4INJA

Crystal structure of the s111a mutant of member of mccf clade from listeria monocytogenes egd-e with product
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
326
structure length
326
Chain Sequence
NAMIPAKLKQGDEIRIIAPSRSIGIMADNQVEIAVNRLTDMGFKVTFGEHVAEMDCMMSSSIRSRVADIHEAFNDSSVKAILTVIGGFNSNQLLPYLDYDLISENPKILCGFADITALATAIYTQTELITYSGAHFSSFSMEKGLDYVMESFSDCLLQKEPFALKESATWSDDEWYLDQENRNFIPNEGLVVMQPGVAEGIIIGGNLCTLNLLQGTEYMPNLAGTILFIEDDFMTIPETFDRDLESLLSQPGADEIEGMVIGRFQQKTAMTAEKLAYIIETKTALQKIPVISGADFGHTQPIATFPIGGTARIDTNQTDKIQIIRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lmo1638 protein
publication title Crystal structure of the S111A mutant of member of MccF clade from Listeria monocytogenes EGD-e with product
rcsb
source organism Listeria monocytogenes
molecule tags Hydrolase
total genus 115
structure length 326
sequence length 326
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02016 Peptidase_S66 LD-carboxypeptidase N-terminal domain
A PF17676 Peptidase_S66C LD-carboxypeptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Class I glutamine amidotransferase-like 4injA01
3.50.30.60 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 LD-carboxypeptidase A C-terminal domain-like 4injA02
5F9MA 5JYBA 4IIXA 2AUMA 4MJXA 3TLCA 4E94A 3TLZA 3SR3A 2AUNA 3TLEA 3TLGB 3TLBA 4JVOA 3G23A 5K99A 5F5XA 3T5MA 3TLGA 4INJA 3GJZA 4H1HA 3TLAA 4E5SA 4MI1A 3U1BA 3TYXA 3TLYA 1ZRSA 5FD8A 5F1YA 4EYSA 1ZL0A 4IIYA
chains in the Genus database with same CATH superfamily
1T1SA 5EMHA 2DVMA 3V6LA 5JSQA 1FSSA 1XMIA 1U0SY 4RPIA 2JKZA 2E89A 4HDKB 3IEKA 2IYLD 1BVHA 1ZUHA 4WNAA 5GONF 1JEQA 3O9ZA 2C1ZA 2QJWA 2O8CA 1GTG1 2ZOSA 5E1DA 3QSYA 5EZ5A 2W2TA 1KY2A 1N7GA 1NRWA 1DCMA 3D81A 1QIKA 3FUWA 3MB5A 3NH6A 5FA5A 4F3KA 4COBA 1XVAA 2HLHA 2OAEA 3FJYA 4FHGA 4YAKA 1E8MA 4CM9A 1L7QA 3EGDA 3P0HA 4B47A 1E6KA 1I6MA 3NFYA 4MPTA 3JRWA 1E5XA 4ZQFA 5CDTA 1WPGA 3PJEA 2GK3A 3LCMA 1U11A 5F2EA 3LUHA 5KQRA 3I6ZA 3E5MA 5TQ2B 1MBZA 4BTEA 4XGKA 1VL6A 2NUPA 3G59A 3UCFA 2J3IA 2BFCA 4GZ3A 3HA3A 3AFHA 4WXHA 2PXHA 2YZ7A 1GYPA 1L5QA 2JFPA 2PEZA 2VUSA 3A9VA 2AVNA 1LQUA 1XT6A 4INZA 1DKPA 4EJSB 1CUEA 1RRGA 4NATA 3VC2A 4NBNA 5K3DA 4MV6A 1NMYA 1NDUA 4FYMA 3DOUA 1XQVA 2WJWA 5CLQA 4AQ7A 4QPCA 3IULA 1LDBA 3DLCA 4OQLA 4F8YA 1CP3A 1H8HD 1RTTA 3HK2A 2MHCA 3IAS1 3VDXA 1YKFA 5JVDB 3UK7A 4RHCA 1EFRA 3V3TA 5LNK1 2O8FA 3QOXA 2Y99A 3B3FA 1KR2A 1QCZA 3FNIA 1M34E 1QWOA 1NVXQ 1J7JA 4Z49A 4GX5A 2GRUA 4LYYA 5FL7D 3VH1A 4PTYA 1FF9A 4URZR 4OHRA 1HYBA 2C8LA 3SIXA 3RVJA 3TRKA 2A0KA 4QECA 5EE1A 3VSEA 4KKXB 4AT1A 1GGMA 4OC3A 3L4BC 4WINA 4W82A 1L5KA 3RBZA 3MLAA 3QENA 3IWWA 1CE8A 1LF5A 3ZCSA 1XZNA 2ZETA 4MR7B 3W04A 4F4DA 3DLBA 2FF7A 3O4JA 3QKUA 1O8BA 3O6VA 2H1HA 1XRNA 4AJNA 1XCJA 4YP9A 1YVRA 3SLGA 5FPTA 3WI7A 3EW7A 1RNLA 3PQ7A 2JDID 2V8OA 4TQAA 5GZ6A 4WDRA 1KE1A 2I3GA 3DTNA 5JMPA 4H16A 4LDAA 2O4UX 3DGEC 2M6RA 2O2DA 1JIQA 4EA6A 1ND6A 3Q87B 5BY2A 4JLAA 4O02B 2EP5A 3T0FA 3U44A 1WMSA 4EB6A 3BGOS 2CDBA 4H1UA 1XZMA 3GLHA 3MWKA 1NC1A 4O0MA 2J85A 2PV7A 2Y2UA 2Q7OE 2IUEA 4X95A 5LBIA 2BGTA 3TPZA 5D6OA 1MUUA 1DJLA 4KOEC 5H7XA 5BQ5A 3EPJA 2Y93A 2HNKA 1HE2A 2G5PA 2OXIA 4ZGGA 3MN1A 5HZHA 1Q21A 3RRYA 4ROTA 1G3UA 3CR3C 3ILVA 4NICA 1M0TA 2OYSA 3F49S 3ABRB 1U31A 1QH1B 3KIPA 4DWJA 4PN7A 3GH3A 3IEPA 4B8ZA 3RK0A 2RAUA 3VTFA 3BX1A 4QTXA 4BB5A 1CR4A 2CFOA 2ID4A 5LA6A 1D2HA 1SWWA 2X2FA 1BQ4A 1TZMA 1JYSA 4RELA 2WT4A 3DDSA 3HPQA 2NTEA 2ZTMA 4H9GA 3WB2A 1JHDA 2OHXA 1G8AA 4KGXA 4NH4A 4RD1A 2Q1TA 1P45A 4YCAA 3UMFA 4IG9A 2I54A 1X14A 3KVNA 3ZCUA 4PSCA 5BN3B 3URMA 4JODA 1EAYA 3I64A 3UK6A 3AF6A 4IDHA 4QGFA 4Y3UA 5CB8A 2BMEA 3WMFA 3AP3A 1HPLA 1NXQA 2ASEA 3L7LA 1OLOA 4OXQA 4G1UC 5A05A 3RHZA 1YK1A 2P68A 2AD5A 4RVHA 4Y2YA 5CX1A 5JJBA 3TGPA 4N5LA 2BKLA 3CZ4A 2JIBA 2BM1A 1QE0A 1TJNA 2CHQA 2ZIXB 3DTVA 1GG8A 5KWSA 1RJ9A 1R6BX 2RFLA 4M1TA 3THWA 2MTBA 2YZKA 3CO5A 1V9LA 3C1UA 2SKDA 3ZHZA 1KNXA 1GLVA 2JATA 1TW3A 3I1IA 1U3CA 3GAZA 3T7KA 2HWXA 4XRGA 3BHNA 2WHRA 2A0YA 3D0KA 1Z7GA 1U3DA 3RC3A 5K45A 2NN3C 5ALFA 3T07A 2CNOA 1R9MA 1ONPA 5IW8A 4PQRA 1D7AA 3RASA 3QKRB 1IPEA 4RVSA 3VPCA 1PL8A 2BF7A 3GK3A 3GUYA 5H4GA 1QSGA 3SC2B 5TMPA 4MIYA 5CXQA 4S04A 3E53A 4P0QB 3IGFA 2VJBA 1FX0A 2YDXA 4NI5A 2EJUA 4GLBA 2V7QD 1QIHA 3CV3A 1SKYE 2F3TA 1C7FA 4YFVA 2R62A 1N5RA 4LUCA 3IV6A 4DCUA 2ZR9A 3FMFA 2CJXA 2IITA 2ZDHA 5JSUA 2VF4X 1QZXA 3KLOA 1M54A 1EJ0A 4BFVA 2GRAA 1P5ZB 1RE1A 4U2KA 2OCXA 4XB1A 3DMYA 4AO6A 1D9ZA 1BCSA 4BKOA 3LT5A 3DD1A 4KO3S 1E0DA 5TQVA 3UATA 2P9HA 3OCZA 4ZDIA 1B41A 1GTL1 2W71A 1GQOA 1F2DA 1ZL2A 3SVTA 4HQLA 4Y1EA 5ICFA 4FZ3A 4BVKA 1L7BA 5E4YA 1D0SA 5EJ4A 3M81A 2VP5A 4RVOA 3OPVA 4GRIA 1UMCA 4RGQA 1BXZA 1QUEA 3L04A 2FPGB 4FBLA 3U31A 4IKEA 4OGGA 4JGGA 3TE6A 3REQA 1E1RD 1CB0A 5DM70 1FUKA 1IHPA 2PGOA 1VI4A 3E7FA 1QH8B 5EGNA 1XROA 2QZ4A 3EDYA 3MWGA 3PFNA 4HH3C 5ERYA 5HFAA 1IZ8A 2WSBA 4CF7A 3GEIA 3TZCA 4A0FA 2PUEA 4JYWA 4I2VA 5ENVA 4CUJA 2ZI5A 4RUKA 1J07A 2EYUA 5M7EA 3LP6A 2PKXA 2GJKA 4HI0E 4JMLA 4DUPA 5E9JA 2YQZA 3Q3EA 5FA6A 1KI4A 4D97A 5AM3A 4B17A 2VF7A 4KQGA 4G97A 3H5RA 4BVGA 2NOAA 3I2JA 2XWQA 1G0NA 1CDEA 4GKVA 4HQNA 1JDBB 4A73A 4OGFA 2H4XA 