4IIXA

Structure of mccf in complex with glutamyl sulfamoyl guanosine
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
338
structure length
338
Chain Sequence
PLLAAPLAVGDTIGFFSSSAPATVTAKNRFFRGVEFLQRKGFKLVSGKLTGKTDFYRSGTIKERAQEFNELVYNPDITCIMSTIGGDNSNSLLPFLDYDAIIANPKIIIGYADTTALLAGIYAKTGLITFYGPALIPSFGEHPPLVDITYESFIKILTRKQSGIYTYTLPEKWSDESINWNENKILRPKKLYKNNCAFYGSGKVEGRVIGGNLNTLTGIWGSEWMPEIRNGDILFIEDSRKSIATVERLFSMLKLNRVFDKVSAIILGKHELFDCAGSKRRPYEVLTEVLDGKQIPVLDGFDCSHTHPMLTLPLGVKLAIDFDNKNISITEQYLSTEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords MccF
publication title Structure of MccF with substrate analogs
rcsb
source organism Escherichia coli
total genus 117
structure length 338
sequence length 338
chains with identical sequence B
ec nomenclature ec 3.4.-.-:
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02016 Peptidase_S66 LD-carboxypeptidase N-terminal domain
A PF17676 Peptidase_S66C LD-carboxypeptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Class I glutamine amidotransferase-like 4iixA01
3.50.30.60 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 LD-carboxypeptidase A C-terminal domain-like 4iixA02
3TLZA 3TLGB 1ZL0A 4E94A 3TLBA 5F5XA 3SR3A 3T5MA 4INJA 3TLYA 1ZRSA 3TLCA 5F1YA 3TLEA 4EYSA 4E5SA 3G23A 2AUMA 5FD8A 2AUNA 4MJXA 4MI1A 3TLAA 3GJZA 4IIYA 3TYXA 5F9MA 3U1BA 4JVOA 3TLGA 5K99A 5JYBA 4IIXA 4H1HA
chains in the Genus database with same CATH superfamily
1SWWA 3WB1A 1XZPA 4MVJH 4HFRA 4P9NA 3E9NA 3IA7A 3P0RA 1YFJA 3PYLA 4RLQA 1H93A 2YS6A 3MERA 1SCDA 2A9JA 2ZI6A 3AFGA 4M49A 1MTZA 5TT0A 5LDDC 3CH5A 1B23P 3RWBA 1I7DA 1T29A 2Z5FA 1ESDA 3QJGA 1K6JA 4B74A 4P0PB 1QZZA 1ZJ5A 1W8IA 2HK7A 4W8OA 3ZS9A 3CQ9A 4E5NA 4EJFA 1SWVA 3QEKA 2QUBA 5B1EA 5FUMA 3U44B 1IQPA 1JT2A 4D3ZA 4D99A 4HX2A 1JR3A 4QTXA 1YB2A 4WEOA 3EG9B 4YJKA 5P8WA 2RIRA 5EWLA 4XVCA 3AY7A 3BIXA 3FSJX 3HZHA 2O50A 4OQZA 1FFAA 2XKJE 1F8FA 1N5JA 1PJQA 1EYZA 4DIEA 1SHUX 4IP0A 1A76A 3O3NB 4PHHA 2DWPA 1D6SA 4EENA 4B3TB 5J2TF 3OEEA 5C81A 4GI1A 4A2WA 3FUTA 4LF8B 4LMPA 4ZKEA 3NASA 1EXDA 2E6KA 1FUKA 3Q9SA 1VQ1A 3EXAA 3FPAA 3A1FA 2LPMA 4ENRA 4XWYA 4EPWA 4BKRA 3G0HA 2X0KA 4OC0A 2V5AA 2WSLA 1L5HA 1QAOA 4FGUA 3TOSA 2WB2A 4OC1A 5B58T 1DINA 1R0KA 1XX6A 1YIDA 5T4FA 3BE8A 5A3JA 3VV2A 4YRKA 5MF6A 1BDHA 3PGKA 3EJ6A 3FGPA 3GG9A 4LOIA 1WG8A 2W2KA 3LWZA 4M9ZA 2I4LA 2WKSA 1QC5B 2WJYA 2JJ1D 4PHCA 2BFMA 3GDWA 1J8QA 3D3WB 3DLIA 3Q6IA 4WBXC 5TMDA 1R6BX 4JP5A 5A7GA 2NUPB 2VLBA 3K9QO 3U7QA 1JIXA 1F8YA 3L5OA 3RABA 3RH0A 4RZIA 3RWOA 3EVDA 3UV6A 3ZBQA 1DFIA 4TV9A 1D2NA 2V6FA 2XF2A 4HTAA 4FIDA 3IDAA 3LHKA 4EGFA 1WSDA 4IF6A 3BCSA 1OZAA 1ONNA 1R88A 2OZEA 4GI3A 3LUBA 3H6GA 3IUSA 3PIIA 2QB5A 5KUTA 4YJHB 1RWOA 4M7WA 4DNXA 4LXYA 2ZATA 3I04A 4OPMA 4QASA 3EMBA 1I51A 3A31A 4ARUA 2HLPA 2B92A 3OKFA 3RADC 1ZMTA 2QYSA 2CMGA 3DKPA 2Q5JA 5LYJF 4C76A 1NXJA 2NZJA 721PA 3B6EA 2ZS7A 1Q1BA 5FORA 2BP7B 2O9JA 1Q5PA 4MR9B 3HG7A 3WGGA 4WLEA 1V5WA 4NCNA 4PSUA 4M1WA 2J5KA 3U4AA 4H1HA 1MB3A 4K9LA 2FF7A 3Q7IA 1SN7A 2R44A 1MW8X 1JJIA 1QRTA 4BQPA 3PA6A 1OC2A 1H8EA 4FWTA 1EZAA 1QGUA 5E9WA 2QEQA 3AEKA 4PPNA 2O1XA 1O6ZA 3H9QA 3QX3A 4J0DA 1VGQA 4Q7KA 4RFLA 3AVUA 2GMWA 3OJWA 2INGX 4D4HA 1C8KA 2I8AA 3UFXA 1Z5VA 3D7MA 3GLHB 1U8AA 3LHSA 4OH7A 5FV4A 2BGGA 1KDRA 3RPEA 1TQ2A 1N2CB 2XQVA 2UAGA 2I2CA 1HDZA 1OQAA 4Z1MD 4HNUA 3Q1KA 3CHYA 2JIZD 1BW9B 5JQGB 4JOQA 1THTA 2B7LA 1JH9A 3G5UA 3ET5A 2C5FA 3JR7A 1KSJA 3BWEA 2W8BB 4EARA 1N7IA 3RRBA 4BJ1A 1ZHHA 4G24A 3O1JC 2BMVA 4EVRA 2XZTA 1OZ0A 4P5DA 1T6XA 2V03A 3GG2A 4M87A 1E58A 5FHQA 3QKUA 3M6MD 3TLCA 1UUFA 1WPGA 4FGSA 4GI5A 2VQ6A 3GJXC 4ARSA 5EKTA 1ZSVA 2DQ4A 4PZYA 2A92A 1YR1A 3K72B 5CLJA 3T3GA 2Y8EA 2IHJA 3CH7A 4QX6A 1RBQA 3S2IA 3G0IA 4XARA 3RYFA 5LQNA 5HP4A 5JJIA 2YHIA 4DV1B 1CUJA 1ODLA 4N5HX 5EJIA 3N8HA 5HS6A 3U3JA 2IBSA 4DIOA 1I9GA 3E70C 3NEPX 1F5SA 2D06A 1E2LA 2CYBA 2C5HA 4UATA 1BCSB 4QL3A 3HVHA 1NBWB 4D80A 3MQ2A 3PX3A 1JUDA 4N76A 3LW8A 4Q19A 5FBQB 3V7NA 1J33A 2PMKA 4F93B 4EFLA 1DADA 2GBGA 2X9GA 2C9BA 1NYRA 1RYEA 1LQ2A 3RB8A 4F45A 4KK3A 4M1TA 4CIYA 3ZKWB 4YJGB 3OZWA 1VM6A 4G4IA 3E23A 2LRHA 3A9TA 3AUSA 3LBAA 4PZ9A 5FOTA 5GZ1A 1PW7A 3CY6A 5C1BA 5I8WA 5IXYA 4TL9A 4PNHA 1R16A 3HM2A 1DX4A 2OFPA 1ZW1A 4NCHA 1BJTA 3TN7A 4E2WA 2WAOA 3A7DA 1NQUA 3T1VA 4YAGA 5L4NA 1V6CA 3T3DA 4DQXA 1ECCA 2ZYUX 2I9KA 3VDXA 2JATA 4YROA 2L17A 4N3AA 4DC1A 4LBWA 4C4ZA 1KERA 1OFHA 3I39X 4L2IA 1OIXA 3X1WA 2WSSA 3KZKA 1A9SA 3L7OA 1JP7A 1QLJA 3N0RA 4J7UA 5CXSA 2QUHA 1JLSA 2QU7A 1UAGA 4DA8A 1CRZA 5AKIA 5FFFA 1HQKA 1P9OA 3FLEA 3Q3IA 2CLMB 3LO5A 2XWSA 3RC9A 5CDFA 4DV4B 1C1XB 7YASA 1GQSA 1JEDA 2YXNA 3ZHCA 4GOXA 3CGWA 2X4IA 4RD3A 3ROKA 5BUCA 3EVFA 5P21A 1TQ4A 2GYVA 3V00A 4KG7A 2YBEA 5LCXA 2D00A 2P1ZA 4URZR 4YX9A 2O8EB 2FW1A 4IOLA 1PFYA 5ERGB 3I01M 4ZGWA 4I50F 2EZ9A 1SAYA 4JYPA 1OGJA 3EULA 3FI0A 3GCZA 4ZAFA 2VLIA 5I7RA 4LF7B 1XCBA 2QTMA 4NECA 3T3HA 4C06A 2AS0A 1P6UA 2NU6A 3M6VA 4QLOA 3TSWA 3UAGA 1DKQA 4BP1A 3LBYA 3VO1A 4E30A 2WKWA 3CLRC 4WD3A 4YAOA 3U3DA 3ETNA 2AQ8A 4Q9JA 4CDMA 3L1JA 3EHDA 4JT4A 4EG3A 1UIMA 2XGGA 3DKRA 3D6NB 3BD6A 5D3MA 2QE7A 3UKDA 5LU8A 4LZPA 3K71B 1AZSC 1KBLA 1O96A 1C9DB 