4INJA

Crystal structure of the s111a mutant of member of mccf clade from listeria monocytogenes egd-e with product
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
326
structure length
326
Chain Sequence
NAMIPAKLKQGDEIRIIAPSRSIGIMADNQVEIAVNRLTDMGFKVTFGEHVAEMDCMMSSSIRSRVADIHEAFNDSSVKAILTVIGGFNSNQLLPYLDYDLISENPKILCGFADITALATAIYTQTELITYSGAHFSSFSMEKGLDYVMESFSDCLLQKEPFALKESATWSDDEWYLDQENRNFIPNEGLVVMQPGVAEGIIIGGNLCTLNLLQGTEYMPNLAGTILFIEDDFMTIPETFDRDLESLLSQPGADEIEGMVIGRFQQKTAMTAEKLAYIIETKTALQKIPVISGADFGHTQPIATFPIGGTARIDTNQTDKIQIIRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the S111A mutant of member of MccF clade from Listeria monocytogenes EGD-e with product
rcsb
source organism Listeria monocytogenes
molecule tags Hydrolase
molecule keywords Lmo1638 protein
total genus 115
structure length 326
sequence length 326
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02016 Peptidase_S66 LD-carboxypeptidase N-terminal domain
A PF17676 Peptidase_S66C LD-carboxypeptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Class I glutamine amidotransferase-like 4injA01
3.50.30.60 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 LD-carboxypeptidase A C-terminal domain-like 4injA02
4JVOA 2AUMA 4H1HA 4IIXA 5FD8A 3T5MA 4E94A 2AUNA 1ZRSA 3TLGA 3SR3A 5K99A 4EYSA 5F5XA 4INJA 3G23A 3TLZA 3TYXA 3TLEA 5JYBA 4E5SA 4IIYA 3TLBA 3TLAA 3U1BA 3TLCA 4MI1A 4MJXA 5F9MA 3TLYA 5F1YA 3GJZA 3TLGB 1ZL0A
chains in the Genus database with same CATH superfamily
3CZRA 1IBCA 2VHWA 2C7OA 4AJPA 2QRVB 2IF2A 4D02A 6LDHA 3DDSA 3SBEA 4EHIA 2C20A 4J7AA 1Q44A 2VRCA 1FTGA 3HJTA 1OX4B 4HWOA 1M8GA 5JE8A 4E15A 3DVRX 3RSOA 4X1IB 1YGYA 1FTNA 4LJKA 1M83A 2QEQA 2PUBA 1GP2A 2PGNA 1FLVA 2XB2A 1XTRA 4EMSA 4AWAA 1DFGA 1EGQA 1G63A 5DM70 1N3BA 4LHZA 1OSNA 3JD3A 2DPYA 2AWOA 4GM0A 2B7LA 3ZWYA 2CFTA 1JA9A 2P9GA 