4INJA

Crystal structure of the s111a mutant of member of mccf clade from listeria monocytogenes egd-e with product
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
326
structure length
326
Chain Sequence
NAMIPAKLKQGDEIRIIAPSRSIGIMADNQVEIAVNRLTDMGFKVTFGEHVAEMDCMMSSSIRSRVADIHEAFNDSSVKAILTVIGGFNSNQLLPYLDYDLISENPKILCGFADITALATAIYTQTELITYSGAHFSSFSMEKGLDYVMESFSDCLLQKEPFALKESATWSDDEWYLDQENRNFIPNEGLVVMQPGVAEGIIIGGNLCTLNLLQGTEYMPNLAGTILFIEDDFMTIPETFDRDLESLLSQPGADEIEGMVIGRFQQKTAMTAEKLAYIIETKTALQKIPVISGADFGHTQPIATFPIGGTARIDTNQTDKIQIIRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the S111A mutant of member of MccF clade from Listeria monocytogenes EGD-e with product
rcsb
source organism Listeria monocytogenes
molecule tags Hydrolase
molecule keywords Lmo1638 protein
total genus 115
structure length 326
sequence length 326
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02016 Peptidase_S66 LD-carboxypeptidase N-terminal domain
A PF17676 Peptidase_S66C LD-carboxypeptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Class I glutamine amidotransferase-like 4injA01
3.50.30.60 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 LD-carboxypeptidase A C-terminal domain-like 4injA02
3T5MA 1ZRSA 4EYSA 3TLGA 5K99A 3TLZA 1ZL0A 5F9MA 5F1YA 2AUMA 4MI1A 4JVOA 3TLAA 3TLGB 4INJA 3U1BA 4IIYA 4IIXA 4E5SA 3TLEA 3GJZA 3TLCA 3TLYA 3TYXA 4MJXA 5FD8A 4E94A 3G23A 2AUNA 4H1HA 5JYBA 3TLBA 5F5XA 3SR3A
chains in the Genus database with same CATH superfamily
4LNHA 4OJMX 4YBRA 3VR6A 3Q41A 2QUKA 3LT5A 2HUPA 3OQOA 3BREA 1U7PA 1R8XA 5DNYB 4DR4B 5IH3A 3W05A 4DQKA 1NFFA 1RSZA 4LHSA 1VECA 5AK5A 2CLDX 1IBLB 1EFVB 3TW8B 2WABA 5K45A 1SVNA 4N76A 4TL8A 3M9LA 2OHJA 5D6OA 2O5CA 4L9AA 5ELLA 4DMMA 4XJSA 2AEFA 3LNTA 4XGKA 2ZBDA 1MO6A 2YQZA 5AM1A 5I6DA 3PC8A 5BSEA 3DWGA 3U7QA 1U3VA 4JWTA 4GRIA 3X2SA 4ENQA 2YZKA 5JS2A 1FDVA 4RORA 1YZGA 3SIRA 2OUKA 2H2AA 4LJSA 1S7CA 1GUDA 3BEOA 4AG3A 2FA9A 4ITRC 2OMEA 4AJPA 3HN7A 3G13A 2KMLA 2JD2A 2CDCA 4X44A 4UNSA 2VBCA 4AZ3A 2ZUBA 2BKLA 2EJUA 3GGPA 1IJEA 4ESEA 3FHLA 4DV3B 2IZOA 4P4SB 5KYXB 1PS9A 1OXBB 1E3MA 3L01A 2QX4A 2ID8A 3AUAA 4OI4A 1KBOA 3HCOA 1EZZA 2RB5A 4RHXA 3ZH2A 1ZEMA 1U2SA 4IAOA 3ITEA 4ZALA 4DR5B 4MQFA 3TK1A 2AMYA 1ZBDA 5B55A 2WF8A 1OC4A 2RB4A 3C6YA 3LO8A 4RV5A 4ZEOA 5AW8A 1U8XX 3LO5A 3R09A 4G37A 3WFJA 4J8PA 4AO8A 1CY8A 1EFHA 1LBHA 4G3XA 5IFLA 1P5HA 1ETUA 1M34B 2JVKA 4GRAA 3TX6A 4F5DA 3CR7A 3IIIA 5JVDA 3F90A 1PYGA 3SC4A 3H9QA 1RQPA 1RWVA 2HSZA 2POCA 1NG9A 3HR8A 4M87A 1YWGO 2NNWB 3F0TA 4OHUA 3FTCA 5CVDA 3CSSA 4EATA 3LQYA 3IBTA 4GXQA 2X9QA 4KTVE 3PC8C 3V97A 3VSEA 1DG3A 1WA5A 2HRRA 3OZ7A 2H2WA 4QO7A 3ZHXA 5E3HA 4CKEA 1R4ZA 3K70C 1UAYA 5FPYA 3E1GA 5ILOA 3MZ0A 4RWZA 4UXHA 2C4KA 4QD3A 5I9TA 3TJRA 2ZPUA 4JJ8A 2Y76A 4KDCA 4EGSA 1QH8B 2PIDA 1Z83A 3BJZA 3EVFA 3FB1A 4BFUA 5JAHA 1OJ7A 3H4IA 3O95A 2IUTA 4WXHA 3P9PA 3R7NA 2F1KA 4MRNA 1CP3A 2ON6A 1GGJA 3HCWA 1LQUA 2IZ5A 4YGXB 1PE0A 5AMXA 3QXXA 2KS6A 3H1AA 4F96A 5JIBA 3O74A 4C78A 1XNGA 3TJZA 1E6MA 3Q72A 4JLWA 5JDIC 3LLSA 1A5SB 1CQJB 2JDIA 4RHTA 3RCBA 3C3EA 1SZDA 2IHYA 4DCOA 5EYPB 2PG3A 4M9ZA 4Q4JA 3M4XA 4ZVNA 3KIPA 5KNCD 2QN1A 1G6KA 3CYFA 5HFAA 3F6YA 3FBGA 1XZFA 3MUFA 1LLCA 3GYBA 3BMOA 2C83A 4XQEA 3IOEA 5JZVA 4RH1A 4QU8A 2Z8YM 3CZCA 1QS0B 5KTKA 2V4UA 1RHRA 5I5GA 3TVTA 2NO5A 3MHTA 5F77A 1UJ2A 1HE1C 5ADHA 2WJ3A 2PX6A 1HZJA 2YYSA 3M4NA 3S4YA 1KYQA 1QYRA 4HLQB 4KO4S 1JQEA 1C9YA 1DFIA 4CIXA 5FBVB 3T7AA 4ZVUA 1NXXA 3M6FA 3OC6A 2JLCA 2JHGA 3ELWA 1ZVMA 3Q1LA 2YIJA 1GKUB 1NRIA 3IR7A 3G0CA 1E2HA 2DE0X 2VNIA 4CL2A 5GV7A 2F3TA 1Y33E 3BTSA 1PEYA 1X9HA 4KMMA 4LE1A 4IHJA 4NDZA 4RKEA 5K03A 3H8VA 5KI6A 1TKBA 3IEPA 1Y98A 3TYXA 5H82A 2K6GA 1JU4A 2PKQO 1DE0A 2ZSEA 5EPEA 4R3NA 4WNCA 2AZMA 2YCBA 4CZ1A 1QFXA 1W88B 2G17A 2Z4RA 3NFYA 4M8LA 3E7FA 4MV7A 4B48A 3DMPA 2QW0X 3ZGLA 4TS3A 2GTIA 2PD6A 2W2PA 2ZTVA 3EXIA 4K87A 4KIWA 4GOLD 5KYUA 2ZYVX 1K89A 3VHRA 1P91A 3LDFA 4CQJA 5TARA 4D9MA 3QVWA 1CR6A 1Z6GA 2O2XA 1W75A 1TUBA 1YB5A 2C98A 3NMUF 1BEZA 1RYYA 2ONYA 2WAYA 3VAYA 2ZB7A 2Q3BA 4PIPA 4R01A 5T4HA 2KQUA 3GJ0A 3R3UA 4JJAA 3VSCA 4XCQA 5K0CA 1W5SA 1YRWA 2CJXA 3RU9A 4GC5A 4MPPA 3CF0A 1KOFA 3Q7QA 3NZEA 1Y89A 3DE0X 4E22A 5BNFA 4BZXA 1NU8A 3R8XA 2C4WA 3C3JA 3AONB 2HHJA 1VYTA 2OQRA 3KYJB 4U5XA 3TLCA 3B6JA 1RCUA 1G3UA 2YJ5A 2F9LA 4RESA 2C7QA 4NECA 1GILA 4QYXA 4DARA 4GR9A 1JEAA 4AJ2A 5CLGA 1EDZA 2CF6A 4MLZA 2K4MA 1Y42X 4IKEA 4IILA 5FPQA 2UYYA 3U48A 4YUXA 4NBUA 1GQOA 1JG6A 2PTGA 2QYHA 2CXOA 4GGOA 1I2DA 1HGXA 4UEWA 1ULBA 4U0KA 3LX4A 4NL4H 2ECFA 5AHXA 3E2PA 4D9KA 4DQUA 3K9TA 1L7NA 3BE5A 3VH3A 3E3NA 3R2JA 3REQA 4TKUA 3KR0A 5IJ0B 4I2NA 4GNKA 1KA9H 4GAEA 1KS2A 1DLJA 1T8UA 3ZOZA 2KB0A 3GNQA 3KAPA 1W4BA 2GHQA 4KODA 4RZIA 2VWGA 3JQEA 3NNDA 5K0ZA 1DJQA 2R8EA 4MV8A 2ZGVA 1GAQA 1I7PA 4D42A 3PFBA 3L0ZA 2GSWA 5F21A 1P17A 3P1JA 2QRHA 4GP7A 1XTJA 4I4TB 1MH9A 1NXOA 2QGZA 1ZGBA 2V9PA 1U2ZA 1TUIA 1O4WA 3HDVA 3WLQA 4F4JA 3WK7A 3TRJA 1CBUA 4PXSA 5EMMA 3ZXSA 3ZJYA 1HDCA 2WTNA 3BGOS 1XZPA 3L84A 1UP4A 4IJUA 1MBZA 2LW7A 1UOOA 2X86A 1J2JA 3OIGA 4RQBA 4TWBA 2W0MA 4K03A 4L15A 4DCPA 5EERA 3VBEA 1EZ4A 5CUQA 3BK2A 4IHQA 2R79A 2PVPA 