4INJA

Crystal structure of the s111a mutant of member of mccf clade from listeria monocytogenes egd-e with product
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
326
structure length
326
Chain Sequence
NAMIPAKLKQGDEIRIIAPSRSIGIMADNQVEIAVNRLTDMGFKVTFGEHVAEMDCMMSSSIRSRVADIHEAFNDSSVKAILTVIGGFNSNQLLPYLDYDLISENPKILCGFADITALATAIYTQTELITYSGAHFSSFSMEKGLDYVMESFSDCLLQKEPFALKESATWSDDEWYLDQENRNFIPNEGLVVMQPGVAEGIIIGGNLCTLNLLQGTEYMPNLAGTILFIEDDFMTIPETFDRDLESLLSQPGADEIEGMVIGRFQQKTAMTAEKLAYIIETKTALQKIPVISGADFGHTQPIATFPIGGTARIDTNQTDKIQIIRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the S111A mutant of member of MccF clade from Listeria monocytogenes EGD-e with product
rcsb
source organism Listeria monocytogenes
molecule tags Hydrolase
molecule keywords Lmo1638 protein
total genus 115
structure length 326
sequence length 326
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02016 Peptidase_S66 LD-carboxypeptidase N-terminal domain
A PF17676 Peptidase_S66C LD-carboxypeptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Class I glutamine amidotransferase-like 4injA01
3.50.30.60 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 LD-carboxypeptidase A C-terminal domain-like 4injA02
1ZL0A 3TLEA 4MJXA 3TLYA 3TYXA 2AUNA 4E94A 3T5MA 3TLAA 5F5XA 3TLGA 3TLGB 2AUMA 4IIYA 3SR3A 3GJZA 4IIXA 3TLZA 4MI1A 5F1YA 3TLCA 5K99A 5F9MA 5FD8A 3G23A 3U1BA 4H1HA 5JYBA 4EYSA 4JVOA 4INJA 1ZRSA 3TLBA 4E5SA
chains in the Genus database with same CATH superfamily
4H17A 2AEEA 3ORRA 4YBRA 4XJTA 3CZAA 2BFFB 2AR0A 3BT7A 4HF7A 4YRDA 3UJBA 2HXSA 3VC1A 3TFOA 2WQ6A 3DUWA 2MSWA 2B99A 3HA2A 1OWNA 5KOYA 1GU1A 4A8JC 4DMFA 3EVNA 2IL1A 4HKTA 2CF6A 4LF9B 1TO2E 3JU3A 2H2HA 4W82A 3H1BA 4QWWA 5CJPA 5DM1A 3WE7A 2PLRA 1OF1A 5E9WA 4F5DA 3TQQA 2G4CA 3DZ8A 3H6KA 4OQPA 1PT8A 2CV2A 1KY2A 2F43A 5EIFA 1U5AA 1WCXA 3AHJA 1RQ7A 1YQUA 1D1SA 2BKAA 2IOHA 2R6ZA 4RSGA 4BFZA 4MGHA 1DKOA 3ZGVA 1K92A 3C97A 1LLUA 1RQGA 3OPVA 3EQ2A 5M7EA 1DFIA 5I3CA 2D0OB 5SZHB 2FP4B 2AOXA 3RKRA 1THZA 3RS3A 1CEYA 1S2LA 3D8RA 4FFVA 4NE7A 1E2HA 2J0EA 1ZQ1A 5BUQA 5HR5A 5AKLA 4YLYA 2V74B 2YL2A 5LQDA 2BTQB 5A0VA 3D8TA 1GZ7A 4BIIA 2H59A 1IL0A 3VVBA 3A36A 3AUFA 5JV5A 3E9YA 3UA4A 3NVMB 5AMXA 3TZKA 3QG1A 3UENA 2B1JA 4C06A 1KAOA 4Q19A 1S7GA 1V6CA 2ISCA 2BM0A 1W2GA 2YWCA 3H5AA 2XVXA 2DUWA 2OG1A 2LKDA 4MR7B 4ENWA 5AI6A 3ID6C 1VIYA 3G2NA 4MKXA 2QXYA 1BXGA 1NSTA 1XR3A 1U2ZA 2FR8C 2XXJA 3NBAA 3MBIA 4MLCA 6Q21A 1EDBA 3S7ZA 1JE0A 1TUGA 4KXUA 2QX6A 1EAYA 1ODSA 3ZV5A 1UDXA 4P7GA 3DFUA 1G1AA 4MMYB 2NTNA 3VH2A 3U3MA 3T1TA 3VTAA 3L8EA 3MJDA 5BSMA 3HLKA 4MW0A 2B9VA 2HB6A 3OESA 3WLLA 4BDTA 3LTNC 1EBUA 2O3JA 4MS1B 1UM8A 4UUNA 3ELWA 5CT9A 5EWLA 1JXAA 2R6CA 3MPUA 2QZSA 2WG2A 4RA9B 4C03A 4CMEC 2HW8A 1Q77A 3RRXA 5INTA 2PVWA 3D7DA 4C85A 4F4JA 3GLHA 4PZLA 1QYWA 4OKNA 1OQAA 1D1PA 1JQ3A 5A7FA 2W6CX 2AJTA 4MRRA 1U3VA 4HDNB 1O94C 4DNXA 4ZYTA 1J39A 3G0BA 3QK7A 3DV2A 5I9TA 1AD2A 1GYPA 1K68A 1Y98A 1L4FA 1FTGA 2XF8A 2DT5A 8ADHA 1U0GA 1EK6A 4GMFA 1NG1A 1UMKA 2LCFA 3PWZA 4MR9B 2WB4A 4PS0A 1Q11A 4HZUB 4TKMA 4TLMB 2ZAYA 3LVFO 2W43A 3BGDA 4GOJA 5HKKA 3UFXA 2GTHA 4QTTB 4KP7A 2YHBA 1ZGGA 3EMBA 2CLDX 5J2UB 1X1DA 2EWMA 3F67A 4PSCA 2IEYA 4B6OA 2C20A 3E27A 3BAFA 1Z5GA 5ICFA 4S05A 1YBVA 1IY8A 4B7CA 2ADMA 1PLJA 3OTQA 2WD9A 4BE4A 1ZN9A 4XIGS 3BRQA 3NCTA 2D3TA 4JEMA 2I3DA 1V7CA 4YDHB 3L2OB 4CL8A 1M2OB 4UNIA 5BSWA 3E9EA 2VF2A 3HJRA 4OQNA 4F4IA 3M3HA 3QNUA 1FP2A 2DWPA 4O2LA 3ZZMA 4FYVA 4H6WA 2A3RA 2DQ4A 4BWVA 3Q5DA 3W9BA 2EZTA 4B2PA 3PT5A 1JJVA 4HEHA 4DUYB 2BFAA 1Y5IA 2XE7A 3PCRB 1H93A 3RRFA 1UZLA 2C3MA 1E1LA 3U7GA 3VRHA 4A03A 1R0KA 1D5WA 4BKOA 1OXKB 4RHYA 4E30A 1EYZA 4J43A 4RO0A 2VL7A 3TLGB 1ZGJA 2R6AA 4MH0R 3WHPA 1MNQA 4QDKA 2QRVA 2FWBA 4GWLA 4ETIA 2V7EA 4HWKA 5PNTA 2X9LA 3GD7A 1FTQA 3U7QA 4TYYA 4CGZA 1CQXA 3NRCA 4ETWA 4KRXA 4ZQCB 1O6CA 5F33A 1VXOA 2PDAA 2X7HA 4MGKR 3K70C 1XAHA 1S3IA 2QK4A 1PQUA 1M6VA 1RYDA 1QG0A 4RVSA 1IHDA 3UK1A 3NNNA 4EO9A 4D79A 2HK6A 4Q4AB 3TN7A 1GGMA 4TXLA 1J9EA 1JHAA 1KQ3A 3PD0A 5FOQA 4NGSA 1BRMA 1QVWA 4GAEA 1WG8A 2G36A 1UDWA 4CW7A 3WYBA 5FX2A 1XEAA 4LKOA 2I91A 4JXKA 5ALLA 3O8BA 3PUWA 4K9NA 4XD7D 2H5LA 2YWGA 1T9KA 2O8CA 3DAYA 3GEEA 1U0RA 3NWPA 1KZHA 2BUBA 1G2PA 2IHYA 5CG1A 2A5LA 1YDFA 1D3AA 4H3KB 3RTAA 1RXSA 3WGZA 1W2HA 3CS3A 3EEFA 1WZEA 3LWDA 3ODGA 4I9FA 4PWZA 5TPZA 4EEKA 1SIUA 1Z4NA 3VUFA 4FWTA 1N78A 3NUGA 3GPIA 4MTCA 4PHFA 3KHUA 4IX1A 4RD0A 5DBFA 3ZY4A 1XPOA 4H4EA 4WZBA 2HXYA 3B6JA 1COWA 1X7YA 4H08A 4CKBA 2GPNA 4LYHA 4B81A 3KOZA 5ALUA 1Y89A 3DONA 4Y9TA 2PPLA 4G5HA 3ZZNA 4R83A 2HWXA 4QATA 1Q19A 2I6XA 3I73A 4IH9A 4IHJA 5CA1A 1L5LA 4CMAA 5C8DA 1EIWA 4F92B 4KH1A 1RWQA 2YRFA 1KH1A 2PFKA 1C4KA 1MPTA 1W5EA 1N6LA 2IDZA 3DT9A 3IKJA 5JCOC 4YDSA 3DKKA 4QUIA 3R7AA 5I9SA 3EDQA 3QTLA 4R2HA 3SIRA 3QPAA 1W49A 2GA9A 3B85A 4LIPD 2JJQA 3PWKA 3RBVA 3ZDQA 4Z3OA 3VR2A 1GPKA 4A2WA 4NXMB 2HL6A 3TRIA 1OOEA 4UHEA 3LKDA 4B6EA 4Q7EA 1CR6A 1ZJJA 4TYQA 5HBRA 3W6PA 1MH1A 2ODNA 1HF3A 3W7AA 4N8EA 3GPLA 2I4OA 2NPIA 1Z2PX 4R3UC 1JLHA 2R2AA 4A2PA 4PTLA 3NB0A 4NGQA 2Z1DA 1VBKA 4LMRA 5CTAA 3ZNNA 3HO6A 1R0SA 3PICA 4KDFA 2ZZMA 5F52A 3PUHA 3R24A 5DB4A 