2PKYX 2R4UA 4J49A 3VJRA 4RO0A 1EGQA 4TZKA 2B0CA 2UYOA 2ATCA 4P0TA 1CZHA 3WSTA 3IVAA 1EG7A 1IMOA 1KEEA 3GBPA 3EZFA 4BNYA 5L7WA 4TL7A 3GXOA 5KSZA 5KKCA 2RGWA 4GDMA 3RK4A 2JIZD 3SQMA 3KZ1E 1Q20A 2R5FA 2ACWA 2XUPA 4JR0A 2P0EA 1A95A 2ZWMA 3PK0A 2YJTA 5TIIA 4G1MB 1O97D 1U2QA 1KS9A 3DPSA 2PT7A 3TBHA 1Y9JA 2JAXA 2YIDA 3DT9A 1OXTA 2VP2A 4IXMA 4YR7A 1SUSA 3N0WA 3DCIA 2IXTA 1NMXA 2OPBA 2QAGB 2WMYA 3ANLA 5DV9A 5AW9A 1X7XB 1IK6A 2SCUA 1T36B 1CLEA 3TGLA 5FNVF 3W4JA 4QGGA 3BULA 3C85A 5ICMA 1CNFA 3P2IA 4CWAA 4KSCA 1W76A 4C05A 2AN1A 3HBNA 4D9CA 1CKEA 1PIWA 5EIBD 3SR3A 4QEKA 2WSYB 5ALXA 3DS8A 1H6AA 2NYUA 1TZJA 2EW1A 3PSAA 3L6RA 4WVFA 1X86B 4EFKA 4MCQA 2YYAA 1WUTA 2B5WA 4M9UA 3DD5A 3UW3A 1KP2A 4V1CB 5CDSA 2H06A 2C7RA 2HUPA 2WFLA 4GKBA 1WJGA 1GL7A 4ZZ0A 3QFCA 3A32A 3BRSA 3C15C 4IEIA 4FEGA 3SJ7A 1X94A 2R00A 3MBKA 4UVGA 3O91A 2NPFA 3TZHA 1Z3CA 3VR5A 1W5BA 5AKKA 4GMDA 5K3FB 1EGHA 4EJ6A 4YRCA 2QT1A 3BTSA 4CV2A 1ZVVA 3AB3A 5E7QA 4DIDA 3SEFA 2PX6A 3DWEX 2M6LA 1V5IA 3OZIA 4FDMA 3GFGA 5AH0A 2ATVA 4KGVA 4RQAA 4EGAA 4YMTA 3RAGA 5EQJB 1HLFA 3A6ZA 5AM5A 3H8VA 3VNSA 4EFLA 1RPZA 4J7XA 1Y9AA 3C8UA 4K9OA 5AKHA 1AUQA 3LHFA 3UJ9A 3N5KA 3IVCA 3VKGA 1IEVA 1M6VA 2Q46A 4Z8YA 2CXQA 3BXPA 3O8NA 4IJKA 4OQ4A 4LFAB 4G1VA 5A3JA 5DMHA 4DLVA 1VLVA 1I3NA 1UUFA 3KQTA 3QE4A 1U3UA 4LHEA 3WGUA 3D4PA 5DTEA 3BHMA 3DXXA 3ZHTA 3BSYA 3JPWA 4W5QA 4RTLA 1XMPA 5I8ZA 5TSDA 2FWPA 3O3CA 5JSZB 3TPCA 5L3ZA 1KGSA 1KMQA 4ZTBA 2XKAA 2HBRA 4O2AA 4RSHA 4GG1A 2GPSA 1F17A 1PJ2A 4ZC1A 5IPFA 1ACLA 1UF9A 4ZJUA 2RK4A 4W63A 2PQ6A 3FXAA 2WLSA 4NZMA 3TVDA 4DNPA 3MWYW 5B55A 3WKCA 2FX2A 1RXVA 2FSIA 4K3VA 1RS0A 1BXGA 2IYAA 3PI7A 3FOEC 2BEVA 4A1OA 3I34X 3DE7X 3IUMA 3TXXA 2MU1A 5DRYA 4EUSA 4DV2B 3KALA 1TYAE 2VRWA 4XWYA 1TC1A 3IT1A 2X9GA 3UJ8A 9LDBA 1PEAA 1QV6A 2W2LA 1NV9A 4H6XA 4JP3A 4E13A 1GRRA 3HEBA 2WYUA 4IIVA 2IDMA 4LVOA 3V32A 1XNHA 3ZUGA 2KMLA 1NVVQ 2A67A 5G0TA 4ATNA 3HKDA 3LNCA 4EH1A 5ANRB 3BMQB 5FPYA 1P4JA 1K8ZB 3IS3A 2EG9A 2QSZA 4LDQA 3EVGA 2G76A 2FG6C 3FVWA 5JALA 1QG6A 2ZS9A 4QD3A 3T5PA 2QRMA 1E2IA 3ABQB 1SKBA 5EZQA 4DCCA 2UZIR 4EEKA 2BHNA 2XMGA 4OV6B 4DR7B 1Y3HA 3LVBA 4OAQA 4E7PA 1TEXA 1UBCA 2PAFA 3QU7A 1DIBA 2C7VA 2RGBA 4K9SA 5D51S 2W0SA 3K0AB 2E5WA 3ZWXA 3BZBA 4ZYWA 3RFXA 4C2BA 3DBRA 5EMJA 4HTFB 1SOWA 3A27A 2LRHA 1N0VC 1CZUA 4QOGA 4E1AA 4CUZA 1WHTA 3M2TA 3P4YA 1GA4A 3IAM6 4MUEA 1GZ4A 1UBEA 1M1ZA 4LBZA 4WKCA 5DK4A 1OXSC 1RWXA 2B2CA 4FNOA 4MTCA 2O20A 1XPUA 3HGTA 1ISMA 4HAUA 1WXWA 1G18A 1JR3E 2B1IA 2D4AA 4RMGA 1JNYA 3A9WA 4K9RA 1CPYA 4WK0B 3H9BA 5B3JC 4S05A 4W5WA 1Y8RA 3L0DA 4ZJPA 1DJMA 4B9AA 2KJQA 4P33A 3ZY2A 1I1OA 2RG1A 4L3OA 2R6CA 4DAOA 4F56A 4P32A 1RLUA 2G80A 3VV2A 1PJ8A 4C6TA 3QWFA 1CJTC 4C8TA 2R8XA 2ZSEA 3VZPA 2GXSA 3EGWA 3FI0A 2AFIB 5DYIA 3V8NA 3HP4A 4I50F 3QFRA 5AKEA 5EWLA 2BGRA 3E84A 2ERCA 1JA9A 2G82A 4TMWA 4NE7A 5GJVC 2ZJ7A 1NTRA 1X8JA 2B1QA 2QUBA 1S2OA 4UU8A 1HX7A 5HTKA 2Q5EA 2BTQA 4II2A 4XQEA 3BVPA 1T10A 2WIGA 3LVQE 3EA4A 4I1IA 1I7DA 4EY4A 1OLXB 7YASA 3BI1A 2WKQA 1YUNA 1BNCA 2CV1A 2I3DA 1AZWA 2BW0A 2FN8A 3EH1A 4UOQA 4C3ZA 5KTNA 1N36B 2BGKA 5A0TA 4BNMA 4ZQGA 2CSUA 2BHRA 3V4LA 2Q0QA 2GBFA 1L5ZA 5F2OA 1EBUA 1JXMA 2E87A 3LYAA 3EBOA 3EDQA 3NI2A 2HV8A 1FBTA 1VBMA 3DDCA 4QGBA 3WIBA 1T6BY 3CTPA 3CSUA 3KOMA 4CDRA 3L40A 1L4NA 2IZZA 2QS9A 2DETA 4OC2A 1UMBA 2QRZA 3DVAB 4KRFA 3EXAA 4FX5A 3X1MA 1ZU5A 2ACKA 2XR1A 4JJFA 1GUFA 4PIPA 4Y0NA 5AKIA 3HZHA 1B3BA 4DCMA 2EKLA 1CQPA 1SB9A 4RPGA 2O0JA 4QFMA 4D9FA 1BW9B 1X1QA 3NBQA 4KDFA 4OTZA 3SJZA 4BCBA 1GTSA 1OFUX 3NAMA 1DAMA 2PSFA 2WOJA 3E7WA 2OXFA 3GVCA 3HGQA 4IH9A 4LG1A 3AQ4A 1WPQA 3Q1KA 3UW1A 4EEZA 3PT9A 1QRRA 1K5HA 2DFKB 5B58C 4BX9A 5I7RA 2WW8A 2YL2A 3HXOA 3NVMB 5CVDA 2KHZA 5CIQA 1UDRA 4NYJR 5CDYA 1M33A 4MW1A 3G23A 3EDOA 3KT6A 3OWXA 1WRBA 2E1PA 1V1MB 4ERXA 3SQDA 4EELA 1Q2XA 1QB7A 2X8WA 2HB6A 2XCRB 3LYUA 1OW3B 2K87A 1NUTA 1TAUA 2H0QA 5KQPA 3GA0A 1DKLA 3L1VA 2W2MA 3MT8A 1MB9A 2GAOA 3D3NA 2Q3JA 2P1RA 3IT3A 4QLBA 3QVGB 3QMVA 1DX9A 3R8FA 4O4IF 4BLRA 4KW7A 3SIRA 3C24A 3R9XB 5AW6A 2X9LA 2JCBA 2JGDB 1QNLA 4PTZA 4QODA 3LOUA 4Z2YA 4DR2B 5F12A 4IQFA 3JD2A 4MS1B 1LUAA 3TUZC 1G38A 5JXJA 1K7EB 1UPFA 2SHKA 4MS4A 4E31A 2JNWA 4PC7A 4DV6B 3FGOA 2ON6A 2WNSA 2O54A 1QCYA 4GO1A 2C4TA 5LWHA 1F6WA 1WW2A 1VLMA 3RT7A 4ZGBA 3NDBB 3KQUA 2OV6A 2XUOA 4JKOA 1UBLS 1JQ3A 2GK4A 1TI7A 4JJIA 4RYLA 3RBAA 4X71A 3RYHA 3W5JA 4ND5A 3HA2A 5BUQA 5BV2P 4EM6A 3QF4A 2CMDA 1JAHA 1VPLA 4FI3F 4OB7A 5C35A 4X54A 1OT3A 3QKSA 2BMFA 3ZCVA 4C20A 4YRNA 5DNAA 5F21A 3FB1A 1HZZA 4C5BA 1MO5A 5TMEA 1F2UA 4JQYA 1U0NA 4IJWA 4IIFA 1ZVMA 4RMHA 4U7FA 3BAFA 4RZ2A 5CNKA 1Z4LA 2V4MA 3I5AA 3NBAA 3AR9A 4P4DA 2JGIA 4LY6A 3L4BA 3AHIA 4CKBB 2HEGA 1IM2A 1PFWA 2V74B 4YEDA 4ZCIA 1PZFA 4A7PA 4R0VA 4WK2B 2QD5A 2AMVA 2OMKA 3DQPA 3L2OB 5LOVA 1EGMB 2IPLA 4LRTB 1PS0A 2P27A 3QBDA 4LBWA 2XMDA 1XVTA 2QMOA 4QYMA 3PJGA 4N3NA 3A2KA 1H65A 5JXWA 4IYRA 1JQEA 1OCEA 2FWIA 3S68A 4XWOA 1R6XA 1U9ZA 1ZRMA 4AVYA 1ND5A 3EPPA 5BSKA 2C0QA 1ZH0A 1COWA 3VBEA 4Y6LA 4BNTA 2BE9A 4TUYB 5H9VA 2GQ0A 3PGKA 1Z0UA 2VXCA 2JVKA 1H42A 3IX7A 2NZWA 5CP8A 2XI4A 3AEUA 3AZPA 3LUAA 3VU3A 4CQNA 4RWEA 5G0SA 1SOMA 1WAMA 5D3QA 2CLOB 3UAZA 5F3WB 1MC5A 3H83A 3H5AA 5SYNA 