1KIAA 4TMZA 2HJSA 2DLNA 2ZRLA 1M8PA 5C4MA 2ZWIA 3NAGA 1J9GA 5A1TA 1XU4A 2Q3MA 1Y4UA 3IV7A 4L8GA 2WM2A 3NASA 1MB4A 4KVGA 1XSEA 1E6EA 3WYBA 3HB1A 4RMJA 4DCSA 1JHPA 3I6IA 3TINA 3CPEA 3VPXA 3FJ1A 3GP3A 4OXQA 1AKUA 3E81A 3R75A 4BHTA 2DIKA 1UMCB 3RK0A 2PZJA 2WTMA 4MVJD 5BPHA 2FR0A 1P1IA 2CXSA 2J6CA 4QYIA 4D9FA 2VTBA 3CZ4A 2PIAA 1RAHA 2OV3A 1S2OA 3OEED 2HWXA 4LOJA 4MW2A 4AMUA 5AM5A 1NN5A 4HADA 3NP7A 1RJDA 2HJRA 3HUEA 5THKA 4DCTA 1W2WB 3NIDB 4KLZA 3A9TA 1E20A 2YKGA 5HIMA 5JMTA 1CUDA 1L7MA 2RK3A 2YV4A 1V4BA 4TT3D 5DYTA 5BOSA 3VKHA 3H4VA 1MKYA 4EHDA 2DQKA 3B7PA 5G4KB 3ROTA 4E2ZA 2VT3A 3GQBB 1ACMA 3QUSA 2H1CA 1QRRA 2ZTUA 3K0CA 3PDIB 5LN1A 4BFXA 1M2EA 2VNHA 2PSJA 5KHOC 1NJ1A 5FBKA 3R9KA 3V1TC 4B6QA 4F46A 4XOIA 2HHHB 4RY2A 3AFNA 3O8QB 2C99A 3E05A 1LCIA 4R1LA 4EB3A 2WSSA 3UFXA 4EJMA 1F8GA 4J7AA 1IN8A 3F6EX 1EK1A 4JBIA 3UM9A 2Q3LA 4QTZA 5L3SB 3IJPA 2QU8A 2WTXA 5J63A 1BDBA 1IN1A 4JLDA 4UHKA 3GV0A 4CLOA 4JP1A 2HY7A 3IMKA 4ZKEA 2NU7A 3SHOA 2QMZA 2ZETA 4LRWA 4HQKA 2P9JA 5H9VA 5LSAA 3TDNA 2AFRA 4TJVA 1HT3A 3D7SA 4C7BA 4N8SA 3PUVA 4FNAA 1G5IA 1TJ4A 3GCGA 1HDXA 1FX1A 3FGPA 4XX1A 1V8BA 2QP3A 2OCIA 2F00A 5IAKA 2GARA 4XAQA 4QDUA 2CK3D 3Q3JB 4JXZA 1GZUA 1VE1A 2JFOA 3BAZA 2IYEA 4BQRA 2Y2UA 3UT0A 4C0JA 3CEHA 4GBED 1FQJA 4R9UC 3TTYA 2XVYA 1ZCBA 3WVNA 3T9CA 2BYTA 1X1RA 1G60A 2COEA 3UFXB 3UV7A 4H7PA 4J9UE 5FJJA 2XMDA 4XGQA 1QGUB 2Q3EA 1VZ2A 1EUCA 1P5RA 2AW5A 1VHTA 1OVMA 1GQQA 1I3KA 3FFAA 3O31A 2BEJA 1SQFA 2VT7A 1E1DA 1P4RA 2BN4A 2P6NA 4HRYA 2OC4A 4KH0A 2WJVA 4IICA 4E08A 2GTPA 1XMJA 5CVTA 4P2GA 5KVVA 3AETB 1H6DA 2F1OA 2QL5A 2Y92A 4XR9A 1N77A 1KP2A 1XCBA 4JZ0A 2G9QA 3S27A 2KLHA 2AL7A 2GBGA 2X1LA 2OFWA 1EM8A 3GLHE 2C78A 1RI4A 2AZTA 3LNCA 3AETA 3H5AA 3R5FA 2QRVA 3CW8X 2PCLA 3UJAA 5L3QB 1LI4A 3HGTA 4KB5A 4L5BA 1MG5A 3X2FA 1Y1SA 4ZHQF 1DX4A 1B0UA 4FMCF 2R9VA 4YO7A 3WGMA 3V8EA 3SJXA 5DT9A 4J0KA 1YDMA 1O95D 3PHJA 2CZQA 4BVAA 2WMYA 2XTMA 3L4JA 4ZU6X 2PMFA 1W29A 10MHA 2DVMA 2M9MA 3QY0A 4PE5B 5CJPA 5JAQA 3VKUA 4YRMA 2EZ9A 2GXUA 3DH0A 1VBMA 1KK0A 3WFZA 1Z0IA 1AKTA 4BNZA 3B6MA 2PMDA 4NOJA 2FRXA 4AG6A 1E1CA 3T5AA 2JFVA 1VL2A 2LKCA 2C4VA 1WDLA 3I12A 4JUAA 4UE3S 5CB4A 1GTRA 1Y1KE 3WTCA 1K86A 3JQAB 3DZKA 4C3ZA 3RWOA 5B6JA 5K8JB 1E3TA 2DFDA 1PSDA 6CHYA 1CR0A 1SUPA 2X5JO 2YWJA 1U65A 4CM8A 2Z3ZA 3JQAA 5B1EA 1H8EA 2UUOA 4B1FA 3ANNA 3FFTA 5AICA 1MX1A 1XDGA 2FMTA 1MJNA 4PO8A 1KSGA 3MWLA 1E0SA 5CLIA 2YJTA 4M8NE 4I3HA 1LBTA 2SCUA 4C7VA 1O0BA 3OMXA 4MDYA 4UULA 3DD1A 1E4YA 1NOJA 2MMCA 3MC1A 2GYYA 5FOSA 2QN8A 1N7GA 3FOAA 2JJMA 3O84A 3TUIC 1NIPA 2G4VA 3LT1A 3WL7A 4A2CA 4WJLA 5A3RA 1RBYA 4DZZA 5MGNA 3C6KA 1WSBA 3JWIA 2RK4A 3L4BC 1K75A 4OGKA 1QE5A 4QRDA 4UHFA 3HKBA 4U2DA 4BFZA 5D5QA 4BLWA 4C7OB 4A8PA 1PYOA 3MXOA 4ZWNA 1W9MA 3G9XA 3KL2A 2Q50A 1ZJZA 1Y8CA 2GK7A 5AVRA 1HQCA 2OK8A 4PSAA 1QKJA 4PQFA 1AVTA 2WJJA 4DIFA 3K70D 3ND9A 2VF7A 3K1AB 2ZIUB 3ODPA 5CIQA 1PJCA 2PBZA 2VUSA 2WIDA 2CUNA 4ILKA 1KYVA 5CAEB 4BGDA 2CCJA 3PQ4A 2GCEA 4G1MB 4DCNA 4DNPA 5KSWB 4COOA 4LC9A 4NGRA 2ORIA 3C5CA 1R9GA 1EQ2A 1U7OA 2I55A 3BJMA 4IJWA 3F5QA 4X20A 2VZEA 1YKFA 3KYDA 3SFZA 2I2XB 2GAIA 1OYWA 1T43A 3L49A 2I33A 3CE6A 3FE2A 1NFRA 4AYWA 1V8FA 1BWSA 3FOFC 4Y2VA 3B2QA 3UQYS 1SY7A 1W0KD 4EB8A 1W35A 1QIFA 2ZUVA 3MIIA 3R3WA 1G1AA 3IVAA 1K9VF 3EEOA 4IL5A 3I04M 1KVTA 5HZHA 3BZBA 3WRYA 1G3RA 4HDSA 1U81A 4LHVA 3RFUA 1CJCA 4KYIB 1W30A 3C3CA 3R0VA 2Q5LA 3E5MA 3SP1A 4AULA 4YRZA 2V6FA 1DJMA 1RQRA 1D7AA 3T06B 1LLFA 4ZCTA 2GPJA 2JLXA 1I7DA 3RANA 2JAWA 2OC9A 2B20A 2YW2A 5ILQA 4AP5A 1FVXA 1W2GA 2TS1A 5FFMA 1EK6A 1ZCAA 4C03A 3W5SA 4BMYA 2LCFA 5EZYB 4DLTA 4X41A 4DSOA 4LF9B 1Z82A 2IEGA 3CIFA 1V5WA 1ZM4A 3ENZA 1GUAA 1TLTA 3FZGA 3JTMA 4KO1S 1RI5A 2OM6A 1ZG3A 4O2RA 3GJXC 4D4IA 4FCWA 5IWCA 2C0QA 3NRBA 2JLSA 1C41A 1R64A 3BRQA 3PX3A 3W7AA 2MU1A 1O89A 1XRSB 1NATA 2PGAA 1S2GA 1KEEA 3BE8A 3U44B 4MIKA 3ZJVA 3IIEA 3VOTA 2ZSJA 1QRTA 4BN0A 1UMBB 4DLUA 4D98A 1M9NA 1JLRA 4HB4A 3BDVA 2E4UA 1SCQA 3ESXA 1P7WA 5B3KA 2ATVA 2CNNA 2MSCB 3RU7A 4G65A 5BOSB 3BMOB 4DCMA 1ZH4A 2OV1A 1SQ6A 1U2DA 4OHCA 5FFNA 1WUHS 1AV7A 2G8LA 4JYMA 1DU4A 1PT5A 1RWQA 2FCAA 1YBAA 1XCMA 1LW6E 3OCJA 4ZRMA 4C7JA 4QBTA 4E4RA 3FSGA 4XWOA 3AVUA 4RETA 3PFKA 3TCXB 2QZZA 3H65A 4MKZA 3ZGZA 1OBHA 3VTZA 3VKVA 4ALNA 4TV9F 4RCZA 1BX1A 5IWAB 1XZGA 2B25A 3L7OA 3WBFA 3ZU5A 2Y67A 4AZWA 1QGOA 4NCHA 4BS9A 4ND5A 2HSEA 1RU3A 2O07A 1JBKA 4I8IA 4CCYA 1UJNA 2A94A 2PSHA 1AU9A 3NVDA 2HK9A 2NZJA 5JWRA 2VHVA 1U11A 2OWEA 3S2GA 1MEEA 1ODKA 3JAMA 3Q88A 5T4FA 2ZFUA 3E23A 3ZR4B 1YJBA 4OJNA 1GPKA 1W47A 2CFRA 3HUTA 4C0BA 2HIMA 2QN9A 3AIMA 1JBQA 1R16A 3FI0A 4NZ9A 1GNTA 3GJYA 1X77A 1N5IA 3Q2OA 2QSJA 4ND8A 4XFDA 2CV0A 1DXYA 2J3MA 2CZGA 2QN2A 1M2VA 1T4MA 2PS1A 2H9IA 1F4LA 1KJWA 1HLPA 4JLAA 2C42A 3T38A 2R1VA 4B71A 4OHRA 2Y0PA 3K5WA 2P9BA 1ZUIA 4J1TA 2AG8A 4P45A 3ZHTA 3F6PA 2PTHA 3IL2A 1JSXA 1XQ6A 3QPWA 1I5OA 4P31A 2QW8A 3SBDA 2OKGA 4P44A 3ZHZA 5KTSA 1LC0A 1FJHA 1K5DA 5C8ZA 3DBLB 1HYGA 1NX9A 3H8WA 2QXTA 4QULA 5LB2A 3DZHA 4IZOA 1LDGA 2RGRA 1IN4A 2OYSA 2QL9A 3GGJA 4H1TA 1TYAE 4KP7A 4MWDA 5I9IA 4B3TB 3ROZA 3EA4A 3HCDA 1DUIA 1MOQA 1XA0A 2R8OA 4WW0A 2IUUA 4DEYA 4FYHA 2R1TB 3ELBA 1P4SA 4L9RA 2ZTHA 4OREX 2WHPB 