3GAZA 2E4AA 2QYTA 3W8NA 5GONB 2VAWA 1QOZA 1ORWA 2NQTA 2QVCA 2QRMA 2O7VA 4MYHA 5GJWC 4MCJA 3UY4A 2FWJA 2P4SA 1P2BA 3AR3A 3D8NA 4TLEA 4HNGA 4JUDX 1H2BA 3LYUA 1YH3A 2BGRA 4K28A 1PT9A 4B7AA 2DF8A 2ZB8A 2FK7A 4CEIB 4HQRA 4CDKA 5CGZA 1W6UA 4IIGA 3RK4A 4F3YA 1IQPA 3PGLA 4K9PA 1FC0A 1M6HA 4K9DA 3STXA 1JNXX 4YAKA 4CBVA 1QDLB 1NUSA 3OKCA 3S2YA 2PO5A 5IULC 3DEZA 2QMOA 3AR4A 5AXDA 5FYQA 1AKEA 1PR5A 4L8GA 1C1XB 2BWJA 2H4XA 1CPYA 5EN4A 1HK7A 1WD7A 1U0SY 4A82A 1U7XA 1AQIA 4MRMA 2ZCUA 3KSDO 4AP9A 4WUVA 1CZRA 1X7ZB 1XLTC 4Q1VA 1Z18A 1DG9A 3ELUA 3S2IA 2D1RA 3SZMA 4CMIA 2VJYA 2B1QA 4AKHA 4DJJA 7MDHA 1WUYA 1YA4A 4RFLA 1NKTA 4Q1FA 2RB5A 3EGXA 3VC3A 1GAQA 3KFXA 2HEGA 3GLSA 1VBMA 2HY7A 3OQ6A 5BN4A 1IG0A 1TQDA 2QTAA 1RHMA 3DEAA 5DHTA 3WLJA 3UAOA 4QKQA 4Z7NB 2C2WA 3PNQA 1JT2A 1XTUA 2RGBA 2HRQA 2Z5VA 3GUHA 4JODA 4P22A 5IJXA 2IV7A 4DIUA 1N5OX 1EUYA 1LJ8A 2AUTA 3PUXA 4QX6A 4QUAA 4Y6OA 3NTXA 4IV5A 4YHHB 1YI1A 1JLLB 2LUOA 2QUJA 1ADJA 3FOAA 2ZYGA 3OD1A 4GGOA 4MUKA 4V03A 5D1NA 4ZI5A 3ACBA 4NU6A 2ECFA 3W5DA 2F48A 4FSXA 3FHTA 4ON9A 2ECKA 1TMGE 2IOFA 1WO8A 2O7QA 1TYAE 2VRCD 2ZYIA 3CLKA 4HMPA 4IXTA 1OH8A 2IIPA 2H1FA 4KVAA 3UW1A 4P84A 4J4TA 2O8BB 1V9SA 1PJSA 1CF2O 3DF7A 3FCEA 3LO5A 4KXQA 1ZSVA 2AG6A 4RF3A 3W9YA 3K92A 4WLUA 1N2OA 4F3CA 2P9QA 4BQQA 2FW7A 3IUYA 2NP6A 3R6LA 1IQRA 1Y82A 2Q2QA 1QO7A 2ZBVA 3GIWA 1C1YA 3PQ3A 3ANSA 1ZI9A 4PV7A 3R75A 4YJ3F 4RULA 2ZUEA 5LL6P 2GF2A 3ODPA 1DC6A 3PX3A 1P7PA 4TJVA 1EFPB 2WSMA 1J8QA 4DNPA 5B6IA 4HQFA 5J47A 2UVPB 3GDWA 2I8LA 3AYXB 2FFQA 1B6GA 3ZTWA 1TZKA 3FCCA 3LXUX 4D9MA 3S5UA 4CIVA 1DFGA 2QDXA 4CEJB 3NMUF 1WF6A 1PQPA 1WL8A 4TXJA 4C21A 3DBRA 1V45E 3DCNA 1DOHA 3TD6A 2XRZA 3AUJB 4B44A 3WISA 2AKEA 1JKJB 1ZA2A 3FG9A 1GLNA 1N5JA 3AHFA 4Y2TA 2BGWA 5CH3A 1YOVB 3WADA 2AXPA 2PSJA 3B38A 2RCNA 2YVLA 3FDZA 3LS2A 3ZGXA 2WHQA 1M67A 1KH2A 3ZHVA 4G1UC 3ZQ4A 1UBCA 4PBTA 4DR3B 3KOMA 1DJOA 4R84A 2IPAB 4A16A 2FRXA 4AJ1A 3AXSA 4U1RA 3ABQB 3FNGA 1G7TA 4EDFA 4ZVLA 1X15A 3PQ6A 4RKQA 2G6TA 2DULA 3GEMA 4E4TA 4EMUA 5H4GA 1W6RA 2AMLA 3GZNB 1GUBA 1PR1A 3AUTA 3H5NA 4WXPA 3ROEA 2HMSA 5EJ7A 5IR2A 2X4DA 3JZAA 3G5TA 1TW3A 2V9CA 1ETHA 1MAAA 5DOVA 4M1SA 3B1ZA 2CBZA 5DNVA 2P9JA 3URMA 3ZE6A 2E0IA 3EMKA 3EAGA 2IYZA 1SUBA 3VR0A 1L6IA 5I4IA 5TE9A 2GBFA 4RVGA 3N70A 5DTJA 3RBAA 3FEEA 1CUAA 4JC4A 4FZVA 3EZLA 3TH5A 3U5ZB 5CD9A 3R40A 4L3WA 3SNKA 4NJMA 1PS0A 4PNHA 5IHPA 3SFTA 3SJXA 1H2AS 3KKZA 3MT8A 4H27A 1R0ZA 1EHYA 1O95A 4J1TC 4ND2A 2VJDA 2VHTA 4PBSA 4YWHA 5SZKB 1T6BY 4F6RA 4URVR 2HYIC 2J5BA 2QVZX 1SCNE 3MOIA 5CLFA 3BXGA 4YJGA 2ATEA 2NO9A 3NNSA 1HO3A 1HDYA 3JRNA 4O02B 1MOPA 3DVAB 4YJ2F 3WK6A 4CL0A 1GL6A 5AM0A 4BBPA 1I3MA 1QH8B 1YDEA 3VHLB 3KSAC 2QYOA 4J75A 1GGFA 1SK8A 3IBSA 1OX5A 5I47A 2XRMA 4K6GA 9GPBA 2HO5A 4ZVKA 5ALMA 2P8SA 1H0KA 3GJXC 3PB3A 2WT9A 1DL5A 3GRFA 2G71A 2C5LA 4UE6A 4W99A 3CIFA 1UWLA 4AN4A 4B3CA 5EP4A 5JT1A 1V5EA 4M1KA 1RWXA 2VO1A 4YRCA 2XMPA 3QUAA 3FNFA 3G17A 3LSYA 4Q66C 4BFYA 1AGNA 1UPXA 2XGMA 3K9WA 3NEJA 3PZBA 2PKWA 2XOKA 3EWIA 4JP5A 4PZYA 3O8RA 2P9TA 2FSHA 1RJ9B 2SNIE 1R0WA 2BJHA 4U6SA 3UANA 1JEDA 5LB2A 3LZCA 4CWAA 2NXWA 1TPYA 3TEMA 5CVVA 3OZDA 2FVXA 2Y1OA 2WWVD 2VAVA 3ZE8A 4I4TA 1JIUA 4LYFA 1K9SA 1YL5A 4TTJA 5DHPA 5G4KB 5HUJA 4KNGE 3RB8A 1FMCA 4H7FA 2ZEJA 3I1JA 2OO3A 3L6DA 1Z39A 4Y2YA 5ALVA 5FV4A 5SY4A 2V1XA 2R8RA 3JVEA 3F5MA 4OK6A 3C24A 1K97A 1FQWA 2SCUB 4Q3CA 4CT4B 3HKBA 1IHUA 1OX4B 1T9GR 4B1FA 1B1AA 2WC1A 4EY6A 3C8HA 1YA6A 3G6KA 1OCEA 2JFFA 1RLMA 4I2NA 4Y3UA 3EPHA 3UPTA 3LRXA 3AUAA 4QQFA 3WKBA 1GZSA 3HJAA 1NJ8A 2ATXA 1LTHR 1XA0A 2Q07A 3A6LA 3JQ8B 2YXBA 4KEAA 1X1SA 3S8YA 4J0FA 3TMAA 1A8IA 1EESA 1VL0A 4II3A 5AJHA 1JB9A 4DN6A 1MJHA 2W2LA 4TLAA 2W8BB 4FEAA 3VU8A 1SG0A 4ZAFA 1Y9DA 1DT5A 1Q1QA 2H4FA 2HSEA 3LBHA 4P82A 2QLMA 1H2XA 1U5BB 4CKYA 1GZ4A 1PWXA 2QG6A 4C6TB 4FZRA 5HIJA 1H4SA 3D8HA 4DLLA 1TVKA 4TSKA 3C2QA 2EYQA 3H5VA 1CTQA 2A84A 1J8MF 4KH0A 1AHHA 1WU8A 5H82A 5BT8A 1SO8A 2ORIA 3STWA 4JI8B 2OZVA 2P4QA 3V97A 4CETA 2PUDA 1P39A 1H4VB 2NOAA 3PNYA 4QASA 4XLLA 4D9JA 1B74A 4A8JB 2ZKLA 4Z7OB 4IJUA 1KO1A 3LLMA 2VZLA 4Z9YA 1WB9A 2D6FA 1K5PA 3E7PA 4ND5A 4RM3A 3PGVA 2GCOA 1W5AA 1BXZA 2W8ZA 2G9RA 2OXEA 4YAIA 4UARA 5CCEA 5FUMA 3KTDA 4HH0A 4GQBA 1V5IA 2W6IA 3T3DA 5HIMA 1KC7A 3H5OA 3CEMA 2I55A 3QSYA 4G84A 1BX0A 1Y4DE 4MITA 3JZFA 3GRUA 4HD8A 4HLUA 1UAAA 3C4JA 5ISMA 1QQ7A 3RHTA 1T1IA 2YOHA 1E3TA 4ZU1X 5A1JA 1XKXA 4QVGA 2O50A 1W4RA 1TRKA 4RQBA 1SIOA 3TPZA 2CXTA 1G6Q1 3LX6A 4LGYA 1W0JA 3RJ9A 1E58A 3A9RA 1TXGA 3SMVA 1B8VA 3U1TA 4RFSB 4BRUA 2G09A 1ML3A 2ZXEA 3P96A 4W9MC 1CVRA 1F2TA 1IN6A 4X1OA 3K31A 5EIAA 3I01A 2BBSA 2P68A 5IF9A 5FUXA 3C1TA 4WD3A 1Z6ZA 2WM2A 3A6ZA 1XXLA 4G1MB 1A5AB 1NM5C 2L82A 3DEHA 1RNLA 3N3BC 3OFJA 4INZA 4BQPA 2Y93A 4BVAA 3DAPA 3A9UA 4K0RA 5CNKA 2YTZA 4C05A 4EVIA 1G0NA 5C81A 1QAMA 4MYDA 4I4IA 2A9OA 3FLMA 1GPH1 3CZ4A 3MTBA 1RAAA 1UANA 1E59A 2PA0A 3O2NA 3P4YA 4GWKA 2P0EA 2PMWB 1WUTA 3PITA 4A9AA 3GFQA 5KDOA 1QYXA 1RI4A 3ICEA 4W1SA 2QMZA 13PKA 1PDOA 1Z7BA 5D3MA 1O03A 1ORDA 5TGDA 1X3SA 4YMUA 1ORHA 4ARSA 4KYTA 4MS4B 1F2DA 3MCTA 3O1IC 2PS1A 4IXMA 1N6OA 4OQMA 4ZT5A 3H1EA 2R9VA 5CM2Z 5FWAA 3FVQA 1NLMA 4GPD1 3CFYA 1JB1A 2W6NA 1JG7A 1I94B 1E1CB 