4HNAA 5JLJA 5IC5A 3HBAA 3TRHA 1NUPA 4P4FA 3B1KA 2ECOA 3HRKA 1SBTA 5EXTA 4DC9A 3VVBA 2C7GA 1GZ5A 1GR1A 1NI4B 3HCFA 4XB1A 4RKRA 1A98A 5CIWA 4S1OA 3IP3A 5I9LA 3UUFA 3QLUC 4TZ0A 1T4GA 1N6NA 5ILQA 3TE6A 4G23A 4GBMA 4PPYA 1SUEA 2V7PA 4FNGA 2W58A 4YP5A 2E82A 4CR8A 1V4NA 1CJUC 1CDEA 1TB4A 3WB0A 2IJGX 5C51B 4Z4IA 1WUIS 2I3BA 4WK4B 3M6XA 1I5RA 1X7YA 4G5FA 1L5MA 4OJTA 3LFTA 3O31A 3VSAA 1YZKA 5ALDA 4C6HA 3IAEA 3WAJA 1CPYA 4L4YA 4IR7A 2XQJA 5TSDA 4OMFG 4B45A 5JZMA 5J1SB 4MW9A 1MGPA 3CBGA 4YJ2A 1M6HA 1W5BA 2W6JD 4BFWA 1J3LA 3I5XA 2C4WA 4K46A 4L8GA 3EJWA 4U6SA 4RGVA 4BZQA 5IT4A 1RYZA 4HAYA 1ZRMA 3E9YA 5C8YB 2J3EA 2CMDA 3CX8A 3WYNA 2I6GA 2WG0A 4JQYA 1RTKA 1M1YA 3ZBUA 3DF9A 4E08A 5CA1B 1KI7A 5AVKA 3I72A 4I9FA 1Z6PA 2FEOA 2V59A 2Y1CA 3LH5A 4DVJA 3THWB 4V0NA 4V1CA 2Q99A 3AF4A 3QU5A 1U3FA 4WKGA 3RJTA 1VXRA 4PO1A 1HNZB 3MGAA 3R23A 1YC2A 1BQ3A 1JHVA 2R8PA 4CTNA 4J0FA 2HCTA 4U3JB 5DSXA 1L5KA 3WQQA 2BI8A 2BIFA 3NPAA 1E69A 1U6IA 3E7XA 4WBNF 3DTVA 3L7LA 1DARA 1HQCA 2O5VA 4KGZA 3UUGA 5KJCA 3SJXA 3EXIA 3OU2A 1R64A 1WKBA 5PGMA 1E79D 2C8VA 2ZBEA 4MYHA 2HSGA 4O1IA 2ZAOA 4WZ6A 4HX9A 2N0SA 2WU4A 3JVDA 3SG0A 4TGLA 4R3NA 4AJ9A 4OB6A 2D2IA 1YZGA 4QBKA 2ZIGA 2G1UA 3ILYA 3DZHA 1CS0A 4FS3A 3JWPA 4OHFA 3ZCSA 4OHBA 4ZAZA 2XH8A 4OB7A 5KWJA 4Y18A 5IG2A 1JA1A 3FFBA 5CX1B 4AXXA 3RAGA 4DR3B 1V7CA 2XUKA 4H2DA 1Z4OA 4HY3A 3TVTA 3URMA 5DHFA 5HJ7A 3SQXA 1W46A 2BBOA 4WDRA 1D4FA 4Q02A 1BDBA 3ASUA 4MWGA 1YRBA 2ODBA 4MWEA 4Q05A 4EG4A 5LQMA 4RIGA 1NR5A 4O2BF 2PA3A 4EHDA 3BHNA 4U7WA 3ZW8A 2CE2X 5H82A 1HE4A 4Z4CA 5FUVA 1RBYA 3EQ9A 1XEXA 3T6KA 2EDCA 2V6IA 2Q5OA 1J42A 3JAMA 4FBGA 4MKGA 3TZBA 1W35A 1XMQB 2BZSA 3M81A 4TXHA 3E3LA 1ZM7A 3G49A 2NXWA 2G77B 1BMFD 3JARA 4H7IA 2VHZA 1V5EA 4N8EA 1J90A 2WP0A 1FVOA 4JYWA 1XP5A 1UKAA 4MS4A 5AHOA 1I94B 5DN6A 1BRTA 1RLIA 3N8KA 5E6UA 3E7DA 2VBIA 4D3YA 4ONEA 2HJ9A 1SUIA 3QEJA 5DB4A 3MWJA 1Z3IX 2O3JA 5A9SB 3DKVA 2IYNA 5GVRA 1KWKA 4F71A 1MFZA 1O5OA 2F8SA 4OMCA 1CUWA 1JAZA 1YRHA 4E4YA 5ITVA 2I6QA 4PVDA 4D6XA 4G0MA 1MXFA 2HD4A 3PZRA 1T2AA 4FHEA 3N8DA 4K6HA 5FIUA 1QRDA 3KJIA 1CB0A 3WX0A 1GTSA 1HX7A 1X80A 3E3NA 3I6YA 1X3LA 4CCWA 3I04M 3QTBA 4MIOA 1BXGB 1CKEA 2LXNA 4Z4HA 4B3XA 3VR4H 4YAFA 2BSQA 1MC5A 2PKEA 1N2EA 4II3A 4TTQA 3JZAA 3M9LA 3EGEA 1HDXA 3IAAA 4DF3A 4DKXA 4YV7A 5JU6A 4U8GA 3QLUA 2G1PA 1DRKA 5DI3B 4BX3A 1PUIA 2WWGA 1BVYF 1HEUA 2V9PA 5ALIA 4MUAA 3WIDA 1GPH1 2C07A 2D5IA 2H2IA 3D5QA 4E5PA 4CG0A 3STTA 3Q8KA 4HUQA 2ZRIA 3CRW1 3IDZA 1N1EA 4CMIA 1QG2A 4PU0A 2QN3A 3QZUA 4IGFA 7ADHA 3IX7A 4IBOA 3VISA 4BAGA 1JDEA 2BJWA 1VKHA 2OXCA 1YZYA 3K2BA 4AZ3A 1NW6A 1SC1A 5KQMA 4PYQA 2NVUA 1IHUA 4H7HA 2VP3A 1NMYA 2ZM5A 1ZHOA 4UU7A 2IEYA 2YOGA 1XGKA 4AYXA 5BOVA 5JUWA 3BVPA 3R75A 2CHGA 4O1HA 4IUYA 3FNBA 4UASA 3MHPA 5FPPA 4V0RA 1BMDA 1UMBA 3Q7QA 1QV6A 1TRKA 5FNVA 3K4QA 2Z9BA 4N03A 3FVTA 1OX5A 2OZLA 3OQMA 1FSPA 2J9XB 3C1UA 1Q1QA 4UCQA 1T9ZA 2P5TB 2W22A 1WPXA 4BE4A 1YDEA 4OI0A 4ZYUA 4BNTA 3PICA 2R1TA 1MOZA 2I6XA 2XDQB 4NJMA 4J76A 2ZVQX 4PONA 4KFUA 4AQYB 1KQFA 1Y63A 3FPFA 4L9RA 5AKHA 3PQ8A 2FPKA 4Q3OA 2CJWB 2G71A 2VEOA 5FI0B 1SCKA 1LI7A 1BDMA 2J7PA 3GEIA 5KOYA 1P6XA 4BJ3A 3BL6A 2F1JA 4CNBA 4F96A 2P2GA 1YH3A 1Z37A 4IUBS 4V1CI 2YIVX 1PG5A 3K5PA 1NMSA 1HTWA 1AX9A 2BFDA 2GK3A 2GHTA 3PC6A 5I4IA 3B51X 1DIGA 2ZTMA 3T3IA 4EYOA 5ADWA 4D9JA 3ZZNA 1L8AA 1ULZA 5CUQA 4UVGA 1PR0A 4HGPA 1C0LA 1TW3A 1UF9A 2BZ1A 4IDEA 2IXTA 4ZEOA 1USWA 2CLOB 3PRKE 3SX2A 5JC8A 1HNWB 2ZI7A 5BN5A 1R9MA 1FLVA 1FXUA 4D81A 3UK2A 3CR3C 4DJEC 3HCCA 2IYTA 3CEMA 4Q7LA 4XCQA 3WLSA 3JQAB 1FNBA 3S5JA 5AESA 2UUAB 3VR1A 2P91A 4JS0A 4Z9BA 4P36A 4X8LA 2VUHB 1QORA 3QWIA 4G41A 2JIMA 2LD4A 3ITDA 2Z83A 3B5EA 2REXB 4TWRA 4C9AA 1CUUA 1UXIA 1G291 4Z8YA 1TKRA 3DR5A 2RC6A 3T7DA 5KKNB 4MP8A 3AFNA 1VTKA 4Q3KA 4CGZA 1ZYUA 2X6TA 5EC8A 3ZY6A 3A3KA 1OLUA 5JSQA 2XD4A 1W6UA 2Q5EA 1M2WA 3HU1A 2EW8A 2HKIA 1WB4A 3NBQA 4Q9HA 2W6IA 5TQ2A 5D5PA 2FG5A 4ZRDA 1QH8A 1Z4NA 1V1JA 2VDUE 3SMQA 1E1MA 1NVGA 2X9NA 3GYBA 2B9EA 1MDFA 5ERYA 2HRDA 3R5JA 5K3FA 5DM0A 4C20A 1B74A 2JJYA 2QX8A 4ARZA 3GLUA 3LBIA 2UXDB 4U8HA 4JXXA 1QH1B 4MB6A 1UPUA 3EGWA 4IXNA 4K8OA 1PSZA 4S05A 1KYIA 1HYQA 3Q3HA 1IRXA 4CKYA 1Q77A 3GY0A 5C4IA 2AR9A 4UEKA 5GJVC 2NXJA 2XOXA 2X40A 3HWSA 3QUSA 3S0JA 2ZYGA 2WOJA 1ZEJA 3IT1A 4QM6A 5LYJA 4Y2HA 3TINA 1C9YA 3EN0A 1H4SA 1EESA 1BFKA 3FDFA 1QDUA 4J1QA 3R9WA 5CEFA 1CNFA 4RYLA 4CEHB 2AI3A 2CW5A 5COQA 4C87A 2VBFA 1U2DC 3TB4A 1E6UA 4J3JA 2O8FB 2BTQA 3WXMA 3VKVA 3SSNA 3LZDA 1E5LA 3ROTA 4R71A 5KSOA 4IZOA 4QATA 1ISMA 3PD1A 2Y6VA 2N47A 3M82A 3VR3D 4ENQA 4UCXA 4ML3A 2QW0X 3A1CA 3Q7TA 4OHCA 5LXTA 5MFPA 4F3TA 2ZIVB 1JHMA 2HBZA 5TGTA 1JJBA 1DELA 4FHCA 3WLMA 3L7DA 1G41A 2WFLA 3KEFA 3OESA 1PSDA 4ATNA 3DBVO 4DUPA 3BD8A 4Z2AA 1XYYA 3P52A 4FFBA 3HYNA 4DQKA 4HYQA 3GQVA 3SNHA 3L5KA 2YMLA 4RDHA 2YJGA 3NETA 4ZOCA 2EW1A 3E05A 3IBTA 3WL4A 1GG8A 3T7RA 1MZVA 3QU4A 3RVOA 4FSXA 4IRMA 1Z5NA 3O0TA 5J4VA 2JBAB 3HFSA 4RTOA 2QJOA 1XL1A 4UAUA 3C8OA 3LAWA 4C8CA 3GZNA 3CNBA 1QZ3A 2C84A 2I62A 3E2IA 4RETA 3Q8MA 4MYRA 4CODB 3MJDA 1MO2A 3K4PA 4C8PA 4H59A 1DXYA 4TV8B 3OTOB 1P7WA 1V8OA 4H0NA 2ZEJA 2G80A 4OIMA 1JU9A 3CF0A 5ALZA 4Y0NA 1WMSA 2EP5A 3PCRB 3STHA 2G06A 