1IQPA 5IABA 1S2DA 5L6LB 4A6PA 2XB8A 4NCJA 1X7DA 1U2DA 2ADMA 1Y63A 3PKZA 1FB5A 3VU1A 5JT1A 2FZGA 1II9A 1VKOA 4IJQA 3TG8A 3AFOA 1NYTA 4JXZA 4MKRA 3WYDA 3TL6A 2Y0BA 4IKPA 4UVEA 1PWEA 1E3WB 2H5LA 4W9YA 2Q0HA 1MR3F 4HLUC 3VC7A 4R3NA 5J2TA 3W1VA 4E11A 3GLIB 3KYBA 2RE8A 5JUWA 3WC4A 1I7PA 5LIRA 2VZ0A 4MYCA 4GEGA 3LX8A 3AHCA 3IERA 1VHTA 3DEZA 2R1VA 1W6RA 4A2WA 3AKYA 3EZNA 4BB0A 3KRVA 1FVXA 5FPSA 3EEFA 1ZD1A 1HMPA 1XLVA 4G01B 3EX7C 3OJEA 3ZNPA 3UAVA 2D13A 3WZMA 3ZQKA 2GN8A 1L5GB 1WUYA 2EC5A 4TQUS 1QFSA 3B13B 4OUKX 1P3DA 4R0NA 2AOXA 3HYRA 1Y1TA 4GMGA 3KM0A 2REQA 4J6FA 1LQ2A 2FPWA 4G9BA 2XEXA 4K9NA 3T7EA 1A50B 1VCHA 1XTKA 1YDEA 3FWZA 3HRIA 2AFVA 4BFTA 4KEAA 3WWCA 3UANA 3HCWA 1YQDA 4Q9HA 4RANA 1FMCA 3MTBA 2H4JA 3GFSA 4MCAA 4Q7LA 1QPZA 3KLMX 3GRCA 4KRXA 3DEHA 1VC2A 4WCDA 1SY7A 1E1CB 4RY9A 3L0IB 2WU4A 2P62A 1VL8A 4TTPA 3IVGA 4GL2A 3C5VA 4IWNA 3AX6A 3I6YA 3SBOA 3D6JA 1PDVA 2OB1A 1SZDA 3DTTA 1EX7A 2DM6A 3PFWO 4LNHA 4KYTA 3ESZA 4OX9Y 1PTJA 5JCXA 1N0IA 4P7JA 5IFLA 4OSOA 3GGCA 1DAOA 2F48A 4KAAA 4L76A 1XTJA 1V9SA 2O2GA 1E6LA 2G06A 1DAHA 2CK3D 2FP4A 4PANA 1E94E 3CZCA 3O8DA 4YJHB 1ZO8A 3RF7A 3LT2A 4YAOA 4BMZA 5LJLA 7MHTA 4MVJE 2CLMB 2J9XB 1AKRA 4C0KA 3MTEA 3BN3A 5E4FA 4WJKB 2J9ZB 5A2QA 1SC4A 1BHSA 5LXTB 1RQGA 5LKAA 1RPNA 3N2GA 4HNAA 4NEGA 2XYGA 4KQEA 1O03A 2ONKA 1G60A 5E3JA 3BORA 4PR0A 5FBZA 4DOMA 1OR8A 1Q0ZA 2ZJ5A 4N9QA 5IAGA 3ZKAA 2I1VB 4D4HA 1GRQA 6ADHA 4ZVUA 3L1IA 1KYYA 3K8YA 1HT2E 3BWXA 3HN2A 4JGIA 2BWJA 4REQA 3K31A 3VR6D 2QRVB 4MV7A 1I30A 4P82A 1CVIA 3RT1A 3OIYA 4LBVA 4QNNA 3MQFA 2PQMA 4DS3A 5BURA 2XQGA 5EJ9A 5CURA 5JTUA 1BWSA 1NLFA 2R11A 4WA7A 4LCBA 4JLBA 4L07A 4PGHA 5F76A 5AICA 5LQSA 5JQGA 2P69A 4DNFA 2Z08A 4XPIB 5EMLA 3EOBI 1D7OA 3N1UA 1H3EA 2FWRA 1LBQA 2G4LA 1M7BA 1T4CB 1CFJA 1XTPA 2HK8A 1U2GC 3BG5A 4BLVA 3HB4X 3NKFA 3PQCA 3CEJA 5E3HA 2X76A 4MS3B 4C76A 3SNKA 1QP7A 2HCFA 3VAAA 2R5NA 5E1MA 4MUAA 4HRYA 2EWWA 4RACA 4EI8A 4OOFA 4R9SA 3DR3A 2F00A 2HTFA 4GEKA 3HJCA 3A1CA 4UEOA 4F4JA 4IDBA 2DBRA 5C8DA 1MPTA 1RI1A 1X3LA 2PKCA 2Q2QA 3CWZA 3DDHA 3F7MA 3ZGOA 4BKQA 1EP9A 1EM6A 4C4AA 5A9RA 3KE8A 4IDCA 1HI9A 2GZ1A 3GJ6A 2O2EA 3E2PA 1IH8A 1A5BB 1ZN2A 3I0ZA 4G0XA 4CMEA 4JL8A 1KGDA 4TLMB 4BZWA 1QGZA 2QWXA 4DNQA 3ZDAA 2H18A 3GT3A 2AJCA 1V39A 1VSTA 3C70A 1XB2A 1G5QA 2IQ5A 4LYJA 4D0LB 1CVLA 3VOTA 4ZKDA 2Q4BA 4IILA 3OC0A 4JAVC 5HFJA 1UZLA 3ZWNA 1DE0A 4RTMA 4CODB 1I1HA 5K6AC 1EVLA 2XSZD 5E0OA 5AW8A 2P65A 3T3IA 2B36A 5L3SA 2R4QA 3CINA 1TA4A 4YJ2A 1OXXK 4L27A 4MKZA 4RTSA 1R9NA 1DQZA 2F2TA 2FPXA 3AI7A 4LRQA 4I7EA 4MIKA 3ND9A 1XSEA 8ATCA 1WOMA 1V5EA 2P9YA 3JAWA 4JBNA 5F73A 3AUJB 4RSGA 1V47A 1OHHA 2XUKA 3VU8A 2X0KA 3D0QA 3LQYA 2J45A 2VJNA 3OMXA 2I7DA 2Q1YA 4TWIA 3BFVA 3C7DB 3WLHA 3MJFA 3PXBA 1YOVB 3HCBA 3NIFB 1QR2A 1U80A 3ZHSA 5KTTA 1IBCA 3FHTA 4TMZA 4M9QA 4I3FA 1J5EB 1Z8LA 3GMDA 2VDOB 3OIVA 3OX1A 4UDXX 3TINA 1B23P 1BDHA 5IVPA 4MHOA 1V11B 2FR8A 3LM8A 5HKLA 2G4VA 5KQSA 2IV7A 1HC7A 1VG0B 1MB0A 3JD0A 2ZSAA 1K0UA 1XEWY 5TVKA 3UFBA 4QTYA 3VRHA 3G7SA 4EYOA 4URVR 2IP4A 2IE8A 1J0XO 1MQAA 1TXGA 1LKZA 1Z6ZA 3JQBA 4GVXA 2PFKA 1PI3A 4OHKA 4XCVA 4DW8A 2HSDA 3ESCA 4L4ZA 1U0EA 3EF3A 4KQMA 4TVKA 3D1VA 3QJGA 4ZCPA 1P74A 4DKXA 3GJZA 4Q7MB 3K70B 1GFZA 4DG9A 3EGCA 2FZ4A 3NAGA 3FUTA 2TS1A 1LJLA 1JHVA 3NBUA 6GPBA 5DBHX 2W6PA 7ABPA 4US2R 2Q4OA 3M9LA 2E49A 4P81A 3K30A 1VJ5A 4NPHA 1H9BA 4YRJA 3SK0A 1KDYA 2VLIA 1JAIA 3GLFA 1I4EB 1CQJA 5CGZA 5A9SB 5A4MS 4KR6A 3V3KA 4L15A 4TXLA 1CR2A 3CZAA 5KTYA 4FK8A 4BZQA 4DA6A 2IYQA 4N40A 2Z3VA 3RYFB 2QTGA 4PIMA 2ZTSA 3E7XA 2QTVB 3QU5A 1KI7A 2AVDA 1DJNA 1NNUA 4KRGA 4LC1A 4QBTA 4B7CA 4I8XA 5B1IA 5BYKA 2EATA 1T0PA 2C2GA 2X7HA 3JZAA 3NTVA 4Y9SA 1G6OA 3ZV4A 5I3CA 2DHCA 3QSGA 3AK4A 1EFCA 1XQYA 3MXTA 1H9AA 2YN4A 2NUBA 2D1FA 3HY3A 2CD9A 2KM1A 3UGKA 3WHKA 5YASA 1SXPA 2ZQ5A 2H08A 1U81A 4IM7A 2VA8A 2ZIUB 3NJ4A 4B7XA 4A15A 4OHVA 1Z5WA 5T5QA 3P26A 4FUTA 2JKVA 4LK2A 1AQUA 3VV3A 2WNIA 3ZV6A 5D85A 4TVBA 4PLYA 5DBOA 3VU9B 1I4OA 2QZZA 1P91A 4G0QA 2ZW9A 5CVVA 3ITDA 3THYB 1FW6A 3PQ6A 2BC9A 2ZYIA 1KYXA 3WYBA 3F73A 3L1JA 4C9AA 3KYCA 4QOSA 3VHXB 1NXSA 3N8HA 3FY4A 1ML3A 3GJ0A 2ODQA 2ZXEA 5BV7A 3EVZA 1MH1A 2XKJE 3CRZA 1FNSA 2ZE6A 2DFLA 3KEQA 2YYZA 3VVLA 5A1TA 4PEVA 3FTCA 3BL5A 3TPFA 1X87A 2QQ0A 5U9CA 2RJNA 1NZDA 3S27A 3HPRA 1JPNA 2EAUA 3M4YA 5REQB 3DMGA 3AVTA 2EDCA 4X3RA 5CK4A 3PHHA 2PUBA 3COYA 1SVLA 5DISB 1EB8A 4B31A 4EG5A 3DV2A 3NOVA 3EXEB 2ZM5A 4BX2A 1I24A 2DTDA 1G5IA 3DE1X 1RM5A 2OORA 1B2LA 4US1R 1PT6A 1C1DA 1HV8A 1ZJYA 4HFJA 2B9EA 3KHSA 1MT0A 1FFDA 2CJFA 5KYNA 1W44A 3ZVRA 5K20A 2AHRA 3WG9A 2XQJA 4FIZA 1BS1A 1YQUA 3B5EA 2Q27A 1Z7EA 4JSTA 2D2XA 3RUCA 4I6EA 4NF2A 1I0IA 1M34A 2NYRA 2YN0A 4L16A 1Z5ZA 3IB3A 1P2UA 3QJ5A 1Y48E 5I51A 4TRRA 2IBMA 4FFDA 4NBSA 3I5XA 4JQCA 1U7DA 5LZ5A 3NG1A 3LL7A 3G2HA 1DKNA 3ZGYA 2I4OA 2H3EA 3OUZA 1UJ5A 5F7OA 3M3HA 2B0JA 1JV2B 4D9JA 4UEQA 1DFHA 1T2UA 4F6RB 4ZFNA 3HH8A 1VTKA 1PQYA 3FF1A 4C3VA 4BGDA 2Y0EA 2R7AA 2C5FA 4IDAA 3V8EA 4HWOA 5D8DA 4KI7A 4PSUA 4XCXA 5BNFA 1N2CE 4UASA 2HDWA 1GPYA 3I8XA 2ZVJA 3EZBA 2IP1A 2HA3A 2F1HA 4J0EA 4L9SA 4B3RB 1KDZA 3NHKA 4JJ4A 4Y2PA 3KASA 4B80A 3NTLA 2AZDA 4WFQA 3ZLUA 2WTXA 1XCBA 2POCA 1RRKA 2Q2OA 3PWTA 