3WLEA 3UA3A 1K92A 4ZYUA 5HFJA 5L3SA 1G7RA 1NU6A 1VFNA 3LCCA 4MS1A 5DHPA 5DI3B 4AZTA 4YXWA 3DB1A 4NBRA 3AI3A 1ENYA 2NTEA 3KUKA 4WNYA 3ZXYA 2Y05A 5I47A 4WGGA 2HSZA 2OGWA 2ZS7A 4I2NA 2P3QA 5B37A 3T4EA 2VJAA 3K2IA 1N6HA 3WB2A 3ZJ5A 4N5MA 4O2BB 3BEDA 3KVOA 4JBWA 3W2EA 4DV1B 3CNQS 3QW4B 2X5JO 8ADHA 5IF9A 1X8XA 1I5RA 3OLQA 5IJ0A 2QU7A 3UAVA 1DARA 3U37A 1WU8A 2G5CA 3GJ7A 5DYGA 3TLAA 2G3YA 3H7IA 4QDOA 3AVXA 4TQGA 4YP1A 2DCMA 2X2PA 3S7TA 4U6NA 4D3XA 2ZKIA 4YDSA 2YOGA 1IULA 3DOIA 1RPZA 3WWCA 3LXMA 1N5OX 3FF3A 2OXCA 4ZO4A 5TR9A 3WFJA 5BVHB 1MV5A 4PHCA 2YCLA 4KK3A 2IF0A 1T6XA 5DM60 4LKOA 3CW8X 2VSXA 4Q9JA 3C3CA 4Z3DA 4BYGA 2WE7A 1KJZA 5ED0A 2Z2IA 2XOKD 4KZKA 3UH1A 2RHTA 4YS6A 3VSEA 4M7RA 4NZ9A 3DWEX 1A7UA 3HUFA 4JQOA 3OPXA 3CW2A 4IWNA 2NP7A 3VR2D 4C99A 5IHPA 2ZGVA 1NNUA 2O0MA 1GNRA 1EP9A 1ODFA 1X7YB 2HQ1A 4G0UA 4CLOA 3LZDA 4P33A 4UU7A 3GMTA 3ZOKA 1K7FB 4MGIR 1ORHA 2XEFA 4IDFA 3TLGB 3S44A 3EARA 2CFOA 3EWNA 5CT6A 2Z4SA 4BV2A 2D1SA 4JP8A 1SRRA 3FFBA 1G5HA 3ZGZA 1V1RB 3HJCA 1WETA 3BULA 1CV2A 5I7AA 1PKXA 1U7UA 2M2IA 2WFLA 4FZ5A 4IZIA 4O2RA 5JFGA 4HO1X 1DCKA 4B6OA 2K87A 4LF9B 3UH0A 3FOZA 2HYDA 3IVGA 3BIJA 2YV3A 2IE8A 1KOGA 1Y7PA 3KM0A 4MMXB 2B34A 4N18A 4CMHA 5EMNA 1R50A 5BQ3A 2V54A 5FFNA 2XDQA 2MSNA 3U16A 1E3JA 2XEXA 4FYJA 4NARA 4YDQA 3BZUA 4Z0HO 1E4EA 1XOIA 4TWZA 3HVIA 3H6GA 2GF0A 2QROA 1IEVA 2B8EA 4QHYA 2DIKA 1BCSB 1A97A 1Y0BA 5GY7A 1JIUA 3KWMA 3TZ6A 221PA 3V4SA 1EX7A 2XIQA 1ULSA 1W36C 2Q5QA 2GLUA 1XD2A 3WBKA 4KJZA 5J4YA 2B82A 2XXJA 4O4LA 3UTDA 1E1RD 3IO5A 2V7PA 4JMLA 4J91A 4QBHA 4JYCA 4DHWA 3VOAA 3KZMA 3G49A 1XWWA 2JCSA 5FPQA 1GQOA 4WLNA 4Q4JB 4TS3A 1E2HA 1QVVA 1T36B 2PA3A 1CVRA 2R7NA 4Y9DA 1ZHOA 1KMIY 1SXJD 1SZJG 4O5AA 4W5TA 4WZBA 1MT0A 3M4NA 1NT4A 3FSEA 5IYZF 5JO9A 2H9YA 4NU8X 3B13B 4FT4A 4K6FA 4V02A 4C6TB 3CH5A 2F8LA 1GA1A 4Y9TA 3CE9A 3KT6A 1R6XA 2GEFA 2PT5A 3P5BA 4NQRA 3UWOA 3WIDA 