1MORA 3WNZA 4QSHA 3IVRA 4LOHA 1T5OA 2IYPA 5JD3A 4HB3A 3FIJA 4YJFA 3SS9X 4R4JA 5A9RA 1PR9A 3KB1A 1M66A 4FQ8A 4B3RB 5L7YA 2AMLA 4XRRA 1H85A 1NYQA 4FYJA 1QSGA 1T8RA 1WU8A 2XOEA 2ZT5A 1QO0D 3CU5A 1ZX1A 1XHFA 3DE0X 4OHVA 5AIBA 5DNCA 1F48A 1YT5A 3M3DA 3EWSA 1CE8B 1G9SA 3HCEA 3W2HA 2J67A 3OIWA 1P17A 5HMMA 3UO8B 1QF7A 2B1IA 1AF4A 1VP3A 2MSCB 4Q21A 3OMWA 1A9PA 2PRIA 1X38A 1N25A 5KX5F 1OY1A 1IN4A 1JKIA 1XBTA 4C0KA 4M38A 1QIJA 2QJWA 1XHLA 3AR8A 3DCYA 3I5YA 2TMYA 5EZ6B 3Q88A 3UPDA 4NV3A 1D1SA 2PX4A 3GA5A 4BFYA 2DR0A 5FWXB 1N4AA 1Q0ZA 5CW1A 2J9FA 2XWJI 2JJ8A 3H0KA 1PWYE 1P2DA 4FR2A 4N5IX 5EMHA 2EHDA 2B2XA 7REQA 1Z63A 4PHTA 2OFWA 4PG7A 5TC4A 3HBLA 4HQLA 4J03A 2IGTA 4PC2A 4YI3A 3RV4A 2Q2QA 3E15A 2Q6IA 4M2LA 5FAXA 2WSIA 3C1TA 4YIKA 1E1NA 3EVTA 3LWBA 3KQWA 1HRDA 1AD2A 5EIFA 3NFYA 2IUUA 4XWOA 2V7TA 4PLVA 1QRAA 3Q87B 2ZWAA 4DV0B 3PFHA 3QUBA 4EPYA 3OCWA 2H31A 4IM7A 4CM7A 3BSFA 4AUMA 3GEGA 2JRLA 4OH1A 2FVYA 4MRRA 3ZV7A 3THXA 4ZVNA 8GPBA 1I7LA 2XVYA 3GH3A 4WLOA 2OLKA 3CTPA 4W1SA 5GP1A 3IJPA 1FFDA 4NJOA 4BX0A 3QMWA 4EGCB 4LQ4A 1M8GA 2BFBA 1YV9A 1MRZA 2GI4A 2O3SA 4IWNA 1YS4A 5JROA 2FXIA 4L9WA 3BMCB 2BKUA 5LP6B 1RLOA 1UBMS 3I53A 1N6HA 3I12A 4GGOA 3BJIC 3ZWXA 4ZVOA 3FB1A 2XB2A 3OLZA 2JBJA 2C57A 5KPJA 2DJIA 1HFJA 4DGQA 1MCZA 2CHQA 1MRNA 2JVJA 1X7WB 1U9IC 3AU8A 1XMVA 4BQNA 1YONA 5JIBA 7AT1A 3KOWA 1W36C 5AVTA 3DZ8A 1YS7A 4XDYA 3RT1A 5IAAA 1YKFA 2JHAA 1ZNXA 3KV3O 4QNRA 4FHGA 3R09A 3ROZA 4DCMA 5I7VA 4C7OA 2AG8A 2VHEA 2I1WA 3ZV5A 3FZNA 2DT8A 4BKUA 2ZYAA 1RYYA 3WYAA 5KTSA 4Z3OA 2BGNA 5B1YA 2C2YA 3LPMA 4R5MA 1NQ5A 1U2DA 2DJ5A 3QLVC 1JVBA 4GECA 5DGCA 1ZNQO 2RK4A 3S3TA 2PJRA 1FMLA 3UUEA 3QUCA 4MUIA 1OWNA 3LXUX 1WY7A 2AEFA 2PSFA 4M4SA 3HZOA 2DBVO 4ZYXA 2W2TA 4AN0A 4B3SB 2V8OA 2G1AA 3O94A 4MUGA 1Y98A 1IWOA 1WCYA 1B73A 2O5RA 4YMTA 4R2MA 1FYVA 1G6Q1 5ICEA 4JI8B 5HEKA 1BJKA 4KYIB 2IF2A 3ROXA 2K6GA 1XRLA 2W8ZA 4LI0A 2KBFA 3HKEB 1RHUA 2J3HA 4MJ7A 3JPYA 1C0PA 2NVOA 1K4YA 3COVA 5L45A 1FDWA 5F3DA 4Y2TA 5IAGA 4JUCA 3O8CA 1RWMA 5KC9A 3WWEA 1ML3A 3AI3A 2JI6A 5EEHA 1KFBB 4XWWA 2QD2A 4ZZ0A 2HK8A 4CEIB 2CZCA 1QVWA 2AFHA 1WM1A 2IYVA 4B4OA 2VJMA 3RK1A 4ER7A 4HEQA 1E9BA 4Y6PA 5HKAA 3U26A 4AKIA 2HEIA 2PGNA 4LHEA 4U2KA 2LCQA 2X0EA 1T3SA 1XRMA 4NQRA 2QLBA 2GH1A 5DXFA 3HCBA 1I1OA 1T8PA 5G1PA 5TRTA 5I4KA 1BG6A 4I1IA 3UKJA 2ZUEA 1XTKA 3FDIA 3INRA 4LE0A 4MSUA 1F51E 4AJ1A 1Q5XA 3NBUA 5IHPA 5JHHB 2D3TA 1R0LA 3GH1A 1U7DA 1UQRA 2Y76A 4KQ9A 3BDVA 2AFIE 2RHGB 2A94A 2WWRA 4HFMA 1XZCA 3DVQX 2C92A 4NONA 3X1DA 4BFTA 1NFRA 2PS9A 4H7DA 4OUDB 2YFHA 6REQB 1ZXXA 4NIMA 4QD3A 2P68A 1RRKA 4R41A 4AO8A 1PYGA 3GYGA 3O9ZA 5K0TA 2O6LA 2FFRA 4HLDA 4D9NA 3AEUB 4NCKA 1XCPA 5CTAA 3P9RA 3ABRB 3ZY3A 4C7MA 4MPRA 3ZNNA 3GPCA 5DHTA 1MJFA 4BO4A 3OIDA 1UODA 4PCVA 2DX7A 1MDBA 3L84A 3OECA 5EG5A 3T3EA 4INZA 3ZS8A 2IC5A 3T4UA 2IEZA 5CLLA 3OJLA 2JG3A 1PNOA 2ZROA 3GT3A 4PQGA 3WK9A 4NPAA 4MGKR 1DKNA 3TYXA 2YCBA 1DOHA 4UM5A 3X2EA 4UU8A 2VUSA 2ZB8A 5CFNA 5LMNB 3D8UA 1QGDA 3NAMA 3BKWA 5JJBA 4HWRA 4N5LA 2NZXA 1SK8A 2ENWA 2W2PA 4GU5A 1NN5A 1CT9A 1PFQA 2C5LA 2GO7A 4DM3A 3JY6A 4JZKA 4RKYA 1DDGA 1VKRA 1PUJA 1DO8A 3G2QA 2O1SA 3F6YA 4Z7NB 4RTQA 3RUDA 4RVGA 3WYCA 1K0UA 5AMXA 5CU7A 3L1UA 2X0RA 1GRCA 4RJKA 3A1TA 1M34A 2H51A 2Y68A 1ZK1A 3IVXA 3QV2A 2XCQA 4IGAA 4I19A 2VSOA 4MKZA 3JWHA 3GJZA 4MS3B 4P4GA 4RHEA 4UBKA 2AYYA 5HIIA 1O95D 3OLVA 4YDHB 4TUYA 3RHZA 3TDKA 3FSRA 3L8FA 1R27A 2RGXA 4II2A 1JDVA 1K3TA 4Q82A 3G2OA 5JCJA 4EUKA 4JLOA 3ZI7A 5JPDA 4WLFA 4N0PA 4B6EA 1TI7A 1AUOA 3CONA 3O4VA 4XCVA 5EY5B 3FJOA 4HP8A 4Y1EA 4CXMA 3EGXA 3U16A 2NGRA 4FNAA 4HZIA 1CUIA 2OZVA 4PC3A 4YREA 4MI6A 1L7NA 3PHIA 3HPRA 1U94A 1NF2A 3L6DA 4JX8A 4FLFA 4OXXA 3ZZTA 2FQXA 1M3SA 2QRUA 2DMRA 2WWIA 4MVJP 5LDHA 4MJXA 2LP4Y 3I74A 2XTNA 4Y30A 2PWAA 4RIFA 1E6KA 3ASZA 3VO9A 6PFKA 3EZBA 4XJSA 5GINE 4X63A 4XOUA 3VMMA 2PJZA 3GHHA 1LDEA 1DQPA 4A15A 3C4VA 4GWGA 4HB4A 4TYWA 3VXKA 1CR4A 4F5YA 1HE8B 2JLZA 2PH7A 1FBNA 4O5AA 4OK5A 2JW5A 1BXZA 1VE5A 4Q1EA 3SLRA 4EB0A 1ORRA 2EV9A 5LL6P 2OMEA 3PSHA 1VYUA 3H1GA 2CKMA 1WHTB 2VYFA 3AP1A 1L8LA 4C6RA 4E33A 4Y2SA 4S24A 1JXAA 2NSYA 2DLNA 4JEIA 2AQKA 1FFGA 2P4UA 1E0DA 2ZSKA 3AETA 3HUDA 4RE6A 1S4QA 1L7MA 3X1MA 4ZT5A 3DMTC 1VL0A 3OD1A 1Q44A 1YQUA 3K1AB 4NEGA 5D7BA 2Z9CA 3CUTA 5TEVA 4MQUA 2DFTA 1UZNA 5LA6A 1WZCA 2IOFA 2J9RA 2FUEA 2UZ1B 2JGDA 3CNLA 1A4IA 1I0IA 1N2ZA 1ZMOA 2EZ8A 1U4OA 3GT0A 3PU6A 1EFRD 1ULBA 2D7JA 2O5EA 2JFQA 1RRMA 1UJMA 3CE9A 1DAHA 3R0QA 4ERXA 3V4RA 4IS3A 4NKRA 4ZP1A 5FWYA 4RPGA 2PH5A 1Y4ZA 3HO1A 2BGIA 1DJNA 5IT9A 3H2YA 3H2SA 5AKLA 1ORTA 2OO7A 1T3LA 3OFSA 1XUOA 4PW0A 1L1QA 4J43A 2Y1EA 4ESOA 1Z7BA 2BFAA 1P8AA 4JQZA 2G76A 3ELBA 4U4AA 3TOCA 4D8WA 4DT1B 3P5SA 3HY4A 4DDWA 4KGVA 4H6PA 2JJ2D 4R51A 1H3EA 5HQTA 1F6BA 5F78A 2WU1A 3LKVA 4TV9F 3HXTA 2JANA 2EX1A 1I36A 2IGBA 1A5BB 4TMWA 4BMOB 4CUZA 1XJ5A 2OORC 4OBEA 4MAMA 1SO8A 2DC1A 5LLSA 4ZQCB 5CW2A 2DWCA 3UAOA 3KUXA 3NDIA 4AUKA 2ID8A 3QXGA 4B9AA 3HB0A 4JEMA 5C34B 4C4YA 5KYNA 1QHNA 2C94A 2PRSA 3B20A 3N58A 5K3BA 3M4YA 1KEEA 4OATA 3IKMB 1TK9A 4D44A 3D0RA 4AW9A 1PYOA 2GVDC 4PYRA 3QY0A 2ENUA 4MYTA 4YRFA 4YT5A 2BY4A 2B6HA 3FX2A 3MWYW 2JDIA 2OV2A 3ZYZA 2ZRNA 3R9XB 3OY2A 2JZNA 