1HXHA 1HEIA 4V38A 4XA8A 3GFBA 2NSDA 2CN1A 2ZI9A 5EYPB 1KK0A 3ZUPA 1B0UA 4M9ZA 2MCFA 4EHKA 5AW0A 2HSEA 2JGJA 2PGIA 2G1PA 1DEHA 3O73A 1P73A 4MNTA 4GSLA 4Y6QA 2O5EA 1ZITA 2A9OA 4IHAA 1XLUA 3QWAA 4JHXA 1E8NA 4YAGA 5FEMA 3AUUA 4FDUA 2PEYA 1SKAA 2XDYA 2ZJBA 3DNMA 3OKPA 1XXHB 3L07A 3Q6NA 3AESB 4YJDA 2CLEB 1JWAB 4QT0A 2BIFA 4U39A 4UEJA 2AI2A 3TSAA 3K20A 1BCRB 1MJFA 3B1YA 4X6YA 2JFUA 3PQ4A 4MW2A 4R1SA 2R47A 1TAGA 4WZ6A 1DBVO 4F2WA 2QG9A 5A9TA 3L43A 1YB1A 2IY7A 1GSHA 1ST3A 2XVXA 1G7SA 4B84A 4FKBA 4QTZA 1YZ3A 4LC9A 3VR2A 4QU5A 2FX3A 3FDZA 5A6VA 4YV7A 1BJKA 1I5OA 2XECA 4MLCA 4TSKA 5IVIA 3W2GA 5J2UA 1X2BA 1E3TA 3I42A 1AIPA 1OREA 3D4LA 3PEVA 4OI1A 3B6JA 1PJSA 2QUJA 3CVVA 4JCOA 2YQ5A 2VDWB 3HSSA 2YOGA 3T1YB 1Z08A 1JNXX 1ZLXA 2XOXA 3EQ2A 4OJQA 5K0JA 5C7IO 2ORYA 3LK7A 1N6NA 4M99A 3C3JA 3RWBA 3I05A 3VZDA 5ALIA 1DMRA 1ZI9A 3RVMA 1J20A 1BYUA 3PD0A 4OVKA 1I7SB 3AP2A 1UBJS 1XN4A 1EVQA 1O5TA 2AEEA 2OO3A 3ASYA 3DMHA 3Q1LA 4HDNA 5F7JA 3SOZA 1ZP6A 2IIQA 1H93A 4P1ZA 5FOUA 4OMCA 2H9IA 4LJSA 3PFBA 4AZ3B 1N1EA 2LVBA 1GIAA 2AOUA 4PPFA 2N1BA 3IDZA 3PNLA 2GESA 3FNQA 4NZPA 3EODA 5HIAA 1W29A 2BBTA 1REQB 3VGPA 4V0QA 1PJAA 4RTKA 4UM7A 4OB8A 5FAKA 1U0HC 4PFKA 1Z88A 4JIGA 2D74A 3RUIA 3WY9A 4GNKA 1VGQA 4H7EA 3HE3A 2JJQA 4WZBE 5HCNA 4OH1A 3O94A 3SPXA 3KDSE 3ME5A 1DP4A 2XUJA 5BP7A 1U02A 3THXB 3D6UA 1WCIB 1DXQA 4PLVA 2PCJA 1N5KA 3K2BA 4GW3A 5JAOA 1CY7A 3P0IA 4ZIRA 4MLZA 4KODA 4PWYA 2GN9A 4ZT6A 3TDKA 4U2GA 1GNSA 2AJDA 3H2SA 3KWFA 2CXPA 4I4TA 4XFKA 3B6KA 1LK7A 3EIOA 3H6GA 1XP5A 3U4QB 4B7UA 1VYTA 5G1NA 1CUBA 3WKAA 2I22A 2V97A 1KORA 3H7IA 4TV9A 2BGWA 4IQGA 1M8GA 3FVRA 3JQFA 2ZCUA 3KD3A 1YFKA 4KXUA 1WTCA 3G9TA 3HCDA 3GJ3A 5FTWA 3FOFC 3EBLA 2QVYX 2I67A 2OE2A 1KI6B 3P0FA 3OTWA 4NAHA 3OZXA 2EKBA 2JHCA 2CVQA 1AKWA 4QRDA 5LC1A 5HM6A 3PLRA 4ZZ1A 5A4FS 3UK1A 4CQMA 1EYZA 4XQCA 1G98A 1I0LA 1OGJA 4HY3A 2ZGVA 2CLKB 2OD9A 4IDEA 4LKOA 1CC1S 4KCGA 4A6XA 1VMKA 1BN6A 1S9DA 5COQA 1KYIA 3T1NA 4DZZA 3C6KA 2WHPA 1TJYA 1GQFA 1XLWA 4RIHA 1H6DA 1IY9A 4BS9A 1QGYA 5JG7A 1JAYA 1OI7A 4IMJB 2E2WA 1SJ9A 2GFHA 3ML1A 4HLUA 3ETGA 3CN7A 2QSYA 1O9GA 4M7OA 1UEJA 4NXNB 2H7VA 4R51A 4Z8XA 3URKA 3NWBA 4RX1A 1NJFA 1CIPA 3DXYA 1A9SA 2H1SA 2TRSB 3GB9A 4N8SA 5EXTA 3GDGA 3IPRA 1G8KA 1ZC3A 1X1BA 3VOBA 3ZE6A 3TQHA 4MYTA 2J3JA 1WNFA 3GZNA 4CMJA 1HFEL 4JSRA 5EJEA 5B36A 1YZTA 4LF6B 3V2UA 1IN4A 2Z5LA 3B5JA 2YVQA 1H1LA 5KVVA 3CRNA 5EFOA 4C01A 3TQCA 3EVAA 1GSIA 2Z4TA 4UUBA 1G9XA 2P2SA 4NJEB 2OPHA 2O2YA 3QVWA 4OSPA 3OG9A 4E2FA 4N5HX 1MP0A 4OYHA 1O6BA 3RR2A 3WGVA 1W36B 4LQDA 3GRPA 5EHIA 4C30A 3WMGA 1QLJA 1Z9BA 5C0OE 4TUYF 5HJ7A 4YRFA 1LSUA 1MG0A 4Q9JA 1Z0DA 4BMNA 4RZIA 2GZRA 2HI0A 1GQSA 2X0RA 3KB1A 3MINB 4X3PA 1U3TA 1F8YA 3FECA 2XJ9A 3AIMA 1LLQA 4XQ9A 4Z6KA 4IINA 3MQ4A 4LHVA 2XD4A 2EKPA 5C5CA 2IEZA 3AG5A 4M8IA 1CQXA 2J3QA 1Q12A 1GJRA 4K9QA 3HJHA 9LDTA 3WB9A 4DWVA 1G8JA 4Q3NA 2BBWA 3U7GA 4HS4A 1TJ3A 3MGGA 1RYNA 2B4QA 5IP5A 4KVAA 2PMEA 5I45A 2XXAB 3E1GA 2QXUA 1XZ8A 3ZWAA 4N49A 4MEAA 2NSJA 4GPEA 1JIIA 4EFNA 3CUTA 3T7CA 1NUAA 2WF5A 2XGJA 4JZKA 2ZLBA 3F8SA 4XB2A 1I32A 2UUAB 1SRRA 2IC5A 1R0KA 3HBLA 1QU2A 1SU6A 1G8GA 5JZSA 4XQ0A 1MFPA 4FYVA 3UWSA 1ZGZA 4BVAA 1ODIA 1VSBA 1ZNWA 3C14C 4DUGD 2ACEA 3CYFA 3I01M 4LE2A 2WDPA 3U3KA 4KNYA 4YNBA 4M46A 5D01A 4RD0A 1NW7A 3AUYA 1GD1O 2VWGA 3RVDA 1J8YF 2HN9A 4E12A 4YRDA 3T95A 2VZ8A 4DQLA 1HNZB 1LNSA 2BLNA 4O5OA 3WE7A 5JH7B 3LQ2A 4X64B 3ZN2A 3GUHA 3AHHA 4O4JB 5B30A 3BWCA 4OHYA 1M74A 1RJWA 1Y4UA 1TAQA 5ITSA 5KYTA 3DVRX 3WQQA 3HXKA 2OGZA 3D6TB 5LA6F 3ABOB 1ONOA 3W5HA 5CUQA 2OILA 4Q1BA 2HFKA 4UOEA 2A0FA 4GI7A 3TGWA 3TW8B 1L5FA 2VATA 2YHBA 5CYPA 4JBYA 4WT7A 2R751 3WRYA 3B48A 3I4CA 1WETA 1T9GR 4JZYA 4QXQA 4C22A 1RXUA 1R66A 4KH1A 4M21A 4DRXB 4AN1A 3PJRA 1QFZA 4PNEA 2F3PA 3ZW8A 3KFVA 1IN6A 4TKUB 1I5EA 1G2IA 3DSRA 1YBVA 1OLSB 1FTNA 3M1IA 1SCJA 4LXYA 2VKQA 4XX0A 3UV7A 2WD8A 1YQ9A 1M2HA 2BDUA 1PV1A 1JBEA 1U2RA 2QP9X 3C6XA 4HSEA 1MT3A 4IXDA 4MI9A 3R9KA 3N58A 4HLQB 1EVIA 1TB4A 3SF8A 2HRZA 3EW9A 1TA9A 4WFIA 4AMGA 4EY8A 1PNOA 4HAWA 4F7WA 5IVKA 1B1CA 2OBNA 3KHUA 4OCZA 4D9HA 3G02A 1J5XA 1DG1G 1TJ4A 2R8OA 2W8BB 3HVKA 3W8FA 1YSCA 2UUCB 3B1XA 3LF2A 3KOYA 3QOWA 4EBBA 4GE3A 1HBJA 1BWQA 4EAAA 2VPYA 2YJ6A 1T1JA 1NXTA 4YP6A 2HAEA 2VYQA 2AN3A 3H17A 3HXQA 4KDCA 3B3JA 3BH7A 3KPYA 2WIFA 3ZE9A 3OX2A 2B1GA 1CUXA 2CXXA 1OA0A 2X41A 1T3SA 4RFSB 4ZV7A 2E4WA 1BRTA 1N9ZA 3E6AA 1FZQA 5MN5A 1QHHB 2WJIA 4TZ0A 4NARA 2DTXA 4H6WA 2I4LA 4N47A 3OA2A 1DAPA 5C1BA 4MKGA 3FCAA 1LBIA 1R0WA 3A0RB 3GEBA 2J6BA 3N0VA 3VNVA 2BMAA 2NTJA 5JADA 2ZP1A 4M8SA 2HT6A 3OPYA 2IUTA 3BMNA 3VR3D 4UQLA 1U63A 4WLOA 1JKMA 4P5EA 2BSXA 1SELA 1YBFA 2XQKA 3DFUA 3DBHB 4MINA 3W05A 1DQPA 3NX4A 3TWOA 3V1LA 3BBPA 2OK7A 1QTNA 1FNBA 1JEAA 5IG2A 1BEEA 4X92A 3UT5A 2EZ4A 4XDGA 4K6OA 4ETNA 2G9ZA 3E22A 4YIHA 4FHDA 1RHRA 1WXQA 4XYGA 6LDHA 3QYFA 5BR8B 4EG0A 3VC1A 2RK6A 1V5FA 1CY2A 3DHNA 1JR3A 4CLHA 3PQFA 4WMLA 1H6BA 1QYCA 3E3AA 2FW7A 3BWMA 4EGSA 4DXAA 3GOHA 1EPUA 1Z82A 2GLUA 4G67A 3DM5A 4OKSA 3AETA 1SVWA 3D7MA 1QP0A 3TKYA 1NHWA 2R6DA 4J0HA 4J94A 4ZEMA 2I9KA 1O6FA 2G0AA 3FGZA 3KR9A 2RHGB 3N53A 4RKEA 3A2NA 4L8VA 4YGXB 1KDPA 5CDGA 5AVUA 3HO8A 4AL4A 3VPGA 3SI7A 1GTRA 1MMFB 