5DLDA 2QN3A 4OK6A 5IT4A 2TMYA 3TI9A 2IYYA 2VHUA 4EP1A 4BQNA 1RMTA 1OQAA 1HDEA 1OHHD 3A1FA 4BJHB 2AFIE 5KDDA 3ZHZA 4UPEA 3KYCA 5JWHA 3ZCPA 2JIDA 1NVMB 4H7PA 2DJ5A 2CCGA 1JDTA 2KS6A 3L8MA 3O74A 4IGAA 4J0IA 5A4FS 2O8BB 1L5RA 2GXQA 5INTA 4NX2A 4O4LF 4E07A 4LFCB 1NXWA 3UXHA 1R5BA 2PZKA 3TLMA 5EWJB 4D6PA 1US8B 1N2XA 1DINA 2ZUBA 3FSJX 2EKPA 2JIOA 4V24A 3K1AB 3MCAA 1QQ5A 5TMPA 1EEHA 4MICA 1BH6A 1JZTA 3IE1A 3T3HA 1L5GB 3NNDA 2WPNA 3OPYI 2R66A 2LNDA 1V3TA 1FTQA 2IUSA 3QV1A 4D6XA 4BNIA 5KVVA 3WQHA 4YV7A 4DR2B 2IYXA 1RC1A 2ZZKA 3FLMA 4ZDKA 3PQ2A 1V9CA 5F52A 1NW9B 5CHYA 1F2VA 3WYBA 4N0PA 2W58A 4UAUA 2GAAA 3M6UA 1GZ6A 3GPIA 4LMBA 5DTMA 1YZVA 1V37A 4QU0A 5ADVA 2WQ7A 5LVAA 4RELA 1C4KA 1RYNA 2I65A 3F7MA 2HWXA 4GMXA 2RI6A 1AF4A 4DSTA 1MXHA 5L4SA 4G1FA 3FWHA 2Q49A 3E3NA 4X45A 5HZMA 1QG4A 2O9JA 5EUQB 5MGBA 1P2FA 1YS9A 1C9MA 4J6FA 3A4VA 4Q6WA 3Q12A 4L8WB 3Q10A 5ALJA 3VBEA 4CEJA 1EK6A 3V7NA 1WKCA 4DV6B 1CRPA 2E1PA 3ES9A 1A69A 3EVBA 3VZDA 1HT0A 5IDXA 5JAIA 1G9TA 2PKQP 5LJLA 4RL6A 4WQMA 5F4ZA 5EJEA 2EJVA 1JG3A 5I7UA 4O2AB 5IT5A 1SUBA 1ISGA 1KVRA 3CVJA 3PEYA 5F23A 3FNFA 1M6YA 3EA5A 4YMVA 5KO2A 2HU2A 2JFXA 2PVSA 5JSQA 3K70D 2DT5A 1NR7A 1PHPA 4CMEA 1K9SA 5F33A 4CEIB 3MEQA 3TNFA 2XB8A 3C15C 1N25A 4FFBB 4ND1A 3EVNA 2Y68A 3R3XA 4UNNA 1JDPA 3H3JA 5JI3E 3KDPA 4A10A 4EJMA 3A4NA 2QT9A 3UNXA 1NZDA 2IC5A 2ZSIA 1ZA2A 4UD6A 1ZK2A 4KQKA 2GPJA 1W4LA 3IKMB 2PUDA 4D43A 1QOPB 5LMZA 4FR5A 1BG6A 1OIXA 5DF1A 1QGED 2FPGB 3DTVB 3VX4A 4Y8VA 1OZGA 4HBZA 3OFJA 4GXTA 4C0HA 2CFSA 4EI2A 3ROEA 2COEA 4C76A 3H65A 1GSIA 2CNLA 3DTVA 4MYSA 4QAQA 4EKGA 2B0AA 2ZT5A 5T3UA 1GKLA 1XC7A 1I30A 2OV1A 1H23A 4JUDX 1KI9A 1EB9A 4H2DA 2AN1A 2CXRA 4UATA 2YL2A 4K26A 2Q07A 4WRRA 1DIKA 3RWOA 1KK2A 4YAUA 5BOSB 3JQQA 2VO1A 2XPCA 1UXJA 2JRLA 3DXZA 1P9RA 4KO2S 2F1IA 4C1BA 5LD2C 1FX1A 1JYSA 4XFJA 2GI4A 1V6CA 3IESA 2VZ9A 2BHNA 3RUFA 4B75A 3DDWA 