4CN9A 5C52B 1GZHB 1LV8A 1AMNA 2AUTA 3DT8A 4OH7A 4BNJA 4CW7A 1D0VA 1SMKA 5BRNA 3UCXA 5JI3E 1KY3A 1M1YB 1E3QA 1EFCA 3K09C 4MR7A 1V25A 4JBWA 1HDGO 1L3IA 4LRTB 1Z26A 4UTVA 3BL6A 3IV9A 2DKNA 1GCAA 2XNJA 4XDGA 3D6FA 4IXMA 1K3FA 1BWQA 4LZJA 4O2LA 5E8JA 2CNOA 3ADKA 2FHSA 4EO7A 1ULTA 4GR4A 4OV6B 2LVBA 5K3FB 5HJ5A 1OX5A 3G0HA 4C0HA 1TEXA 3FM9A 2G25A 3KT0A 3ORRA 5J2UB 2J48A 4E09A 3G2MA 2BFEA 3ZVNA 1YGYA 2PLAA 1TKCA 4KGXA 4MQUA 4P4UA 1EJBA 3NEPX 5FWXB 1RP7A 1LPAB 4UCQA 2FW8A 1UBEA 2ZRPA 2VR1A 4HVAA 4JCCA 1CPYA 5C7OO 1FMLA 4R6WA 3KKOA 2XYQA 5AJWA 2CFIA 2H1OA 3ZD7A 3ZE9A 2Q0SA 1QFYA 1T4BA 1WDMA 4GQBA 1P4AA 2ODTX 4X7RA 3T5DA 5IPFA 1Z3CA 3DE4X 4FNOA 3SK0A 1D04A 3T5TA 3ZWNA 5HS4A 1BDMA 4G8BA 4II3A 1LB1B 2OXCA 2J08A 2CZCA 1TXGA 5CB8A 1KGSA 1W34A 2FEWB 1JLKA 4R81A 1B23P 1Z73A 2OHOA 5DGIA 4J3NA 4R3UC 1GAXA 1LUAA 2CEAA 2Z5LA 2VH1A 4UMEA 3CR8A 2VF8A 1HZZC 2BFBB 2BFPA 1M2WA 2CCKA 2WMOB 3G59A 4HB3A 4HX2A 4YFYA 1K7XB 3EN0A 3TNJA 1YFJA 4NLLA 1PJ8A 3K1YA 4F6RB 4RA9A 3ICQB 3CUWA 4EUEA 2PRZA 2A0UA 2Z56A 2HI6A 3GYGA 2PBFA 1G6HA 2FQ1A 3NOQA 1PLLA 2PZMA 2OP0A 2EK9A 1EBFA 3BDIA 5JSUA 4QGGA 5FPPA 3ZG6A 4C87A 1RRGA 3GUZA 4TYYA 1TKRA 4UM8B 1JIVA 1N4DA 2JAUA 3BGVA 4BMSA 2R68A 1TLLA 1YVUA 1N33B 1ONBA 1YCFA 2CLCX 3L0SA 2ZYRA 3DEAA 2VP4A 1J06A 3DYBA 4I5GA 3HP4A 4J1NA 4L57A 5IM5A 3ZQ6A 4ZYUA 5HVNA 2X6QA 5AYVA 4ZYYA 4A27A 4KW7A 1NVMB 2X1VA 3GZJA 1OZAA 1Z4IA 1E1YA 4JY7A 4PWYA 4R40A 2NUAB 2PAFA 1URPA 1YQXA 1X7XA 3FYSA 2PZEA 3LHFA 2REQA 3F1LA 4LS3A 2F67A 2XUIA 3JWJA 5B3JC 5ENZA 3M34A 5JZMA 4RL6A 3GP8A 5CJJA 2W58A 4ZIRA 2EBHX 3NHAA 4JC0A 2P5SA 4D9EA 4NGMA 2HPZA 3GRKA 4OY3A 3F7TA 1EXWA 4Q3AA 4TV9A 5KYWA 3I73A 1M2KA 4PZYA 2GH1A 2YW9A 4L28A 3WBBA 4URZR 4D0SA 3R6DA 1DEAA 2AS0A 4KWTA 2C5HA 2JH9A 2AEJA 1BU8A 1DGQA 3UZUA 1BQ3A 3LKZA 1XL0A 1DJPA 2AE1A 1NJFA 2X9VA 3MIZA 2ZR8A 3H83A 5F3DA 3FNQA 4NAVA 3RHFA 4AQ7A 4F3CA 1JEOA 2Q2VA 3C45A 3IDSA 2B4KA 4D6XA 2P7HA 4MINA 4RHUA 2HHLA 2PKRA 3GDOA 1B42A 4LVOA 3P19A 5ETJA 4B5KA 3CKLA 2D13A 5B57C 3NIGB 2Z95A 1PU2A 4GWLA 4KQIA 2XXAB 1WU7A 2I2BA 2QI9C 4CM5A 4CNQA 5IKXA 3NIFB 5DBFA 5ESDA 2OD7A 2O8VA 4GBJA 2H59A 3DGEC 1XD9A 1H2BA 3MAAC 3ZNPA 3T1QA 5CG2A 1ONNA 4DCVA 2C6CA 4PHHA 4Z3OA 2JI4A 3QYJA 2IYRA 1O54A 2Y3IA 5PNTA 1EK2A 1PGPA 4ZZ1A 2Q99A 3N1UA 1K6MA 4G89A 4X0EA 3NAMA 4FD3A 3CXRA 1LVGA 5JYDA 2DTXA 4WCFA 4AJLA 2QTGA 4EG4A 3E1KA 1E4EA 3AZQA 3VC2A 1JDBC 3BTUA 1K8XB 3W0LB 2ZT8A 1R4MB 4WCFB 4XASA 1KWGA 1OY1A 3AR4A 3ISJA 3R5JA 5JSZA 5MHTA 1NZJA 4UASA 2PVVA 1TPZA 3FH0A 3B3AA 4JGGA 2Q0HA 1AS0A 4L4RA 4Q4HA 2ZRFA 3X1ZA 3LF2A 5K3CA 1W49A 3KKEA 3NTLA 2BGTA 4KAJA 4F3RA 4EHFA 4P4LA 3EWIA 4FFVA 5CJ2A 5JH7F 1DTWA 1X1TA 4NEQA 3SF8A 4FQ7A 1VKZA 4DMUB 4QWWA 3AKCA 4C89A 3OQIA 3F47A 5IBQA 3U1TA 4BNGA 2WP8J 3ZWXA 1RFGE 3JZAA 3LVRE 4HD8A 3NH9A 5L9AA 4OP1A 5JTUA 4NXNB 2NZ8A 2DHQA 3QWIA 2A0XA 4ZQBA 3PEVA 3W2FA 4EA6A 3VKFA 2H54A 3F9RA 4TVOA 4MWBA 2Y66A 1GZ5A 4JJKA 1Y8QB 1XYVA 2H9YA 2EFEB 1C0EA 1EGAA 1CLEA 2OT3B 4G84A 1V16A 3TQSA 2O8EB 1ENOA 2QRZA 3ADDA 3ZBUA 5BUSA 1UC5B 3LVQE 5FFFA 1PJQA 1JJVA 1YJXA 2BSQA 2FPXA 2WJZB 4ZT7A 1XKXA 4B3GA 3WB0A 2P75A 4BATA 3BC1A 3OUTA 4DNQA 1BMDA 5T6MA 1HT0A 4F8YA 4HHEA 1PRYA 5DIFA 5BMVA 1QOPB 4FSDA 1BZYA 1ZISA 4TTPA 2PNJA 2I34A 5DWQA 2AJ8A 3EBLA 1TW3A 1KAEA 1UMCA 3ETCA 4XDZA 3UB4A 4MV0A 2QT1A 3BXEA 2A88A 3I01A 4DM4A 4P58A 5KB3A 1KU6A 1Y3FE 1NZFA 3KKKA 1OX4A 4CLHA 1G2IA 2FZ4A 2IODA 4CMKA 2ZM6B 2ICAA 4DB2A 4MXDA 1YCDA 3B3GA 4FEAA 3UXYA 1DP4A 4UTZA 5DNUA 4GKJB 3C1TA 3QFFA 4H1UA 3CLHA 4QJIA 4F1JA 1LDBA 4CI9A 2I9PA 3RTCA 3TZCA 5IF3A 1L1FA 3RU3A 2I6FA 3M6AA 1DO0A 3ZNQA 3F6SA 3WX0A 2VKQA 4M1MA 1TCVA 3EGCA 2CHGA 1U90A 1Y4AE 3M89A 1W5AA 1NW3A 2XXBA 3BTOA 2O8BB 5JV5A 1G3MA 1Z88A 2QJOA 3MSCA 3VVMA 4NZPA 4ZGBA 2FSVA 3MINB 1Y6RA 3TZQA 3HY4A 4ZV7A 3LGXA 4D3ZA 4KLRA 3UK2A 4QT0A 4INOA 2C0PA 2D8MA 1NYRA 3WLEA 5K0FA 3HXMA 2G9UA 1A98A 2Q9AA 5CTJA 4HLUC 2RBEA 3DAGA 4HXFB 5LA6B 1JLHA 3BXGA 4JLOA 3KAJA 4LF8B 1NF2A 1T6ZA 4Q18A 4XM0A 3HRHA 1ODIA 3LG2A 4D4GA 3BSFA 5IZ4A 1T3HA 3KCQA 3SQLA 1N9KA 4LNUB 2DH6A 2ZCJA 5JXGA 4ND6A 1T10A 1GYPA 1PBNA 2YMLA 4IXTA 2DBZA 4YJ2A 1UM8A 5CH8A 4A0SA 2LDBA 2BKUA 1SG9A 1Q11A 1WUTA 3QTBA 4BQIA 4BFTA 4HQRA 4ATNA 4EBFA 3L77A 3DVSX 1JWAB 3BQMB 5JROA 2ID7A 4MKRA 4RMHA 3NWPA 3FJYA 3KSBC 2EJBA 4CDMA 2R6HA 2E7ZA 4O29A 5K05A 3A4IA 4N5NA 4HQFA 3WK4A 4MW7A 1G20A 1MPXA 4MWSA 5HG0A 1XZKA 3K9NA 4UVGA 5FHQA 1WOYA 2VRNA 1OYYA 2Q29A 3CFYA 1B7GO 4QU0A 3SU8A 3VC7A 3WGZA 3ZI0A 4OU4A 2YN2A 1MQSA 4PLWA 4NZOA 3LT2A 3KEOA 4DPKA 1SOUA 2CDBA 3GFPA 1OAAA 2QQ5A 2B9VA 1U1GA 1H2FA 2RGUA 1AKWA 1QGAA 3MELA 5HF5A 2NUPB 4BMVA 3K6SA 1K06A 1KC1A 2BTOA 2G80A 3MBKA 3GLTA 4KXFB 5I3CA 1M2VB 1N2GA 4LVCA 1WF3A 4YUVA 4EH1A 4AUNA 4ABTA 1LJUA 4MP8A 4ND3A 1U2EA 1DTEA 4E0BA 3HYCA 3DDSA 1XAJA 2JI8A 2AV6A 2QD5A 1K5HA 2IU6A 2ZWOA 3PX2A 4MV4A 2Y4OA 2B6HA 5JFGA 1P4GA 1F5NA 3OQJA 3K8YA 2I4RA 4PW0A 1MRNA 1SCDA 4MB2A 5IC6A 1UBCA 2AYZA 3C4QA 2CNDA 1UFRA 2QVGA 2QKYA 4JMPA 4TL9A 3UHJA 4BIMA 4NEHB 2KYRA 3IP8A 4RL4A 4D9GA 4UEOA 1G0NA 3GLGA 3KASA 4CEHB 4UUPA 1YACA 3LDHA 5KTMA 1M1ZA 4MVJH 1KF0A 2XPCA 3GCXA 4N40A 3D1LA 2WWVD 4MEAA 3RIGA 1MC8A 4KQWA 4KX5A 5EJ4A 2FETA 3QJ5A 5DLYA 