1KH1A 1KU6A 1M1NB 3SWWA 4BJHB 1EK6A 1XEWX 3DQZA 3EVBA 3FFTA 1TLLA 2C3PA 4EGFA 4GZ6A 2OGSA 1BMTA 1EP1B 3R3YA 4WACA 1J2TA 1H2FA 2V9CA 5KIAA 5FUBA 5I9BA 1YVEI 4CL0A 4QLOA 3MUOA 3TNFA 1XCPA 1SVSA 1DGQA 2PRIA 4MVYA 2ZTLA 3NC0C 3HB5X 1IBSA 1PNVA 3EBPA 3LDGA 1PR9A 3CR8A 2RGUA 4HDMA 3MRVA 3HCRA 4Q9NA 2H7YA 4GOLD 3EC2A 3VKHA 4GBED 4RZUA 4L8YA 1A4UA 1MIHA 2B6HA 4X6XA 4RZ3A 3ZJ5A 5CFZA 1JDSA 2VL7A 4GM0A 2E18A 5BO5A 3TG2A 4F97A 2HSJA 1XTQA 1Z0JA 2HJHA 1ZH6A 1UL1X 1GNVA 4P4JA 3T7JA 3KEOA 1P33A 3DV0B 4Y9DA 1LPSA 1T8TA 3FAKA 3JZFA 4NNPA 3SBEA 3JWPA 4CKCA 2CL0X 2VXOA 4D99A 1HE1C 5J58A 4JCCA 1N2BA 1KOGA 4RM2A 5BSFA 1XTSA 1YS9A 2BEUA 3R5TA 5IJWA 1NUSA 2RGGA 4G9GA 3T61A 4QJBA 3X3HA 4I6GA 3FFBA 4DE5A 2O0MA 4HC4A 4BLQA 3EQZA 1X7ZA 1XLTA 4R54A 2BP7B 3CW8X 2GJSA 1BDMA 1T1RA 3WAGA 3D7KA 2H2FA 3OT1A 1EUCB 1XZCA 3S2IA 4TLBA 4C29A 4WERA 2EXXA 2HU8A 2ODEA 4TX1A 5B7PA 1KEWA 3GNLA 1DAGA 2J4CA 1AUOA 3T0IA 2JB9A 2VZEA 4DV7B 4N18A 3P1JA 1SCUB 2QLNA 3VXKA 1XTBA 3UJHA 1SXJD 3NP9A 1BJTA 2B2XA 1WQ3A 3WO1A 1ZMOA 2AUNA 3EIEA 3TD2A 3TZLA 3CLUC 4YPVA 4PO8A 1UXOA 3NANA 5DE3A 5HFNA 1LJUA 5JIBA 5T8KC 3S9MA 3HBJA 3QFHA 2QZ9A 4WLFA 2ZJ2A 3UO8B 4WTOA 1KQGA 3B12A 1XK6A 3ANSA 1U2ZA 4MRNA 4MKHA 1A98A 1GPBA 3FDXA 3G7UA 2CB9A 5AHKA 5IK2A 3K92A 3MRTA 3O5AA 5EVJA 4N76A 3JARA 1FZTA 1EUZA 4KGDA 5HRCA 2GPYA 4HDQB 1KO4A 3IR6A 1YQGA 4RH1A 2R4TA 1RWOA 1I33A 2PH3A 2HU7A 3AI2A 1S8NA 4Q37A 1KAEA 3H1AA 3DO6A 4AJEA 2RAFA 3JASB 4WY2A 4DCOA 4I14A 5B5SA 1MG5A 1SXGA 4IP0A 1FK8A 2NVWA 1TO1E 2O3TA 2PZFA 3PKIA 4GXQA 4J03A 1E9SA 2CVZA 1VHWA 5JD6A 1N0UA 1O6ZA 3WXBA 4XTCS 2AG5A 4Q12A 1H1DA 3S9NA 2W8ZA 1IULA 3LQFA 2C4NA 1DC8A 2LE0A 4H60A 1QGOA 4B1FA 4DMGA 3MJEA 4E32A 1QV9A 4RVUA 4DBLC 3LQ4A 1L5OA 1XTUA 1UXJA 3Q8KA 4ZOEA 3JQDA 1ZHOA 3LY8A 1HOXA 4C6HA 1VMEA 3K9CA 3QX3A 1HR0B 1ADCA 2H1OA 3NHMA 4GAEA 4DLAA 3KDPA 4LY0A 2PO7A 3FYSA 7MDHA 1XZPA 1DCTA 3FPGA 3L7CA 4UU1A 1JL3A 2HPHA 1YJCA 5TPWB 4BQQA 2WINI 4G5OA 4K8RB 5IEJA 1J23A 2HIGA 2XKKA 1XTTA 4DUZB 4R6WA 4YP1A 3FKSD 3RG2A 1U6KA 3SAJA 5JNRA 2BISA 3UGJA 3ERCA 4C8FA 5F77A 1EK2A 1U28A 4ZWNA 1ZMBA 2Q3MA 1A5ZA 2DP4E 3G7NA 3PNSA 1L5LA 4O6VA 1RLJA 4NOMA 4YT5A 3JAKB 3MILA 2XLBA 4OO3A 4JI3B 3W6OA 5A04A 1N0WA 2W4MA 4A0GA 5BWOA 1GNPA 3C3MA 3GUZA 3DKVA 2GUWA 3E2MA 1N4AA 4CMHA 2Y0DA 4DQKA 1N2EA 2FRDC 4YJGA 4D0RA 3RKRA 1H8HA 2HUNA 2IU3A 4LXQA 2TSYB 3KYDA 1KKLA 4RESA 1Z7WA 2F8TA 1Z6PA 3N8KA 3OUUA 4YN3A 4GOND 3X1KA 4WBXC 3RHSA 3WRVA 4LOKA 3F1KA 2IS4A 1G5HA 4AY6A 1UBUS 3N74A 4XUGB 4ER3A 4WRRA 5FL7A 5DT9A 5DH9A 3ZZNA 2Q9AA 5IT0A 1W35A 4QRHA 1ZHFA 3LNTA 4G8JA 5EHNA 3MQ2A 1JW9B 4E2XA 1SH7A 3WKDA 4NU5A 1LWOA 5M34A 4H1TA 1QPBA 1EBFA 1FQWA 2EFEB 4UUNA 5FLEX 2C9CA 3SMQA 2AFHB 4YWHA 3PHJA 1Y8QB 2XX3A 4RETA 1MA3A 5P8WA 5IJZA 4B3CA 2Q6LA 3NBMA 4GLOA 3UXYA 1DEXA 2VT2A 3CNLA 1WBBA 3FNFA 3NS7A 1CT9A 3CLRC 3VKVA 1WV1A 1T3TA 3AJRA 5LZ7A 2I3BA 4LXXA 1CIJA 1I4LD 1XCMA 1OH6A 1UMDB 5KS2A 2C03A 1VLZA 3LE8A 2JEZA 1XRQA 4JNCA 4BBAA 2VRCD 1D4OA 4N5IX 2EZAA 1C30B 2JGMA 2PZMA 1DG3A 2VYVD 1NN1A 2O8BA 3RVSA 2BVNA 4DR5B 1X9HA 1X80A 1UQUA 3IUYA 2QE7D 4MEBA 2ZUFA 1CV2A 3K73O 1FQOA 2YH2A 4IF6A 3VO1A 3OT5A 1OJ7A 2ICAA 4ZDWA 1JEYB 1RT9A 3R0IA 2RJOA 4RJJA 3U17A 5EWJA 2BGJA 1R4NA 2CJPA 3LLSA 4QQFA 2ZBPA 8ABPA 4CKWB 5KC9A 4ZYLA 4BVFA 1C8LA 2AOWA 1QH0A 1U94A 4R9VA 3CUYA 5KTPA 1JN0A 4M0KA 4JVLA 5IM4A 3HO1A 1JJFA 1K3UB 4E5VA 4XUEA 2WF7A 3LC1O 4H27A 3CT4A 3I04A 4XJTA 3BCRA 3RRFA 3GVHA 3J81k 1WZ2A 3UBTA 2ZROA 5G0UA 1AXEA 4Z1MA 5TR9A 4DC1A 3HXPA 3VSAA 4NBUA 4FYHA 2YWDA 3JQ9A 2CB0A 4Q02A 5SY4A 3PNBA 2Y71A 5CB4F 3ZWKA 3SHQA 2D5LA 4WADA 1FP7A 1U2SA 1WCYA 4ND4A 1W5AA 5KYVA 1I01A 3QELA 4UU0A 4E07A 1U8CB 4IHJF 1SU7A 3X2EA 3ZZUA 2VSNA 2H5IA 3A6KA 4JB8A 3INGA 5CG2A 5JYCA 2VIIA 3D6MA 1YMQA 2DHRA 3QYAA 4H1WA 3SJXA 4ILKA 3QIVA 1XMVA 1ZSYA 4FDAA 1OIXA 2H31A 3V4SA 1P7WA 4L5JA 3A1FA 4JVNA 1TTTA 2BY4A 4WXPA 2GPTA 3NBFA 1QMPA 4H3HB 2VT7A 5EJAA 1E9EA 3TIXB 5D3MA 5CDHA 1CUZA 5JD4A 4YO7A 1GL3A 1MRSA 4Q39A 4DLKA 4OIMA 4B79A 1IQUA 2GB4A 1N2JA 1M1YE 3M6UA 3DJYA 2NQ8A 3RS0A 4XJVA 1LK5A 1SNYA 3RFFA 1GV0A 2J32A 2QRPA 1WB6A 2I1LA 2G83A 4GBGA 4NESA 3U4AA 4AF8A 2GZ2A 5D3ZA 3HDTA 5DGHA 1PR6A 1YRWA 1ZYUA 4RD3A 1O4WA 4JJGA 3LVFO 1XL0A 1E6CA 1UZMA 4LNUB 3L8FA 2P2CA 4QBFA 2EEPA 3V7UA 3DZIA 1V1RB 2VJLA 3OTQA 5ALVA 4XWKA 3Q88A 1AUXA 2WTNA 1WQ4A 2V7QA 3IQEA 4OB6A 4EMUA 1KZGB 1OB2A 1KKUA 1VRWA 1TC2A 4DCJA 4D9IA 1UR5A 4Q7EA 2FP3A 3S1AB 4LJ9A 3MA0A 4ALIA 2ZYGA 5ILOA 1G3IA 1BXRB 4FW8A 2OAP1 4DEYA 4OI2A 3AMVA 4O63O 3RHFA 3FDIA 5U1PA 5JHGB 1H2RS 4F5WA 3VH3A 1EZAA 3EZEA 4U8HA 1R9JA 4TMXA 2WLTA 4L85A 3LAWA 5LQDA 3ETEA 4ZHQB 2NLOA 3RRMA 5L8VA 3UG7A 2ZBFA 3AWIA 5ITZA 4OQPA 3RDPA 5TEWA 4F71A 1DRJA 1RYZA 2FLWA 4PGMA 1BH6A 1HTWA 1QRDA 1RYMA 5JJKA 2OCYC 4YROA 4CCAA 1DPGA 2HADA 1E1RA 1WU7A 1TT5B 3LPAA 4Y9TA 3DB1A 3NO4A 3WZLA 2QVGA 5LOVF 1R0YA 2QVZX 5BNZA 4C7VA 1G64A 1M73E 3AP1A 2NAPA 2NO6A 1W0JA 3UJPA 1H2WA 2VTBA 2Z5VA 2C9MA 2O8EA 3TIIA 1P2DA 4GSYA 2ROQA 4FPXA 5FOTA 5EFZA 1T5LA 2GM3A 2K7FA 1K89A 1KC3A 5IAEA 3DO8A 4ZEWA 2WWXA 2OXEA 2XUQA 3ZWYA 5TC4A 4UFPA 2O1SA 4MWOA 4ARAA 1UBHS 4B6EA 5EKDA 5LL6P 1QANA 1XP8A 3C5HA 4W9NA 2EF1A 1U3GA 2I66A 2YV2A 5E7JA 