5CHEA 3IE2A 4GXRA 2IIPA 4K0KB 3LXUX 4M7OA 4Q7JB 3T9FA 1Z8FA 1P2GA 2AVNA 2L0XA 5H4HA 2OCGA 4WCFB 4JU8A 2Y9MB 1VJRA 2G0AA 4MUFA 3UMYA 5F2EA 1U1DA 2QU8A 3AUUA 1Z9BA 5HUHA 2FPRA 3GRCA 4W6QA 1RLJA 5JPCA 2NXWA 5B3LA 3PGA1 3I12A 2J3DA 5ESRA 4J2HA 1QZUA 1XCPA 5CDSA 5IVHA 4Q21A 3OSUA 2JD0A 3KJZA 5CXXA 1RHUA 5FF9A 3NO4A 1AGRA 2PX8A 1O77A 2WJVA 4ARZB 4BB0A 1M1YB 1Y8AA 2QI9F 4G97A 5ALOA 3NDRA 3SNHA 4N7JA 4C7JA 3NHZA 3QNWA 1EFPA 3PFNA 4URHA 3GJXC 2X76A 4FFNA 3GGJA 3ROXA 1T8SA 1D2RA 1KSHA 3EIXA 4RD1A 3KAJA 3L3BA 4A82A 1WCXA 2WSIA 2Z2JA 3VO8A 4UUOA 1NBWB 4NECA 1Z0IA 1IPHA 4OHOA 4Y1RB 3K9FC 1USUA 4AJIA 1DO8A 1V1MA 1VGVA 2E1RA 2ZSEA 3GJTA 1QFMA 4Y3UA 4UM9B 5BWOA 1J09A 2EHDA 3OWHA 4IG9A 5A2GA 4HDNB 3HU1A 1WXFA 4OQYA 1QH1B 4H77A 3TVYA 1EQ2A 2GCIA 2NUPB 1GV1A 2VHYA 4QD3A 3KZXA 1CJCA 1MNAA 3RARA 4BZWA 4JJ8A 4BLQA 3OO0A 2LW7A 3KHTA 1UZLA 1B16A 2WTXA 1PCXA 1WMBA 3DHYA 1ZK3A 2VBGA 1Q1NA 3M6IA 3PWTA 4IJQA 4F2WA 5HGXA 4DLPA 3KD3A 4FFMA 4M0UA 5G0VA 3STWA 5BRJA 3B9PA 3S81A 1RBQA 2QXTA 3GMDA 4YPVA 1UFVA 1WP4A 2PL3A 3S68A 3ZOZA 2HBQA 4HNRA 4BO5A 3N07A 3Q8KA 3BXXA 1K4YA 1HSZA 1KAMA 4BVHA 4CFZA 3MTAA 2CVQA 1OPRA 3SIXA 4XPZA 3Q9UA 5JY6A 3EQ9A 4K28A 2X6RA 5LBTA 1K7EB 2X15A 3Q5GA 2R6GA 3EGXA 2H2WA 3INRA 4MVJP 1NLUA 2G0TA 1SUCA 1MX9A 4WIAA 4KXXA 3GR6A 2WKSA 4DVGA 1YQXA 4CQMD 2ZJ1A 2YINC 3T5TA 1RZVA 2W2KB 2WHRA 3PFHA 3A9UA 1RI4A 1AN9A 1C3JA 1T34A 2BVNA 2H11A 1G8HA 3H5AA 4JYMA 1N2CE 1W46A 2D0OB 4WD3A 5TMBA 3SR0A 3OF3A 1E59A 3SSMA 4ONEA 2QRNA 4LY3A 4DUGA 4YYZA 1QQAA 3W78A 2QUBA 3QXGA 3KKPA 1I4DD 3MUNA 3TW6A 3RW9A 2VRNA 4BVLA 4OXQA 3O9ZA 2GWHA 1NW8A 2YS7A 3VR3D 3ANXA 3ICEA 1SULA 1L3CA 3CVOA 3DKIA 2RI1A 3NHWA 2Y0BA 4H4CA 5CR9A 1KPGA 3USCS 1HI9A 2B0CA 3DKKA 4CDMA 3ZS8A 1I6MA 1FDRA 2GT1A 4O4JF 3UC5A 4ECAA 4AP6A 1P2DA 4HKTA 3C43A 1EK5A 3ETEA 4GNKA 5IABA 2YN0A 1DLIA 4I46A 5ALFA 3I72A 2QUZA 3M1AA 5E3IA 1HNNA 3I09A 