3DDNA 2OESA 2CVQA 5FOXA 5BNFA 1DKMA 1E1DA 3G8AA 3INGA 4L07A 3Q7EA 3IIEA 4ZCSA 4F2WA 2XWPA 2P6UA 5IDYA 5C46F 3PHJA 4LVCA 1FFBA 5LP6C 3GDGA 1DP4A 2PSDA 5E1BA 5B58C 2JCGA 4IDNA 5IDWA 1MTZA 1UC4B 2FMTA 1WJGA 2VYVA 4HVTA 2C5GA 1VPDA 1P73A 3EF1A 3G82C 1R27A 3GG9A 4FFRA 4HATA 4NJEB 4RETA 4D92A 4Z4FA 1SUDA 5IPFA 2JBWA 3ZBUA 4RDIA 5BR7A 2WWRA 3G9TA 4ZMBA 4TWAA 1K8ZB 1RKBA 1JZTA 3T4PA 5AVQA 9MHTA 3WNVA 3L7KA 3VX3A 3MMNA 2OSVA 5KCMA 3HXOA 1YQXA 2QSZA 1NVDA 5K0ZA 5HIIA 3EVDA 4IHKA 3VH3A 2WJ3A 1P2VA 1YMQA 1KRXA 3C6KA 3ZJ5A 2WJYA 1RWPA 3AHDA 4MICA 1KEEB 5EGNA 2QTHA 1MJGM 1R6DA 2PZLA 3WNBA 4B4VA 5HOQA 1QRUA 1QX4A 4B8ZA 1T0JB 3KXIA 1U1DA 3MJ4A 1NDHA 1JG1A 2QL7A 4J9UE 3V00A 1XDZA 2EKPA 3TCXB 1FSFA 1LBEA 2YRXA 1DFHA 2FZKA 4NOMA 5BVHB 2JVKA 4KMOA 1C9EA 2JD2A 5JADA 1O2DA 3BF8A 4WOKA 4NJOA 1KEPA 1ZWLA 1BOFA 3IAEA 2FM4A 4K86A 2BFCB 3EZEA 1UBLS 3B3QA 3QU7A 4Q34A 4QHYA 3ONVA 1Q5PA 3GA5A 2GM3A 3NOXA 1SOUA 3WGQA 2AG5A 2RIPA 3OG9A 2ZS8A 3J80A 4JYAB 4A6XA 3V46A 4WHMA 4E4RA 3DMRA 3K6JA 1KHTA 1HSZA 4FKMA 3VVMA 5DNYB 4A8TA 1V3VA 3BWYA 1HE1C 2VWHA 3N07A 2XSZA 4N7RA 2FFRA 1CDDA 2YNMD 1ORVA 3FKSA 1NNLA 3A1UA 3ESXA 3WFJA 3UV6A 4IQFA 1Y8QA 2OWDA 5BN1A 3IIBA 2JFUA 2NSJA 2YCLA 2Y1LA 2HBRA 1F38A 3JXEA 3MWDB 2Q7DA 1NXVA 1IOZA 1HYGA 5IT9A 4Q9IA 2B5OA 4GICA 2WVJA 4YVFA 2V7TA 1W0KD 3CUUA 3H1AA 4UU7A 2O0LA 5JTTA 5EIBD 4PFSA 2BGKA 3EB9A 1GPDG 2OCPA 1Z0ZA 2FE1A 3PUYA 1UPAA 5DIZA 1ULZA 4BO2A 1B76A 1C0EA 1CY6A 3S6JA 2WJHA 2RK4A 4V0KA 4EECA 3AQIA 1PFUA 5CB0A 5KSOA 1S2DA 3V9PA 4M8DA 2J7PA 5D2CA 3U7EB 4DCTA 1LW6E 1KZ7B 1VLVA 3A26A 1XLWA 1N0WA 1UQRA 4I0WB 3G9ZA 1SXGA 5AJXA 4CM5A 1IXRC 2KQUA 1VCHA 4INOA 3U1BA 4EL5A 1JJAA 4FYYA 5A4DA 1LBHA 4H1VA 1ZUHA 4D3ZA 3LBFA 5DN6D 4PPQA 1XHLA 2J4DA 2YWHA 1RBMA 2HPAA 1VYTA 4J16C 1JIXA 5IT4A 2OV2A 4FFLA 1QE0A 1MTOA 1ZU4A 2M1XA 1CUGA 5KNCH 3BMNA 5F23A 2PKRA 4RA6A 4Y2GA 5IAEA 2YJTD 1IPHA 3FDJA 3MQ2A 4H9GA 4J1SA 5KWJA 1VE7A 2X7XA 2M2IA 4CKWB 1U8YA 3ILVA 5ADWA 3A6GA 5CTJA 3I61A 2E4VA 4H6VA 5HDBB 3HH8A 2DT8A 4MMXB 4OJTA 4BY9E 2Q0XA 2ONYA 1ISGA 1OFUA 1JUDA 3CYFA 4ZICA 2P2DA 3E8MA 3K1JA 4HZGA 3SIPA 5K0BA 3HDYA 2MYPA 3G2KA 5FA8A 1V1JA 1DWQA 5KSPA 2P30A 1FYWA 4HNAB 3EBOA 1XTRA 3HR8A 2MWMA 4YO7A 1GG8A 3FNQA 3CVJA 3UO8B 1WOMA 5ALSA 1C81A 1PEAA 1W1IA 1Z2AA 2I62A 2JLQA 4I1IA 4X7PA 3SEAA 4F45A 1GOTA 5MF6A 2QLBA 3F73A 2H1HA 2GDZA 2FW9A 1RMQA 5DXFA 3V2IA 4EAAA 2IQIA 4WXMA 1LS1A 1Y5MA 3RU7A 1PGNA 2WSBA 5I7RA 1CVIA 3AESA 4CMCA 3KT3A 4JL6A 1RR6A 2BHRA 4BATA 1A8QA 1IG3A 4ZCTA 3EX7C 3ZVNA 3TVTA 2AVDA 4CQLB 3LUDA 4TWIA 5JROA 2JBJA 4C7OB 4ZKEA 2F1JA 4JB3A 5E8RA 4DIOA 3HP7A 5K4GA 3VJRA 1MORA 2ZS7A 3PKIA 1AS0A 4IR7A 4FU0A 2OGUA 3D02A 1X9IA 2XB4A 4ZTBA 2YHSA 3BS4A 3PCTA 4E09A 5HUQA 1QVRA 1IIBA 3ETHA 2GAOA 2H57A 1UJ5A 3I9KA 3HCAA 4OYRA 4D5GA 2F8LA 4DT1B 4KFCA 1AMUA 3NXKA 4P4SB 2ET6A 3FFBA 5K8UA 4FW8A 4LY3A 5DM60 3GJTA 5KS2A 3PQCA 2XT9A 4HL6A 1ESNA 4OB6A 2OORA 3JWHA 1VPEA 4NCJA 4PINA 5CJJA 2BONA 4PTZA 1XNGA 3P52A 4JYBA 1M72A 3LFHA 4GO1A 4C3UA 1A88A 4E22A 1PZMA 1ZO8A 3GVCA 4H31A 1J0EA 1DAGA 3NYQA 3A6HA 1NVVQ 3U5TA 2O5RA 2CDRA 3H3JA 4YR9A 2Q5OA 1COWD 4OREX 5ECYA 3R0XA 1Z73A 4M99A 3U1VA 4OXNA 2F00A 4FNGA 4TQAA 1OU0A 1TAQA 2FAXA 4MNTA 2BZ1A 3KXPA 3ND7A 1YNSA 3E23A 4HN9A 4FGKA 1IEXA 3ISVA 5DBEX 2V5AA 2Z4TA 3NASA 3OZFA 1GQOA 3AGPA 3MIZA 3GLFE 1T0HB 1P33A 3ICUA 1WDTA 3VZDA 2QN1A 2DH5A 1ORIA 3C70A 3D0QA 3MXTA 4IDDA 3OKAA 4P32A 7REQA 4TZ6A 2I4MA 1NPTO 3QIAA 3TLCA 4ECAA 3CLTD 1IJKA 5KOJB 2BLLA 5IK2A 3OZGA 3CGGA 1V11B 2PXHA 2HNAA 1STOA 1F1JA 3PD1A 3T9FA 1CUYA 2I2DA 3JSXA 3KWLA 2ZT7A 3RYIB 5BWNA 4MVWA 4UDNA 3LLSA 1KFCB 1XEXA 3G85A 4C14A 3W2TA 3NDPA 2F3RA 2ZBQA 5AW5A 1P45A 2JIZD 3RV3A 4ER6A 2VP0A 3ZKWB 2PGNA 1AH2A 1KI8A 3V8QA 4BKMA 4EJSA 2JH9A 1FUIA 5FYDA 9LDBA 2XOXA 2UXBB 1USKA 3FDFA 3PUIA 1S2MA 3W90A 4MIKA 3WGMA 4EGSA 1MAVA 4L0MA 3WMGA 2RGRA 3R6WA 2FHPA 3EISA 3QWHA 1QTRA 3CMMA 1WXIA 1ZN8A 4RXMA 1DQPA 1ZONA 2PZ8A 2Q6LA 3F3MA 4OI1A 1O0SA 4TVBA 4H0NA 4FFPA 4NH4A 1ZJ6A 1SUPA 1D2EA 3FNIA 4LDJA 1M83A 5M2QA 2FRVA 4JJ4A 4GMKA 5CIQA 3CE6A 1Q6YA 1J00A 1W9HA 5LZ8A 3V1UA 2QMQA 3KKPA 1QZ3A 1BNCA 3K1YA 4IM7A 1XO1A 5IAAA 3QUQA 2PVSA 3SDBA 5BSHA 3VDXA 2LZ0A 4OA5A 5KNDD 3THSA 5B2ZA 1W36C 3QKSB 4CIDA 4EG6A 1OR8A 2FYTA 2MHCA 2NT4A 4GSYA 3HV0A 1I32A 4PR0A 2XAAA 3WFZA 4ALJA 1RACA 3EQZA 3DGFC 1R6UA 2VP4A 1BN7A 2BHLA 2WJAA 3HVIA 1R3DA 5JD4A 5A6VA 1G42A 5EZYF 4KU4A 2J9GA 4JLVA 4BQIA 2HHLA 1KDRA 4BNUA 3EA0A 3P4XA 4HAZA 4PLTA 2QF7A 4L57A 1I5EA 3N1UA 5CDHA 4C8CA 1XP8A 1EGVB 1FQJA 4QXMA 1Q57A 4JUFA 2EEZA 4GDFA 3B3JA 3ROPA 1GQRA 2R4QA 1AN9A 3DQPA 4YV7A 5KVAA 3ZD9A 4EHJA 1BC5A 3B1KA 5IAOA 1JQEA 1JR3A 2JFBA 3E1SA 3QGMA 3ZWKA 4E07A 5JNSA 5JTUA 1X8XA 3E5HA 4CKCA 4N6NA 5JDIC 1XWFA 2Y4NA 4MQLA 1W25A 1V7QA 4EZIA 4ZOCA 4QOGA 3L77A 2C9BA 2AW3A 1R12A 5FUWA 1U2RA 4C0QC 1T1GA 3HCEA 5JRZA 4GZMA 4BRZA 3DLPX 3WG9A 2CFCA 5JRJA 3IKMB 4N5HX 1WZIA 4E14A 4QNRA 2JH8A 1MC5A 2F3SA 4ZAGA 4CMEA 1GG5A 5FL7D 3EUEA 3JYOA 5ILGA 2VCEA 1A77A 4B2IA 6LDHA 3DL2A 2IHKA 2PX3A 4IQ4A 1BE8A 5GIPE 4TROA 2F4VB 3KUXA 2VA9A 2XVZA 1M8KA 1YKGA 4YAOA 5C5CA 1Q5XA 3AVXA 1N2IA 1AUXA 4RGVA 1XRSB 1ZITA 4TMTA 5ADUS 5BURA 5EP2A 2FRDC 4GQAA 1TJ4A 