4ZI2A 3WWYA 4AM8A 1Z6AA 4MW0A 4JBNA 2F43B 1L3BA 3NOVA 1M2VA 3WADA 2ON6A 3ZU3A 1EG2A 2Y05A 3LCVB 4DREA 1TO2E 3HB4X 1DSSG 2ADFA 2O2CA 1TLFA 3PE4A 5IKEA 3IRUA 3L1VA 4B7ZA 3WGUA 5BT9A 3HYLA 4A27A 4C7VA 3AHEA 2WYIA 3K4HA 4LMBA 1XXHE 2C2WA 3SZRA 3PFIA 2PYIA 1J8VA 1E4OA 1GHTA 1ZNZA 1QR2A 1VMDA 2HIHA 1OIVA 2P9GA 3ADKA 4G5XA 1UAAA 1YJ8A 1XJCA 5KTOA 5FO1A 1E3WA 3H19A 5GAJA 3UG6A 1L8QA 2CXPA 2XADA 1MEOA 3T5GA 4DS3A 2KQUA 2P9TA 2VIIA 5FUWA 3EWIA 5EHZA 3PGMA 2EYUA 2O8BB 3H7AA 3JR3A 1KNQA 2GF2A 2VYQA 1YOVB 4UXJA 3JALA 5JYDA 2C7OA 4FOLA 4JL5A 1HM5A 3TG8A 2IV2X 5JI3E 1GARA 3O9VA 1YAHA 1ATZA 1XCJA 1TVKA 1FNSA 3F90A 4ARAA 3H1PA 3WV5A 3UPUA 3D7GA 5HIKA 1DLJA 1VA4A 3AIKA 4BMSA 4M76B 3RT7A 4ENVA 4ZIRB 1XNRB 4I1SA 1K4KA 2YIJA 5DGXA 2F3SA 2R84A 3GW8A 3HP7A 1V35A 1M0WA 2JFBA 3FSEA 3RK0A 1GA6A 2GEKA 4GR4A 1VHJA 3KQQA 4L5JA 4CL3A 2CDNA 1EUZA 3A70A 1ZD5A 3WGLA 4RORA 4Y1GA 1ZGAA 2XB9A 3RD5A 4HK4A 1I5OA 5I8PA 1ZRSA 4ABTA 1SBZA 1UPAA 3KOXA 4O63O 1B16A 1Z88A 1A72A 3V8NA 4JR2A 5IAJA 3W2IA 1Q0RA 4QSMA 4YCSA 2HXGA 3BDIA 2KI5A 4GQIA 1WXWA 5FOQA 4OQMA 2IYXA 4IINA 2EXXA 1P91A 1T8TA 4RAOA 3NHWA 4Q4JA 5JD4A 4Y67A 2DY0A 3VO2A 2WFMA 1E61A 5BUQA 2XGMA 1ODTC 5BSMA 4NFLA 4DLRA 1FJ2A 3KB2A 3KKMA 5J40A 5F09A 2ACEA 2AFIB 2BFEB 4YRJA 5CB8A 1XZGA 3L41A 1ODKA 3BMNA 3ROPA 2P8SA 2B2CA 3T54A 3IAM1 3WWZA 1GZ7A 1PEAA 3MLBA 2B83A 2DHCA 1XZEA 1TO1E 1W88B 5CRIA 3WDMA 4UMFA 4RPIA 2WHEA 3WTCA 4RWZA 4OGFA 3SI7A 3OQHA 3FHOA 2GJ4A 3MLEA 4J0JA 1Z0ZA 4JUDX 4DE5A 5KKCA 3BT7A 5FOSA 2D0OA 5HM8A 3CKKA 1IATA 4FYWA 3G2MA 3X1KA 1IJKA 3IELA 4KH1A 5CFLA 2E5LB 3N2GA 4RBNA 3I2YX 1E7MA 6ADHA 3HPQA 5DYIA 1K97A 1WB6A 2VP9A 3UZUA 4NBUA 3L7JA 4EQ6A 2JLVA 1T9KA 2XDYA 3QSGA 2GTHA 2EJBA 4DTIA 3B38A 1E66A 4PNZA 1ZQ1A 5EE1A 3VH1A 1C9MA 3PQFA 1UK6A 4ZOEA 5AHKA 2VC2B 1HDEA 4BP9A 4P4SA 3GFPA 4ZRNA 1RPZA 3GC6A 4RIHA 2GK6A 4CF3A 1KK1A 1NF9A 5BV2P 1U4SA 3DOJA 3NM6B 2DOKA 2GZMA 2OENG 1BU5A 2QPOA 3EFOA 2OORA 4UTOA 5JD5A 1C4OA 1TMKA 4IJ6A 3UV7A 1TAUA 1C8VB 2Q0HA 3VMFA 3TXAA 2XKKA 4MV6A 2YYYA 4EZIA 4CO9A 1I5EA 4WACA 2P6MA 3M70A 2Z5VA 3PT5A 4CDKA 2CHVA 4HQOA 4D74A 5BNWA 1Q74A 3O3OB 2HHAA 3LMKA 2ZIXA 3NW9A 2UKDA 1ORWA 2ODNA 2HSZA 4K6FA 5B7QA 4LJ9A 2LTAA 3QBVA 3HGTA 4CF7A 4XIFA 4BN4A 2Y6UA 3TIIA 3UMJA 1Q14A 2IP1A 5AJZA 2QXUA 3CUYA 1H22A 3U7FB 5ED0A 2XYQA 1NSFA 2GPSA 1HFKA 3AJ9A 1KZ4A 4MOWA 4RC9A 3TMKA 4F85A 3TR6A 2OAEA 1XK7A 2BFWA 4E51A 3WIOA 4TX1A 4YMVA 1P1FA 1YB6A 3QSYA 1H8HD 1AVTA 3CRNA 4JI1B 1G7SA 2N75A 3DQZA 2ZRAA 3BTSA 2VEDA 4KOAA 1VHQA 4YAKA 3G88A 3G2IA 1OXXK 2HHLA 1Y5RA 1C29B 4KQKA 2JK1A 4RAQA 4E5YA 2Y1OA 3LTEA 2HSDA 3UGTA 3RIMA 3KJZA 4G5GA 4L9SA 2MTBA 4RTKA 2NYVA 4Y2JA 5HKOA 3ESXA 4KMSA 2VP6A 5JRJA 4YJ2F 1YCDA 1ANKA 4PFJA 5DU2A 2DXIA 3OT1A 1EAMA 3RKRA 1Y9EA 1RI2A 2Z4TA 4CM3A 1RJWA 1IRIA 3DVLA 3RJ5A 3MPUA 1SCUA 2ONCA 2Q2VA 1ECPA 3MCVA 5HE9A 3T7AA 1U5CA 1Z6ZA 1NVAA 2J3DA 1Y1KE 2P4EA 3CXRA 3ESCA 5IBRA 1SH7A 1ZP6A 3BSYA 2PMDA 4UC0A 1L5NA 1AKTA 3MJRA 4L0QA 4EM6A 2NADA 4Z54A 3PEVA 1UPXA 3KV1A 3K20A 1HNNA 4IEFB 4K2AA 2JCXA 4OV6B 3T4EA 1Z7GA 2X9VA 1BKSB 1K8YB 1RWPA 5CVEA 1G63A 3RBZA 4A9AA 4EBFA 4F11A 4CVNA 1ZU4A 1I7PA 3D3QA 1ZWKA 5A4DA 4IG4A 4D9BA 3UGJA 4JU8A 1O0BA 3GJYA 4UTZA 2D4HA 2X0JA 1ES9A 4R2KA 3LPNA 1CB7A 3GJSA 3G23A 5CCDA 3T99A 1NM5A 1WTAA 1SD1A 2Q29A 4BMNA 4CLDA 1NI5A 3R3YA 2ONZA 2IA5A 5IAEA 2V1UA 3DBRB 1GZUA 4S04A 2AI2A 2H57A 3MILA 3NCTA 4IQGA 4REMA 3ETLA 2H4YA 2OOKA 4O2RA 4I4TB 4EY4A 4HKTA 1YZ3A 2QF7A 4QTTB 2QTWB 3UENA 2GCPA 3LNTA 4GPBA 4HZUA 3KKQA 1BS9A 2WHPA 2CL7X 4BN0A 2EF0A 3LL4A 2J87A 3X1ZA 1GZSA 2G0AA 2FR8C 2QX7A 3I73A 3K0BA 3R0IA 5DMXA 2D0PA 4MQBA 5KSWB 1G60A 1I3NA 5M3BA 2C98A 4P83A 3CCBA 1U2GC 3W0LB 1WUTA 3X2FA 3I8OA 4ZC1A 1Z26A 4IXMA 3GEDA 1OTHA 2RH5A 4TSFD 4UBLA 5TQVA 4BV3A 4X61A 1MH9A 4P3XA 1G21E 3D6MA 2JEOA 1BWQA 2R8YA 3HWRA 1AKRA 2CXXA 3K6JA 5E95A 3WYFA 3DNPA 4P2GA 3HGQA 1JAXA 5TPWB 5CDSA 4U7DA 3JX9A 2YQ4A 4FZ3A 4ZODA 2QRPA 3NZEA 4JVMA 5J4YA 1D2EA 4S1NA 2H0QA 2I22A 2CV1A 3H4VA 4UOEA 1YVUA 5EP2A 3FROA 4P98A 4IVRA 1E3QA 1SFRA 5CVUA 3IHTA 3TM5A 4CLOA 3U1VA 2Q9AA 4U7HA 4W5WA 4AJEA 2W43A 4UQLA 5FLXA 2RKWA 1E99A 4L8VA 2WHXA 5DNVA 4HH3C 1S2GA 2A84A 4F3RA 1ZL2A 1W7AA 2HPZA 1ZDMA 2YWFA 3E5MA 3OI7A 2JFYA 1A04A 3LS2A 5BR7A 2J85A 3CMCO 1VSBA 2IYWA 4ND1A 1ZINA 4Q4CA 2PSDA 3CZQA 2GYWA 3RS2A 5D29A 3E61A 1K8ZB 2W37A 2LW7A 2OB1A 4GE3A 1QAQA 4I6EA 2PE5A 4DA6A 3DWGA 4UTPA 4OI2A 3DNFA 4EMBA 3GL9A 4PXSA 1U28C 5BMVA 4Z0HO 3C2QA 3NOXA 1GDHA 4G1VA 5K99A 1HFWA 1QJ4A 3BGWA 2Y1KA 1UZMA 1FTWA 2HRCA 3HCRA 3FNRA 5D6NA 1CSEE 1CZUA 1USUA 1AGYA 3DZKA 3IAHA 5F4ZA 4K7JA 1I6WA 4D4IA 5ESDA 2OKCA 1XCGB 1RYDA 1TF7A 2ILTA 3DFZA 4EJMA 2V8BA 4XGRA 1T6YA 5DOZA 2WUGA 3H8SA 4QNMA 5J2UB 1M1ZA 2YCLA 5IJ9B 2AX4A 2FP4A 1VJCA 2NSLA 3EIUA 4RZUA 5LOVA 2D5BA 2VYVD 3KEQA 3KVYA 4GI2A 1N2SA 1JG3A 4ZV9A 4YQEA 1X42A 1P31A 3FTCA 1NW9B 2ZJZA 1OFUX 1K7SN 2PIDA 4XWTA 5DX8A 4ZCLA 2I29A 4TTRA 4UTNA 1R6DA 4EPVA 5HPYB 1SNYA 1WXDA 2ATIA 1K5HA 3OX1A 4JJ8A 4KAXA 3TLGA 2A0YA 5F77A 1FF9A 2R4TA 1Z6XA 2CJPA 2V7EA 4FN4A 4W8GA 4BZPA 1JEQB 2WRZA 4GBGA 1N9KA 1EUDA 3AZOA 1UDXA 2HRBA 2QX6A 1Q3HA 3PE3A 3SICE 2IEBA 4F6CA 2FWRA 3TFOA 1F6WA 3F4LA 3G02A 