3HN2A 1NBHA 4PPFA 4WOPA 1X6VA 2CNDA 2PWBA 2VTBA 3ESZA 1FA9A 3LW7A 5JCOA 1EA5A 4KN8A 5DRTA 3OLZA 2H0QA 1SCKA 2OCBA 4INOA 3EASA 1O94C 1NQXA 4PGAA 4XWOA 1TLLA 4Y9RA 1CUIA 4PC6A 3GROA 2C00A 2H2IA 3HADA 1R8YA 1SO8A 1CEXA 4JEIA 4P4FA 3RSSA 2G4CA 2GKOA 1JEEA 3VKGA 1GQYA 1R0RE 1LVUA 2P3SA 4JCCA 3SDSA 2X0NA 1EZZA 4BP3A 4LVUA 3PVSA 4S3MA 3BJZA 2UZ1B 1TC1A 3EEOA 3ZZ0A 1Q17A 5DWVA 3LPNA 2QX4A 1KH1A 2BGNA 4UDNA 4BGEA 3CR8A 4ZQHA 4AB1A 2DULA 3A27A 3C8HA 2JAWA 3PUYA 1YMQA 4RZSA 1IOZA 3EVAA 1KAEA 1TM2A 1ZH2A 2EL9A 3HDHA 3OZXA 4H1TA 1W581 3JV7A 4MJ7A 5FUXA 3DLBA 1GO2A 3Q40A 4K88A 4B76A 2V58A 1FRNA 3C6MA 3UPUA 2HGSA 4YJGA 1KBQA 4BNZA 4D79A 5ES4B 1ZGCA 4IYRA 3A14A 1CR1A 1TOAA 1U81A 3CRNA 4K3VA 3V4PB 2I9PA 1WZIA 3O1LA 2C99A 4V0OA 1Y3FE 1H3NA 5EKDA 3U4QA 4URVR 4CZ2A 5JMTA 3FBTA 1SA0A 2NQ2C 1WA5A 1G6Q1 1Q5PA 3GAAA 4MGZR 2NO4A 2GOYA 2GYVA 4IO1A 1Z35A 4FOTA 2JJ2A 4LSZA 2TECE 1Y6JA 1JWAB 3T1HB 3CE6A 2OR4A 1J8QA 1X1QA 4UUMA 1JG2A 3EBLA 1GNTA 5EZ5A 3TXAA 4LS3A 2D0DA 1ETUA 3RF7A 4LDJA 2VAXA 3COPA 4KR0A 1UPAA 3NAZA 4QDKA 4INPA 3X2FA 4B4OA 3E9RA 3E9QA 2RHDA 1N5KA 2I55A 3EZ2A 1WLYA 3WWPA 5BV7A 3VNVA 2XD9A 2GCOA 5ALUA 5H81A 2HMWA 1ZICA 2QYTA 3FMPB 4LPKA 2PMWB 7REQB 1TZCA 4EKIA 1Z6AA 1BS1A 1CQJB 1VXOA 2TRSB 2X4IA 1JU4A 3E27A 1GNSA 5FYDA 2O19A 1QVRA 3FCUB 1ECFA 3OU7A 1EM8B 3CZAA 3PX3A 2HT6A 2NNWB 5KMGA 5DDIP 3RFXA 1BD4A 3TAUA 3ILHA 1XMSA 2QD3A 3DKVA 3QEMA 3ZK9A 5AIBA 1DBQA 1EP1B 1KOJA 1UJBA 2FSUA 2WB2A 3A3YA 4NQZA 1BDBA 2XECA 4TTVA 4Q37A 1IHYA 1EZ4A 3PXUA 1Y7IA 3WHKA 1M2FA 2R00A 4B3HA 4NJEB 4CDRA 3O0DA 3FCAA 3ORQA 2AZTA 4QU9A 3RC9A 3USZA 4KPEC 5BW5A 2AQIA 2L42A 3SHVA 4UQLA 2GHIA 4BMVA 2H57A 4H35A 4XCQA 4O4JA 1HGXA 3HWX1 4JQZA 4WOJA 4YALA 4ALLA 4GEGA 3K9LA 4DA8A 1C7QA 5B1SA 3RROA 2RCNA 5JSHA 4B6QA 4Z7NB 1E3MA 3EPJA 4TN1A 2QE7D 4MWSA 3V8PA 5GIOE 3C6ZA 2LVBA 1A9TA 3S9LA 2N46A 5FEMA 3OM0A 4LQLA 4NOKA 