1TD9A 3CKKA 3OZBA 5JMPA 5HWSA 1RYHA 3WNVA 5JY6A 1TZKA 2GB4A 1L9KA 3AW9A 3OKFA 4HWTA 3LCRA 1UPTA 2NXJA 1N9GB 1D6JA 2M32A 3CRVA 3D9QX 3HCNA 3KS9A 3OEEA 4PIVA 1CUFA 2F1IA 5CYGA 1V6AA 2CJWA 5M34A 2PUFA 1Y7IA 1L5VA 1Z5WA 4CO9A 2C1XA 3EEYA 4OIMA 1TB4A 1Y6ZA 2CLSA 2P27A 2Q9CA 3JQ8A 1OWLA 4PYRA 4M21A 4IH4A 4PC6A 3RUDA 2ZRKA 1S01A 2W22A 4B3DA 1IPHA 5DT2A 3V46A 4RVUA 3K1JA 3KT6A 2W42A 3IO3A 5CDSA 1YDEA 1CQIA 3HY3A 2HA5A 1UP7A 3OTWA 1GIAA 4AN4A 1U2GC 3LYHA 4H4EA 1Z0DA 3IPCA 1NM5A 3OM0A 3WG9A 2JFPA 2XVMA 3KV1A 3LKVA 3VTKA 3KTFA 1VRVA 1A5ZA 2XZTA 2Z1NA 1AQUA 4PGGA 4QUBA 3HKEB 2XUHA 2B94A 3ZD8A 4WKCA 3A9VA 3HCPA 3W4JA 3A2KA 1QYVA 1TJNA 1XMIA 5ES3A 1TA4A 4RJTA 2UZAA 2D0OA 3CN9A 1M2FA 4MCSA 1H2RS 2Q1SA 3O9MA 3AEUB 3NC4A 1BJRE 1GGEA 4H7DA 3UBTA 4PWZA 3RSHA 4JZKA 5BSVA 3P0IA 5L4NA 3U37A 2DKOA 2VUUA 3B70A 1Z75A 3WGVA 4K6FA 4TTIA 4V0RA 1RMYA 2ECOA 5AM0A 2PGLA 2FW6A 3I0ZA 4YJFA 2A5LA 4RADA 2BGGA 1ISJA 2IHKA 3ER8A 3X43A 3PDUA 3VOSA 1O6ZA 3WLOA 2XCSB 1PQUA 1ZUHA 2BGKA 3GLIE 3RRNA 3G2IA 2ZBRA 1N7HA 4C7OA 3L6CA 4HCJA 2R84A 2CXNA 5K2OA 2FMFA 3L46A 5CT6A 4DXDA 3VFDA 2AYYA 2UYGA 4KI0A 2VZ8A 3LXUX 3B53X 3JRWA 3MCTA 5J2UF 2QX8A 3F67A 4MGIR 3I5UA 3IAAA 1R27A 1GNVA 2AFHA 2QVYX 3LK6A 2VDQB 1BN6A 3QIAA 1FFAA 4RGQA 2AOVA 4IJ6A 4B3FX 4RACA 3N7TA 4DUYB 1CJVC 4NHOA 1ZK4A 2W4IA 4BU0A 3ELDA 4C4ZA 2ONZA 5AI9A 2IQ5A 4AZSA 4AKGA 2I67A 1PTJA 3BHMA 4IBOA 4P83A 1FBTA 1Z5GA 2A1TS 3CVWA 8OHMA 5JJKA 2ASVA 1SPBS 3AKDA 4HFRA 4PFKA 5IBRA 2ZT6A 4LE2A 5KX5B 1WXFA 2EQBA 4KQKA 2E87A 3BA6A 3V4RA 2BY4A 1WCWA 4WLEA 3W34A 2OV6A 3QNWA 2YXBA 1WVGA 3E27A 3DZFA 3KK0A 3NC1C 1JQAA 2FEMA 1KORA 4HI0E 5L7YA 5IXJA 1LWNA 3SYLA 2GZMA 3KFXA 4QWMA 4UE2A 1IXRC 3WSVA 3RC8A 5F2EA 3GRFA 4C84A 1J1ZA 4IVNA 3I9KA 4X66B 2N1MA 4OK3A 1HZZA 2BFAA 3AF4A 4BV8A 4LHWA 2XHZA 2JJ2D 2NTVA 1XB2A 1YR6A 3S29A 1NBIA 4GVPA 1WB5A 4ME6A 4O63O 4WE3A 4Y2XA 1OV4A 3ILHA 3UICA 1DX9A 1P1FA 5DWVA 1NJSA 2A84A 3TQOA 3WLMA 1XT6A 3TTSA 4ETWA 2R11A 4FN4A 4Q12A 1T15A 1EX6A 1UMDB 2OAEA 4UBIA 2WUVA 3JALA 3Q0IA 2J85A 2PH3A 5SYAA 1TVEA 2PX2A 2OHHA 5FA5A 2EEPA 1E6LA 1KBQA 1ESZA 3UAZA 3HJRA 2WHEA 1GLNA 2BRUA 4BLOA 5KS2A 1SBQA 1ABFA 3TIGA 2XDWA 3GX1A 3IQWA 4N12A 2GHRA 1Y1PA 3HSYA 4M3NA 3RVRA 1IQRA 3EA0A 4RS4A 3U60B 3ZDCA 3SQOA 4D8WA 5KVSA 4WXRA 2ZJYA 2HXGA 2X1MA 2QN6A 4WBXC 3O3NB 3OICA 3JQRA 4ETNA 4LXUA 2NSLA 1VKNA 3VC1A 4LOIA 2QLFA 2CKMA 2CMFA 2VF5X 2C7VA 2PEYA 2AXEA 4JJIA 1NURA 1GTSA 2FW7A 3O4IA 1TE2A 1BO6A 4FONA 1BCSB 2ZTSA 1HI9A 5KNBD 4FEYA 2AX3A 3OIUA 2I54A 1NJ8A 2X42A 4WY5A 5KYXA 2FAXA 1CCWA 2FHPA 3G5AA 1C3OA 1NI4A 1NJ2A 1AKVA 4MQEB 4F4HA 4TV8B 4ZYXA 2PMEA 1Z68A 2VP3A 4ZCQA 3RJTA 3PEUA 3VYRB 4JLKA 3TLYA 2JFXA 3NG1A 1LPPA 4P3NA 3F8TA 4NRDA 4DQXA 5D5PA 3MF4A 2LUOA 1UIMA 4K2AA 4G36A 1ZOOA 4G1VA 2WE8A 4X3PA 2IIBA 3KJIA 4FZ3A 1R88A 3K72B 1UDCA 3LP8A 1AGPA 3ICWA 4IVRA 5JSFA 3E7XA 5DEIA 2E6UX 2FPLA 3E6AA 1ST3A 2GFQA 3NRCA 2WWYA 2YHBA 4TTJA 1BOOA 1ULSA 2EFHB 2E89A 1UWKA 2CD9A 2J3KA 2VL7A 4MWCA 3ET4A 1MIOA 1XCJA 3LUFA 2NU9B 1BVUA 2QR3A 3I76A 4DV5B 1FFEA 1GITA 3FNBA 3OHSX 3KU1A 2C5QA 1TPYA 2KSQA 1L5NA 3U4QB 2PRJA 3C14C 1EFVA 3QK7A 4MQ4A 2JLWA 1SRRA 4FT2A 2JCGA 4J94A 1GDDA 3KDPA 3SX0A 4EG5A 2NQ2C 2WHXA 1QG4A 1KAHA 3HADA 3MB8A 1TM5E 1Q1AA 2J41A 3SE0A 3H2IA 2UDPA 1V4VA 2JJ2A 1FXUA 3ND7A 4WFJA 4B33A 5LOVA 2I9KA 4TLLB 3AY0A 1ID1A 5U4QA 1MABB 1OBOA 4MCIA 1DCFA 1D0SA 1B93A 1G19A 2XAAA 4HYQA 3BMCA 1L5HB 4K9QA 4TKVA 2YV3A 3W5VA 5G0SA 5D87A 3SS9X 1C9JA 4RVDA 3U1VA 4UM7A 2IWHA 1EMDA 3V80A 4JBGA 4KRFA 1PTKA 3N39C 3AGPA 2IV2X 5HCNA 1T5BA 2OECA 2W6QA 2BFWA 3CUSA 3PFFA 4M1EA 5LBTA 5EMLA 4LFCB 1VCHA 1VHDA 4FIZA 3IULA 1E2MA 1NYLA 2BFCA 3AF1A 1E8MA 4LNAA 1HETA 1JDBB 1KY2A 3MJSA 3TRKA 3UJDA 5JR3A 3K94A 5JLAA 5TPZD 1IEVA 3FOBA 1KVSA 3M6MD 3OLZA 4G4GA 4W9YA 1PNTA 2GOYA 1L3CA 2IF2A 4LYJA 3N75A 1GPNA 4C76A 4EPRA 2NN3C 5JXWA 2P7IA 4ID3A 4ZOLF 4UFNA 1YA8A 2D2VA 2HYIC 3TSCA 5JSYA 4C9BA 2J0SA 3QRWA 3V7FA 1N3YA 3KALA 2CXHA 3OQIB 4OHZA 3FSJX 3WYNA 3NBUA 3KTAB 1ML3A 1Z5VA 1B0AA 1T0HB 1FCJA 3PXUA 4XKJA 5TF0A 1YVEI 2F9MA 2PAAA 3ZK7A 1PGOA 4NOKA 2XTJA 1RYEA 1E4OA 2EW2A 2YUIA 3O73A 1QTNA 5E38A 3R8CA 3VH1A 2CV1A 2G1KA 3M1YA 5CEJA 4KZPA 3JASB 3O21A 3SJAA 5ADUS 1SKQA 3G2HA 3GCDA 3ITDA 5JSZB 1P3DA 1Q21A 4MR7B 3GN1A 1X13A 4C2UA 1ADJA 1VLHA 1PGNA 4NYIQ 5F73A 4M53A 4DA7A 1ND5A 5JVDF 1T24A 1S4QA 3FFWA 3RTEA 3JW8A 3S6JA 1H3FA 2D2FA 2QJTA 2GN0A 3EQ9A 4GEKA 1ZSYA 4Q39A 3NORA 1SCAA 1WY5A 4UOZA 2H63A 4DGSA 1XMQB 2BISA 3COPA 3PNPA 2PFSA 1OXSC 1R0CA 4D96A 1QQ7A 1X8XA 3EAGA 3EGVA 1Z16A 1PFYA 1U80A 2HI0A 4E5PA 3UXHA 3FTNA 1NUHA 1YXMA 1NGSA 2H2HA 2VJPA 3LT0A 5DIZA 2QX6A 2I22A 1EFKA 4OHWA 2OXRA 3EH2A 1H2HA 3A06A 4XEUA 3RASA 1U2PA 4Q19A 1ZRSA 2DWOA 3GBSA 3OLCX 5KBYA 3P32A 3A1EA 3JWHA 4KCGA 4BB5A 2L0XA 1N7JA 1I14A 1U8CB 2WSBA 2XX3A 2DQYA 1YMVA 2HA4A 4V03A 3QTLA 3HA7A 5JDCA 3LX6A 3PVSA 1ZGHA 3FPCA 3QVXA 1S9HA 1YHNA 2QZPA 1E7QA 3AFOA 4L9WA 4NZYA 5D8DA 3SPXA 4E12A 1N8KA 2H7VA 2WUDA 5DOVA 3H6GA 5FUMA 1LBQA 1W6RA 3SEFA 1EDEA 2C2HA 5K2MA 4BC0A 3SWWA 1TA0A 2QT0A 4ZK2A 3BRWA 4WQMA 1GT91 4PAWA 5IJ9B 3VJLA 2WM3A 4W5HA 5FQNA 4LWOA 3SLKA 4D0RA 5JBNA 1PS0A 1M2OB 1XVAA 3DP7A 3QX8A 3GLFB 4NEGA 