCA 5H9VA 2EZBA 1TEVA 1C9MA 4Y9RA 3I6MA 4EJ0A 2EGGA 4G5OA 4QDOA 1PWHA 3KSDO 4CHTA 3PEUA 3BB1A 4H7DA 2QTTA 3OCUA 3QYPA 4HWTA 4R9RA 4V02A 1HT0A 3VDMA 2W11A 4C7BA 4YMVA 2J4FA 4Q05A 4Z4CA 4OU5A 1FTQA 4D44A 3ZJ4A 3ZV4A 3QKSB 5D8DA 2WHXA 5HS6A 2PWYA 4FZVA 5T3YA 4F8EA 5I9NA 1JHAA 1OXXK 2BT4A 1GL7A 4XR4A 2OGUA 3NDIA 3P9ZA 4RSRA 4WY2A 4CCSA 1C1XB 3K0AA 5IJZA 3FGZA 1AT1A 4NH4A 3T7CA 2PUWA 2WM3A 3JYPA 1YS1X 5GMOA 4UVGA 1U94A 1WWKA 5DLYA 2EFCB 2X4DA 3BYZA 4DC1A 1LA2A 4HJRA 1DFHA 2R79A 3RYCB 1QK5A 1TQ6A 1E1KA 2D54A 1AKRA 3NUQA 2VT7A 3HY6A 1EFPB 4HEJA 4KK3A 5EPUA 1NKVA 4G4GA 4L08A 4U02A 4B71A 4YXFA 3I5XA 3I9FA 3AY3A 1VB5A 5AVJA 3V8QA 1RHUA 3U7GA 2FAXA 3HXTA 3JWEA 1E5TA 1JI3A 1JIQA 2HU2A 2YVQA 4L3VA 2FYTA 1NYQA 3DGFC 3TO5A 2X8JB 1SN7A 3P26A 1MOPA 4BRUA 4EKNB 2E3JA 3QE2A 1VL5A 2QROA 3G9QA 4P3PA 3RWOA 4EGAA 1SKQA 3HN7A 1YUBA 5JWHA 3A4MA 5GONF 1P1HA 4RUKA 4ZGBA 2QTCA 1J56A 4NE9A 4M83A 1W87A 2SCUB 4YP5A 1SCKA 3I5AA 4PANA 1QO9A 4EW6A 4Q7MB 2I03A 3S8YA 2RBKA 1M6YA 5FPPA 721PA 2JIZD 2IZOA 3BRWA 4WCDA 2CL7X 2G70A 3IRUA 3NHWA 2FMUA 2IPMA 2A5FA 4KRGA 5I3CA 1U1EA 3WGNA 4OI2A 3BCUA 1K7EB 2QE7A 4YV0A 3DS8A 4QDUA 1LBIA 3D4OA 1CJCA 2VBGA 2ZXFA 3IQGX 1UDAA 1C50A 1S02A 2WD9A 2BP7B 3C3JA 5FAKA 2XEXA 5F4BA 3AL0C 1KRXA 3G1UA 3INTA 1EJ6A 2XKAA 2Z2JA 3BTOA 1AF7A 4G4IA 4IV5A 3ZBUA 4CIBA 3DYIA 1IK6A 4ZAGA 3HUTA 3FPLA 5KSWB 1JKIA 4ECEA 1VKHA 1NWCA 5ALJA 4ZOQI 3V4LA 3ZYCA 4B2PA 3OT1B 4BB6A 1MAHA 1KQPA 1A95A 3P94A 2GEUA 2CIJA 3EVGA 3KLOA 3PEWA 4CEHB 3CA8A 5ESRA 4DDHA 1A5BB 1IAQA 1OT3A 1TAHA 1Z73A 3OPVA 4PU0A 5EINA 4W5QA 2CJWA 1V1RA 4L02A 3MUEA 3P5SA 1D2AA 2NPOA 2MTBA 3S6JA 4QVIA 4BGVA 2BHSA 1GUZA 3JQDA 3AZPA 4AP6A 1C8VB 3C8UA 3CZ9A 4JXJA 4JYPA 1Z17A 3RRYA 3W2GA 3HEMA 3V5NA 1WABA 3L8HA 4FJ2A 1UXJA 3F78A 3HB1A 4ZOLB 4AF7A 2WHQA 3LOPA 2K7FA 1CUUA 1TVEA 3OLXA 1EFVB 3K9LA 4ZN6A 2VXOA 4AYWA 1IPEA 1M34A 3FRIA 3IUQA 2DSNA 1C4KA 2G77B 2QJWA 3QPVA 4CVNA 1AS2A 1X7GA 1P9OA 1QH1B 1RWXA 2WHPB 3IEXA 4PFKA 2YJVA 2ADMA 2HCBA 4JELA 3UWDA 4P34A 4R1PA 5CK5A 5DKFA 3KDAA 4M21A 5CJJA 4FFVA 1VQ1A 2HUPA 4QQKA 3HUUA 5FL7A 3P2JA 4OM7A 4XYMA 1CW2B 1UJBA 2AXPA 5AT1A 1U7HA 2UZAA 4FC7A 4C9AA 2P9YA 1EEXB 1M3SA 4H7HA 4M1WA 3WMRA 3GEGA 1Y48E 1UH5A 2V5AA 3C0KA 1NSFA 4BMSA 3B20A 2P3OA 2IUTA 4KL8S 4I1OA 3LM8A 1J8DA 4KYIB 1RAIA 1SUCA 5B4TA 1HDXA 1AZLA 3QELB 2BY4A 3LQRA 2WTXA 5CYOA 5H7XA 3RKRA 1GTL1 2BM9A 3OZDA 1U99A 1ZD2P 4GVLA 5EAIA 4C7MA 3JAKA 3LKVA 5HGXA 2WNHA 1RQNA 3K9HA 3ZWVA 4EUKA 3D0OA 2IXEA 1SC4A 7REQB 2I2FA 3F98A 4JSTA 1RIFA 3D9QX 3OHSX 4JQSA 5JSUA 1T36A 2A9QA 2XMDA 2ZI6A 3GI1A 3BE5A 1CUGA 3BWDD 3MJDA 4IVPA 2GEBA 5TX7A 4BWVA 3EY4A 4JYCA 3GRYA 4RA9B 1GRVA 1VMAA 2NN3C 2AJLI 2FPRA 4MV9A 4NYJQ 1EAYA 5G4LA 1ACJA 1B6TA 1P39A 4IMJB 4ML3A 3PRYA 5B12A 2AS0A 3ZWCA 2JCGA 4K7JA 1JEAA 3Q10A 5GJCA 2ZJ8A 1MU0A 5EEHA 4YA6A 2FMKA 3FJYA 2EQBA 3IUNA 4GSKA 4ZC8A 4D7AA 2JHCA 4Q3OA 4ARCA 2VJPA 1K27A 2B82A 1FF9A 1KBOA 2XMZA 3K05A 3MERA 3JU3A 4CM5A 4D56A 2CF6A 1W88B 2QM3A 3DFZA 4ZV4A 2QBYA 3OEWA 1JSXA 1VMIA 1OH8A 1MO5A 1FJHA 5JV5A 3FPKA 4AO6A 3GFPA 3H04A 3VKGA 3LZCA 4P31A 1QAOA 4G01B 4M36A 3UAYA 2X0SA 3AUAA 5U4QA 1JW9B 4UE6A