2JI7A 2EGGA 2J3EA 1U0OC 4HVCA 3JQGB 2YMLA 3D2AA 1WMSA 2O2CA 3E84A 2XW6A 4UUQA 4EA6A 1RZRA 1QP4A 3EDMA 3KWMA 3L4JA 2ZUWA 2EFYA 4RPIA 3C5EA 2DFLA 2O2HA 1PZFA 1MQ9A 2FW6A 3O73A 4KLZA 4RW0A 1SIWA 3K9TA 2KLBA 3AB8A 1P3DA 4HDMB 3EMVA 1TO1E 2ZUCA 3JAWA 1MLDA 3AILA 2WU0A 4R1QA 4UXHA 4ZV9A 5B7GA 3ZHSA 4X1IA 4AC9A 5B7NA 5JCPA 4RKYA 2WTAA 1WMEA 4NSNA 1EJ2A 3UPDA 3G5LA 2XZPA 4J7CA 4UVEA 4MGZR 4RMJA 1PN3A 4EYEA 3IQZA 1DO2A 2ZRNA 5LDHA 3O8OB 4B4OA 2IUTA 5FD8A 1E1YA 4JLDA 4XGRA 1MCZA 4YMGA 3K73O 2A5FA 3FCAA 4CODB 2GPYA 4DKXA 1RI3A 3GLIB 4H1TA 1RM0A 5JANA 1I33A 1FRZA 2OGWA 4OKIA 1MNAA 2GD0A 3T3IA 3BTVA 3DKVA 1E0AA 4P83A 3IIKA 3ADPA 1BMQA 2XB8A 3M5DA 4Y2XA 3TLKA 3BEOA 1F14A 1BCSB 3ESQA 2PRSA 1T3TA 1EZ1A 3ER6A 1ABEA 4QARA 3L06A 5ENVA 4BN5A 2GNOA 4MMZB 3NTUA 5FLEX 4C22A 2JLYA 2B1GA 2EL9A 4JJGA 1ULAA 2HMYB 4MS3A 1OTHA 3QXXA 3L9WA 3NJRA 3OKPA 4K9MA 2FK8A 3DH0A 1VA4A 3NBXX 3C5CA 3RIEA 2GAIA 1LBSA 1KEKA 5KJ6A 2HXGA 1KEVA 1JH8A 4C4PA 5IDQA 2GEBA 2H00A 2AN4A 1QG2A 4Q7QA 4RS3A 4CE6A 5FFFA 4Y9RA 4R1OA 3ND9A 1JRLA 1UC8A 1ZUIA 1V41E 4DIFA 5FJJA 1SCBA 4IWYA 5ILQA 1P62B 2ZRHA 1Z0DA 3JALA 3LBYA 4ND8B 5K8CA 4UOEA 3GMSA 1D4OA 3ITEA 3HTXA 5JD5A 2IZZA 3NBUA 3ZLUA 4DXDA 2Q5HA 1DV2A 1L7QA 4PYQA 3OLQA 4BASA 3FSGA 2BGGA 1ISHA 5SZIA 2EFGA 1QF7A 5CXSA 1KEWA 2XOEA 1U3DA 2HA3A 2R86A 4MVXA 4PZEA 5CDYA 6GPBA 3FMIA 1E18A 3EZGA 2R97A 3MOGA 4UDXX 1PWHA 4ZYYA 4K03A 2PKEA 2QV0A 3MTAA 4EI9A 4HDOB 4LJ6A 2P6RA 1LK0A 2O0KA 4HTAA 4JLSA 5GINE 3LCMA 3KQUA 3AGQA 1NRJB 4ADSG 4U7HA 4ES6A 1L4HA 1QLHA 1YS9A 1RTTA 3KWJA 5AD1A 5LYJB 4LZAA 3BAZA 3X3HA 1OE0A 3D0RA 2COUA 1FK8A 1RWBA 3LY7A 4OB8A 4RD6A 1HEYA 4BMVA 3I6SA 1IZ0A 3HUTA 3R4VA 3N2EA 5HJ5A 5CT5A 1QO9A 4J94A 4HB2A 5ENDA 1NF8A 1ID1A 1NMQA 3HDVA 1A2QA 4AZ0A 1K6XA 5ADHA 1NFRA 2ASVA 5FTLA 5EXSA 2HU8A 4YQYA 1SWWA 2CMFA 2E7ZA 3K9NA 1L7AA 4TL9A 2ZBGA 2K7FA 3PX7A 1U7UA 2AS0A 4YCDA 2Q3LA 3G0DA 2PX8A 4DJTA 3C4QA 4LY6A 1KKMA 1R50A 4WADA 1Z6PA 2HTFA 3E0QA 3N2YA 4OJKA 4F0JA 1DLJA 2CB0A 1J90A 2LBPA 2ZK7A 3GNQA 3KJZA 1F4PA 2C7PA 2C8KA 4KO2S 5HF9A 3TLJA 1BWSA 2JRCA 2BZ0A 4RGBA 2AQIA 5DLDA 8ABPA 4ENUA 3FD8A 2CNWD 4LEIA 2HBZA 4RKWA 4B32A 4MTLA 4G5QA 1YTLA 3WZLA 5AI9A 3EW9A 2XTNA 2YHUA 1FUYB 1D6SA 3DS8A 4IS2A 5AJZA 5T57A 4DIEA 3DZGA 4HSGA 2ZUUA 3ZHOA 4F96A 2H3EA 3EUWA 2P6NA 4HLCA 4E03A 1FXUA 1UF9A 1OI7A 3QE0A 2MSEB 4DDHA 2JFNA 4F9FA 5D7NA 4D9CA 3I2GA 1LK7A 1VFNA 2MYUA 3USES 3L4BC 1HDXA 4WKCA 3I34X 4NZZA 2CXSA 3K0CA 1TQ4A 4GYWA 4ACBA 2QP3A 2J4FA 3H99A 4YRGA 5JJBA 2YFKA 4E6PA 5F09A 2WKSA 5I48A 2V7VA 5LNK1 1ZYMA 4OHMA 2NG1A 4HB0A 3RSCA 5ILOA 3E5NA 4NATA 3UJNA 4ERXA 4FOTA 1I3OA 3I1YA 5IG2A 1OA1A 3T5PA 1FVFA 1KPHA 2VBIA 1C7FA 3ETNA 4DANA 4UFPA 1JEQB 2QIOA 5BSRA 1FS5A 4M9ZA 4Y2JA 4YJFB 1V6SA 1Z5PA 2CWDA 3CEPB 3GCXA 1BHO1 1OAKA 2CFTA 3WI7A 4UC0A 1E2LA 2GH1A 3CRZA 3GFSA 4RACA 3WDSA 3KDSE 5EEHA 2PL3A 4KO8A 1ZPDA 4QGFA 4XQEA 1TUEA 2EP8A 4O63O 3CR8A 4UAJA 4F9GA 1FMFA 4KWTA 4GXTA 4P4BA 6ADHA 1SBYA 4HEJA 1SWVA 4RORA 4C7MA 4EQ6A 1KO8A 3TGPA 2LIPA 4DIMA 4DQKA 1HT3A 3MTQA 1A2OA 2HOQA 4GS5A 4CV0A 3NX4A 3I2KA 3GOQA 3BK2A 2QRHA 1BW9A 1KBOA 3MD9A 2XE4A 1F8GA 4E12A 2ZIZA 4FM9A 1BEEA 2HI6A 2J07A 3COJA 3QVLA 3CURA 2V8OA 2Q2VA 4C8FA 2O0MA 4MVJP 4GMGA 3UKJA 2J9YB 2Q0QA 2V55B 3H83A 3IAM1 1NWHA 4WZAB 2JPDA 5CP8A 3V9AA 4EX7A 4K7JA 2PL9A 3PJDA 5FUQA 5JY6A 2O6LA 4M7OA 4XYGA 5FBQB 5K7SA 2I99A 2TECE 2XADA 5DRTA 1PYOA 4F5YA 2GAAA 2VUHB 1NT2A 4FYKA 4UE2A 4F4FA 2GETA 3O2SB 3LGXA 4QIHA 4CUJA 1OBVA 5IX8A 4RZSA 3WGKA 4G97A 2VP3A 3EXFA 2DC1A 1L5NA 4N48A 1W87A 1JTEA 4JB0A 5HKOA 1FU4A 1NOKA 1WEKA 1R4NB 3ZOKA 3LU1A 2M6RA 4V0MA 5GADl 2OXRA 3GJ7A 3U48A 4AXXA 4ZCRA 1LBTA 2FLVA 4BFCA 1DIRA 2NSHA 5BPFA 3RQIA 3HDQA 5JD6A 3NM5A 2O3SA 2QKYA 4FHZA 3E3MA 1G5RA 2KS6A 1QHSA 4MW7A 4H4CA 3DMNA 2C0CA 4X45A 1SQSA 4WMLA 1LSOA 3QSGA 5DWQA 4BV8A 4C78A 4ENSA 2RGDA 5AI4A 4WECA 3A0RB 3QJ5A 1CUWA 1CE8A 3KSZO 1JQKA 4NCAA 1N2GA 3BHNA 3TW6A 1VGVA 3JQ9C 3MT0A 1EVKA 2AR9A 2QLFA 1IK4A 1HUQA 1M2FA 2QZZA 3NHLA 5ICEA 1EXVA 5B2EA 4IS3A 4MWGA 5D8DA 4AX8A 2GYUA 1J9GA 1L6RA 5HPYB 4MQ6A 4Z7QB 3BCSA 2CNNA 1UH5A 3DG9A 4M1YA 3W5SA 4BMNA 5C1DA 5KHLB 5KO2A 3IP7A 3PVCA 4JJAA 4QNMA 5CM8B 3BJZA 1GFIA 2W2TA 3W6UA 1Y4UA 3SF8A 4BX2A 3VR5H 1GPBA 3B89A 4MVJF 2WHPA 1GYQA 1R5BA 4JEUA 3M6UA 3RCBA 3D0KA 5FWXB 1C9MA 5B3LA 2GVNA 5BSFA 3SI7A 1JP7A 5DEIA 4EGJA 3OY2A 4RPGA 2V0GA 1TA9A 2OYRA 2WG1A 1A1VA 1JDZA 4GGPA 1ZM9A 3K5HA 2AFIB 3L01A 2BGIA 1A69A 3IOCA 1R10A 4LGMA 3TBFA 4CIAA 4GMXA 4PFKA 1YGPA 3W1WA 3CX4A 4Q3EA 3U3JA 1IOLA 2DWUA 4H1WA 1E4EB 5E3IA 5ED0A 1QFZA 3D6UA 4TUYF 3GFFA 1N92A 2ON6A 4ZYLA 1I1HA 4I55F 3NEAA 2E2WA 4FKBA 3SKVA 1GVHA 3RU3A 3F4BA 2CMKA 4O25A 4A2CA 4WESB 1MAHA 1QUEA 5FBKA 2GBIA 2UYGA 1NR1A 3KUDA 1CRPA 4H16A 3MGAA 4OM7A 2HCBA 4TKUB 3A1WA 5EA2A 4EI2A 4XIYA 2YJTA 2D3WA 3VTKA 4U7GA 4M98A 4O4HF 3R5KA 4UBKA 4G9GA 4TV8A 4RTOA 2WOOA 1Q44A 3RVQA 1V39A 4A0SA 1OTXA 1X2EA 3FFTA 4NBKA 5GPBA 4DLSA 1XWWA 1EWKA 3BJMA 3DO8A 1ZJ4A 1IH8A 3UWPA 1VCIA 2QRQA 3JWIA 4V0NA 1MPXA 2W2XA 4ZRNA 3ZEIA 1SC4A 4IAOA 4J2TA 5FNVF 5I9MA 2R5FA 2YJZA 1BWRA 4TLBA 5FPQA 3BGSA 1GXSB 1DNPA 5HFAA 3BZWA 4CR8A 1VPTA 5JVDF 4AAYA 2JGMA 3I01M 4IIBA 4EABA 2ZRFA 