4Q9IA 3ROTA 1OZ0A 4CMKA 5EHQA 4P2GA 2A58A 3WLRA 3CG0A 3F98A 2QW8A 3C6YA 5DI9A 3PXEA 1QONA 3PUZA 2XB2A 5IN4A 1NVTA 1RWVA 3EZ6A 4PSKA 1W7AA 2I2FA 1KH2A 1JPJA 4LJ8A 2JIZA 4L8GA 4XYEA 3A6PC 2O48X 2F1RA 2WAMA 3BL8A 4NG4A 1KO1A 2DWCA 1YJBA 1KA9H 1Q22A 4JDUA 3HZOA 1YOBA 4LJYA 4WKOA 3E1SA 5J2TF 4G26A 1IDN1 2HK7A 4ND1A 1I3LA 2AEFA 4MWBA 1ZH2A 4OGKA 2UVPB 3G9ZA 3VVBA 2OG1A 5LB2A 3WTCA 2I5PO 3QLJA 3SS7X 4JENA 3TIGA 1BROA 2OV3A 3MWEA 2GMWA 4GBJA 4KFSA 3G2QA 3IIKA 4PO3X 1UM8A 1G1MA 2NZVG 4E5NA 3WGIA 1FP4B 3BF7A 3ICCA 1E3IA 1ZGCA 2WKSA 4M1SA 3USCS 2GR9A 2UUBB 1LW7A 1OTYA 2XT0A 1JQLB 1P80A 2R65A 4MGYR 4UXJA 2MIIA 1HT1E 2X0FA 3NT5A 1OAAA 1D2EA 4YI5A 3OETA 2F4VB 5I9MA 4MCJA 2QMZA 2BFDB 3HU5A 1Z63A 2Q2NA 4QQNA 1VBNA 2O2JA 5K0TA 1DVRA 1JWBB 4QHYA 3HYNA 4P3XA 3ZDRA 1Q0HA 3AHGA 3NLLA 4GS5A 3TE7A 3IMFA 3CUWA 4AY2A 2LDXA 1OBOA 3B89A 2JFGA 3VDMA 2G6TA 3Q4GA 3MS4A 2QTFA 1G55A 1KRWA 2EFJA 1D1QA 3KJEA 1VXOA 4RXMA 4TXMA 1V48A 4YB8A 3SIPA 3TRDA 1T8PA 3VZSA 4D3SA 1XA0A 1O0CA 4MPPA 1IN8A 4HB2A 2NU6B 1XHFA 2ZIAA 3B1FA 4AX8A 5J5VA 1ADYA 2ZYRA 2KE5A 2E55A 1PU2A 3HBAA 5JH7F 3MMZA 5JWHA 3UGTA 2IELA 3KAPA 3PTLA 4DG8A 1CUFA 2YXLA 4EB8A 2ORVA 1G21A 1DUSA 2KBEA 3S8YA 2XTNA 2NXNA 1NBMD 2A5YB 1RKBA 2EERA 1XV5A 2H2WA 3FWYA 5EQDA 1E3QA 3U3ZA 1XMQB 3KELA 3VTKA 3CIOA 4NCAA 3R7DA 4D0GA 1R0BA 2EQAA 3KWLA 4UNQA 3DUFB 5EJ2A 4J4TA 4YI3A 1X7HA 4TRNA 3U9LA 4JUAA 2AQHA 2QLLA 2EKZA 4NU8X 3RFCA 3VR6H 3FPAA 4QBKA 4FMDF 4ZU1X 5IBQA 1UK8A 2PUAA 1DS6A 2PUGA 4R7TA 421PA 3VYTB 4GD3Q 3FYUA 4G09A 1JTFA 4OSEA 4LTDA 1MENA 4U2FA 4OMEA 1MDBA 1Y7IA 2C7QA 3DEYX 2C7PA 2XMZA 2QU8A 2ZRKA 3ECAA 1J7KA 4W8HA 3SHWA 3VKFA 5F23A 4BVJA 3EULA 3I09A 3EPLA 1U4SA 2AMLA 1NAIA 3C8MA 4OI4A 4EHFA 4PBSA 4B34A 1UJ4A 1I2ZA 3GCDA 3GVPA 2NU9B 2ZT7A 2H00A 3QNWA 1M5RA 1Z2OX 1HOTA 1UOQA 2P90A 3T06B 5JQGF 3CX6A 4EKEA 2QV0A 4D4KA 3WHPA 1NYRA 1KEPA 3SDZA 4P3OA 1JPVA 3N86A 2WIKA 4E15A 1L1RA 4C6SA 3NHZA 4KIGA 2QRUA 4XDHA 5A3QA 3HJFA 1NL3A 1OBVA 2EJCA 4ND7A 3SDSA 5IT4A 2PUCA 1QLHA 1UT8A 5DGDA 4C04A 3LLVA 5JRZA 1J2UA 2WYOA 2AXQA 1U1CA 3U3XA 3ZCQA 1TADA 3LUPA 3T38A 2O9JA 2RBGA 2B7CA 4OKIA 2AE2A 2GXAA 2VCEA 5BW4A 4LDRA 2IXEA 2QM0A 2BGIA 1AXRA 3E8MA 4RFVA 2AUTA 3NNDA 4G4SO 3HVRA 1N2CA 2H4YA 4WLUA 4N0QA 4WD3A 3ICPA 1LH0A 3H9CA 3JQGB 1DBQA 5AVYA 4KQCA 4EPXA 3Q41A 3LWZA 3RM3A 2FM4A 4RQBA 2G1UA 2GHTA 4X24A 2CUTA 3PCTA 3AEQA 3QXHA 4EOGA 1Q3HA 3SYLA 4J0NA 1OTXA 4CW7A 1TQ8A 4N6GA 4OATA 1Z5VA 5CIYA 1NNEA 3M34A 3KQHA 1IOVA 1GAWA 1ZUNB 2ILVA 2VPXA 3B82A 2VWHA 2QNIA 4NP6A 4NS4A 3QITA 3T1VA 2OB2A 4DQ0A 1FDVA 3LFUA 2BM9A 4DC0A 3GDWA 5LD2C 2EL9A 3EEIA 2ZSHA 4U3JB 1U6IA 2A3NA 3TQQA 4YYEA 1VBHA 2BJVA 2PBLA 3NONA 4G07A 5KTKA 1RAFA 3O90A 3HACA 3CX3A 4FX2A 5KYUB 2ZTVA 1GQ2A 2VJPA 3KX2A 4NNOA 4NR0A 4P80A 4EVSA 1C0LA 4AG3A 3RRXA 3SXUB 1T34A 4A2PA 3CNNA 1CQZA 2DRIA 2E37A 4W99A 5C8YF 4CIDA 1VHLA 4KSBA 5EMNA 5TGDA 1V8DA 5DNYB 2R60A 1IMJA 3U0VA 1A72A 2C7BA 3FMIA 1XRJA 3HNRA 3FEEA 3EJWA 2ZJYA 4Q03A 2JLWA 3U2QA 4X7RA 3FPCA 5FP0A 4EA8A 3G2LA 2H5JA 1EG2A 1NU8A 3W79A 2ZYUX 3HV0A 3N5CA 4EQ6B 2W2QA 1UJ6A 4NCKA 2H3HA 3U61B 1WULS 4XYBA 1NVBA 4FYIA 2GAFA 2HF7A 4J1TC 4PCVA 1GZ3A 3LKBA 3RIHA 3EQ9A 3GJSA 3WGTA 2QYSA 1E2UA 5HIIA 1GPAA 1CZLA 3D6HA 3TR0A 3S81A 1VHJA 1HURA 1A9XA 3LH5A 2PWPA 4WNAB 1MXHA 1X8KA 4D8TA 3RS8A 5KNDH 3LZ6A 5D2CA 2O8CB 3UMRA 2I6TA 1E1QD 1GKLA 3BHJA 3PUIA 1QGDA 1YCDA 2ABWA 4TTVA 1W73A 4FD3A 1BE0A 3SFVA 4IEFB 2WHXA 3FX2A 5TS3A 4F38A 1IBRA 3THRA 1UK7A 2WUVA 4OJTA 2XNCA 3UKOA 5IKMA 4F1WA 4HGQA 3LKZA 4D46A 5ALQA 2G5GX 2GDZA 3AY6A 1D2AA 1EWKA 3K5IA 3PUKA 4BZZA 2RGCA 2VK8A 3ZWOA 3DL4A 5TE9A 4X61A 5E6UB 2J3LA 4ZAZA 2C20A 3DOIA 3EMKA 3I9JA 3QVUA 4M9XA 4WZBA 2ZDGA 1N2IA 2J5KA 2ZG6A 3ISJA 5DX8A 3RB8A 3TB6A 3ZE7A 3WK7A 3L01A 3QU4A 4XGIA 4C78A 3EIXA 2PCNA 1YR3A 2XNKA 4J0IA 3GD7A 3C5EA 4R2MA 4RLQA 5GGXA 1B6GA 2J7PD 1TLFA 3ITEA 1JU4A 3KTAA 1KEZA 2GAIA 2C5SA 2JI6A 2QMEA 2VI5A 1RWQA 2HCTA 1OIVA 2VTKA 3OM1A 2UDPA 1B0AA 1LDMA 4KE7A 4TV8A 1ZK0A 2Q5IA 2R6AA 4ACAA 5HJ5A 3FZGA 4CBVA 1KE2A 2ZVPX 4ZI2A 4I1PA 3BMCA 1JG1A 2J5XA 2JAHA 4K9KA 5BOSB 1N34B 2ZATA 2Z57A 2CF5A 1SM4A 1WCWA 4PHCA 1L4LA 4Z4FA 3RSQA 1KVUA 4TKVB 4CIBA 3MJ4A 4BO6A 1JYFA 2ZQYA 2IHZA 3A37A 4BXOB 1V3TA 3UWPA 4AZWA 2VKTA 1J25A 1UM9A 1VSUA 4MVJM 2RB5A 3CF4A 2O8FB 1DIAA 5J4KA 3DGFC 2VJAA 3I23A 1Z2AA 1T43A 3OO1A 3P9SA 3MRSA 2BFBA 1TCAA 2IYVA 2WJZB 5L6MB 3MJDA 3KHTA 4LF7B 3KCQA 1GU0A 4MITA 4Z5XA 1JR6A 2WVAA 3WMXA 1Y5RA 5KUTA 3IBCA 1SUBA 1XDGA 3D4NA 2PR2A 3HKBA 3ACBA 4P22A 3O2SB 1ZH4A 3KFXA 4BGUA 3SJAA 1TVKB 3BMOA 1YZUA 2IF2A 1Q14A 3EXHA 2FPPA 2WJAA 1PGPA 5ERXA 3LTNC 1XDBA 3PGA1 2YNMC 4L28A 2HZBA 4YXWD 1E2KA 1SPBS 4GP9A 2AZTA 3PXXA 3HY6A 4M0LA 1Z38A 1SG6A 4BTLA 1AB5A 1C3OA 2YYSA 2ECKA 3D7SA 4E3ZA 2YFKA 1FDSA 3HXLA 4LQCA 4E51A 4ZAGA 4EB6B 3DP7A 4R8SA 4GFDA 3M4JA 1JT2A 2BZ1A 2I6QA 4CEIA 2FSVC 4FD2A 4DGSA 1E61A 1YFJA 2HLDD 2R8ZA 1UFVA 3GAFA 1QAMA 1P1KA 3M4NA 5AHRA 5E6SB 1KWGA 3HHPA 5ER6A 4M83A 3HHEA 1G6KA 3LGAA 2ALJA 4E2ZA 3K7EA 3Q10A 4ZOQI 4JLOA 1ZI8A 4NGNA 3TLKA 5I7OA 4RHXA 3SN6A 2VC2B 3S4YA 4D6XA 4AKGA 2ZI6A 2PGXA 3ZHUA 2B7LA 2A94A 4UPVA 4X6LA 5HVNA 4JP8A 4FQ7A 4QBGB 3FVTA 5LUBA 2R66A 2XE7A 