5FNVF 1A7UA 2X3UA 2A1UB 2FZEA 5E7IA 2Q45A 2DUUA 3I8XA 4WA7A 2CV0A 1P75A 3GNTA 3OFNA 4U9UA 1AUVA 3JAWA 3KPYA 1L4FA 4GXQA 4URXR 2H1VA 3GN1A 5FOUA 2WIGA 5KYKA 1AH2A 3HJBA 3G8AA 2BZ0A 4KVGA 1BOOA 4O2AB 1XZ8A 4JSYA 1CY0A 1GQRA 1OXUA 1ZLXA 1ML4A 1OA1A 4DLPA 2PQ0A 1VJ1A 2QMOA 1DBWA 3HUTA 2BGMA 5EFZA 2GJAA 1OF1A 2BE7A 1NMXA 4JLBA 3O8RA 3R41A 4RZHA 1JDZA 3KDPA 4TSRA 2I67A 4AJNA 1L6IA 1W2WB 4BNUA 1YCHA 4EKIA 1PK7A 4EUSA 2DB3A 4TWIA 2HYIC 3BAZA 4KR0A 3A6EA 3KQKA 1N75A 5A9TA 4WESA 1Y8QA 3R7WA 4CZ1A 1COZA 3H1TA 2ZP1A 2XEIA 3C7AA 3GPIA 4M1YA 3Q0TA 1SBQA 2FR8A 2QQ5A 3G7NA 3NAQA 4M83A 3TL6A 3G9ZA 5I4BA 4FGWA 1MAWA 2PH3A 1K63A 3GEHA 2W6OA 2JHFA 5IF9A 5BORA 1U2GA 2EKPA 3D4PA 3TRFA 3ANSA 2HLNA 1HTBA 3HVKA 4MO9A 2J4FA 5JQWA 4JZYA 2P2DA 2H8GA 4LY9A 5F5LA 1Y7IA 1AUPA 1W0CA 1GPKA 4KLRA 1IHXA 1IY9A 4YYZA 1EUYA 1QCZA 4NOMA 4YRLA 1JDSA 1E94E 2CHUA 4MPPA 3W8NA 4TXNA 4DR7B 3F1KA 5FP0A 5JAMA 2Z6AA 4B17A 4NBKA 5A4IS 2XXAB 4Q4AB 2WZDA 3DAPA 1NUHA 1QYXA 4PSCA 4TT3A 4HEA1 4DPLA 1GTRA 2H17A 4I5DA 2BH9A 3MSCA 1WUJS 3FKQA 3OJOA 4B7CA 2DF8A 2JAHA 3DDNA 5JXHA 2BJVA 3RUHA 3PQ7A 4RY9A 3IQDB 4ZU6X 1OLSA 2VPYA 4ENUA 1O97D 1VLQA 5EVCA 1WZIA 5IVHA 1J22A 4KLAA 1RZUA 1N1DA 3BORA 4ACBA 3IAS6 2RIPA 4M7OA 2ONYA 2H07A 4JH0A 1MIOB 1WTCA 4Y3UA 3TPZA 2DKFA 2OBYA 4CETA 4KPUB 1U3WA 1IEXA 1JU4A 4Z7QB 4OLAA 1GFZA 3UB2A 3ZTTA 2ERXA 5CK5A 3EZYA 4V3BA 1U28A 1BD3A 2I3DA 2YVKA 4KFRA 1K5PA 1PJ2A 3MCUA 3SF0A 3TTWA 1FFXB 1EK5A 3DXFA 3FWNA 4RA6A 1FSGA 3PWKA 2GX6A 1Q1EA 4MUJA 4PSKA 1GSAA 1K7FB 2TECE 5FOWA 3SX0A 1U2EA 1HQDA 4ZCTA 3AFOA 1LW7A 3GR6A 3PDJA 3ACDA 3R5FA 4BVEA 1IN7A 1UT6A 4D4MA 5CK4A 2H85A 3RKSA 1V3UA 4PGGA 5HRAA 1RQNA 4BY9E 4MDEA 3AV0B 2AC7A 4KQJA 2HUPA 2C4TA 1UEXC 5AI5A 2OBXA 3QUTA 5BRNA 2ZREA 3IIKA 2R7MA 2R97A 2I0FA 1P3Y1 2B1GA 5H02A 4EF5A 3JYQA 1R61A 1RRGA 5HJEA 4X90A 2BGRA 1QHXA 3DDCA 1YJXA 2QSYA 3B52X 1TTQB 3I9FA 5LXTF 4F4DA 1DC4A 2LDXA 4JBGA 4EKGA 4YV2A 4Q1DA 2ZJAA 1Y37A 3IEUA 1YDMA 3WIVA 4BRUA 3CRRA 3DEJA 4CKEA 3S1SA 3VPAA 5KDOA 2VF5X 1QP8A 1CRLA 1YD7A 4HRAA 3A3OA 1T2UA 2K7ZA 1MA3A 3VZBA 1PR4A 1Z6TA 2D1YA 3WNVA 3ABSB 4LK3A 2B1RA 4C4AA 1ORDA 2V9CA 1ZGZA 3E1SA 4QUAA 4DXAA 2CD9A 2PKRA 1D0IA 2OZKA 1GWNA 4CU5A 1AU9A 1JA0A 4DV6B 1SM4A 3GEBA 4BGIA 2QN9A 2R751 5EXXA 4XVQA 3CVVA 4QG7A 1DTWB 1ZCJA 1I2AA 2P9ZA 1HDCA 4NBWA 5LMUB 2HZBA 1KI9A 1E18A 2Z4SA 3NV9A 4K3UA 5THQA 1LLFA 3BMOB 3TD2A 3ZCVA 2FOXA 2F90A 4FFRA 4Q7MB 1GILA 2ORED 3NP9A 1HGXA 2XNCA 2ADMA 4HLNA 2X0NA 1G21B 3O4FA 4UMVA 4C6TB 5CB4B 3CCFA 3GDOA 3P96A 3OPNA 5JATA 3RVSA 2W9XA 2WABA 2VDKB 1Z2EA 2VYNA 1XTPA 2VDVE 5CH5A 5AI8A 4EB6A 2XWQA 3IL2A 2PU7A 2W2MA 3E9RA 1X1QA 3AKDA 3KZCA 5D3ZA 2WY2D 3SF8B 1NKSA 2WBLC 5F9MA 3IKVA 1VJ5A 2QY6A 2X19A 1U7XA 4EG8A 1RAAA 1CQJB 2R6HA 4H60A 1RE1A 2HXYA 1KYXA 4O08A 4X1KA 3BWDD 3FYUB 3RLFA 4AURA 4IO1A 1ODFA 4RHYA 2VSYA 1H1DA 2ZT7A 2HA6A 1KMQA 1ECGA 2C3YA 2WF8A 3KEOA 4ZVVA 3KPWA 1E1CA 3U3RA 3C1AA 3OJCA 3ZD9A 1YA4A 3T7CA 3IQZA 1KYVA 4OU4A 1ENYA 1P61B 3WL5A 4XUGB 2H1LA 1U2RA 1VPTA 2ZRQA 3KAKA 4EKEA 1CQIB 2A9KA 1XRSB 3GLGA 1BU8A 1GN9A 1JAYA 1M83A 2VDWB 4LZNA 4S3MA 3PQDA 1T1EA 2C7PA 4K5QA 2OP1A 3NGMA 5IRCD 3Q12A 3QF4A 4F5EA 2YWRA 3W5DA 3ZWYA 3KK0A 1FU4A 3DG9A 5CURA 4DGSA 2LKDA 3VSCA 1B8NA 4ZCRA 3ZEIA 1D7AA 5JC1A 5KQLA 1ATIA 5CLIA 3E8XA 4AU1A 4ZPXA 5INTA 4JYMA 1I2CA 2BUBA 2WUEA 3WSVA 3X0DA 4X45A 2PVWA 4CV1A 1JJ7A 3GMIA 4A4DA 4DG9A 3PSAA 4AZVA 4RCZA 5CHEA 4QOJA 1S9HA 1O77A 2FK8A 1V71A 2ZXFA 3G9TA 3HKDA 3KWLA 1EE1A 2EZTA 2Q6TA 3OCVA 3H9BA 3PT9A 3NBMA 3ROFA 3RJZA 3BWVA 5A7HA 3P2JA 1ECFA 1XA3A 3FD8A 1TD1A 4RABA 5DW0A 4UQOA 3KWFA 3WGJA 4CJXA 1F12A 2ZYVX 5B37A 3V2IA 1MP0A 4JWTA 2VT2A 4DCNA 3RS4A 1L4UA 1CUVA 3BCRA 3MS2A 4KGDA 4QECA 3D1LA 2PX5A 2HUNA 2YQZA 4I3FA 4X41A 3VNBA 1LDMA 4NV1A 1OX4A 5K01A 3WR5A 5L40A 1QK5A 1A27A 1WB5A 1Z45A 5BSRA 1Y8ZA 3FLMA 4YRNA 1R0ZA 5ULLA 3QBEA 1W48A 2C9OA 3VJRA 1M6EX 2ATXA 1NVFA 1DXOA 4B7AA 4ZALA 4YP6A 1PKXA 3V1LA 4G89A 5I7UA 1Y5IA 4PWZA 2Y1DA 3DZDA 3EA4A 4TRNA 1RPNA 1D6JA 4OKIA 3LVBA 1SUFA 3L9XA 4U7TB 4YXWD 5CFZA 2YW2A 1V39A 2XTJA 4KJZA 4LNUA 1V16B 3FNHA 3NHRA 4LCBA 3W4JA 4BVBA 3EUAA 1RWWA 4KIJA 2F3UA 4QOGA 4L7QA 4EKYA 1VE1A 2EJWA 1CUSA 2GKGA 4GG1A 1XZKA 3GGSA 4GO1A 3NDJA 2I7CA 1QGYA 1RI5A 1JEOA 3FCEA 3RAPR 1NRWA 3QEMB 4OI4A 4G01B 5CEEA 5K0JA 5KTYA 3SX4A 3PJDA 2BL4A 1BJRE 3L4EA 4OAQA 4WA8A 3TQIA 1Q50A 2IITA 3D1VA 3NBYC 3ULKA 1L5WA 5K6AC 2VHTA 2F1KA 4E4TA 5KJ6A 4P4BA 3RC7A 1UWVA 4I4IA 4Z8XA 4FR5A 2G9UA 1ORVA 3LHDA 5LQDA 3L8HA 2IUSA 1TLLA 3MJFA 4QEDA 3DZFA 3KAJA 4ECAA 1PP4A 2Z8XA 3OZBA 3QHPA 3K0HA 4HWSA 4JLVA 1TYZA 4WVLA 1NPTO 4FFNA 2XMZA 4H4CA 3IMEA 2K87A 1WW8A 1RR6A 4V0MA 4FJ0A 1AKWA 1K08A 3DE1X 3GN2A 4JYAB 1SQGA 2F67A 1WU7A 1PLKA 3EZ2A 4RANA 4X1OA 4KRXA 1ZSNA 4C4TA 1HUQA 1T1GA 2JI7A 4FILA 3RHFA 2XLBA 4LYDA 4MCQA 4O0LA 3MAGA 4DMMA 2HR1A 3PYMA 2Z8YM 1SMKA 2B25A 1MJHA 2CFSA 2ZYDA 3KC2A 4L4RA 4PX2A 1IZ0A 2QSZA 3V7WA 1BHJA 4H7PA 2YWGA 5TF0A 2IUYA 1HG1A 4R8RA 1A7AA 3P2MA 4B4WA 3ERCA 1M2FA 1WMAA 3DB2A 1Y48E 4HQKA 5CA0B 2Z2KA 3HXOA 2Q4TA 4OYYA 4XIGS 5CD1A 2OMKA 2WYHA 5AHXA 4JJ4A 3V6LA 5ESWA 1B6TA 2NTEA 3K1TA 4FOPA 3UQZA 4PN7A 4K81B 1ISRA 1FX1A 4EW2A 4FYPA 