2OMKA 3IOCA 3OY2A 3UFBA 4N1AA 2O05A 3RV4A 2X22A 1IQUA 4ZI7A 3FF4A 5C5CA 4J03A 1F1JA 4WACA 1OLUA 5F73A 1W1WA 2AJ8A 2BW0A 4WY8A 3MTGA 2DY1A 2PS1A 2YVAA 1MJFA 4L08A 4MITA 4QUEA 5JS8A 5LFAA 3VJRA 4PLVA 1UR5A 3I73A 1OTHA 4WINA 3B3GA 3RNOA 2NADA 4A23A 1LPAB 4UTPA 1KYIA 4LJ9A 3Q1KA 4LRSB 4KWEA 2XYGA 2HIGA 4MMZB 3L46A 1TADA 3C3KA 3L8DA 4MS4B 1CS0A 4R1NA 1CSEE 4TMTA 3DE2X 4D1YA 1NC1A 3R3WA 3K8OE 4JI5B 4EYKA 1UEIA 1TYEB 1SQSA 1UXKA 2C7VA 4G09A 3KQNA 1L5NA 4DIOA 2B20A 1HT3A 1M6EX 1US8A 2HF8A 2R8BA 3TJZA 2JIZD 2PFGA 3KTDA 4EMTA 5I45A 1DRJA 4DL9A 1MABB 4CF4A 4KFTA 2XWPA 1P91A 2J5XA 2O2SA 5CCBA 4BNVA 5C34B 1SC6A 1W0JD 2JH3A 1Z08A 1XQVA 3IUMA 4HZIA 4HWPA 3TGLA 4R2HA 1FNMA 1HY3A 1NMZA 1T6NA 3IUYA 4P4SB 3TBHA 3WGNA 5T41A 3MBIA 3N0VA 3FSGD 1I4TD 5L3QB 4HP8A 4ZQCB 2ZUDA 2A2ZA 3EQ2A 4TSRA 2H1HA 2VKQA 1E0KA 5HK9A 2FF5A 2FR8A 1CJTC 5JATA 5F51A 1A9OA 4ROTA 1DIRA 1DRUA 3CH6A 3H9UA 4FDLA 4AG3A 3MAGA 4BWVA 1JAXA 3D7SA 1ZYMA 1WCYA 1PDWA 1HG1A 1RYHA 2HIMA 3Q7PA 4Q05A 2JBKA 4CO9A 2XQVA 1TXGA 3AESB 3WIOA 2R8PA 1XZ8A 1PT6A 2P6OA 2ZRAA 3BD8A 3FVQA 4IW3B 4QGBA 4HLDA 1KZ7B 2AI3A 4WBXC 5HFNA 3HBNA 1DELA 1CUJA 2RHHA 5EKUA 4DV2B 5HDQA 1ORWA 5A7HA 4INAA 5DNVA 4Z7QB 1YULA 2WAYA 3IV6A 2EXXA 3EWIA 1T29A 1IBMB 3LF2A 2GP4A 4OA5A 4BNLA 2VNAA 3JZMA 4QVKA 2FG6C 1GUAA 4W1PA 2PFKA 3LOPA 3LV8A 4I4TA 4HMQA 1TM3E 1IB6A 3AVYA 4QX6A 4ENUA 3QYJA 1K27A 4OJTA 3CVWA 4N0QA 4DWJA 3EVEA 2VNHA 3CZPA 4PPNA 4CKEB 1M6NA 1EFVB 2R6DA 3UJ9A 4BVEA 1GILA 3P0HA 4QNNA 1IAVA 3IDSA 3U2QA 4M9SA 3GLIE 1TUGA 4PBTA 4RNCA 2E37A 3SNKA 1K1EA 3BC1A 3OT1A 4AMGA 5HJ5A 5JY1A 4G0YA 3C3DA 3SN6A 1NVXQ 3DE7X 3RH0A 4CIYA 4YLGA 1F8UA 1HDZA 1PAUA 2RSLA 4WOCA 3IIJA 2A5YB 1YVPA 3VKFA 4ECEA 3PDIA 3C4VA 5KWSA 2JI9A 4LDRA 4FZVA 3R7AA 2FK8A 1LX7A 2WM3A 2IPMA 3CB4A 3ND6A 4CLOB 4EOGA 2YY5A 3UHFA 4QARA 4ER3A 1FSZA 1MKYA 3LY8A 5AW3A 4P1ZA 1Q0TA 2F1KA 3CF6R 4DA6A 3WIEA 