2ZT5A 1G8HA 1N3IA 1PKXA 3COZA 4UTXA 4A23A 1YCHA 1JUDA 4X1YA 2Q6VA 4MIEA 1KMNA 5J59A 1ESNA 4YJ3B 1C1XB 1IZYA 1PAUA 4LNAA 1GNLA 1KC7A 4J29A 4MA0A 1UWVA 5IJAA 1W25A 4W1PA 2E5FA 2QJOA 2P6PA 2PBZA 2A2ZA 1FPMA 3Q7IA 3HEMA 3KQQA 1YTLA 3PRYA 2PMDA 2B7BA 4MROA 1FQKA 2FCRA 4A91A 4DT1A 1DLJA 4RD2A 4XD7D 1GZSA 1KYWA 2GCOB 1JGTA 3ZDEA 3WMEA 3VA7A 4I9HA 3FTPA 3KOZA 1TK3A 2XUFA 3MWDB 4MAFA 2Q5JA 1XRMA 4PR3A 4U63A 4HCJA 2HO5A 1PFGA 2CC2A 4R2KA 1F1JA 4UE6A 5CX1B 4E5YA 4AUEA 2CMKA 1EJBA 1RJ9B 1QRUA 4Q4LA 4KXNA 1DAIA 4ZDKA 4UHCA 2RGEA 3FSRA 1FYWA 4EABA 3WVNA 4KR7A 5JI3E 1I3OA 3RAPR 1PJRA 4E3WA 3PEWA 2V6FA 2PTGA 1N25A 4GYWA 1DIRA 2OESA 4FE3A 1NT2A 2DFTA 2PLNA 4HNTA 1N8NA 3PVCA 3T0TA 2Q29A 3FWNA 1N7IA 3IE0A 1V35A 2IHYA 2Z04A 3IP6A 1P29A 2QQFA 4TM8A 2O3UA 2OQRA 1Y9ZA 4UBJA 4I1YA 4FU0A 5CXXA 2JW5A 1Z16A 2PX4A 3RT9A 1O95C 1WV0A 2HHCA 5GY7A 2CHFA 3FSGD 1V3UA 4G2TA 2JH3A 1OROA 1N6LA 4H4CA 3NC1C 1V7PC 2CK3A 1U0RA 4G5GA 4AYXA 3GDOA 4BATA 2ZI3A 1NX6A 4RHTA 5KTSA 2AXEA 4EYQA 1F8UA 4GR9A 4YMLA 1AKUA 3D8SA 1K2WA 3GHHA 3QBJA 5BSEA 1Q95A 4RNDB 5EZYB 2WU0A 3ELDA 4L8LA 1XDWA 1E0SA 1GUYA 2BE7A 2C5QA 1Y1LA 4HGOA 3CU5A 2OYRA 5FI3A 3T4EA 2DFVA 1EE1A 1KEVA 4LIPD 2GCGA 3DWFA 2CEAA 4A8JA 5ADWA 2JLQA 5AW3A 4YCLA 2B78A 1FXWF 4PAQA 1BCSB 5DP2A 4GRDA 3DOFA 3QNMA 5FV7A 1SU8A 1LBSA 3I9KA 1GTZA 1HK7A 3OP4A 1L7PA 5E9AA 4M1MA 4DCTA 4K2HA 1RCUA 1T2VA 2Q6IA 2Y92A 3Q72A 2Q9UA 4BQFA 3VR6A 1DFGA 1EZBA 5JYDA 1YKGA 4LDNA 3SCZA 2RD2A 1E4EA 5EJ7A 5FH9A 4W5HA 2ET6A 4O4LB 4LSGA 4G0ZA 1NP6A 2YY6A 1Z6AA 2ZIZA 1XDZA 4H08A 2OP1A 3IHKA 3D7GA 2C88A 4S0ZA 3WLLA 4FFMA 2GPJA 1J00A 4NJOA 2WJJA 4I4TF 4MW0A 2YC4C 4UM8B 4UPEA 1Y6QA 4PU0A 2F1JA 1NLUA 4RL4A 4BBPA 1YK0A 3ZBTA 2VYND 5TF0A 1NXWA 2WFAA 4MDFA 1OY1A 1MHTA 3KJFA 4HV4A 2VSFA 4PLFA 5F51A 5FUVA 4YGYA 3AR4A 1EZ1A 2XVAA 2ZVQX 2DEUA 3PL5A 2OT3B 4EUNA 4R6XA 4JI6B 3DXFA 4TWZA 3DC2A 4R16A 1SULA 4U02A 3ZDDA 4P4EA 1ACMA 4L3VA 2RGNC 3IV9A 3U7QA 1QMGA 1RAHA 2BFFA 3AI3A 3P32A 3OKFA 1U9CA 5J1TB 1VRCA 3QE2A 4M0DA 3KSDO 3GLTA 4BN0A 3I6BA 4CM8B 4EY5A 1X0XA 5JXHA 1DC7A 2QTCA 4RK1A 2XW6A 3S2ZA 5EINA 4IDQA 4DB4A 1NMEA 1QF6A 13PKA 4G86A 4IMPA 2V3WA 3LZDA 3C98A 4M0FA 4AQDA 1X1CA 3PHBE 4F04A 3TTTA 4ZHQF 2ZR7A 4R41A 2QT9A 2WC1A 1CY8A 2ECFA 2G8NA 4H0FA 5EE3A 3D4BA 3T15A 1LRLA 2XSZA 4K3UA 2GS9A 3H86A 1PLKA 3HDQA 3K2QA 3MTDA 1YB7A 2QXTA 3B85A 4M8DA 1N7HA 3IP3A 4TJVA 2JC3A 4UVHA 5TQJA 2OO5A 1KQ3A 2VVTA 3H5LA 4R1LA 1N33B 1O94C 2ZYSA 2IUYA 1P7YA 4FLEA 5AKYA 1XNQB 1INLA 4HR7A 3H9EO 2C6PA 1SOUA 1DUVG 2PYDA 3BQMB 2QUIA 4JEHA 2CCJA 2QBYA 1M2OB 2HWWA 3PSHA 2DPYA 4WOBA 3VYSB 1YZKA 4EZEA 1ZUD1 2D2IA 2B5OA 2X2PA 2ZAIA 3B1KA 4E5PA 3FZYA 5A4JA 5H9WA 2HBYA 4DPMA 1CUJA 3JCZA 1NW4A 2SKCA 1BHJA 1SD2A 2QA5A 3RVPA 3LPMA 3QLVC 5LP6C 2ZIVB 5HKBA 1WXFA 2PKWA 3VHRA 5CJ2A 4YYZA 1XL1A 1Z8NA 1Y4SA 2AS0A 4TTQA 4D6PA 2JJ1D 5FA8A 1TIPA 1Z4MA 1G8YA 4G9EA 5EIWA 3X2SA 3ZY5A 2A4KA 2GP4A 3ENNA 3DHWC 4N7BA 2WF6A 4OC4A 4TWJA 1RE0A 2BLLA 5CEFA 5GADl 1A5SB 1GRVA 2RH8A 2ZRIA 4QYIA 4B8YA 2XF8A 4TMKA 1M6VB 2FXVA 4PSAA 2QD1A 1X9GA 4ZVMA 5IU6A 5JS7A 2WAYA 2V0CA 2GM9A 3E03A 4YDSA 3ZXYA 5KVCA 1MAWA 1QK4A 3LDFA 4LI3X 2P9FA 3FLAA 3HCFA 1U5BB 3LOPA 2YWFA 3UH1A 4HVCA 5EP1A 5ER9A 4O2AB 1R61A 1CS0B 4J0DA 2EK8A 2OBLA 5E3IA 4P3PA 1YDWA 4QEDA 5BMVA 3RV4A 4BUZA 2JFQA 1ZC4A 4UATA 3KV3O 4NLLA 3WOVA 4ZC8A 4GBMA 5ECGC 5IMSA 4DDTA 2C9ZA 2BEVB 4JY7A 4F85A 5I7UA 3EYAA 3GN2A 3VH2A 1YXMA 1A9YA 1DDIA 2OC4A 5E2AA 4M87A 3GLVA 2QPAA 1MOQA 2H29A 1H4VB 2XH8A 2ZB3A 5JCOC 3OQIB 1NBHA 4KPUA 4G56A 1L5RA 1N8SA 3DO5A 1Z73A 3FBWA 4KB5A 3WLJA 2D7DA 1RFLA 2JGRA 3RNLA 3FMOB 4WHMA 3BXOA 1N5IA 2AF3C 4F7DA 1NBME 5GGYA 4XKJA 1D2GA 2NNLD 3R3XA 1EDOA 3C8OA 1WZIA 4XWGA 1FTYA 4WWHA 2CHEA 4MUBA 3ROXA 3QPCA 1XTIA 1SCDA 2JHGA 1E9BA 2C5HA 2CNBA 2QY6A 4IOMA 1L4MA 1WKVA 3GR6A 1TGVA 1Y5IA 4LCEA 4MW4A 3SS9X 1GPWB 4WVLA 1VJGA 4C7JA 4YMUA 2I4TA 2W6ZA 4J3JA 4QYWA 4J16C 4NV1A 3BC1A 3H87A 4U2EA 4DLBA 1PG5A 2WVJA 4CDKA 4HEHA 3FFAA 4BV2A 5JBIA 4ZXPA 1W581 1VG9B 3D0OA 2V65A 1Q57A 2C2KA 3LX5A 3PNQA 4L1KA 3K2IA 3SC6A 2GGSA 1UPBA 4KTVE 1SZPA 5LZ2A 2IFTA 2WHYA 4Q1AA 1Z06A 3FF3A 5CJJA 3GJTA 2I6XA 4TPKA 1USKA 5AT1A 4MI6A 3LGSA 4Z51A 1IG0A 1EM8A 1VFNA 3K0FA 3PRKE 1GDDA 3I4LA 2Y67A 2HPZA 1JHOA 4TKMA 3K6SB 3NASA 1IZZA 2CJWB 2HMWA 4DCVA 1ESZA 1VIYA 1BZYA 1RWBA 1XRLA 1CDOA 2NVOA 2V55B 3A1VA 5FTJA 2BTQB 1J2EA 1Z13A 3MWJA 2OFXA 4CNBA 4CQLA 2CL5A 3P20A 4DN6A 4R2XA 5ISMA 3GQBA 4IY1A 4CTMA 5C8VA 4MRPA 3KSBC 3OIUA 2RGRA 4FMPA 5EESA 5JPDA 4WGFA 1P0IA 3VUFA 4V24A 1ZCZA 2NXCA 2FMHA 4WCFB 2GNPA 4LF5B 3RTDA 3QXGA 1C4XA 2XYQA 5LP1A 1DQSA 1PBNA 2GTPA 2ZPAA 3ZWWA 4A16A 1AH2A 1A1SA 3GYBA 2B5VA 1GT91 1UOEA 2QDKA 3TCKA 3R0XA 5BR1A 2VTVA 1HL7A 4XEHA 5IAAA 1XZLA 2OK8A 3R3UA 2HF8A 1N6IA 1PKEA 4HX5A 3AG6A 1CUDA 4EVRA 3I6MA 4Q3LA 2I80A 4ZT5A 3H7AA 4ZVOA 1S5PA 5LDGA 4HUTA 2QM7A 4C1NA 4ESVA 3IQWA 3ANNA 1M0WA 1OWLA 2VEDA 3LVRE 4LV8B 3TXAA 1KFJB 1KBOA 1HY3A 4J1TA 4AY4A 4MUGA 3NV9A 2VSQA 4B8WA 1T9BA 3IUNA 4FFBA 5FPPA 1DJQA 1P2GA 1Q3KA 3ITNA 3L6BA 3GLRA 4JYZA 1U3VA 5HIMA 1WWKA 1Y4DE 3MOGA 4GX0A 2D2EA 5AI9A 3HNPA 3IUJA 2B8TA 3OE4A 4V3CA 3O8OA 3UN1A 4BX8A 1H2HA 1O4VA 2XCQA 3GELA 4IICA 5DMXA 3B78A 