1KZ6A 3LIIA 3AL0C 5K8IA 2O4CA 2CHFA 3I9JA 3LYLA 3M6FA 4YGXB 5LR6A 2YOFA 3PGA1 4PANA 1SHKA 4LXQA 1TT5A 3N8GA 3BCHA 3Q7EA 3PK0A 4PLFA 2A14A 1N6RA 2H1RA 3MGGA 2YV4A 4HYTA 4UXHA 3JD3A 3NH9A 4CCYA 2UXBB 3ZVKA 2QL5A 1H2WA 2D1TA 1WCIB 2XD9A 2P9CA 1E3MA 3QWHA 1MUUA 1EVQA 1SGWA 2FZWA 2ZYHA 2PKXA 3O47A 4IG9A 2OCIA 1OMOA 5DNUA 4LE1A 4NGNA 1E0KA 2IYSA 3TBKA 1FRNA 2HA3A 4RULA 1GLNA 2DECA 3TRKA 4IIHA 4QPZA 2C00A 1XRJA 3U13A 4CIDA 3T5PA 3A2KA 4BNXA 5HMLA 4OFWA 3PHJA 1B8VA 4IO0A 4W9YA 4LKOA 1JR6A 2BFFA 4BP3A 1C3LA 4ZJYA 1DXHA 2HDNB 4FEGA 5A71A 4NCJA 2QD5A 1N2BA 5J2TB 1SVMA 3DAGA 2ZSBA 3SQNA 3TZEA 1DAMA 4GOMD 3VFDA 1D8AA 2GKOA 4MCAA 3PIDA 2JHPA 3HE3A 4CG3A 4EB8A 4QGGA 2V65A 1S5PA 2P62A 4B1FA 2PKCA 4CN8A 4I99A 1PFKA 1YU6A 2HA2A 5LZ7A 1THGA 3T9BA 3VA7A 1Y6QA 3BZWA 1EE9A 1GY8A 4PPQA 5T5QA 1PQ4A 2UV8A 1FDOA 5HGJA 5K5EA 5FQNA 2IOHA 1QKKA 4GMGA 2PL3A 2QI9C 3CJRA 3BS4A 4R05A 1CVRA 3FTFA 4ZAWA 1X0VA 2YC4C 1HRKA 1ODIA 1K6XA 1IYZA 1MO4A 2FMXA 2PL5A 5EIBD 3I0ZA 5AXCA 3H2KA 4B31A 5DI9A 2FWIA 4D6PA 1G5QA 1W8DA 1Z15A 2FVXA 2YUIA 2J33A 3MBKA 4U2EA 1LZKA 2REQA 1HT2E 1BO6A 1KJIA 4H17A 4L16A 2Q3LA 1TNDA 3JSXA 4TSKA 1BXRB 2ZG6A 3MRVA 4KXMA 4EMTA 4FDAA 3A27A 4ND8A 5BYAA 4BRZA 3M33A 1N2IA 5MN6A 5CT4A 1CY8A 1KJQA 2QLLA 3QMMA 4MIYA 1XG5A 4FQ7A 5AVZA 2VZ9A 1GPYA 2ZSFA 1Q0UA 5JSFA 5K6AA 1E59A 2V7BA 3AONB 4PG6A 5JAQA 1SC9A 4QWWA 1PDWA 4RF5A 4PYLA 3I1FA 4B6OA 5KU7A 3AERB 4KFCA 5ALGA 4UNNA 1DIAA 1AG9A 1WEHA 2DH5A 1OA0A 5LA6F 3S6JA 1EP3B 1JKJB 1NN3A 4K9KA 3ZZUA 1NI3A 4NYMQ 4BO0A 1X7XB 2HDWA 4R9RA 2GXUA 4LGCA 1USVA 4HDNB 1FUUA 2OQIA 3B9QA 3QVUA 4XFDA 5F5XA 1JI0A 5DHUA 5ECGC 4OXRA 1MAVA 3CNOA 1ND5A 2J9ZB 3RKUA 2WSMA 1L4HA 2CUTA 2FEWB 4MUYA 4RA9B 4PC7A 4LRSB 4WPGA 3V32A 4DJ5X 3LLVA 1I32A 3COJA 1J0CA 3NIBA 2FE4A 4QQNA 4XEUA 1BEUB 5FD8A 3RFXA 2Y0DA 1IY2A 4JL8A 2I1VB 3GEEA 5D1NA 2GCEA 1B1CA 3WBFA 1O94C 2I03A 3NH6A 1AO0A 1VL6A 1QQ5A 3DWIA 2V74B 3H75A 1M5TA 5L95A 4RESA 2QRVB 4RX1A 3LOQA 4MV1A 5A4AA 3DAHA 5CD9A 2GOYA 2PUCA 4Y9DA 1RS0A 2ZBQA 1WCV1 5IABA 1RZRD 1DKPA 2H3HA 3UGQA 4E5UA 3SQDA 4RDCA 4D9HA 2YIMA 1HF3A 1TQ8A 3EQ2A 5FOXA 4BNNA 1H2XA 2QZJA 2R8BA 3ANTA 4FDTA 1JBQA 2JIPA 2G88A 3K05A 4RGYA 2IEIA 2I33A 1DHTA 1MX9A 4MIEA 5IVIA 4PYNA 4EJ0A 4UHHA 4AY5A 1OV6A 1NOKA 1EUCB 1BGVA 4UUOA 1DJQA 1FQKA 2DFPA 2QZ4A 3EZXA 4D9MA 2ZJ6A 4F5WA 2IPOA 4HPXB 2IPAB 4A5SA 5BUZA 1B8UA 3DQPA 4NGMA 2JARA 3HY3A 3GGDA 4KQMA 1EX7A 1EU1A 4NYIR 4MRNA 1YZTA 3EDRA 3NWEA 3ER6A 3FHJA 3HJAA 3VVCA 1M6WA 4B35A 2XAAA 1N2JA 2ZOSA 3BBPA 4JI5B 4Q4HB 4P3KA 4RE5A 1TE2A 2XUQA 3DDSA 3DE5X 1H2AS 1MLDA 1Q7GA 3BRCA 3D5EA 3OF2A 4OFXA 2MCFA 4CMHA 2HGSA 2FW0A 3AUTA 3FZQA 3P94A 4F2DA 2CYCA 2VNIA 3T9AA 2I3GA 4P44A 3CUVA 1UOEA 3FUUA 2P2NA 3KYDB 4BBPA 5TJHA 2OCYC 4M36A 1MOPA 1S2DA 2SECE 3KPJA 4NOJA 4D4JA 3ZYCA 1ZVJA 3PKJA 5A2QA 2AG6A 2O57A 2G67A 4YQZA 4BFZA 5T3UA 5M04A 1GTMA 2CLFB 2ZWPA 3LC0A 1EFAA 3KYCB 3LVQE 3KKKA 5J5VA 2FPMA 1QV9A 2YL2A 4AD8A 1ABBA 3IV6A 4HGOA 4ZT4A 3QKSA 3EZGA 4ZV4A 1EDOA 1AA6A 2CJYA 5IPFA 3WRXA 3VNQA 3QNUA 1V9LA 2PK3A 3JD1A 4D02A 1JB9A 1XQ9A 2F1HA 3UC9A 1C4WA 3G2LA 3QE4A 4P3PA 5JNTA 1JWLA 1T3TA 1W49A 1Y7TA 2POCA 1I2ZA 3IQEA 4IWYA 1ILWA 2PAFA 1H4QA 1Y33E 3BGSA 3ZDRA 4QJ4A 2IQ5A 2Z6UA 4ZCMA 1C1DA 3IDFA 3MRSA 4KYVA 1DL5A 2AZDA 3RHSA 2V3WA 4DR2B 3I6MA 1DX6A 2CFCA 2V6JA 4FNOA 1IJEA 4GX0A 2A9VA 4C4XA 1ZOIA 3DZCA 1PJ4A 3K9WA 2NNLD 5CM2Z 3L4BA 4DMHA 4N0DA 3EASA 3QFCA 1KAOA 3QIVA 4XPIB 1BS1A 3M4NA 3WYDA 4FMDF 3RYCB 4I50B 3AUJB 3D1JA 2OTCA 1N5IA 3VYWA 1KAGA 4N01A 2R9VA 4KXLA 4XFKA 3ZVNA 1II8A 4MQ4A 2QZPA 4C0QC 2XCTB 1XRRA 1LV7A 3OQIB 3H8WA 1TX4B 3KJGA 5E6RB 5BWCA 1RPTA 1JPVA 2H29A 3QOYA 4QUIA 2FUG6 3ENNA 3MF4A 3ADDA 1M6NA 1FYXA 1PN3A 4U2BA 4XJXA 4BBZA 3G9QA 2FW6A 2UYHA 2D74A 3ONWA 3TS1A 5JCOA 3T38A 1A8PA 4PRKA 3MINB 4MVWA 1BHQ1 5GV7A 2GM3A 3AR5A 5JWOA 4PM4A 4QUHA 3NAGA 4BFSA 2YXBA 3E53A 4K88A 4BTVA 5KOHA 2JLUA 1SXJA 2GN0A 3F6RA 4H08A 1FVXA 4UJ5A 4DBVO 5BQ5A 3UWKA 4MDHA 5FADA 4CEIA 3NONA 3QX8A 4BXOB 2J4CA 1A9RA 2JFGA 4XGNA 3ICEA 3BI0A 1N8SA 1M2GA 3GOHA 5A2GA 1I7QB 1PZMA 3I5MA 5EWMB 2IP2A 2YWHA 1YRYE 1D09A 2CC2A 3MD9A 2APJA 5EKDA 4DFDA 2ZTVA 4LYYA 3TLEA 4IMRA 4L4UA 3RDPA 1J24A 1BCRA 1V45E 4DARA 5AW3A 2BM1A 2EFHB 1NUUA 2DWUA 1E3IA 3EW7A 2L2QA 2XSZA 3QVWA 1KSGA 5JO0A 1C8LA 4CRWB 3B3GA 3OFKA 1F17A 1MD9A 1OWMA 2H92A 2VATA 4WCFB 3T7JA 2ISQA 1JQAA 4CI9A 2V0GA 4N1AA 2WM9B 2VSXA 3DL4A 3TQHA 4JGBA 5CYOA 1SKMA 1OYVA 2ODAA 2GCOB 2QRHA 4IV0A 4G9GA 3V4OA 1WHSA 3DB1A 2Q1SA 4R1PA 3PF9A 1X9GA 3I9V6 1QG4A 4JD5A 3AESA 4OA8A 1P2BA 1MABB 3OU7A 4M8LA 1K2WA 1K7XB 3UTDA 3BG5A 5LNK6 2ZE5A 2AI1A 3QVJA 5EJGA 1XJWA 2QAGB 3HKCA 2VJDA 5F33A 4G1CA 4AY3A 4JK3A 1GFSA 2JFUA 4MV3A 4HRYA 3TCXB 5EHNA 1U99A 3JATB 3ON5A 4HLCA 2BBTA 1S89A 3OZUA 4N3BA 3UHAA 3F78A 3ZKAA 3HUUA 4MA0A 1NVTA 1TTPB 3FAZA 4JOBA 1RBMA 3FPCA 1T9DA 1EJ2A 1UBTS 3ANLA 3FMFA 3KYIB 4W4TA 4OKNA 1O6CA 1N3BA 4WBNB 3OZIA 1QAMA 1RAGA 2DKNA 5HCIA 2NPFA 2P2ZA 5IXJA 2V97A 2IF0A 1ZUIA 1G6OA 2ZB2A 3DFUA 3OSUA 4LYAA 4O4HB 2V96A 5ER9A 3V7YA 4S35A 1XLTC 2ZZKA 4FYVA 4FZ5A 4F1WA 1GZ4A 1DJLA 3V8RA 4EA6A 1LW6E 1E1QD 2FZKA 2C88A 3LJKA 3MNFA 1PWEA 3ESAA 4S0XA 3ZX4A 3DGFC 3ORHA 4R0MA 