4EBBA 4GIBA 2HADA 1Y7LA 4ZYTA 2PUTA 1B43A 1JDSA 1PCXA 1RMQA 1SOAA 1T6NA 2X5KO 1ISHA 4NCNA 1I10A 2PX3A 1IN7A 2G72A 2P6PA 2W7TA 3H0KA 4U7TB 3WQSB 4AY3A 4ZI3A 1CDEA 4OC4A 4CIYA 3NOXA 3DZBA 4MV5A 3B36A 3GLVA 1A5AB 1BCRB 1ZA2A 4IH9A 3PD0A 2HL6A 1C80A 1JIUA 4GXNA 1OYVA 3A7DA 4F6LA 1ZOIA 3SCZA 4U7HA 3ME5A 3L6BA 4X60A 4BB0A 1E89A 2X7HA 5TGZA 2VZLA 3D8BA 2QN3A 2V98A 2JD1A 3NW9A 1YQEA 3A8TA 2QRMA 5IH7A 2OBNA 5E3JA 1K6XA 1V96A 1NWHA 1BYUA 2GCOB 4LFAB 2G0TA 4RF3A 3N0TA 3OOEA 4ND1A 3L2OB 3CBGA 1RRMA 3IBYA 3OWOA 3HJNA 4OHXA 1GKLA 4MYUA 1F12A 2QQGA 4C9AA 3QLVC 3PK0A 2B69A 1P1JA 1Z33A 2HV8A 2JANA 3KELA 5E9AA 4Z3DA 3OX2A 4BE9A 4L9SA 1GGOA 1ZOLA 3WHIA 3CHYA 1O87A 3ENQA 4AP9A 2HWWA 4ZC1A 4BX0A 1UKAA 3HKCA 4X8MA 3GJ6A 1JKIA 4UUBA 1FA9A 3HXPA 1MIHA 4AL4A 1IHXA 1A4UA 3OJFA 5CTAA 1E66A 5JNVA 2WVHA 1JH9A 2V8BA 2QMYA 4FB4A 2EP5A 4N3CA 4IEIA 3KJHA 4FQ8A 4Q47A 2H1VA 3JQ6A 2VQFB 1R10A 2H16A 1JA9A 4PGFA 4QXAA 1RCTE 3DDOA 4ZAGA 4AJHA 1MG0A 4BZZA 1T1EA 2D0OB 3QVMA 4REQA 4R5MA 4CDRA 3LGAA 1NVGA 3CZAA 3W7VA 5I45A 1J5XA 1FY2A 3L7AA 1EDBA 2RE8A 3THXA 1U04A 1QAOA 3VPDA 3X1WA 5J4YA 1Y9EA 5K3DA 4A1FA 1CC1S 5CA1F 3RT1A 5F52A 4Q9IA 1Z4JA 2TECE 4NBVA 2Q3CA 4IIJA 2GBCA 5FJIA 3GDHA 1N5OX 4CDNA 3AZPA 3PNYA 2V7WA 2WF5A 2HF7A 2NSJA 1HYBA 2I65A 1NBAA 3HV0A 2X1HA 3U4DA 1N57A 2DP4E 3BL8A 2P9EA 1UF9A 1NW8A 1OTXA 2JIZA 1WB4A 2WWTA 3DEHA 4TQGA 1F2DA 1N6KA 3SR0A 3VKWA 3D3QA 4DY4A 3VHQA 2X0NA 1FMFA 5C4GB 2HYDA 2UVQA 3N6XA 3WLSA 1Z06A 1P1KA 3KJEA 3QPVA 3BJRA 3MMSA 4D8TA 1MA3A 1PL7A 5FOQA 2EU8A 2ZYHA 3KVYA 1F8XA 4YWJA 1YB7A 5LD2C 1GNPA 1XZAA 4Q1DA 3IMEA 4O4LF 3IEVA 1CY1A 1LLUA 1POXA 1YKSA 2ZANA 3BERA 4TLCA 2ZAGA 1OCEA 5B2EA 3UN1A 2GEBA 2RGNC 3PQDA 5AH0A 1A72A 3PF9A 5C4IA 3GHHA 1T2DA 5PGMA 1UAAA 1NONA 1O2DA 4GUAA 3DKIA 4J0NA 1KJNA 2BFDB 2JVIA 4RV4A 1P1HA 3PWSA 2Q0QA 1HFEL 3LC1O 4NG4A 3CJRA 2IHUA 3RSSA 1O9GA 4IEFB 3K0CC 2YRFA 1PZNA 1YMQA 2FEAA 2WJAA 3A2LA 3WXBA 4IG9A 3QOYA 5EPOA 3PRYA 1CHNA 2TSYB 5KIAA 3EX7C 2DHDA 2I7CA 4OG2A 1IXYA 1UDXA 1QBKC 2BPOA 2I6TA 3FR8A 3H2HA 2LZ0A 2IPLA 1FC0A 1VC2A 4IM7A 5MN5A 4AI6A 1LRKA 3KUUA 4MA0A 4Z4GA 2IYOA 4KQGA 1R61A 2ONCA 4RKQA 5E95A 2HEGA 3ZWDA 3FKSA 3D6NB 3ON5A 2QLBA 3FAKA 1AE1A 3C98A 2JIDA 2JFZA 4I55A 4K9MA 2N3ZA 2J5QA 3QUCA 3STXA 5IJZA 3HYSA 2WVJA 4CLOB 1GARA 2P5UA 1FE8A 3HJBA 5D86A 1QRAA 2RHOA 3K0FB 3K9GA 5GPBA 3TNYA 4ZCRA 4GOXA 2J3JA 1J56A 3LPDA 2YY5A 3MS7A 3IKMB 3GEGA 2HA6A 4OB6A 5JYEA 4JSTA 2DRIA 2B4AA 4AF6A 4YT8A 1XE3A 1Q7EA 4CKXA 3BH7A 1CZNA 3UK0A 2REOA 2IHVA 5FUVA 4LDRA 3FPHA 4KLAA 4IUCS 8AT1A 5KVAA 4OUKX 4DLSA 2OSVA 3T5BA 2VA9A 2EBWA 1Z8NA 5ANRB 4C6TA 1GP2A 4ZJYA 1Y6GA 2XQVA 3M70A 3HEMA 4N5IX 1KR5A 3F3YA 2ZBQA 3P0HA 2XB9A 4JVNA 3GLIB 3EPLA 3PE4A 1WR8A 4MZDA 1DC3A 4IXNA 2JBAB 1J0BA 2GN1A 3GFBA 5BV2P 5AK3A 3VTFA 4D81A 4HG2A 3IEKA 5CT5A 1P2SA 3C85A 4IQ8A 4ZREA 4RHCA 2AHRA 4R2MA 4CM6A 4JLMA 3SN6A 2C3OA 4F0JA 2NZWA 3R5SA 1YS9A 2JS7A 5AK4A 2IVZA 2GZDA 3WKBA 1AQLA 1UM9A 1RKBA 1DKOA 2J5KA 1FQOA 2WKQA 1BJTA 1WUKS 2WD7A 3JZDA 4INAA 2VRCD 1BMQA 3RHZA 4UU0A 2W2OA 1XQWA 3OP4A 2AMVA 4KDRA 1AKMA 3ETLA 5TIIA 1IFXA 4G8CA 5GP1A 3RRBA 2IOFK 1KMIY 1AKNA 2XQJA 3K15A 4CJXA 1WPQA 2C7BA 4D4KA 2IYNA 1N34B 1E4VA 4PSKA 4DB4A 4R84A 4WLFA 4DZRA 3ANSA 4LYHA 5JEEA 5AHOA 1I4EB 1FX0A 1CUEA 4KQMA 1G4HA 1X80B 1Z12A 2EBUA 3DEFA 2AWOA 4M1ZA 4MRSA 1YZVA 4O4LA 5TMDA 3RADC 2FI1A 1ADGA 1DKQA 1GRRA 1Q7GA 4QPZA 3O38A 3A05A 3J81A 3I42A 3CUYA 5DBHX 5IAGA 3IDZA 4Q01A 1OV6A 1M6YA 3AF3A 1U1IA 1ZI6A 4EG0A 1MAAA 4N3GA 5B58C 1II9A 2ZE7A 3H86A 3K16A 3PNLA 2WJYA 1OHHD 2DFPA 4XB1A 4M88A 5F64A 4EUSA 2TYSB 2ZJ4A 4IR7A 3G02A 1RHJA 1ZKMA 4LSMA 3NONA 3VZPA 3MERA 5ALRA 1LRJA 4M8DA 4OOFA 2O05A 4OQ4A 4RLFA 3P96A 2FJUA 4JVLA 1IOWA 2P79A 1RI2A 3GPLA 3MWJA 2A9FA 1YK0A 3WGNA 1A71A 4XJXA 1QHYA 1MVOA 1X8KA 3EEFA 1DHRA 3SKXA 1ZK0A 4ALIA 4F5ZA 1FFSA 1DDIA 2XUAA 3AFHA 5AUNB 3AB8A 3UMCA 3VUFA 4OHFA 3P4YA 4P4IA 2UZ4A 3NWOA 1J0AA 1XTTA 2DHCA 2MSDB 2OBYA 2R4QA 2P2CA 2X2EA 3COSA 2O9JA 4YC7A 4PYQA 5TDHA 2H17A 1U98A 3JARB 3OG9A 5F78A 1VKHA 4WA8A 3QOXA 4C2TA 1D6SA 4R3WA 5EJ2A 3H13A 3KHSA 2PX5A 2RGGA 4O6VA 3EXHA 4B40A 1RQGA 2YY6A 1RHUA 3ICEA 3C48A 3ZWKA 1OWOA 2YJ3A 4V39A 1LS6A 1V7CA 2IX3A 2JFFA 2C1ZA 4MVXA 5HHTA 3JAWA 4XCVA 2QSZA 2J09A 4G5SA 2E3JA 1YZHA 4QTXA 3AK4A 1IY1A 3HU2A 3EVZA 4GZ6A 3K5IA 3A10A 1ZJ6A 3AQ4A 3L18A 3GPDG 1JSLA 2XB8A 2ALJA 2ZG6A 4J91A 5EKDA 2B8JA 1ZI8A 5JDIA 4OMCA 4TWEA 3P9KA 4JLPA 5KJCA 2G1UA 3AUUA 4MCPA 2X2OA 3UH0A 3CLVA 5TVKA 5DNCA 3SVZA 3GCZA 1M76A 1EG7A 1EQUA 2B8TA 4YMHA 1T1GA 4EX6A 1KBZA 4U2FA 4C6HA 5JRDS 4AMYA 2XKJE 2YXLA 3THYB 2LXNA 2XEGA 1PR5A 5C1OA 2AK3A 2BEWA 3WAKA 4F72A 1SR8A 2GNOA 2PH1A 2AJBA 3L05A 3PQ2A 3GJ5A 2QYTA 3D7LA 3C8MA 3GOQA 4KU4A 4PHTA 4HUJA 1MFZA 5JY1A 3JQQA 4JT4A 4NE9A 3T52A 3QVLA 4PQRA 4QGAA 1DINA 5DI3B 3ZZUA 1SK8A 8ATCA 4ZXFA 5BMVF 4I1YA 4IMRA 2BSAA 3TR0A 1YBFA 5KMGB 3ZKAA 3KSMA 3GP5A 5DX1A 1BA3A 1E2LA 3EVCA 4B83A 1XQYA 3RRFA 3KE8A 1QXSA 3DNMA 4PZUA 3GLSA 4X1IB 3WNDA 2IYWA 2QRKA 4E21A 2YXDA 3AHGA 1ECCA 2OCLA 3IIJA 4J16C 1TFUA 2WFMA 4CQLA 3ND6A 1CD5A 1S3SA 4G0XA 1KZ7B 3V6MA 1AGYA 4DYVA 1C1XA 2BI8A 3OOHA 3O2SB 1WTCA 5GVRA 3PQEA 1XDZA 4OQLA 2HRZA 1BSVA 