4S24A 1B6SA 2COEA 3HFRA 1S6YA 4WSOA 4XIGS 2AWOA 3GUVA 4C2TA 2AJTA 3DEJA 4YAIA 4QGHA 2YJ3A 4TVOA 1P7VA 4YPFA 5BVGA 4AD8A 3H8WA 1CBUA 3E7DA 2Q6KA 2CXTA 4UZSA 1UP6A 5H68A 3WOHA 3KSUA 2IV2X 5JDIC 4JH0A 4P84A 621PA 2AHOA 4FQ5A 1L5NA 3K70D 1K8XB 1THMA 2WWIA 3GARA 1G0OA 3F9RA 3IIIA 4IDOA 4ARVA 2BUBA 1XVIA 1KYTA 3TRFA 4C7MA 3AVPA 3W8NA 2OOTA 2HA2A 1P5HA 1E5DA 4E2YA 1CRWG 2H2AA 3JVDA 1ONBA 3GFPA 4GWGA 4MS4B 4HDSB 4XWAA 2CXOA 2PMKA 1PR3A 3H5IA 3R4VA 2UZ1B 3BXFA 3KUUA 2VO1A 4KE8A 4V39A 4YLEA 5DW0A 1BFKA 3IE1A 5K3CA 3EWAA 1JFFA 1T5SA 4E14A 3NT4A 3UB2A 4YT8A 3FD8A 3WL3A 2GVZC 3RVLA 3ZDYB 3A4LA 2ILTA 2J8ZA 3FWKA 4E70A 2VLBA 4UUQA 5GONA 3GCZA 1CHNA 2PKRA 5H1YA 4G23A 3KZNA 4Z0PA 5CYGA 4GPIB 1E89A 3G89A 3NNSA 1KYQA 2X9VA 3LDHA 4FWIB 3ZX4A 3W2TA 4ZVSA 4RA9B 2QQ5A 1M1YA 2RH9B 3M6IA 5FWYA 2B0AA 3UMGA 1AKTA 3IRUA 1J0AA 3T9FA 3GJQA 1E3DA 1TKBA 1LBEA 1UKBA 1YQTA 4GECA 4U1RA 1F2UB 3E82A 3HCCA 3I74A 1E4OA 3PXAA 5CBPB 2W90A 2PUJA 4A9AA 3JS5A 4AJ1A 5DEOA 5CFRA 3GY0A 1RZ3A 2YMPA 5BWNA 3HRKA 4UCXA 3SZLA 5F98A 2OM6A 1EWYA 1Q1QA 4R69A 1Y6RA 3CCBA 3NPAA 4Q6BA 4XVUA 2EW8A 1CUIA 1MAVA 2ZBDA 4O29A 1DC3A 1TRKA 3CH4B 2IKQA 4OY3A 1YTUA 1I7NA 2Y66A 2C4VA 3MTAA 4ISBA 2XBUA 3AVOA 3ETNA 2E9SA 2YNMA 1Z75A 3AHDA 5DGIA 4KVGA 3EY4A 1ZJ4A 4KN5A 3D8RA 5CEJA 10MHA 2WJHA 4KQ2A 3OM8A 2NO1A 2P2ZA 4B4UA 1FOEB 1G8PA 1KU0A 3A6DA 3B5IA 3IQIX 4GL4A 5ESDA 3ZE8A 4DNOA 3RYCA 5CA0B 1GGVA 2VHJA 4KREA 4RF5A 3RS3A 2FSVA 3M5DA 4X3OA 3D6AA 3NW9A 5FUYA 4BCCA 1KRXA 5CCXA 4F5DA 3AEUB 1Y1QA 1ZOPA 5H16A 4CCYA 4HYQA 3ESBA 3T5MA 3I3SR 1FP1D 4LJAA 5HQ3A 4G41A 5ULLA 3TUJC 4OBEA 4OYRA 3ROPA 5J4HA 3CEAA 1NQTA 1TIBA 3ZWVA 3K0CA 4RPCA 1WDTA 1X9IA 4F2GA 1UP7A 1J22A 3AJ9A 1WSAA 4TL8A 5ARCA 1MO6A 2B94A 2J9FB 4XSGA 3KQMA 4ACBA 1J42A 1L1FA 4DDMA 3PC6A 4KVZA 1VL5A 1AZSC 1O96A 1P60A 4AU1A 5DM2A 5KYXA 1CQIB 3WK4A 1SBQA 1UBFA 3CVOA 3G49A 4KYUA 4QQRA 1JQBA 4TQGA 4PAOA 3UY4A 1VLJA 1EFPB 2ZRGA 3C0KA 2XMBA 4WOJA 5AI8A 1FTGA 4Y2QA 2AD1A 2VDPB 4UHHA 2J0SA 5CT4A 2W6QA 4GKKB 4MMZB 1NI4A 3FW1A 4GT1A 1TTHA 4PVDA 4HGZA 5E38A 2C0CA 2AL7A 2GM5A 1ORTA 4QG7A 3NAQA 4RY8A 1Z8FA 2TMKA 3OPYI 2PH7A 4KX5A 2OHIA 4F3NA 5HF8A 2JAQA 4OHZA 1TMKA 1W19A 1J1UA 1UFOA 4ADSG 4ZI7F 4EQZA 1NBWA 2WJPA 2BMJA 1ZD4A 4KXXA 5FOVA 3UT0A 1VKZA 3QBEA 4QDJA 1L8OA 3EC1A 1RLIA 3KO8A 3IXLA 4MWDA 4EJ0A 1GDHA 4IVPA 1OILA 3L4SO 4LOHA 5TMBA 2DU8A 4BWGA 1RQNA 3ROMA 3VX3A 1L4BA 2F1KA 1TUIA 3D8BA 3I61A 3I32A 4Q7JB 3U4DA 4GU5A 1GKKA 4QFCA 2D3TA 1KJIA 2XUIA 5AOBA 4YCSA 1LTHR 1T8UA 4B3TB 3KLNA 4MUMA 4DSAA 1LPAB 3ZVNA 1QFYA 1G7TA 3SZRA 3F9CA 1NNSA 1NUUA 1QH9A 1FUUA 1YZQA 4M7WA 5G0WA 3IURA 1FPQA 2I2BA 5KAPA 4RTQA 2CDCA 4OQYA 4IUDS 1NVMB 3PIRA 1WMEA 2R8YA 3DV9A 3NETA 2PT5A 1DKRA 4D82A 3ZE1B 2AR7A 5IZCC 4EHJA 8OHMA 1X8LA 1SA0B 3FG9A 4FCWA 4RJ2A 4Y2HA 3HA5A 3WRXA 2ZM6B 3ZXXA 5HK9A 4C0QC 4CGYA 4OQQA 1Y0BA 2OCLA 1CJVC 3T1HB 5KQMA 2NO9A 4GNRA 1TYBE 4MJLA 4M89A 3C7TA 4RH0A 2PUTA 3S28A 1T8RA 5DKFA 4WKPA 2PSDA 1A8HA 1XCGB 2G72A 3SJFA 2I2CA 3WDSA 4FMBB 1ELOA 1S3GA 2NYVA 5F7XA 2J5RA 1G2QA 2D54A 3VO8A 4B45A 3L4KA 3BHXA 1MF7A 2B4RO 1E7MA 1ECCA 2G0NA 3D3KA 3UJDA 3ZJVA 1ZK3A 1ZBDA 4L95C 2HD4A 2CWDA 2VR1A 4IV0A 4MV1A 4RAOA 1CG6A 1NFQA 2AZMA 3GAAA 1AS2A 3LW7A 3MWLA 4LDZA 3ZK8A 3FTDA 1XZHA 4NIMA 4ZOLA 1Z4PX 4B82A 3SEAA 2O6HA 3PITA 4WESA 1NJ5A 4YRBA 1NF2A 3FUUA 5B3KA 3BJIC 2GCEA 1YACA 1T2FA 1Z22A 5CW2A 4YRLA 1XC7A 4AS1A 3ET5A 1PNQA 2EKQA 1KSJA 4IIJB 5SV2A 4X65B 4TLLB 1AHNA 2J67A 3UK2A 5MFZA 1FUYB 4FN5A 4JYBA 2RHJA 4ZVTA 1CWUA 1A82A 3AUTA 4GI1A 3ZI0A 4ZTZB 1ATZA 1RMQA 1ISRA 1D03A 2R2GA 1ONSA 2C07A 1B93A 3HGMA 3HKEB 5FFFA 4TXJA 5EUQB 4DA9A 5LIPA 4LOJA 4TWAA 4ON9A 5C31A 2Z58A 3UMSA 4MYHA 1PN3A 1Q84A 3ONFA 3THOA 4ZANA 3EVNA 5AHWA 5KVSA 2JFXA 2RGNA 1ZCJA 2HDOA 1L8LA 3KZXA 3FMGA 5ECYA 5EZYF 4FGLA 1NJ1A 1MV8A 3QJYA 4RK7A 2AQIA 2NZUG 2P3LA 3OE7D 3OFKA 3PEFA 3AY3A 3DEIA 1YA4A 4I9NA 5LYJA 2YWRA 2CFTA 4ZALA 1ZHHA 3EGXB 4MWGA 4ARBA 4EI7A 3DLHA 3KCNA 4ZVPA 1XZAA 3MJSA 3U6KA 2X6QA 3DWIA 4TXHA 5BNIA 16PKA 3UC5A 1D5WA 4KXMA 1KVSA 3MIZA 2QX8A 2ATXA 1QX4A 4FS8A 2VOJA 2EZCA 4R7ZA 3D64A 4WOCA 2PX5A 3OEYA 2FFBA 2P2YA 3GG9A 2YWJA 1JTEA 4J91A 5G4LA 3VR3A 1PEYA 3CR7A 3TOSA 1AQJA 1X7WB 4LVNA 1MEEA 7REQB 2GPAA 1C4KA 1CEYA 1VIDA 2X7JA 1GSOA 2E3JA 4KFTA 5CNIA 3JQ7B 1ZIXA 3JAWB 3OX3A 5ALGA 2VH1A 3OIWA 4QSHA 4G36A 1E2DA 5LLDA 4X8OA 3AOEC 4ZMRA 1Z0ZA 3N3BC 1IG3A 3EVEA 2REXB 4EP1A 1IQ0A 3FM9A 2JLXA 4RXTA 5BMOA 4JV5B 8LDHA 2XWJI 3A4TA 4UW9A 1EA5A 3JATA 5TJHA 1KIMA 4J4HA 5I7SA 1C41A 1MC8A 4K46A 2DIKA 3JWEA 3ZIDA 4WN9B 4B75A 1ZYMA 3PDJA 4ND3A 2EX4A 2XD9A 1CS4C 3BF8A 3CKMA 1V43A 1C29B 3G8YA 3CY6A 4BBJA 5HKKD 2WZBA 4H1VA 2GZDA 3QEAZ 1MGOA 2JKYA 5BSWA 1GP2A 4RMJA 1W36D 2QW1A 2AA3A 2FVYA 3EG5A 2GJ9A 4BE9A 2G09A 1QTQA 4KUGA 2NZ2A 1H4QA 4HMPA 1H5QA 2J46A 1GPNA 1T5BA 3V55A 4JQSA 2ODPA 1LSJA 2HYDA 4O8CA 2GLXA 2OCBA 3VZCA 3HWX1 2JLRA 2WM3A 3B38A 4YDRA 4YRIA 4G2NA 3ISVA 3EZ9A 1USGA 2HL6A 2IHBA 3JV7A 4HWRA 4IX9A 4PZCA 4U4AA 2CLIB 1JB1A 1Z17A 2V0GA 4KXVA 5H80A 3IUSA 4N4AA 3ZD8A 3L0OA 1DOHA 4X8MA 2GWRA 3ZS9A 2OQ2A 3GLFB 4FKMA 1YZLA 1JMKC 4R81A 1PJBA 4BGIA 5M2QA 3ZCXA 3HO6A 3AYZB 4FNGA 4L0CA 2G04A 3UNXA 3W1WA 4BO3A 3KUXA