1NASA 5F73A 4D3FA 5FUYA 5HFNA 5AKEA 2OV3A 5K8JB 4MW6A 3CFYA 2EJTA 4X24A 4ALKA 4Z0PA 1D3AA 4B3CA 2BKXA 1ZN9A 4E2YA 1NNEA 1ZGCA 2CLHB 1U2QA 2JGEA 3DMRA 1H0KA 5AJXA 4B0OA 2BMWA 4G0QA 1NW4A 2CWWA 3WAGA 2HIAA 1HE5A 4LDAA 1KC7A 3EXEB 3WK7A 1LNZA 1WNFA 4LRYA 4HT3B 3ETEA 4LXTA 1W5EA 2VWGA 1GAQA 2FZGA 3LVRE 4Q3NA 4BKOA 2DVMA 1Q1ZA 5FXMA 3RWMB 3N5CA 5AO9A 4GYKA 3VHLB 1KI2A 4RNDB 1E2IA 1SHTX 2I4RA 2YVUA 1AUQA 2QRJA 3EBOA 1KYYA 3PTLA 4OJNA 1KZHA 5LVAA 1N6KA 4OKSA 1HV8A 2PYZA 2JFZA 1CX9B 3ZE2B 4AUNA 4D57A 2JLAA 1ZMXA 1QFSA 2CXRA 4DZTA 3JQEA 2IE8A 1Q22A 1XZAA 3GJ4A 4ZT3A 5T8KC 3TIXB 5J4KA 2JKZA 4MWSA 1JHYA 3GCWA 1TJNA 2EKBA 1I2MA 3MBOA 4Q47A 5LLDA 2WYOA 1M8JA 4RSMA 4REQA 3V4PB 2XMCA 1WDWB 2ZJ5A 1I2BA 3QVMA 4RHCA 1FB5A 1J25A 1NP6A 1YDWA 2ZIEA 3LDAA 5U1PA 4A2PA 4YUAA 4JA2A 1XR3A 2HTFA 2ZYTX 2SCUB 3ASYA 3C5VA 3E1KA 4OOFA 4LNAA 4YLYA 3HA3A 3ODGA 2QG9A 3CN7A 3F3MA 4RO0A 5CBPA 3A6LA 3A14A 3LP8A 2C9ZA 4QREA 1GGKA 5K1ZA 1VSQA 3KB6A 4XD7D 3R0XA 1UP7A 5ITWA 5LKRA 2G09A 3HR7A 3I5UA 2ZYSA 2GFHA 2WJ3A 3I1IA 2G3YA 3BJRA 5DJ5A 1X74A 1RJEA 5DIFA 4ZVKA 4LJ5A 1GQYA 3WLIA 2VWPA 1LPOA 3N0WA 4QWMA 3FOAA 2B8TA 1WMDA 2J3QA 1Y9ZA 3OFJA 1KJYA 3CO0S 4KE7A 4WKCA 3IT2A 5FPQA 4DAEA 1G38A 3ET4A 1HDRA 3PWSA 4MPDA 1Z5GA 3A1EA 2AXQA 3WL3A 4IGEA 1E0SA 3SXUA 4GGPA 3SHWA 4Q3CA 1DXQA 4BU0A 1R1DA 3QUAA 3WLLA 5BWNA 4X62B 2P67A 2ZUSA 5BQ3A 4EW6A 4J7XA 1XB2A 3TL3A 2Q28A 3CVOA 1BAPA 2X2EA 3NC0C 4OK3A 4RY8A 4BLPA 1WZEA 5DNWA 2YY5A 2FMFA 3Q8WA 3ZK8A 2BAGA 1USKA 3TX2A 1E3JA 2CEKA 4HF7A 4OQDA 4BFVA 3TG2A 4RK1A 4CM9A 5AK4A 4NPHA 3CZRA 3O2JA 4GR9A 2E49A 5DLYA 5BMVF 1DLIA 3UMMA 4YY3B 3K9TA 5JNLA 4WLUA 2IXDA 4P4NA 1LCIA 1P5HA 4RQAA 1MX5A 1A5AB 4YJ3A 1KGSA 2I3AA 4DMCA 2NACA 2A4MA 4KWEA 3FTQA 3ZTWA 1CX8A 2B8WA 5IT5A 4W5HA 3Q7PA 4G84A 4EGQA 3LUPA 2ID4A 4NJEA 3LD9A 4R2LA 1TJ3A 1VI2A 1Y89A 4YONB 4HAWA 3LIPA 3PUWA 3MK31 4MUNA 2C82A 5LOVF 3O7MA 1G8JA 2BFCB 1IZ9A 2JGKA 4P32A 4CKWB 3I2IA 5DE3A 3W78A 1XLTA 3BJEA 3U80A 4ZOQI 2WWXA 3SIRA 1FUIA 2Z0MA 3Q5DA 1X1TA 2B0AA 1E4EA 2CB9A 3AI7A 3IVCA 3P2EA 4P54A 3IP1A 5ADUS 4AKGA 3H1AA 3OKAA 2NXEA 1OXMA 2KS6A 1PCXA 3F3KA 3K2QA 5E4JA 4AROA 4MQMA 4NP6A 3MWEB 5K0ZA 1NG9A 1H3NA 2WNSA 2XCSB 2W2LA 2D7CA 1JZTA 3LBNA 3W2TA 4B6QA 1U0TA 2IUTA 2P69A 4AUEA 1V1RB 1OIWA 2Q1XA 2EK9A 4KCGA 4D0GA 3LKBA 3JU3A 4Q3AA 3WAKA 1PQWA 2CNOA 2QQFA 2XOKA 2AHOA 4DG5A 5WRFA 5JG7A 1CFZA 4LV5B 3VR6A 5KEIA 2V45A 1N9GA 1N5KA 2CDBA 3GAAA 3A1WA 2KLHA 3JQDA 1PTJC 3HXMA 1GA1A 3P9YA 2WUDA 2WINI 1TKCA 1FBTA 1E7YA 1FOEB 1KTIA 1PTKA 4GRIA 1Q17A 1W4BA 4EG0A 4OC4A 5K0EA 3O8LA 3J7AC 3TJMA 1U6JA 4G5YA 5CNKA 3WGOA 2E5FA 3M89A 2ZJ1A 3C7DB 3H0EA 4LN1A 4N0QA 2VO1A 4CLEA 5F1OA 2CHEA 1PWXA 3IOYA 3OCJA 2HF8A 3AWDA 4V38A 1HNXB 3UT6A 3NKVA 1Y7PA 2X0FA 2RB4A 3DFMA 3GFTA 4DBLE 3QE2A 1IY1A 1QB8A 1GO2A 3DBHB 3B3JA 4ZVLA 3DW3X 2MYUA 1JZQA 4KVZA 1L9XA 4QO7A 3NV7A 4PHFA 1NYTA 5DLDA 3T95A 3EF3A 2YZMA 1Q92A 1VKNA 3QK7A 4Z0TA 1LA2A 2TMKA 1RHJA 1Z7YA 5HRCA 3A1SA 1TEZA 4BVHA 1KGDA 5LB2A 4XASA 4D79A 2OBNA 2QLTA 3M2PA 5JWRA 3H5TA 2IY7A 2ZCVA 2O2IA 4P33A 3DO6A 2OL4A 3ABZA 1H2YA 1QYVA 2IV7A 4BVFA 1GDTA 2G8LA 3K8OE 2IBMA 2AIRA 3ZGNA 4ND2A 3PUVA 2FRDC 3A37A 5SV2A 3VDMA 4A6EA 1L5OA 3Q2KA 2TYSB 3OIUA 3IUQA 4PZ0A 1DO2A 1MT3A 4L7VA 5HKKD 2H7XA 2VA8A 3KKZA 5I01A 2A0XA 3C16C 4C9EA 3O4HA 4RCVA 3BILA 3W7AA 1OT5A 3K73O 3ISTA 2PMWB 5L51A 1BN7A 5ALOA 2PL1A 3FG9A 1I33A 3HYCA 3M83A 4MHSA 4V3CA 4RTSA 5KYWB 2P9QA 2ZYIA 2ZTUA 4L02A 1ULAA 2XEGA 3VC1A 1XZNA 3CM0A 1QUFA 3VAAA 5L3ZA 3D7RA 2ZVPX 1B0AA 5E2AA 2OD9A 2GM5A 3M5DA 4GPAA 2ASEA 1CR0A 4FU0A 5FI3A 4QUEA 1XVVA 5IUNC 1SIUA 5KKAA 4DZZA 3H5LA 3Q10A 2QTLA 1EX9A 2J3MA 3LY7A 4X20A 4PGHA 3SGLA 3I2KA 4FMPA 3SYMA 2QBYB 4GS5A 1YIAA 4FKZA 1YVEI 1XIVA 4YWJA 1AGXA 4NFHA 3P4YA 3I62A 2HJWA 3GRCA 1BIFA 5FTKA 2FI1A 3T61A 2A0UA 3TEMA 4KXYA 2CK3A 5FBLB 4K03A 1LRJA 3DPSA 1FRQA 5IMSA 1HYGA 2E6UX 2ZDHA 3PEEA 2A2ZA 2QZ9A 4KDEA 4OGKA 2I4MA 4QUBA 4ETWA 1R2QA 2V55B 4K87A 1JQDA 4E21A 2PUDA 4PN3A 1T8SA 8OHMA 4AZSA 3DT9A 4EGJA 5DMHA 3FBGA 1J2UA 3GX1A 4X0EA 1G6HA 2V0NA 4FEEA 1T0JB 3F3YA 4M1MA 2HDOA 2GVNA 3DMDA 2GF9A 2RGCA 2AGVA 1T5HX 1Y1TA 3WRYC 3WLHA 3PNQA 3BXEA 2VXOA 2VPZA 4BV9A 1OBHA 5B30A 3TCKA 2X23A 1M1XB 1ZGJA 1GZHB 5D87A 4DV3B 3DP7A 3M3PA 4A1OA 4HS9A 3DBLB 3BWMA 1ESMA 3H5IA 3I32A 4L0DA 3ZJ4A 3LL7A 4RENA 2HFKA 4TN1A 2PTGA 4E03A 1PJLA 1RPJA 1SBIA 1X2EA 4ARIA 4RSHA 5E6SA 2LBPA 3N3AC 3SBXA 2OK8A 3F7MA 3J81k 4JXZA 3CF4G 1S3FA 4C84A 5DFAA 3C0KA 5FUQA 4URVR 1UBLS 1NBMA 4L57A 3O8QA 1XKLA 1GAEO 3U3KA 4BLTA 4BEJA 4HAVA 5BSHA 3OE7A 2X9LA 5FHRA 1IPFA 1DBRA 1Q0QA 3RRZA 1MPXA 2NAFA 5AJYA 3IB6A 3UXMA 3AV3A 3KFVA 4EJSB 2OHJA 1KVUA 1LDNA 1EFKA 2OCGA 3Q9NA 4X1IB 3VX4A 2O8CB 4BO6A 4TLLB 5K3OA 1JWAB 4JAVC 5H80A 1NJSA 3T94A 5LQRA 3QKRB 1PTJA 3KJXA 4K9SA 4IIFA 5SZKB 4G0UA 2VJAA 5ALMA 3JAKB 1E9AA 4GL2A 1ZOSA 1O03A 4Q66C 4NY1A 3ENKA 4MI1A 4KPFC 4DLAA 1IVNA 1KAQA 2WWFA 1J8MF 4FE4A 4EEXA 1QIHA 4IXTA 1A9XB 3CV3A 3TVDA 3B1YA 5ALWA 1AQ6A 2Y93A 3P9QA 5K3SA 4X1YB 5TPZD 3GCGA 3EW9A 1Z5WA 2AMVA 4MAFA 5JAPA 5GOTA 3ANNA 1SXHA 2PZFA 5EXSA 2VDOB 3NVDA 3TVYA 2QMZA 4CKBA 1PEYA 3UY4A 4X3CA 3TXYA 3O38A 5J23A 1U5BB 4HNHA 2QSJA 2AN3A 