1XP8A 3PDHA 1QIIA 4I1VA 4YAGA 3G2LA 2G1AA 3KSUA 3FOZA 1AG9A 3L7NA 5DM70 1W85B 1OSNA 3EDCA 4TQUS 4Y9TA 3DO6A 3DHNA 2GD2A 2R86A 4RK5A 2G9RA 3LVFO 3P0FA 4EYOA 5JNUA 3DV2A 2ZYGA 3EGDB 3KLOA 4GLFA 3PIRA 4PHFA 1DAPA 3IB3A 1J3LA 7MHTA 2VPXA 2NVUA 1T5OA 2A2ZA 3FCCA 1UWVA 4ZVLA 2XDQB 2X23A 2YIVX 2A59A 2B37A 4DIMA 4ENRA 3WXMA 1UZLA 1XN4A 2NUTA 3F6BX 1F6DA 1Z5ZA 3RSGA 5IK2D 3UPDA 5LD2B 2Z2ZA 2BKAA 4C88A 3KPUA 4TXNA 1U3UA 4PX2A 4UM9D 2O5VA 4D1YA 5TQ0A 1GGFA 4B6GA 2N75A 3MOIA 3EZ6A 1FS4A 1KHTA 4NJEB 4S12A 3WSWA 2ZI6A 3FPGA 4P1ZA 3HYLA 4TWZA 4UMFA 2DMRA 1C30A 2Z5FA 1YRLA 3WK6A 2CSXA 5J4LA 1U94A 3AUSA 3K32A 1RLOA 4BEVA 4CU2A 4J7CA 4EGAA 1Q15A 4ENTA 2FUEA 5LA6F 5F33A 1OLUB 2B7BA 4UAUA 2A30A 4DMFA 3OU2A 3UEOA 3QEAZ 4JK3A 5EXXA 3W5BA 4EEKA 1N0WA 1YAHA 1FTQA 4BFWA 5CDGA 3IERA 4L6AA 2VXOA 4PTYA 1RRFA 1YNSA 4K9KA 3TQHA 4KN8A 3JWPA 4ZGWA 3GARA 4C3UA 4F1WA 4I1PA 2J46A 1VJTA 2FDXA 2PKWA 4X8HA 2P62A 5JQGB 4FSHA 1KY5A 4TUYB 3NYWA 1P81A 3QXGA 3NT5A 5DV9A 1NY5A 2EZBA 6ABPA 3LCUA 1IHUA 3AL3A 1A8UA 1RQXA 3KPWA 3LV8A 1N6OA 2RSLA 1YS6A 1H22A 1Z6YA 5F1PA 1MB2A 4B2PA 4C1BA 1I3LA 1SQSA 2PYIA 2QGNA 4WEOA 2NO4A 2A3RA 3INTA 1AZWA 2ZUEA 5DI3A 3VX4A 5CGQB 1UKVY 4FQ5A 4C22A 3ZHUA 5KJ1A 4XD2A 1UDRA 1IDN1 3KLPX 4OGLA 4YV0A 1EE1A 2ISCA 4Y2SA 2OAQ1 3OQBA 5DK6A 3D6MA 4MITA 4HDAA 1CQIB 4LWZA 5JCXA 2WU0A 4M0PA 4FS3A 4H6XA 2WIBA 3PGMA 1G2PA 2H7YA 3ZTYA 1B00A 5MDHA 3V8MA 2XCRB 3K9WA 5K0GA 1YZYA 5J4HA 2P4UA 3D2AA 1RAIA 1B1AA 1TMKA 4ZOQI 1O94D 3B78A 1G4UR 4IDQA 3SVLA 3IO5A 4M22A 5JAIA 3RIMA 5A5VA 4TTQA 2VNAA 4UBKA 1KTIA 1NMSA 4HATA 3HI6A 2P9HA 4WXEA 4WASA 4HQ0A 4WDQA 4YMSA 1P4JA 3RI3A 1WRBA 4FNGA 2F4NA 3ED5A 4DWOA 2GSDA 4YQYA 1MO4A 2VHUA 1QIJA 2F64A 1Z2AA 3FEEA 2O3UA 4UZSA 3GFRA 5HQ3A 3N58A 2GVDC 3N07A 2XD4A 3U3MA 4BQFA 3ABOB 1A27A 4NGNA 1YR7A 2ZQYA 3GNTA 5EXTA 4AICA 1KO7A 3PV0A 4A82A 3BF8A 4F45A 4O08A 2CLIB 2WU1A 2AWNA 3KCNA 3OF2A 4BE7B 3AUJB 3PHHA 2ZDGA 1F0NA 2O1SA 4MDHA 4CTNA 1KOGA 3ETEA 4I4CA 3KOMA 2J0EA 3KQMA 4YRBA 4ZK6A 1PQYA 1ZD2P 1TADA 1PEDA 3IQGX 3M9XA 2R1ZA 4DE5A 4RZ2A 3CPJB 2D2EA 3EQ7A 4QOIA 1RHQA 1ZBQA 5FPKA 4OHVA 1S3GA 1C2TA 4P3YA 1FP4B 3RSQA 3V2UA 4MKIA 3VVBA 4I08A 5KOJB 5J9FA 3R9IA 4DDHA 1PEAA 3UOWA 5JS7A 1PJSA 2EV9A 3JY6A 2PE5A 1DRJA 1GQ2A 4WGGA 1COZA 1QP8A 4X93A 2Y27A 4YLGA 4WKPA 4F38A 5A62A 1IZ9A 3P4UA 3KQOA 2AMFA 2YJTD 2Z4SA 2D3TA 4MK4A 5LCXA 2Y1DA 1SHUX 2H2GA 4W9MC 1WPGA 1ZLXA 2EWMA 3B20A 4HTFB 4TLBA 3L02A 1U1FA 2W2LA 2X2PA 2CLFB 4I0WB 3AT1A 3LW7A 5I7UA 1Q7RA 3WO1A 1PWEA 1GNQA 3FA2A 2R1UA 2IP2A 4EA8A 4EDFA 1NVXQ 2A33A 2FTKE 2JEOA 3AWIA 1K3UB 2ZT5A 1FP6A 3BBLA 2DUWA 1ICIA 1IB0A 4G56A 4QLAA 4XQ9A 1M8FA 1GFSA 1NL3A 1II8B 5J1TB 3S2ZA 3OJCA 5JYBA 2QNBA 4CL8A 1NNEA 2RKBA 3IE2A 3FDZA 3IFSA 2WYUA 4ZPXA 2BDEA 2NV6A 3WLTA 3H5IA 4AAYA 1YH3A 5JAZA 3KUKA 1J21A 2VK2A 4YT2A 2JZCA 3PR3A 5EIEA 4ZO8A 5LDGA 4A7PA 3O8OA 4LHYA 4A5OA 3OZCA 4HDRB 1KETA 2X8JB 1Q20A 1NU6A 2FSFA 1DDGA 2HWYA 2JHPA 3JX9A 2O50A 2PNFA 5CK5A 3C3XA 3W79A 5IARA 3IPYA 4G4SP 2JBAA 3BCUA 2WV7A 1GGKA 4QRIA 1RZ3A 1TZMA 1UH5A 2G77B 3QVOA 3U4IA 1WY7A 4DJAA 4LE0A 2JL1A 1JR3A 1C29B 4G26A 3NDJA 2C82A 3DBRB 2ZSAA 1XVTA 3DC7A 5E3IA 1XG5A 4HDSB 3LUDA 5CXQA 3P52A 1AZTA 1P0FA 2QVCA 5TRTA 2VHZA 1ZA1A 3R3XA 1RWMA 1EHIA 2PXXA 2VBGA 2ZWMA 2FOXA 1VPVA 2P5YA 3KHTA 3NIWA 4ECEA 5JATA 1NQOA 3FVTA 2BKXA 2QD4A 3M3HA 5BQFA 2ZRJA 2Q5FA 1HG1A 1YQDA 3PKJA 2GWHA 2FU5C 3RF7A 3SYMA 1QJCA 1KPIA 1JB1A 3I0NA 2WKWA 1ENYA 1GYRA 1VI2A 1P6XA 2V7PA 3N7UA 3JYNA 4JL8A 2JB9A 3K53A 4YLEA 4ALKA 1WV1A 4BU1A 2G1PA 5TMBA 4BMNA 1VI4A 1TFRA 1TAUA 1DIKA 2AYXA 3NBQA 2ZBVA 5ABPA 2BJVA 2IYAA 3GBVA 4LGVA 4UPDA 1X8JA 5FBLB 1ZH8A 2R5FA 4L4YA 3L92A 4RANA 1OLOA 2EJCA 2EDAA 3GWZA 8ABPA 3O7MA 4MEBA 1PL6A 1IM8A 1GKKA 4I55F 4K6CA 1JZQA 3P4XA 4BUCA 3D7FA 2E0IA 3DXZA 3KJGA 3GGGA 1MJGA 1H23A 1JDVA 4JR1A 4AXXA 2FMHA 3KBBA 3FWHA 3ZN2A 3VYTB 1CVLA 1T91A 3JYOA 1JTVA 3Q9SA 4J1QA 5DN9A 1K7EB 1Q6ZA 1T36A 2C3PA 3NALA 3OZTA 4FXPA 3LLCA 3KOZA 5TPWA 1XTZA 3WHKA 3IUEA 2WW8A 2UZ0A 3IEXA 5J2TB 4GMDA 2PUCA 1DEXA 2C7GA 2J3HA 2YWHA 4HUQB 3E4DA 2CVHA 1G9TA 3FRJA 5IJWA 4BNDA 2XEFA 2P8JA 3A6DA 3F7OA 2HMTA 3LD9A 4INPA 1N5DA 1PUIA 1XLWA 3RC3A 4YB8A 3VSDA 5CLFA 3G9QA 2O8FA 1PUJA 3AHEA 4CKYA 3PYMA 1PBTA 2FR8C 3LY7A 3KPJA 3OURA 2I7XA 1ADCA 3O2QB 1A2QA 4PZ0A 3H2ZA 3C3YA 3HEBA 3K71B 1Z0ZA 3AEQA 3PS9A 5HPYB 4UTXA 1KAMA 3LZDA 4B45A 3SYTA 3ZCRA 4I5EA 1KVQA 5HQJA 1GGVA 3FSRA 1AUXA 1Z0KA 1G9SA 3OCVA 4NG5A 3ZHQA 3IX7A 3VZCA 3DAYA 2M1ZA 4F4UA 2V6MA 3GFFA 5JFTA 4TKZA 2NT3A 4FFBB 3NJ8A 3ZU4A 2EF0A 3TQRA 1CS0B 5C80A 4BFYA 4DNXA 2ZI4A 4YI5A 3SR3A 2OZPA 4GXRA 1ENZA 2GPNA 3W9UA 2WKSA 2F90A 2P2LA 1KQOA 2E37A 3A1DA 3I32A 3KZNA 2GA8A 3PRKE 4L0DA 4RKFA 5FI3A 5C8YA 1XWIA 1NQTA 3KNZA 3SDSA 1EK0A 2ERYA 1IQUA 1B3RA 2XWPA 3MOGA 2RGDA 1DAHA 3MXTA 1C0KA 1Q2XA 5E0KB 1GNLA 5GAJA 3LVBA 5JAPA 2P9FA 3VR3A 3RVPA 4DWVA 4JT9A 3HPQA 1EJ0A 2ZUUA 1TTTA 1P2FA 2Y1GA 2ENUA 3GQBA 1HSOA 1WZEA 2ZKLA 3N8GA 1T2EA 1WXDA 4GZ3A 4KXNA 1HNNA 2AVDA 2R5NA 3UB3A 3ZZTA 2PD4A 2F3PA 4P5PA 1BE1A 1M8JA 1IH8A 2CLKB 2WZQA 3WQHA 5AVZA 5AKHA 1MENA 2SKEA 1EB9A 1T9GR 3CX7A 3GBPA 4IQFA 5CIWA 2P9CA 1HFJA 1XF1A 4R2WA 3WWDA 4XSGA 4E2XA 1GUYA 