2C5AA 5ALXA 1D2GA 1XRQA 3IR5A 1QIIA 1EK1A 1U6KA 2L17A 3TIGA 3ZDDA 1C9DB 4YMWA 2DBZA 5T64A 5CK5A 2IS6A 2FV8A 4XPIA 4D3YA 2ZSAA 3P7MA 3QOFA 2AKAB 3FNHA 2O06A 1TM1E 1Y9ZA 4L3OA 2HROA 3OPXA 2N47A 3QW4B 2XITA 3K53A 3ORFA 3O1LA 2XUJA 4YCCA 2WJPA 4B3HA 5LJLA 5ELLA 1P3Y1 2BP7B 3NHZA 2WVHA 3FMFA 1QOPB 1O1YA 3JPWA 1U2QA 1Z35A 1PS8A 1UBNA 3IDOA 4UTXA 1XDWA 1WXWA 2Q3MA 2I6TA 1I6KA 2RH4A 3QKIA 4DZTA 1XSEA 3BB3A 2H5IA 4COKA 4F5ZA 3BMOB 2YQZA 4IOJA 4YRZA 4TMKA 4RLQA 5C3UA 3IOYA 2RH9B 2VYNA 1JLKA 4FT4A 1XKQA 4I36A 2QRLA 4URXR 3E03A 1UUFA 1L7NA 4UNPA 3ICCA 1T2CA 2IHTA 1MF7A 1A95A 3CBQA 4J0GA 3A31A 5DGCA 3T3HA 3OWHA 3B70A 2QA5A 3TRDA 2FPKA 1YQGA 1ZLXA 4PCVA 1T5HX 2FF5A 5GGXA 5CCDA 5ALYA 1ZNQO 3ZE1B 4MYSA 4INAA 5IAGA 3ILSA 1A9XA 3DMPA 2Y0BA 3GT0A 4KQ1A 4OHKA 2PX4A 1JYSA 3ZD8A 1H1TA 1TEVA 4IQGA 3S2ZA 3PU6A 2IP1A 5DBHX 4YRSA 1C7RA 2IYLD 3N75A 3A3NA 3UAGA 1ABFA 5AI0A 2E21A 3KVVA 4PXYA 4POOA 2PXAA 4BX0A 1GPAA 4U7WA 3BK1A 5KKNB 2BTEA 2OO5A 2B4TO 2QM0A 4JDUA 1XKLA 1KPIA 3KPVA 3AFMA 5ERYA 3ND8A 1AB6A 1ESZA 5EHNA 4C4TA 5L7WA 3GA7A 1VE6A 1GTRA 4C9UA 2Q6TA 1JEOA 3P0JA 1L1QA 2P3QA 1ZMBA 2JAPA 3KBOA 2IS2A 5HMMA 4JITA 3D1JA 4JQZA 3LW7A 2RGXA 3WLEA 2X1MA 5TJHA 2AQHA 2V65A 2AJ8A 1MHPA 1QGZA 1WZ2A 4ZDKA 5SY6A 4EGQA 1IN5A 2CWWA 3H1PA 3CPHA 1QMGA 2HN9A 5HKKD 1N6IA 1R0BA 1RHQA 3VZBA 4LOAA 1UT6A 3MTIA 4F93B 4YWJA 4PYMA 1X7XA 3C6QA 3AV0B 2WYVA 2OMKA 4FDMA 4K8RB 1Z12A 2YWRA 1QK4A 3AETA 5IM4F 1KJYA 2F8SA 3TLYA 3F7NA 4UHHA 3KC2A 1X7WA 1T6NA 3L4SO 5A6SA 2EBHX 3GJ4A 3HZOA 4PQYA 4Z9BA 3TUIC 1Y42X 3BMQB 5CNJA 1QGUA 3R9XB 1NONA 2C3OA 2A14A 2C82A 3FR7A 5F1KA 5L53A 4NL4H 1ENOA 3ADOA 4W9NC 3SP1A 2VNKA 1DT3A 2XUPA 3OLYA 2QWXA 5LA6B 4OGKA 1KYIA 5AP9A 1NQ5A 1LPAB 4WERA 3BQNB 1GT91 1F2UA 1LI5A 3AEUB 3KL4A 2AH5A 1YL7A 2I76A 4NY1A 3UIEA 5K20A 2QBYA 2GXUA 4IRMA 4DRXB 4J1NA 2D5BA 1RXVA 4CM8B 2V0NA 5BV7A 2ROQA 3KTFA 1L7EA 3FLAA 2NU7B 2ZVDA 3WB1A 3LWBA 4OMUA 3OFKA 1U2EA 2FMHA 5F76A 2XWSA 3BL5A 3DT8A 2C6GA 1HYEA 1QE3A 2FXVA 4LWQA 4D4LA 1EA7A 1OH6A 2H1LA 1XF1A 3SXPA 3CLRC 2OOTA 3RT1A 3TDKA 3A4TA 3MS4A 1WETA 1DEHA 4OXKA 4QUDA 4GH5A 4QYTA 1ZKDA 1WDWB 3Q5GA 5H3HA 5K0SA 4KRGA 2O8DA 1VE9A 2EZBA 4DG9A 3S68A 1V48A 3BA6A 1W59A 1DZ3A 3LDFA 3O4GA 4GPBA 1QYRA 3ZVMA 1KJZA 3JAKB 1V43A 2P91A 1HWYA 3NI2A 1M34E 2ORWA 3CVOA 4QGHA 5CAEA 2NU9A 4N6GA 4DLUA 1LNZA 1U4NA 2CW5A 4JGGA 1ZXXA 3AHEA 2OB2A 2RONA 3IV7A 3L4EA 1S1MA 3RVNA 4EHAA 4QICA 1V1MA 1G98A 3PNVA 4HWSA 1XZJA 5MFPA 5HILA 3KSMA 4L6AA 1BVHA 2Q4EA 1U0TA 4IZIA 3FBGA 4C0KA 1KYWA 5EZ6B 3D8UA 3O0TA 3AV3A 4N3GA 2WHEA 1G5HA 4TL8A 5E9AA 4CMKA 1YZ3A 4Y1RA 4D2IA 2QYHA 2ZM5A 1Y5LA 5SY9A 5T5QA 3LLUA 1PJAA 4L16A 2B36A 2H0QA 4WAUA 5A3RA 2PXXA 5TSDA 3CCFA 5B4TA 4YECA 1VKHA 3R6TA 2IVZA 3I04A 5GJVC 1M2JA 3V8RA 5EKUA 1RYFA 2GPAA 2BMWA 2J3KA 2QAGA 2REXB 2WAOA 3U4QB 1KMIY 3OE7A 3Q3VA 3E22B 3GAFA 1ENZA 1GUZA 3OT5A 4OXQA 3IGFA 4G0ZA 2O54A 2WFMA 1EUQA 1TGYA 2W9XA 2PWYA 2V7GA 3DPSA 5GVSA 2IEGA 1KVTA 1T3ZA 4JI5B 3VGPA 1Q1GA 3RSFA 4Y2QA 1CQPA 1TW2A 2ZSEA 3N2KB 4A2QA 5G4LA 3HEMA 1E0JA 2ZI7A 2BCGY 3GFGA 3I58A 1SURA 1L4BA 421PA 2QDKA 2IUYA 1G60A 1Y1QA 5ALKA 5EAIA 3TBHA 3G0GA 2FSFA 1YR3A 2P9BA 2OWEA 2J31A 1U2PA 2BGLA 1NVUQ 4D9BA 3OO1A 5JWOA 1BYIA 1Q0HA 2R751 1L1RA 3AU8A 2JFPA 5BWBA 3QBJA 3TOXA 4FFBA 4UUOA 4RE6A 2NTJA 4KQWA 4DEXA 1XF9A 1TK2A 1FFXA 4TUYB 3UA3A 1M7HA 2H65A 3L6RA 4ZZ2A 3J7AC 2Z5LA 4OJQA 1G59A 5B2FA 4WVLA 2QN9A 3DO5A 4FMDF 3DB1A 3IDAA 1RBZA 4ATNA 2DFTA 3NHSA 3JYQA 4I4LA 3DKRA 4LXTA 3A7DA 1VB3A 4S35A 4HGNA 2IEAA 1I4TD 4WCFA 3UJAA 4R81A 5A04A 4DHWA 3CF2A 2D59A 4NE2A 1WD5A 2NZ8A 2QTNA 2VDWA 3LH5A 3OQBA 2R65A 1YI8A 4YGXB 4EYGA 3U39A 3AIOA 4ITVA 5B1EA 5L7TA 2X2FA 3W3AA 2JJ2A 4KQ2A 4WGGA 2ZJBA 1J0CA 3PIDA 3NVKI 2CY0A 3KKNA 3GAAA 1CB7A 3BORA 3KB6A 3OI7A 1J0AA 3AF6A 2D8AA 1BVRA 2R48A 5AOVA 3WGVA 2R7NA 3FR8A 3IAS1 4DQVA 4RHTA 3I0MA 3FKQA 4FC7A 4NYIR 1NBME 4QSHA 5IF3A 1CQIB 5BMVF 3EFOA 2GHQA 4M60A 1Y9AA 2I3AA 5AXCA 4KIGA 1C0PA 1SXQA 2BBTA 4FI3F 5DLYA 2JI4A 3VR5A 4MV0A 5K3FA 2PSFA 3BRWA 4U5QA 2EKBA 1W76A 2I2WA 5K6RA 3FUXA 4FD3A 1QFMA 1Q7CA 4D9GA 3HJFA 1Y3FE 4W1PA 1QVVA 3UMFA 1C0KA 5BMVA 4D4IA 3HPQA 4QVKA 2X8JB 4YAEA 2V7XA 2P2YA 2WFZA 4LX8A 2DM6A 4JHXA 1RMTA 3EEYA 2OENG 2BDEA 1PJ3A 3N05A 3PYLA 4GM1A 2AEMA 3FPSA 4LQLA 4O59O 1G21A 3VPSA 1R1DA 1XD2B 3VJMA 1N2HA 2V5UA 1HL3A 1U0FA 3ZCPA 4F4DA 1QF6A 1QP8A 2BM8A 2H9IA 4MPRA 4ZU3A 4LE0A 5F7XA 1MW8X 3X2FA 4WNIA 2HKIA 3GLUA 3L7JA 2CUTA 2JIMA 4LRSB 1MX3A 1AK2A 1D2HA 3V8MA 3P20A 3VZQA 4XCVA 4BO1A 1IHXA 1Y6JA 2F9LA 2OILA 3ON5A 5G3YA 1QU2A 2HA6A 1N33B 1F6BA 2WLSA 1LEHA 1W44A 4YCMA 2GLUA 2O8EB 1Y5NA 3GLRA 3TLBA 5JJIA 1TZJA 2AT1A 2J67A 3LGAA 4WNCA 2UUCB 4Y8VA 4QEZA 1MBZA 2WI8A 1KSFX 3ORYA 2VQ3A 4LFCB 2R62A 2J6IA 1Z7GA 1HA3A 3ZIUA 1ZY2A 4AROA 4BX3A 3B9BA 2ZJ7A 2B20A 3QELA 3THRA 1OLXB 1RPNA 3RADC 3PEYA 2ZIGA 3QMWA 3U40A 2ZSJA 1T4MA 1ZA1A 1C9YA 2XRYA 4Z9FA 5I7SA 3DPIA 3ASUA 2X22A 3VZCA 2JGDB 1PJZA 2Q6OA 3W8RA 4EKEA 2AC4A 4BBZA 1T2NA 3H2JA 4OSPA 4RMHA 4XA8A 4DWJA 1JSCA 3BHJA 3GLGB 4N47A 1CNMA 4TMZA 1LSJA 1KVQA 3DZJA 4ISBA 2PSHA 4E0BA 4B85A 4IFEA 1K7EB 3LRTA 5LJIA 4QBHA 2CLMB 1CLEA 1SY7A 4TZKA 5FPHA 3K9LA 5I45A 1S1CA 2AJDA 5E4JA 