3HHEA 1ADFA 2Y1FA 5KNCA 2FSUA 1SUSA 4DWWA 2XJ4A 3B82A 4MR8B 5AUPB 5SYMA 3GF4A 3EG9A 3SJAA 1O6BA 5E2IA 4IQ0A 4BO8A 2GP4A 1Z4QA 2Z58A 4WXRA 3JQ6A 2J5QA 5G3YA 5IFLA 2O3RA 4KWTA 4GLOA 4Q37A 4JUAA 1E1KA 3MJVA 5KJEA 1GGMA 4A6DA 1EVEA 2JS7A 3F3SA 5ALRA 1JMYA 2QZSA 3O4RA 1D7OA 5EVJA 1U80A 4PFQA 4L5IA 2G8NA 2DU8A 2O23A 2XNJA 4GXNA 4TKUB 1KQ3A 2FRDA 4JI7B 4KQGA 1L7AA 5JLAA 5DT9A 3VYUB 5B4TA 1IVYA 4JSRA 3F9IA 4QOIA 2MSNA 2OCXA 5HILA 3P0FA 1GSOA 5TMEA 2YV2A 3IFSA 5IF3A 4MW1A 1UZAA 4MUXA 2NPIA 1YB5A 1XZJA 3R6WA 5EJEA 2RCNA 2IZ0A 4JJFA 5ENZA 1XQVA 3LDGA 5F1PA 3MMZA 3TNDA 4CM1A 3E82A 4C7BA 4EUHA 3UHOA 3QTLA 2O19A 3EMKA 4D8TA 4F91B 4UPEA 4E6EA 4TRRA 5AI4A 2QR5A 1UDCA 3CZPA 5HWSA 1A82A 4MVJA 2V4ZA 5FUBA 4RHXA 1SURA 4IXWA 2IT1A 1JJAA 1OAKA 1YRQA 2UVPA 2XB8A 3KIPA 3P9PA 4KQXA 4DBZA 2VNJA 2B21A 4CPDA 4H3VA 3A3YA 4C88A 5EKSA 5FPYA 2AW5A 1DE0A 2ZDQA 1KP3A 1ZZGA 4Y1RB 3MJSA 4RJTA 3EUWA 2QTRA 4YJHA 2ACVA 3VU8A 1XF9A 2XUPA 2NZVG 5IS2A 1F2TB 6ABPA 3HB1A 1H6DA 2QVBA 4MP6A 4WZZA 4N3NA 3FNIA 4YLGA 1VIDA 1KH2A 1E32A 3KPVA 1NG1A 4Q18A 2Y99A 5EMJA 5ERXA 4ZVSA 3ZK9A 1WO8A 2FUG1 3OZTA 2BP7A 2CLIB 1RCTE 2Y1WA 3E0QA 4HWPA 4O8ZA 2OVFA 3AUUA 4TMFA 3TR0A 4C22A 4CKXA 3U4QA 3DWEX 1M2OB 3L6RA 1JSZA 1YZLA 4KAFA 1LI5A 4IPTA 4Q9AA 1C80A 3PITA 3E7PA 1TZ2A 1ZVVA 1BE0A 1ZJ4A 3WRYA 3FJ1A 5CJJA 5EGNA 1U9JA 1GXSA 4PLGA 2VRNA 3COSA 3FUCA 5DXAA 3RIXA 3KRVA 4TLDA 5AKYA 1LLUA 2RARA 3G6KA 3NFRA 3OT4A 4P58A 3Q8LA 3BH6A 4YACA 5LC1A 1KRHA 3EEOA 1Y4UA 3AVXA 2CL6X 4PINA 1DC6A 5K4AA 1KRWA 2EAUA 3DT8A 1KFJB 1NOIA 4G0OA 1N5DA 2GD0A 3MTGA 4M22A 4Q6BA 5HG0A 1NJGA 4E46A 2IS1A 3M1IA 1C0EA 3PXXA 4PVCA 2RG7A 3GPDG 2R6FA 2VK1A 1VXOA 4ZXPA 4QTUB 5DTIA 4R1LA 4GX1A 4QVIA 2MR6A 4P7BA 4DDUA 5LJLA 1KY5A 2D2XA 1YR6A 2WUFA 3KSMA 4UD2A 1SUAA 2CXNA 1II0A 4MUEA 4XLTA 4Y6QA 1N57A 5EPEA 5CDFE 1YCGA 4AECA 3P27A 1S3IA 4W5QA 2MJLA 3MEQA 3D7FA 3I09A 1DIHA 1F4VA 2DQSA 3GLFA 2PKYX 4GWLA 3EH1A 2X0SA 3ZDDA 3PGXA 4G09A 4EFDA 3D7DA 4HVTA 3Q3CA 3OJ0A 4MYCA 4CMBA 3G59A 3GP5A 5FOVA 2GSDA 3EUFA 3O4JA 3RVLA 4F9GA 2GZRA 3PEWA 4TYYA 5BW4A 3LP5A 1NZDA 3CZCA 4YS6A 2D13A 2GR9A 1KBZA 1DAKA 3BIFA 1XVTA 2JPDA 3ZE6A 1RJ9B 4P4JA 1FX0B 3OO0A 4HDMB 16PKA 2IHYA 1E6CA 2WD7B 2WTEA 5SY6A 2X5XA 3ORRA 2HK6A 6CHYA 2FUCA 4RZXA 2OFOA 2YNMD 2GS9A 2R7LA 4FCCA 5HFAA 4A10A 4CLRA 1YTUA 1A50B 3FH0A 3IUYA 1OI4A 1D6MA 1S4MA 2DR3A 4YALA 1ZJ6A 3ZKWA 1QTIA 1FFYA 3OA2A 3L05A 2YWDA 3ODPA 4N9WA 4A8PA 1LBQA 2GTIA 3CRMA 2YHSA 4XX0A 1UPBA 1USGA 2WVHA 1PHPA 2XKBA 2YXLA 3KS9A 1TFUA 1WA5A 3PC7A 2NPOA 3QY9A 3R6TA 4FDLA 4HATA 4M88A 1QGZA 3I5AA 4Z9YA 1NU6A 4CL8A 4F04A 3O3CA 1OHHD 1O8BA 1CNMA 1KZYC 3H0CA 2HGZA 2NU7B 3BB4A 3OQPA 3O5AA 3OZGA 4JNCA 2YJTA 3EPPA 4ZZ1A 1RFGE 1KYQA 1FU7A 4INAA 4DV5B 1FMFA 5CLFA 1PJAA 2QK4A 4URYR 2G9QA 3BFXA 3R5XA 4Q1VA 4UW9A 1D1PA 2UUCB 2GM9A 4MRAA 2QGFA 5C37A 4RWEA 5T6BA 3Q5GA 2PT9A 1N2XA 5EWLB 2JIDA 2ZRHA 1Z2OX 1YZUA 3MIIA 1R0YA 3QKTA 1Z33A 1KBOA 1JBKA 3QXSA 1LJLA 1QH9A 4R1TA 2E87A 1NBAA 2P9HA 3CW8X 1UC5B 1NURA 3QE0A 1GVNB 1ULUA 2AFVA 4TXJA 5GONA 3I6IA 1XQ6A 4K40A 2RB5A 5C8VA 2H59A 1L5HB 3TLMA 4CI0B 5HF9A 2IHKA 5AW0A 3JVEA 3RODA 4XR4A 4EAQA 2OLSA 2Q6LA 2VTBA 1F1JA 5JSYA 2E1RA 2FRVA 2IYEA 2ODWA 1VIMA 2W4QA 1JB1A 3DJFA 4H1UA 4MVJI 3I42A 3UJ8A 3BRWA 3KQUA 1OFTA 1XQYA 2E1PA 2P5UA 2C7RA 2X13A 4FFOA 1FW6A 4OX9B 1KQOA 3VR5D 1RXVA 1KVRA 1B26A 2WVJA 4WADA 1ZMRA 2O48X 4QXAA 4Y9SA 4LY0A 2IH4A 2EKLA 3AHFA 3EZAA 3U7QB 1IHYA 3WE7A 3F9RA 4C8TA 5HF5A 4E70A 5BV8A 4TV9B 4H31A 4H7JA 3E48A 5BR4A 4BNYA 4IRXA 3HK2A 3AVOA 4CEJA 1IDN1 2C4VA 4ZQHA 4G4SO 1Z3CA 1BE8A 3OH8A 4H3KB 5KVSA 1GGNA 2EK8A 4JA0A 2CIJA 1UDAA 2XODA 1L5YA 5F9FA 3RK4A 1JFVA 4MEAA 3RS3A 3MHTA 3NWOA 3M8KA 2C7BA 2WPDA 2H5JA 3ZD6A 4KR6A 4WECA 4OHWA 2QUJA 2E28A 3ZE9A 3E5NA 2R6DA 3OTQA 3H9EO 3UJ6A 4YLEA 4RXMA 3CJQA 1AZLA 2PT7A 3CIFA 2IZ7A 1P5FA 3UXHA 2OXIA 1FJGB 3AFMA 5C4MA 1QGUB 3TPFA 3H2JA 4IEEA 3UYKA 4IZ6A 1KO5A 2JGRA 4GR5A 1YJBA 1P9RA 3K9GA 3K31A 4S2EA 2ZUUA 1YMQA 1D0VA 1OKKA 1UEJA 4OXQA 4XYMA 3UFXB 4BWYA 5B2FA 3GFBA 2I6TA 4EK9A 3WOHA 1G64A 2QMHA 3OOJA 3QPDA 1LPBB 4ZQIA 1AQYA 1CJKC 2GYYA 2PLRA 4R68A 2X58A 3BXOA 4TZTA 4V0LA 5C8YA 4UTVA 1LQTA 2PUJA 4BX2A 1OUMA 3ZVRA 4CMCA 5DRYA 4CT4B 3IBGA 1AF7A 2QL7A 2E4XA 3ZC3A 1RQ7A 1L5LA 1Q3TA 4I6JA 5FL7A 5K0GA 1YBVA 2GN8A 2AMFA 5KSZA 3JZIA 1VMEA 1VPLA 4LOJA 3BXPA 3LYAA 1NZFA 4I36A 2DSTA 2XWBF 1MG5A 3EDCA 3VU9A 3AJ8A 3F9CA 4LHYA 4YCJA 1TCBA 5K3CA 5AP9A 2HA5A 2VDQB 3HEAA 4GRDA 1BE1A 3ITEA 4XUCA 4ZREA 4DNFA 5BN4A 5JW6A 1DDIA 3BK2A 2C3PA 4J6FA 5KTRA 1GITA 1Q21A 5FKJA 3RYFB 2YHIB 3MMSA 1B3BA 3S1AA 3G8DA 3WGNA 4A8JA 1FFEA 3G2JA 1E5DA 1NN1A 3RVJA 4OA5A 3FE2A 3DC7A 2ZJOA 1LVHA 1U0LA 4O4LA 3EAFA 2JD0A 1PL0A 3O8OA 1TUEA 2QVXX 1TLTA 2VRCD 1U8UA 2XQKA 4NTZA 5DTJA 2ET6A 2P30A 4C5CA 1R37A 4MB2A 2IIBA 2E89A 3FRJA 5ALQA 4KODA 2O2ZA 3LOUA 5CX1A 1KE1A 2HAEA 3WJ2A 5C35A 1ZR2A 3W5BA 2CVHA 3U0BA 3MB5A 2C3UA 3H4MA 2UUOA 1LDYA 2HPVA 1Z2DA 4INOA 4FGZA 4N4AA 3U40A 1LSSA 3VZPA 1U3DA 2JK0A 3QPVA 2XUGA 4B2PA 1V8PA 2BR3A 1NIPA 6AT1A 1JLLA 3BF7A 2CDCA 3BTUA 2NT3A 2JCYA 3A9UA 3IEVA 2H7CA 1WDLA 1DCKA 4F8YA 2HWKA 3R9KA 2PUWA 3CR8A 3EZFA 1S0UA 3AM5A 3RJ9A 4BLOA 2R66A