1B6SA 3AEUA 5A0VA 4C7XA 5A5FA 3DSRA 2IXAA 3DEZA 4L5JA 3VR6D 4B6SA 3FCOA 1BX0A 1KIMA 1RW4A 4OGFA 4FB5A 1L7PA 3VO2A 1L4BA 4W5TA 2WAAA 4YCBA 1PFVA 4LBWA 3MFQA 2V5UA 1MXHA 3WQBA 4UNRA 2IDZA 4LF6B 2O2EA 2OGWA 4MI1A 3OKPA 3PCTA 4EAQA 3KB1A 1D4OA 1GG2A 4DNOA 3RUFA 3ORHA 3OF5A 3K0HA 4LXXA 4X62B 1X1EA 3REFA 1Q92A 3VR4H 3I53A 3TF5A 1SFRA 4H3SA 1PZGA 1X3LA 2GN8A 4FVTA 2BD0A 3O92A 4KMOA 4DFDA 4EENA 3MJTA 1MJ5A 1T13A 3NHKA 2P9GA 3KB6A 3LQFA 4PC3A 2VPYA 1USUA 1E79D 3T7SA 2V9ZA 3WWPA 4WLNA 4C0AC 1HX7A 2Y9PB 2A86A 2I3AA 3DMTC 3LCCA 1XZMA 1F2TA 3CLKA 2I2WA 4URYR 2HCRA 3NEYA 3A2MA 4MUGA 2BMVA 1PZXA 1VSTA 4LXHA 4AY4A 4KIGA 2ADFA 2GVNA 4XUGB 1GAEO 4GMKA 1IBSA 1VJDA 1AO3A 3L1IA 2IEYA 4HDMB 4NICA 1UMKA 3T4PA 1IEWA 3K5PA 1YS2X 4GKAA 3MMZA 1ORDA 3H3FA 5HK8A 4EW6A 4UAGA 3PQ8A 1CQPA 2BUBA 2R60A 3OZXA 4TRRA 4E2WA 3IKTA 1W5TA 2FSGA 4FFOA 4NJMA 2F43B 2CFTA 3QA9A 3TOZA 2ZI9A 3V8VA 5F3WB 3NOVA 4WFKA 3ZV3A 4MYSA 3PJRA 1US8B 2YOFA 1ZN9A 5EIFA 4EUHA 5AVXA 5C5DA 3ZV5A 1NC3A 2GPTA 5ER9A 1TYDE 1E9DA 1JHDA 2RGXA 4E88A 2JKYA 5EVCA 3IP6A 5C51B 1IUOA 1KJ9A 1XRPA 2VDWB 1SBZA 2ILVA 3BRSA 3R5XA 3THRA 4JJGA 4CMBA 4KO2S 4EW3A 1A7AA 4LJRA 1X15A 3U80A 1W1IA 4RCVA 3QBVA 4JEIA 3HL0A 3OE1A 1XK7A 5DI9A 5FI5A 4EUNA 5A03A 5CCEA 4A6DA 1NVAA 1PR0A 3HBNA 3NT2A 2DQ4A 4LZNA 1CX8A 2FPKA 2ZTLA 1EQAA 3NTVA 1XTVA 2HBRA 1E8DA 3D3WB 2V3VA 3EMBA 2RC6A 4ZV4A 3TUJC 4WOKA 1K92A 5EWJB 4ARZB 3QFTA 4B44A 2JZOA 1XWFA 3GLHA 4OB7A 5BR8B 3JD0A 1AA6A 3U6BA 1QZXA 3DOIA 3NM4A 3WHPA 1FP4A 2DH5A 4MRRA 3ZHBA 3AM5A 4LHEA 2FW0A 4WVLA 2GM5A 4YAKA 3YASA 4CQNA 3M5CA 1Z28A 4DLBA 3N2KB 5CIYA 3KXDA 3RYTC 2V1UA 2P0YA 4MYTA 5EOVA 3ZLBA 4URHA 5IKPA 1JG4A 4KBYA 4I46A 4PONA 3O8LA 3OE7A 3PUKA 4KXXA 2ZJ6A 3HB4X 4OXXA 1QV7A 3D1JA 3X0DA 1U2DC 5F7OA 1CRPA 3L0IB 2YX1A 1FFXA 4Y6GB 4JB3A 2CVZA 3B89A 3RR2A 2PV0A 4BRWA 4FUTA 5LB4A 4M98A 2O4CA 2NTEA 3II6X 4NV1A 1V2HE 4S0ZA 4FOTA 4O4HA 4FE7A 4E5DA 2RBKA 4C7KA 3GLGB 5F98A 1CY6A 2PRKA 2WEKA 5TJ9A 3SY8A 2YVLA 3AI1A 4EABA 1EVYA 1R5OA 1EFPA 4B43A 1L5MA 1A2OA 2ZVJA 3GMTA 1FQWA 3IC5A 2Y6VA 2RHJA 5F5NA 3BS4A 2MT9A 421PA 3CW2A 2J9XB 3V9AA 1UK6A 4HTAA 1ECPA 1OF1A 1SC1A 4QDTA 4Q66C 4AJNA 2FPGB 4MVJP 2BUCA 4N82A 3TI7A 5TV2A 1KEUA 2GJ4A 3W8DA 5JXIA 3EZEA 2HMSA 1NJGA 2HO4A 1VZ3A 2WSIA 4PG8A 2YMPA 2VBIA 1SD1A 5BSHA 2AKYA 5AKEA 1J90A 1VE9A 2BEVA 2QMUA 4NQZA 3TOVA 4ZJPA 3KXPA 2EGHA 1GTZA 4I50A 2AT1A 2XKBA 3ETJA 3GMSA 3X1XA 5B7NA 2ZDHA 3IKJA 4PC7A 1RZUA 4B8ZA 4ERXA 1SUCA 3STWA 1FDOA 3NPAA 1K8YB 2FGJA 4TZ0A 2O1EA 2ZZMA 4EG6A 4DVJA 1HTBA 5LYYA 3KQKA 3ZLTA 4C0KA 3M2PA 5DNEA 4FMCB 1G64A 5GIPE 1XZDA 1Z6AA 3DT9A 4TWIA 3T41A 3DPIA 1M5RA 2O2IA 2VCEA 4H3HB 3UIEA 1RWPA 1UWCA 2O8BA 1L5HA 3ROXA 5EMNA 4OA8A 3KC2A 4GMFA 5KYVA 3LLUA 3EUWA 3I2FA 3DVLA 1JQ3A 3IIMA 4JBHA 3AEXA 3DM5A 1YB1A 4P6VF 5AO9A 4LOKA 1S8FA 2PZKA 2XVZA 2Q5IA 1DRUA 4R83A 4U7JA 4TN1A 5KNDH 1GSOA 2HXYA 3TRHA 2JCBA 3K0KA 5IXSA 1YVPA 4MKGA 4O5OA 4L5YA 1DTSA 1T9KA 4W1SA 3TLGA 4PYJA 3L6RA 4PTLA 4F6CA 2UAGA 3H2JA 3OQHA 3QFRA 3Q98A 4R2XA 1FDRA 1IONA 1P7CA 1X0XA 4C8TA 3P8ZA 1XCPA 3JD3A 3PXBA 3ZCXA 1CUCA 3SNKA 4TT8A 2F59A 2O2YA 1FUEA 4Q3NA 2APJA 3TIFA 1E0DA 1IY0A 1VPWA 2CHUA 2JFUA 4QJ4A 1JXMA 5EGSA 2X15A 4EZBA 1OI2A 5K0TA 5CW1A 3EOZA 5IRCD 3AEKB 5FUXA 1AK1A 4QFMA 5J23A 4RTRA 2I29A 3GFGA 4RPIA 1GPH1 2EJWA 4OI0A 4X45A 2CC2A 2WC1A 1PX0A 5CCDA 1VFPA 4HGQA 3B13B 4BNUA 4Y2PA 4Z9FA 3NHFA 4EYSA 1CIJA 1NZDA 2FG6C 2QTCA 3A37A 3AEQB 3T0TA 4W1RA 1RAGA 1LS1A 2X2FA 1YR8A 3LUAA 1N1MA 4Z9AA 1W6UA 3ZWVA 3HKDB 4QPJC 4W5OA 3ODGA 4DA4A 5IG2A 2ZVDA 1U8EA 4QT4A 4BLTA 1I80A 4UBNA 5EE9A 4YPOA 4L8YA 1OFUA 4M9SA 2HCFA 4LECA 4PZPA 3NJ4A 1FRNA 1RXIA 4FR2A 2FW1A 1NMQA 1Z39A 5J47A 2XLBA 1FVHA 2WKRA 4GVLA 4BNXA 2YHSA 4BVHA 3NVKI 3O4RA 4KXUA 4OMEA 2D1TA 2QI9F 4D0LB 1GVHA 2Y93A 3T3GA 3TZBA 2JHCA 5CYPA 3CX6A 2B21A 2VK8A 2XEJA 1YRAA 4X97A 1AURA 2HRBA 3BTVA 1A9YA 5K8LA 5KO2A 2ATXA 4WFIA 3EZ2A 2QM3A 1Q5PA 3FNHA 4NS1A 2FWJA 1U0HC 3O82A 4U2EA 3OE7D 3KT8A 2ODAA 1YIAA 5MFPA 3X3HA 4L8FA 1GPBA 2CLHB 1SZCA 2BZ1A 2W5UA 5K7SA 3ZDQA 4ROTA 1WCV1 2PY6A 2BGUA 2IEZA 1GGHA 3D6TB 3G5UA 3G2JA 4FWIB 3F7NA 4K9PA 2QQ0A 4U9UA 5C0OE 4LAFA 3UMVA 3KXLA 3VBCA 3DUFB 2W90A 2XA1A 4MQMA 2D7JA 3CR3C 5HDQA 4BQPA 1TW2A 2AMLA 2BIFA 2XMPA 4I2VA 4BN5A 1HR0B 5COQA 5CFQA 3UUGA 1CUVA 1D2RA 4M0MA 4OIFA 4MVJF 3W9SA 5A04A 2Q0XA 3IP5A 3VQTA 3QX7A 2EGUA 3DFKA 2W9XA 3SOPA 1WLSA 1ECJA 5T4BA 4KVZA 3JQ9C 4AXBA 4PLTA 3VZBA 2AKEA 1MP0A 5ICEA 1C4XA 4QDXA 4CUJA 3WAGA 1RJ9B 1R8JA 3UMYA 2ZRAA 4GQIA 3C3MA 3GT7A 3KEMA 3ESQA 1S3FA 4JIMA 1GUFA 3LUHA 4WXMA 2IUSA 3MFYA 5AWFC 3RS3A 2VHYA 4IKOA 4LX8A 1U3CA 4B7UA 3PP8A 4DVGA 2Q9UA 1XMPA 2CE2X 2WFLA 4JJ6A 5DHTA 2XVXA 3GPIA 4QOGA 2CW5A 2PZFA 3KXKA 4G0OA 4L0CA 4G1UC 3PFCA 4NZNA 1N2SA 1W1UA 5EE0A 4BOYA 3PJGA 3GZNB 4C4PA 4XVUA 3VHXB 1SUAA 3MS2A 4PVCA 4KITB 2RAPA 2X77A 1ZXXA 4EIWA 1XCLA 4WZAB 2FR1A 2W6OA 5A6SB 3CT4A 1KJIA 4OFZA 5B7PA 2FG5A 3LMKA 2VHXA 4QPDA 1P73A 4G25A 4OH1A 5EP2A 1E94E 3JVEA 3RUCA 3TL2A 2DBRA 3H2SA 4CCSA 5BQXA 4C4SA 3PENA 1PYDA 3SZUA 2FKNA 3WB9A 4AW9A 1U63A 2ZUSA 1SAYA 4EJ6A 4HLCA 4YJHA 1WM1A 2B9EA 4WOCA 2C3YA 3DOJA 3E18A 3PXDA 3S8YA 1H0KA 2DG2A 1JDUA 1LPOA 2BMAA 3EAFA 2NQTA 