1MDFA 4JT9A 4IRXA 2I67A 2PIDA 1OXMA 5JCXA 2WMOB 1VG9B 2EVWX 3REQB 4WWHA 2W2NA 4JOCA 4ZC1A 4LBVA 2O5VA 2VYQA 1QIMA 1K27A 4RZQA 4XUGB 3VUEA 1OLSA 1R4MA 2GQ0A 4FHFA 4HAOA 4LWPA 3LKBA 1BOOA 4NPAA 1DCKA 4WNAA 4MXDA 3WKDA 6ABPA 4W1RA 2YMQA 4JP3A 4KBGA 2XKJE 2YWDA 4OOFA 2O5CA 2F9FA 4RHUA 1PG5A 4TYPA 3RRBA 4EFNA 5I4CA 2E1RA 1VKNA 3IS3A 2H4WA 5JMWA 2IPMA 4TQGA 2EKZA 5HG0A 2C6PA 1B16A 2RSLA 1PX0A 2B9EA 1YZKA 2WHXA 1T9CA 1X80B 5KYTA 3GVHA 5E95A 5KX5F 1K5GA 2P2NA 2ECOA 1QBKC 3F78A 3LT2A 4RGQA 1ODCA 1TZCA 1XGKA 3KLNA 2PKCA 4KWHA 1II0A 4HJRA 1JTVA 1Y0BA 2QGFA 1VMIA 4NI5A 4YREA 5EJGA 4N41A 2DHCA 1XQWA 4U0JA 4FQ7A 3GEGA 2BFEA 2DQZA 1SXPA 5JSYA 1QC5B 1MFZA 4S2UA 2ZUBA 2QMYA 1H5QA 2ZYUX 2PO7A 1NYRA 3KE9A 3PRHA 4IOMA 1UBOS 3RNOA 1BMDA 4B17A 1NV8A 2B3DA 4DIKA 4ZVMA 1YASA 3RHSA 4TT3A 2AWNA 3A2KA 2IYNA 3TZQA 5FWYA 3A0UA 3DD1A 1YJ5A 1Y5RA 1EAMA 4CYMA 1FMLA 1SQFA 2VP6A 1L4GA 4KI0A 3H7AA 4GVLA 4RPKA 1NBIA 3VOBA 1M7BA 3AJRA 4ZODA 1FCJA 4XYBA 1P75A 3NBQA 3RJMA 3W04A 1EB8A 4KXNA 3GVXA 1M66A 3FJOA 4OQXA 3HS3A 2VDQB 5KNBH 2H3HA 2JI6A 1Z06A 2G1JA 4NMXB 1NAHA 4RPCA 2QPLA 3ASYA 2HMAA 3V2UA 4C0WA 2XEDA 3AY7A 5AK4A 3QKWA 3MRVA 3WYCA 1E9BA 3RYCA 2V4ZA 5F2NA 1KQNA 2XCQA 1SEVA 3ZIDA 2VCHA 1WMBA 3PHLA 3HCDA 3RS2A 4AZ3B 2J5RA 1OZGA 2LV8A 1I9GA 3U0VA 4GOND 4ZVSA 3SOPA 5LOVA 1WDLA 3SQMA 4BNDB 2G70A 3BSYA 3KEGA 3CVYA 2IHUA 3D6JA 3PDWA 3LMKA 3PDJA 1BGXT 1FX0A 4DILA 4WN3A 4RQAA 1G66A 1H66A 1E66A 2ZLBA 4E32A 5AW2A 4W5OA 3BL6A 1UINA 2JIDA 2RARA 1B8NA 3A7EA 4IVRA 4J1TA 1R18A 1XVLA 1ZESA 2CJYA 4UVGA 2VPQA 3SZUA 1D1TA 4BMOB 2I5PO 5IUKC 1A8UA 2C5BA 3IMFA 4QQKA 2QYSA 4WEOA 3SPXA 4EH1A 1AURA 5ICGA 4F6CA 1GDHA 1ONOA 4I50A 1I2DA 1SKQA 1U28C 2ACWA 4MAAA 4WY8A 3V6MA 4DQDA 5JXJA 3IUPA 1P2DA 2W2OA 4WN9B 3RTGA 2CDCA 3GP8A 5A9SA 1TT5B 4UAGA 1I7DA 4EW1A 1GPMA 1H6CA 1H8ED 2GI4A 4GYKA 1AF4A 5JQGA 1ZD5A 5DTEA 1YKSA 2ZTUA 1LBIA 1XRNA 2VHYA 3U4IA 2R66A 5EXDA 2V7QA 1CY0A 3ANXA 2C2OA 4L7VA 5EWMA 3BFVA 2PWBA 1TC1A 2ZPUA 4D96A 2VVTA 3GWZA 4ZT6A 1RJFA 4ALNA 4KMMA 3QYAA 3VHXB 1UDBA 4MYUA 5HX7A 3FXAA 1K7XB 2PZEA 5F64A 1BD3A 3QVOA 4L5YA 4M38A 2H8GA 4ALMA 4J76A 1P9LA 3M7IA 2OZKA 1JEEA 3HU3A 3HY3A 1ZK0A 4P7KA 4B79A 4XWWA 5EEGA 4MQMA 1XQ9A 3NYWA 1U4OA 5KOHB 3DMTC 2I71A 4OSOA 3ZVRA 4MWCA 3W9SA 5JJ5A 1C1DB 3JQEA 3UXHA 3K0KA 3G1UA 4ZA2A 3NHKA 4OMEA 4PPYA 2DE0X 3AEQA 2GZAA 3IVXA 1E9FA 2DPGA 3WQRA 1SRRA 1XALA 4JT8A 1PS9A 3H9GA 2IH2A 3DE0X 4LXUA 3CONA 2A6PA 2XB9A 5FEMA 5MDHA 4C76A 2WJIA 3VDNB 4MLZA 2YIMA 1SR8A 2I33A 1TL7C 1UP6A 4JJ7A 2ZRGA 1MOQA 2O3RA 5JH7B 4DCVA 3P2YA 1VMDA 1DIGA 1HYHA 4REQB 3EEBA 4DTIA 3LDHA 5LBTA 1CP3A 4A0QA 5BNIA 4KOEC 3HXQA 3PHBE 4GBMA 4PRYA 3PQ7A 4E2ZA 4IDPA 5IBPA 4JROA 1HYQA 2W70A 1ZM2A 1JHZA 4UUBA 4K0KB 2FF7A 1RM5A 2Y1WA 3IQXA 2R1VB 4LDNA 4UZFA 1RPZA 2W37A 5AFSA 1QP0A 4NIMA 3H8VA 5CW1A 3QOXA 2VXOA 5T3YA 3WYGA 2J0UA 2R5NA 3PGA1 1VMKA 3T9BA 1CBUA 1COZA 3LZDA 1B8OA 4I4TF 5H1YA 4C2TA 1H85A 2AI3A 3IKVA 5EJEA 3JARB 1GCUA 3HY4A 3L6UA 1OXXK 3P2EA 2DPMA 5AM1A 5HNKA 2NNLD 3M89A 2EV9A 4AWBA 2BF7A 1D6NA 3SJUA 2B8NA 3PGXA 3Q8WA 1UL1X 1RXCA 4LZWA 2Q3HA 2OV1A 4EEXA 3DM5A 1BQ4A 1K7YA 1P4GA 1VFPA 2FN7A 2P41A 2QJWA 3OD5A 3WIVA 4BZPA 2PJDA 3AONB 3KASA 3KJEA 4TS4A 5ER9A 2ODBA 1U2DC 3VNUA 3F0TA 3FPHA 3U62A 4X7RA 4INPA 3KR2A 1KMNA 5LD2B 3THWB 3GLQA 1IOVA 2GFIA 5EPEA 1A4XA 4EX6A 1YHNA 4KYIB 2R8XA 4CLRA 2EJTA 2PS0A 2HREA 2H18A 3IV9A 5A7GA 1YDGA 1FDVA 4YJ2A 5KNBD 1QZXA 3QVMA 4P0PB 2P1ZA 3EK2A 1WM1A 1NQVA 3IH5A 5D7BA 3WYDA 5JD3A 1KY5A 2QIPA 3L79A 2XEJA 4KR9A 5JDIA 2MIIA 2GN8A 3MUEA 1T9BA 2VK1A 1UMCA 3FYUA 1DQSA 1LA2A 2VJKA 3COZA 1VSBA 4I4CA 4JP8A 3PC7A 4R3WA 2L18A 2PT7A 1E2JA 3F6BX 4IP0A 4AUEA 4QAJA 4WJLA 2BUCA 4AW9A 1LVGA 4B7ZA 1ZGHA 4D0NA 4E5DA 3J7TA 4TL6A 3OCJA 2E55A 4Z0HO 1WSBA 5G0WA 4PLCA 1CT9A 4RLFA 4OP3A 1DUIA 1ZCZA 2EERA 2YV2A 1QR6A 3CGWA 3WWEA 1HNXB 3PNKA 1T10A 3SZ3A 1DCTA 3E35A 1C4XA 1R8SA 4KR3A 4OVKA 3LA8A 1PKEA 4Y2PA 3FAKA 4PLPA 3TS1A 3HCPA 3WLOA 1Z15A 2OVBA 1GCAA 2BBOA 3N6VA 3QMVA 3G59A 2NPFA 2EF1A 3L8MA 2P67A 3P19A 3UHFA 1CUIA 3CWCA 2V7QD 4MPJA 3EGIA 3IUQA 1APBA 4QYIB 2NVBA 4DVGA 2A57A 3DWGA 3HCWA 3S2EA 5J9FA 2NU6B 1CIVA 1Z4MA 2REOA 3H75A 3RFUA 3DDZX 2G4VA 3DDWA 5EKDA 1HETA 2NSYA 1RRCA 1GCGA 1CIJA 5K0GA 2CLSA 2AV6A 3AEXA 3UT5A 6REQB 3UCFA 3A6PC 4FP9A 2B7LA 3B6IA 1A7JA 1V96A 2OCBA 1ATZA 2QRNA 2ANBA 5IJWA 3GRRA 3SLKA 4BJ6A 4JJ8A 3ADDA 4RNCA 5JQGF 2B0JA 3GEHA 4ZEXA 3I6YA 4KFTA 5TRTA 3PT9A 1EFAA 2B8WA 2G1AA 4A0GA 4NV1A 1BH2A 3ZXYA 3GH3A 4L5JA 4DMMA 1TQHA 2LVBA 2ZJ6A 3EVFA 4YQZA 1CDZA 5KTSA 4K9QA 1RYEA 3ZY5A 1MRZA 4J0CA 2G17A 5K0EA 1KBLA 4C5AA 1EDOA 1O6FA 4MPDA 1GFSA 5HHTA 3TYXA 1W35A 4TTPA 3C5HA 3MW8A 3OTGA 2IZ5A 1P9WA 5FR2A 4GL4A 1LI7A 5BXQC 2VBFA 2OC9A 3MWYW 5IFKA 2IIQA 3I83A 4Z2YA 4PG8A 3CNHA 1EKXA 2XQKA 2CEKA 1D03A 1KMQA 1W2WB 4Y0NA 4NZMA 1RABA 2CE7A 3WGIA 1XNHA 4KTTE 1C2YA 2QTCA 3DE7X 2C4KA 3MWEA 2X4LA 1E2QA 4LTMA 1TCVA 1FNMA 4OFZA 2C54A 2QQ5A 5E4TA 1CS0A 4BFUA 3GLFB 1IVNA 1ZGZA 4CM7A 1WKCA 3OEYA 3TBKA 5DNWA 5J4KA 1DBPA 1RQPA 2IYTA 3RIHA 4E5SA 3KVYA 4QRDA 1N34B 1VJ1A 1PNOA 4GUDA 4EW3A 1IUNA 3KELA 4DJ5X 5JJLA 2P69A 1QYIA 5LZ7A 5EHXA 3ZDYB 2FEKA 1ULSA 4UU8A 3IPYA 4RMGA 5ALDA 3L92A 1XQXA 2X9QA 4BP8A 2CXUA 1P5HA 1U04A 1A5SB 1ENPA 1QCCA 2WJ6A 3CV3A 5AVTA 4KWEA 3UM9A 3MOSA 3Q8LA 2XXAA 1YVEI 5IDXA 4MOWA 3EXIB 2O2GA 4MIEA 4ZJZA 4NAHA 1D4FA 4AS3A 4P4DA 1FL9A 3ANNA 2PS9A 4R16A 2X5JO 1TM5E 2OECA 3WV4A 3C39A 2XKBA 3RI3A 2JF0A 1B8UA 3ZXIA 4XIJA 3KQSA 3QXJA 2W0MA 3H04A 4P4UA 2NZ2A 3SC2B 1E3EA 1DVRA 1I10A 5KPJA 1PWZA 2RHDA 1I4WA 1LF0A 3L04A 1IU9A 2CHVA 4NCKA 4YTEA 1WXFA 3WICA 1JEYB 2HQRA 1EM8B 2ZI6A 1U2GA 5DEOA 2GTIA 1S6YA 2EARA 3N5KA 1DBQA 1P61B 5BQPA 5TJ9A 1JQ5A 3QNWA 1IPFA 1FP4B 4ZJPA 3DJYA 3IP1A 3RLFA 2HWKA 4L5AA 3H42B 4MVJM 3Q40A 1EDZA 1OXSC 4QXOA 4Y9UA 1RVDA 1ZMOA 2AEFA 5IZ4A 1NBWA 4IIJA 3L9XA 2WAXA 4NABA 1HMPA 2WTMA 4AO7A 5CHYA 1M34B 2B82A 4PFQA 1BAPA 1M2VA 4A23A 5KX5A 3U7FB 2I7CA 5AHRA 1DUVG 3WA6A 2RH5A 2CLOB 2CCJA 1MR3F 4RK7A 3LNCA 1PLLA 4R31A 1B0AA 4MA5A 4JI6B 1X8LA 2OGSA 1O5OA 1N6KA 1ZMRA 2PGDA 3DUFA 4KN9S 1V4BA 3G1WA 1LLDA 3QTBA 1N75A 4ZAXA 1SU4A 3FPLA 4LYYA 1FYDA 1E5LA 5CB4B 2GM9A 4IXNA 2AJBA 1B43A 2PWPA 2HI0A 1NQWA 3DHVA 2ZRDA 3T9DA 4ZK2A 2EFDB 3TLXA 4ZYVA 2Y0DA 3WMXA 5CFPA 2O52A 2DPYA 3VKGA 1NMEA 2GPJA 3GQBB 4WACA 3COVA 3C3BA 2ZSKA 3PC2A 1H1DA 2OB1A 1QHXA 1FX1A 2R7AA 2WB2A 3WYNA 1EIZA 4J0NA 3ZH2A 1C80A 1T5DX 1UT8A 3D8BA 1G3QA 3GU3A 4BU0A 4MDYA 4DDMA 1RYBA 3C8OA 3S9MA 3W0LB 1ZINA 1KR2A 4ALLA 4JENA 3OJOA 4U3JA 4D56A 5BXYA 5JS2A 4BJ1A 4DMRA 4HB4A 3DTYA 2TYSB 1SCUB 2J48A 3R5FA 2ASEA 1NI5A 2Y77A 3AERA 4KFRA 4MQ5A 3FPKA 1DRUA 2V8BA 1UM9A 2VBGA 2WW8A 1QF9A 1H65A 3P27A 1ZGAA 2PM8A 3DC7A 3WGJA 3OE1A 1D7AA 1LNSA 1VM6A 1X2BA 5IVIA 3K2EA 3K0AA 3K9FC 1GL3A 2IYVA 4C9EA 1JSLA 2BI7A 3L1IA 4H59A 3ZE0B 4C20A 2IYQA 4RFVA 5DI3A 5KTRA 1C1HA 1K66A 1JDBC 4KPUB 1EE1A 4UTOA 2HDOA 5H59A 3IWWA 2VJBA 3P1JA 2D2EA 2G8LA 3KOUA 5ITZA 4AKGA 2VQDA 2M9MA 5LBIA 1U0EA 5LQCA 1W85A 1G5IA 1N2XA 3JTEA 5KYUA 3TDNA 2Z56A 4GR9A 2W2VA 3W05A 2FHSA 3W2IA 4N18A 3K20A 4PX2A 3QX8A 4C0LA 4ER0A 1JKFA 3U44B 5LA6F 3ZD6A 5IUNC 4CQMB 1R9MA 4LTDA 2D4AA 3LY9A 1USVA 1XL1A 4WKNA 4D8WA 4NHOA 4PZPA 5JNRA 2IXEA 3QE2A 3F98A 5HSGA 4UCWA 1EFVB 3I2JA 1DIHA 5HQJA 3OM8A 4Q18A 1XJCA 3QJYA 4PAGA 2ZYSA 3PKZA 5J1TB 3M81A 5ALPA 3NAGA 2GBLA 3ABOB 3D3WA 4MRSA 1BMFD 5AVJA 3L8YA 3BRCA 2XBUA 4JELA 4J7XA 2WNHA 4ITUA 2YZKA 5H7XA 2BFDB 5IN4A 2RAVA 1O4VA 3I64A 1QV9A 4R9SA 3TIXB 1W9MA 2VDKB 4HPJB 4A73A 1RRGA 4QJ5A 3HN7A 3LQFA 2XYHA 2Q7OE 2DR2A 4O3MA 3RAGA 1H3EA 1T8PA 1VP9A 3C7TA 4TVOA 4FMPA 2X5NA 2CXOA 3I3OA 1IY1A 2EFEB 5BW5A 1HSOA 1P19A 2AMVA 4XFDA 4EPXA 1W47A 2WD7A 2ZI3A 4GRAA 2JEZA 5LZ9A 1L7RA 4MV5A 4RTNA 5JNTA 2AFHA 1YXMA 1O9HA 2WFAA 4B31A 5KVCA 1P3JA 5GWXA 2I66A 3IDSA 2CF5A 2QUKA 4KWCA 1N3LA 1PP4A 4UUAA 5E6SB 3MWLA 1X42A 4BV9A 3A37A 1FLVA 1J7JA 2BEWA 3GT7A 3PXCX 3E0XA 4MRVA 3P26A 5JCOA 1N9GB 2FEWB 1O6GA 2Z95A 1U2SA 3DWEX 3N7AA 4YIKA 1AM4D 1WQ3A 1SVWA 4TWZA 4RHEA 5IJZA 1ZL2A 2B34A 3KHKA 4UXJA 3HU1A 4CG0A 4QU0A 4EJSC 5TV2A 2QLNA 4OCZA 4FEYA 5SV2A 4JKOA 2NYVA 3OETA 2YW2A 2W7TA 2YMPA 2ZIFA 2Z09A 2ZPTX 4LUCA 1Q91A 4G86A 5DXJA 2B7CA 4B4KA 3RFTA 3UZUA 4H1HA 1WPRA 4U2KA 4TS9A 4IFTA 1Y6QA 3PUJA 4ARZA 4ZOBA 3E82A 4CIXA 4GW3A 2LW7A 3NLLA 1J8VA 1QYCA 1Z13A 1T8SA 3NALA 2CXPA 3Q8KA 2ZSUA 2ZRPA 2GILA 3JD0A 2WTBA 1M0EA 4AZTA 4YDRA 1LFAA 1MKYA 2ZP1A 1NV9A 4QOFA 1NJGA 2PEYA 2RHLA 4TTTS 4F71A 2ZUFA 2HK8A 1DAMA 4HUQA 1IXKA 2PRZA 4II2A 3IA7A 4TMFA 1TOAA 5EIXA 3HJHA 1KOJA 5BN5A 4RY0A 5EMMA 1KI3A 3VBCA 3CQ9A 2XDYA 4MCIA 3H86A 4MKZA 5JOQA 3ER8A 5KYWA 2Q21A 3V7WA 2G67A 3S5JA 1CZLA 3BM5A 3KJXA 4DQLA 1SVIA 3H11B 4FIDA 3DL0A 4NESA 4NMLA 4QOJA 5CA0A 4ND4A 3TW8A 1T5OA 4PRKA 1OA0A 4QO7A 1DRWA 3MGBA 1I2MA 3WGTA 1AXRA 2L69A 3OFSA 4MV9A 4HHEA 3WX0A 4ZEVA 2FZVA 1Y33E 4BAGA 4C0SA 3QFFA 3MGKA 1J97A 2RHGB 1FQKA 1O96B 3M9LA 3DBHB 4S12A 4BO4A 1CJMA 3L5KA 2XMQA 3NKVA 3B8EA 4OATA 5ENZA 3AIMA 3RVKA 4ZJYA 5IJ0B 2A9JA 3HN6A 1L7BA 1LH0A 5KZMB 1F5NA 3FYSA 5E1DA 2GXSA 1EXWA 3WWPA 5FNVB 4HDSB 4P4NA 2VSQA 4EB6B 1KEZA 3K0FA 4RZ2A 5JARA 3Q6MA 3U4MA 4FMDB 4MKFA 1G7CA 3F4LA 5M29A 4OK5A 2OP0A 2C5QA 4TOIA 1O95D 3NBZC 2FKNA 4FUTA 4KO3S 3HVHA 3OAAD 5KVSA 1C3JA 2I03A 3OJXA 3QFTA 3BFXA 2MJLA 1K2WA 4DR7B 2ETXA 2WJJA 4Z51A 3F8WA 2FXIA 2QX7A 5KQLA 1FFEA 3ABZA 3D3JA 3LOPA 3KVRA 3OZ7A 3ZIAA 1RRFA 5AO9A 1NVGA 1OBCA 4KGXA 4BEVA 5KTKA 3OZUA 2DVMA 2IYXA 3GVPA 5KYXA 2BYTA 1G2OA 2G6BA 2II6A 3BZBA 3W5HA 4EWLA 1QQ5A 2V97A 3HYNA 1WUHS 4G0OA 4R8SA 3PC8A 5IW8A 4CR6A 4K6FA 4IKOA 2NAFA 3M1YA 3NDJA 4FGWA 5DT9A 3F5DA 1Z4QA 1Z0IA 1TYEB 2G88A 2QENA 1Q0TA 2IOYA 4BJHB 5ELXA 4BXOB 3L82B 4Q4CA 2IPLA 4OQEA 2HU2A 3QV2A 3ZWMA 2B4AA 5A4FS 3OJLA 3ZWCA 1FRNA 1KA9H 3MWGA 1M8GA 5CUQA 4GBED 1SM4A 1DXOA 4YNBA 2NVUB 4BQSA 2HT6A 3PF8A 2EAUA 1BHQ1 1Y7TA 5K3SA 1P0IA 3W1VA 2EU8A 4NGRA 5HGJA 1GQYA 2BFWA 2Q1YA 2XCUA 2CN1A 2NXEA 1E2MA 2C29D 3DOOA 4UHJA 3USCS 1WXEA 3PXXA 3VR6H 3PFGA 2J9XB 3FOBA 4OBWA 3DLHA 2D0PA 3IMGA 3MHPA 1A8SA 3ZBQA 2PMDA 3SX4A 3HG7A 4ZRDA 4FMCF 1K1EA 1NVWQ 2XH8A 3BJEA 5K2MA 5LZ4A 4HNVA 3O74A 3T3NA 1KFBB 3KQLA 3WXBA 2LKCA 2VQFB 1RWMA 1YDMA 1MGPA 4X95A 3GJ8A 4TRNA 2VC2B 5AJVB 5CU7A 1JAYA 1QP7A 1HDCA 1RW4A 2WBLC 4RVNA 4OX9B 4YPOA 1KU6A 1SCJA 3HYTA 4FKZA 3IBTA 4DADA 1UK9A 2BBWA 2PEZA 3DBLA 2A0FA 4EG3A 3ER9A 3KSBC 4F84A 3R5SA 3DVSX 5F73A 3ZLJA 