3NCTA 5JE8A 1NBMD 2C03A 4ZOAA 4PNEA 4I6GA 5GZ6A 3R3VA 4P0QB 4NOMA 7ADHA 2VLBA 5KREA 1D6MA 3Q0TA 4X6UA 2YIDA 4G5GA 4PLFA 4TSFA 2GXQA 5E4TA 4ZCSA 5CXSA 2WWIA 3VO1A 2GYWA 1EXDA 1OXTA 2CWWA 1ODJA 4G0MA 3ESBA 2QX9A 3N3BC 5CT8A 3C1AA 2BJHA 2ASEA 3LXXA 5MN6A 4CKZA 4UBOA 3ANXA 2QQFA 4CL0A 2H5LA 1V5FA 5ARBA 1DIAA 3CY6A 3M49A 1P62B 5HIIA 4QJ5A 3PVZA 4LZPA 2AA3A 3R23A 5D5HA 2NZUG 3QG1A 1S2NA 1QQ5A 3IAHA 2AE2A 2HWKA 1VJ5A 1PD0A 4W8HA 1Z7GA 3I8XA 4Q5IA 2FPGA 2W6NA 4MKXA 3PZRA 4EWLA 3RYCB 5FTKA 5KWEA 3G2NA 3TOSA 3KSAC 3SAJA 2C2YA 2HMWA 3EIWA 3BCRA 3LK7A 3QEBZ 2XJ4A 2VHCA 3AU9A 1R9MA 4Q1EA 3I58A 3LQ2A 1WDTA 3P20A 2BDUA 4BYMA 5BN3B 4NCIA 4MMXB 1HKUA 3DV0B 1K63A 1KGDA 1MO3A 1Z47A 4O1MA 1F9EA 3KQTA 3CNQS 4GOND 1AZSC 2YNMA 1OTYA 1RXEA 4Q48A 5LDDC 5DYIA 3QOFA 2XUDA 4JN6B 5FYDA 3WGOA 4XA8A 1X86B 3C8ZA 3VRHA 1GOTA 1TJ3A 2MYNA 2XOXA 5B64A 2JATA 2ZJZA 3GAMA 3L7IA 3QFHA 3WQQA 4ZU1X 2JFWA 4MV3A 3IA2A 1ZX1A 4WI1A 2GZHA 2C59A 3E1SA 2FZCA 4DR6B 3IUPA 3M5PA 2FFRA 1C2YA 1VL6A 3RWMB 3DONA 4UVEA 2UYHA 2WDPA 4ERNA 4DA6A 4OVKA 5KCMA 1UXHA 3LQKA 2F8LA 1QGED 1IBMB 3VVLA 1OI3A 2PL9A 3P2YA 2Z4TA 1VGVA 3KOOA 4X85A 2ZSFA 3L4KA 2FK8A 2EHDA 2HNKA 3FWZA 4N9WA 3D2LA 4NABA 2WUFA 3QFCA 1EDOA 3OVMA 4RNDB 4JP8A 2ZB3A 4NX2A 3WFIA 2JIPA 2L18A 4OYHA 2VBFA 2VHQA 1KTVA 5KSYA 4CM3A 2JG3A 2PU7A 2D5CA 2DECA 3ZU6A 1QAMA 2YJGA 3TM4A 5KC8A 4X7MA 1U9CA 2N42A 3N5KA 1P2DA 1RBZA 2WVGA 3HFJA 3MGBA 2NADA 4LJ6A 5G3ZA 5DDIP 4NSNA 3B3FA 3ZHYA 4X64B 1Y7HA 3CH4B 3OETA 1XZNA 1RMTA 4W7HA 4ZRNA 5REQB 1T5IA 4RBNA 2Q27A 5AW1A 4GZMA 4CM4A 5D3QA 2I4NA 1YZTA 3EC7A 5KAPA 4PAGA 1S2LA 3KOWA 1UIRA 1KI4A 2A58A 2BF7A 2W2KB 1FDTA 3VX3A 3RGGA 1LBEA 2GUWA 1JDEA 3B52X 5AM3A 1UQUA 2R7KA 4KK3A 3UUEA 2NIPA 3UAWA 1J9EA 1YO6A 5BV7A 3CLTC 1FYDA 5H16A 2GM4A 2ZWVA 3QVSA 3GGDA 5IDXA 3HJFA 1WXIA 2JBJA 4FOOA 3PUIA 1ARZA 3KYBA 3WIUA 3CZ9A 1OGJA 2AGVA 1ZNQO 1NDQA 2NYRA 5EQFA 4PSDA 3DE7X 2OLSA 4O2AB 1JECA 2PA3A 2Q9BA 4B09A 1H65A 1WQ1R 4XGNA 4PGMA 4NK4A 1E7WA 1SXJE 3TEJA 2X8AA 3UWDA 3ED1A 1R9NA 4R2LA 5ECYA 4D8XA 3RTDA 5H8WA 3KP1A 3O0TA 4JMLA 2HB6A 5KVQA 2X13A 4RDIA 2OWDA 4BDSA 3H5RA 1CUYA 1LRLA 3DDCA 1N2HA 2W6JA 4H1VA 4RU1A 3VZRA 1GCIA 1VP9A 4R1NA 1TD1A 3O83A 2P78A 3JATB 4CLEA 5AUPB 1LTQA 1DWQA 3BMXA 3PPXA 2QNRA 2ZZNA 1TZCA 4E31A 5IMSA 1RVDA 5MFZA 5TEWA 3FTDA 1QQ6A 3ZGYA 1YJ5A 1AJEA 1A50B 3HDTA 1MOZA 4JU8A 2FSUA 3RIXA 1L4FA 1CDZA 2QG6A 2CE7A 4P34A 1ODCA 4W8OA 3PLAE 4LQGA 4JJEA 1G6OA 1MRSA 1LPSA 1UC8A 2QG9A 1N2OA 1EUZA 4KJZA 4DS3A 2GXAA 2ZWAA 4D6YA 2AFVA 3S1SA 2HMAA 1OUMA 2VRCA 4X7PA 5SYNA 5K6AA 3TIVA 2B8NA 4QOEA 2WOOA 4DQDA 1QVAA 2WWWA 3PGLA 4G9GA 4NOLA 1QYWA 3D3JA 3W8FA 5FNVA 1JQBA 5I8ZA 1NRXA 4Z9XA 4ARVA 3T7EA 2WB4A 2IU0A 5JI2E 5LQSA 3AVWA 1IMOA 3TSZA 4RVSA 2YXPX 3HKBB 5KYTA 1P33A 2GK4A 2W2VA 3CB4A 4B47A 1F7UA 4DUZB 2Q3HA 3FMGA 1EAMA 1RS0A 2Q5OA 3HA5A 1TO1E 2VNKA 3L6UA 4IF6A 1N0IA 1IUNA 4M1WA 5HJ2A 1YC2A 4XB6B 3KM0A 5C3UA 3TTXA 1IIBA 5C8XA 1AHHA 3NTRA 5BW6B 1PKEA 2PL5A 1OFTA 1YE3A 1TEZA 1JFVA 2PX0A 2X0KA 3D5TA 3PUJA 1R6TA 3ND5A 2IVFA 4R8SA 2J9FB 2MTBA 3LDGA 2VDLB 4UEKA 1O58A 5SZKB 5I48A 1IN6A 5G1OA 5EXDA 4WOPA 5H3HA 2ADOA 2ODPA 2P3LA 3DP9A 3T34A 2B5OA 2P6UA 4QXRA 2X0DA 4YV1A 5B1YA 4ZOEA 5H68A 4RIHA 4HGZA 3EZFA 4RF2A 5IEJA 1UFOA 3H1BA 3OHMA 4U9HS 3PC3A 1E5LA 1KSHA 3CCCA 5IW8A 3TUZC 3THWB 1XAIA 3BFPA 1KAGA 4GUDA 4AUEA 1O96A 3JPYA 2VA8A 2VAVA 3FMPB 5G1PA 3X1DA 2CFSA 4ZFNA 2UYOA 3WIVA 3LGSA 4M8SA 1Z4NA 4L16A 4PYKA 1KOLA 2XT9A 4WV3A 4CLDA 3BGDA 3NFRA 1ISRA 1WUIS 3F5FA 2R25B 2QPTA 1WP9A 4RGVA 2LIVA 4MH0R 1NUPA 2RIPA 2WKPA 3UMJA 2X0FA 3AHCA 3HCFA 1JJBA 1A95A 4UUAA 4B0OA 1H2YA 2CUZA 4W99A 3FB4A 5A4KA 5HIJA 2Z6VA 4ZZIA 3U7FB 1NP6A 5EP4A 1C0LA 1QC5A 2OEPA 3ZCVA 4MHSA 3WRXC 3DDWA 3PD7A 2F17A 2YHIB 3CURA 3QITA 4UW9A 3ZLVA 3C3WA 1YNOA 4Y2TA 1D2EA 3WMWA 5EP3A 2YOHA 4E1BA 4J6EA 4F7WA 2BGRA 4QGFA 3FF1A 4S1VA 1SCUA 2EZUA 2H1WA 1E58A 2WPDD 2PGNA 5HZGA 4G67A 4PLVA 2J4DA 1E2JA 1R5NA 2ZIAA 3UYLA 5HIAA 2AI2A 1P6QA 1Q50A 3GT0A 4NFYA 5EHIA 4BQNA 3SIPA 3TRIA 4P7KA 2V0GA 1W96A 3OOWA 4TYWA 2NV0A 4X6YA 5KYWB 3THYA 1YI8A 1RWBA 3E22B 3QU5A 1JHVA 1SEVA 3ZTWA 2EZCA 1YSCA 3O91A 1X7GA 2UVPB 3EAQA 3FRIA 1UFVA 4D4LA 3C3PA 2H3HA 5C5EA 1BX3A 5B53A 4AF8A 3QIVA 4WT7A 5JTTA 3SBOA 5C7IO 2XD9A 4BKMA 2H4WA 2H5EA 4P4SA 5D3ZA 3UAXA 1K27A 3SD7A 1CP2A 1UADA 3FLMA 3K31A 1X7XB 3DVQX 5EWMA 5KQSA 4BGIA 3R9XB 2EFYA 2TMGA 4MUKA 4MICA 5EIBD 4NFSA 5B58T 1R6AA 3RS9A 3WKCA 2P9ZA 4BO2A 4Q05A 2H7CA 4HNQA 1FNDA 1Q16A 4YJ2B 4KPFC 4PN7A 3UJ8A 4FGJA 1PWYE 2CMHA 1W4CA 2COKA 4IF4A 4I66A 4MTLA 5BY2A 4QECA 3KSZO 1ZAYA 1A7JA 1S8OA 1TOAA 3GD7A 2BF4A 2GP4A 4OK5A 1X7WB 4HDKA 4OEHA 1FUYB 4E30A 3H2KA 1KEVA 2IXGA 1KDVA 2VYCA 2IV7A 4LUCA 4JI6B 4EJSA 4CM7A 3A1UA 4QVGA 2Q4EA 3QVTA 1KC3A 3H11B 4GS5A 5DYYA 1YUBA 1BROA 2ZRHA 1BFKA 4MKHA 1NW7A 5IKMA 4AS3A 4OD0A 1BHQ1 1NNLA 1M8GA 3HU5A 4YMUA 4V2IA 3AOGA 3LCMA 1NVUQ 3GD5A 3GDGA 2ZI5A 5AW2A 1EM8B 1AN0A 1L3BA 4LQCA 4V0QA 1IU9A 2IGTA 3FZYA 2GJSA 1P8AA 1TCCA 5DW3A 5GQSA 4CQMD 1NPYA 4FZRA 4EYEA 2VWQA 1TQHA 4BC1A 3TLXA 3KEGA 1R6VA 1KI6A 2QUJA 1AY0A 2R00A 1FNBA 3ETDA 3SJZA 3WR5A 3RBVA 2FZWA 3RYIA 3CXUA 1E1LA 1DEKA 2ATEA 3EWAA 4QVKA 3EF1A 4HNTA