5F3WB 1N25A 1QLJA 4NECA 5AK6A 3SFVA 1K9VF 3QVSA 4J0HA 2GD2A 1F7UA 5L3RA 3A6KA 2XYPA 4N65A 1FZQA 2JCVA 3L0CA 4JDPA 4ABYA 4CCWA 3H8SA 5AUPB 1TU4A 1Q7BA 3X0DA 2PBLA 3E9MA 1LPMA 3ZNPA 2OCAA 1DBSA 4FGSA 4LOJA 5G40A 1W5BA 1C30A 2C5HA 2YXNA 4XKJA 4RTPA 4W5NA 5D6NA 1I0ZA 1YZTA 4MV3A 3ZN2A 1VE3A 2Q0SA 2APJA 3RVBA 5HE8A 4BUJA 1VZ2A 1DRVA 3K1AA 1P5RA 2J46A 1YQ9A 2NYRA 2WICA 1MT0A 1JQBA 3G89A 3ONWA 4J9VA 1ISRA 4NK5A 5EIWA 3R7WA 3RC9A 3WRVA 3DEIA 1CEQA 5JS1A 5CMLA 1XZKA 1TFUA 2O1WA 5L6LB 4F06A 1DARA 2XUZA 3QVTA 2FX2A 3CKYA 4R8LA 3RVRA 3H9UA 3D31A 4JLNA 5CYOA 5IKEA 2XUIA 4HNUA 3BI0A 1MC1A 2LXNA 3FHCB 5COQA 2Z8ZA 3S2FA 3MS7A 1B0UA 2PGJA 3AWIA 4K8OA 5ECGC 2JCBA 3A2LA 3HKCA 3GJYA 3M1AA 5IKPA 1AHIA 5KWVA 2H1OA 4N5IX 5F3DA 3IJEB 4RCZA 3NC0C 4DZRA 3IOEA 4DLXA 2C77A 1RPTA 4YXFA 1BH6A 2YZ2A 2OD7A 3TOCA 2OAQ1 2GASA 3IB3A 1G3MA 2XCSB 2C9DA 1T13A 1ESCA 2H48A 1DTWB 4IVPA 1JV2B 1XTQA 2ICAA 1ITZA 4PZAA 4ZQGA 4JYMA 4QQ8A 1JAIA 5FV7A 5B7QA 1DKRA 5JVDA 1ZH0A 4JK3A 4LY0A 2X15A 1CW2B 4JBWA 1EGHA 1KL7A 5KAPA 1KE1A 4W5TA 1V0JA 1MN6A 3IDFA 4L7QA 5BUZA 4R71A 4M0FA 1G9XA 4NEQA 2PVCA 1GUYA 3BN3A 4I5IA 1U7DA 1BHSA 5AHKA 4X1KA 2H1SA 4JY7A 5DKFA 1RQLA 1U3CA 2D5LA 5U1PA 3WK4A 1AXGA 2E85A 3ZHZA 2I3ZA 1U31A 1XL0A 1IN4A 3T7EA 4BVLA 3FOZA 3JQ7B 5D87A 1Q95A 5B36A 1FVOA 3PUVA 2PXCA 1NKVA 1EGAA 1P4SA 2JJ1A 3EXAA 3QV1A 3EOZA 1L0BA 2GRUA 2REQA 4XTCS 1GN9A 2DQYA 3DZHA 3OJ0A 4U7FA 3TLZA 3DDUA 3IX7A 5JNLA 3IKLA 1X86B 1Q83A 4L4ZA 4FNAA 1I30A 3ZW9A 3I32A 1ODIA 4PTYA 4UFOA 1NNSA 1CY7A 1C7IA 1SZCA 1UKCA 3D81A 4R41A 2QAIA 3ZHBA 2VK4A 3H4IA 4JS0A 1AA6A 1W29A 1SB9A 4UD2A 4MQEA 4F5WA 4JLJA 5EXTA 4BX9A 1RJGA 4PANA 1E6CA 2ODQA 4GX1A 1K8RA 3OFVA 3BWMA 1HLGA 1E1RA 4GOLD 1T9HA 3LQ4A 1G8MA 1SG9A 4L72A 1UT5A 3RFVA 4PG7A 5ES4B 5HMLA 2D54A 4OC1A 1UMDB 1WKVA 1GQSA 3C7CB 3QE4A 3JS5A 3WWYA 2VK8A 3ZKAA 3DVQX 2JBAB 1M75A 3II6X 4L9WA 4V1CI 1OBFO 1QE5A 2H08A 3TVYA 3IMKA 1VP3A 1YU9A 1KOFA 4AYXA 3GARA 3JVUA 4EUEA 2YVUA 1KAQA 4ZHQF 1OXTA 5GM2A 1EWRA 3GUZA 4JWTA 3IUBA 2I2AA 3C7AA 4IVNA 2R8EA 4W9RA 5D51S 3HYLA 5DCUA 5H02A 1VI5A 4KNVA 4KLNA 4C4AA 1J22A 1HG0A 3LHSA 1FUKA 3IODA 1E7WA 4HDKA 4LXHA 4OMDA 3TQRA 3BG5A 5K05A 1E2DA 1XB2A 2IBMA 2BGUA 3UMBA 2PLWA 1Z5UA 3KNZA 4KAJA 5JAUA 4KZKA 5CVTA 3P0EA 1G2IA 4Q12A 1EK0A 2A9QA 2FZEA 2HC9A 4E2XA 1YSCA 5C9ZA 4N49A 2G08A 3VNSA 3WSWA 2BKUA 2CCKA 3N2ZB 4OHXA 4Q3DA 4R6XA 1CX9B 1Y4ZA 4MWZA 3VV3A 2A67A 3UOAB 3USZA 1HL7A 3BXOA 4HH4A 3AFOA 4WE3A 2C7OA 4FOSA 2BGJA 4X8OA 3FB4A 3FYTA 5B3JC 1EQUA 4TV9A 4B3JA 5FA6A 4EFKA 1GSHA 4R1TA 4L5BA 1OILA 1IQ0A 1CJSA 1ZCAA 3TVDA 3MRSA 3FROA 3D5TA 4FDVA 1H2EA 4YACA 2Q3CA 5I7UA 1IB6A 1O94A 2H5EA 2Z8YM 3BH6A 2BJWA 1Y3BE 2TMGA 3MSXA 1E2GA 1XAIA 2JGFA 3GLKA 3AF1A 4GI5A 4MLDA 3TIFA 4AS2A 5KSZA 3ILYA 3ZDCA 4MP8A 3SEFA 2BEUB 1CXZA 2CKMA 4PZUA 2JJ1D 4QELA 2I4TA 1IM5A 1E5VA 4ND7A 3CZ5A 4WLNA 3IDZA 5CHEA 3E5RA 1ZGCA 3QXGA 1RIFA 4KKVA 1VL5A 2HF9A 3IVCA 3NTQA 3IPRA 3EIWA 3MTEA 3EGEA 4MQUA 1W36D 3TMKA 4QYSA 4OIMA 4MUBA 5EZYB 1GV0A 3KJIA 1V6AA 2VF5X 3DOHA 1ODJA 3X44A 2G0TA 3RAJA 4O4IA 5KYVA 2CNWA 2F43B 4L4XA 4OHUA 3CJRA 3V48A 1M2NA 3G2QA 3ZGZA 1SMKA 4GKBA 4MEJA 4E46A 4KQJA 4ECEA 3GX1A 4PC7A 3MYRA 5DHAA 4DV4B 4YRKA 2HQBA 1U9YA 4RJLA 1XXHA 1YJQA 1G9TA 2FP4A 4NQZA 5B3KA 2E5WA 4HB3A 1BJTA 4TTQA 2I7VA 3TNJA 3K4QA 4D3DA 4ZO8A 2Z6QA 2BTQA 5TPWB 4ME6A 3ZYZA 4YAWA 3WYAA 2WUFA 3LXMA 5BR1A 3HZRA 3DBVO 5ITWA 3PL5A 1IUOA 1OV4A 3VTZA 4EG7A 3NPMA 1GDDA 2JLAA 4ZQIA 4KR7A 1D9XA 4I8XA 3KALA 2POCA 4OQQA 4MR7A 1RLUA 1A2KC 4Q1CA 3HFJA 4HYYA 3AKZA 3BKWA 3I2YX 4JD5A 2ZYTX 3AEZA 1YBFA 4ZI7A 3EFEA 2BTOA 1BXGB 4R8RA 1WXXA 3RUAA 3VU3A 4G1CA 4FCCA 4I1PA 3L49A 1D4AA 5KBYA 1M1ZA 4UQPA 1WKBA 4Z86A 4YMTA 4L0DA 3PV0A 4BLOA 1GZUA 3IQFA 1J25A 5J3JA 2PN1A 2NO5A 3JWGA 3WDLA 1RDFA 2RI6A 4M1ZA 1UKEA 1LQTA 3DNPA 3A1SA 3AUXA 4RD4A 3SEQA 3GLHB 3B9RA 2ZE8A 4U4AA 3EWSA 3SICE 1TEHA 4IJQA 4P54A 1GTL1 4QDOA 5LZ2A 3DEYX 2RAFA 2PH7A 1HI9A 3H84A 2UYQA 3OCUA 5EMJA 2H1CA 1V2HE 3WDMA 5B58T 3TE7A 2ORVA 4MR9A 3H0CA 3O4HA 2HX1A 1QVAA 3QE3A 5JZVA 5LVAA 1G1MA 1T9GS 2WQ7A 3FWPA 1IZZA 1YS4A 1GYRA 5BV8A 1MGOA 1VYHA 4JT4A 5J2UA 3HB1A 3JCZA 4IZOA 5A2GA 1NMYA 1QO0A 1T8YA 3LSTA 3O3OB 2WU1A 4IINA 4EW2A 3Q9UA 3LT5A 3SNHA 3VXKA 2WF8A 2WHRA 1UFOA 3ZD7A 3NHAA 1SK9A 3QZUA 4R4JA 1CLUA 1NMSA 2HJSA 4LHXA 3G5AA 3B7GA 1I6MA 4M2LA 3ZLVA 3SQLA 2GFQA 2YICA 1W88A 3KB8A 4B2LA 8LDHA 1P1IA 2PQ0A 4GSLA 3IAAA 3V8NA 4M1QA 2CLKB 1B15A 3E2MA 3L0OA 5C0OE 3OTOB 2ZJ0A 1JH9A 3A04A 4HP8A 4KQMA 3WNCA 5CLQA 3WWCA 5BW8A 1H5NA 5AKYA 2BUAA 5BMOA 1EX1A 2AK3A 3AF5A 1WV1A 4JFRA 4IXDA 2RGAA 1FVHA 1JDTA 2FN8A 2V3CC 1IOWA 4L4YA 1QM5A 5HQ3A 2CSXA 1T6YA 1WCYA 5FO1A 4C4XA 3A4IA 4R0NA 3AKCA 3EVBA 1Z2DA 3OZWA 4IIXA 3U7QB 3D4NA 3FECA 1DC3A 4P7FA 4XGQA 1N5LA 3BD6A 1AK9A 3X1ZA 4W63A 4CN8A 4JBHA 5G1PA 4PPGA 5DPMA 1M6VB 1G8FA 3ZCQA 4MB6A 4CTKA 4ER7A 2XCOA 4GIBA 2A9FA 4BNNA 1AKNA 1DLIA 2NV2B 4J16A 4Q4AA 4JOSA 1YZYA 2WA2A 5K0CA 4GLBA 4M49A 4GLFA 1PL7A 3VU0A 2V45A 3M70A 4QPDA 3BGIA 4PSVA 1UJMA 1ZI6A 1ZC4A 2HRZA 4LDQA 4J7UA 3OZVA 1PFQA 1E3QA 1QKIA 3OPNA 1G7RA 2WY2D 3SM9A 1NQTA 4BBAA 1QHNA 2O8CB 4O4JB 1CQWA 2AW5A 2LNDA 3RIXA 3PSAA 1POWA 2IYWA 3DULA 4OY3A