1FP1D 4X0EA 2Q5JA 3OF2A 4RD6A 4XGIA 2X0SA 2GEKA 1PRYA 1Z2OX 4OATA 3AP1A 5LB2A 1OIWA 2QM8A 4CIXA 4LBYA 3R3HA 1SCIA 2BY4A 2PUHA 4RA9B 4D9EA 1QH9A 2CD9A 3PHGA 1S01A 5BSTA 2X1VA 3H0CA 1Q0UA 2Z5GA 4FE3A 4RLHA 4BL5A 4BX3A 5JT1A 4NK4A 2BIFA 3DLHA 1HQKA 3AOGA 4Q9NA 4M9UA 4MUJA 5EMJA 4YJ3F 2F7SA 3K0BA 5F2OA 4IM7A 4XWGA 3LC2O 1WB5A 4L4YA 1NVVQ 4B34A 5JCXA 2GYYA 4TTSA 4CKWA 1XEAA 3ZWDA 4C86A 1I1OA 5CCEA 3A1WA 5A4KA 5CJPA 2FMHA 1R5JA 3FMGA 4EK9A 5T8KA 3EAFA 2JHFA 3CINA 4NGSA 3FIJA 3BMQB 1PEKE 4HRXA 4TL6A 1R1DA 3IRVA 4Y6QA 3T0IA 4EI7A 3F97A 3RFTA 1HEIA 3AHHA 1QLWA 1YQEA 3IR5A 1EFPB 1KK1A 3AVPA 3OPMA 4G1VA 4HUJA 1KMNA 5CM9C 5DSTA 3UM9A 5HYVA 1VPEA 5FTLA 4K9NA 3IKJA 4FR0A 2EFJA 3V34A 5IR2A 5JASA 1XV5A 5JNWA 3JD0A 2ZANA 1DIAA 3DLPX 1NBWA 1E3LA 3FOBA 4DLUA 3R7BA 5FBZA 1O94D 3WKCA 4AULA 4DZTA 3MJRA 4HRAA 3ICOA 2E28A 2NT3A 4EYQA 4YUXA 3T3IA 5JNSA 4U7GA 4GOKA 3EX7C 3ASVA 1SVMA 3CZCA 1QVAA 2YV5A 2PQMA 3C1TA 4RF3A 1GPYA 4B81A 4LZJA 2I4MA 2WKQA 3GEEA 5J23A 3VVLA 1TAGA 4NU6A 1VIVA 3JAKA 1GG2A 3NI2A 3TRHA 2QX6A 1W73A 2DCUA 3RC8A 1U7HA 4OHMA 5DE3A 3X1YA 1S02A 4D9HA 1E99A 5KI6A 2JCVA 2QD2A 1EDZA 3MGGA 1I5OA 1K98A 4L0MA 4KDEA 4B73A 3H5RA 4MS4A 4LNHA 4DV4B 3KB8A 2PWYA 4LNAA 1KJWA 3KOZA 5EWLA 4KX5A 5TNXA 2QT1A 4B4VA 4YJ2A 3JS5A 3DL4A 4AIRA 2O54A 4FHEA 1YK1A 3OLYA 3K1AA 4LXTA 3NBQA 1VBHA 1ZWLA 3NKFA 4AWXA 1PFUA 5FOQA 2WTUA 4IIBA 4RTRA 4DR6B 1TE2A 2NNLD 1X7GA 5TVKA 1TF7A 2FCRA 2GO7A 3GGCA 2WYIA 3CVYA 3U3MA 2QWXA 1N0WA 4QPNA 5HS4A 1VI5A 4CTOA 4WNIA 1M66A 2Y1XA 3OEWA 4M54A 4YQEA 5LOVB 3KXKA 1YC2A 5DHAA 5E6UA 3U7FB 3TIFA 1HZJA 3ZZNA 1KEEA 1E9CA 1DDOA 1KQOA 3H3FA 1Z74A 4L7QA 1OGIA 2ZG6A 4D0LB 4COGA 3I0NA 4MRAA 1PG0A 2Z83A 4TTRA 4HGZA 5EE3A 2NSLA 2MYTA 1NTOA 3K30A 5D3MB 3URKA 1W36B 4UPDA 4C01A 1SEVA 2OILA 1C0PA 3KV3O 2YMMA 3TGWA 2CL7X 2H4WA 1GPMA 3EZNA 1DKNA 4GPBA 1KOFA 1X9IA 5IBPA 5JVDF 2HU8A 3VFDA 3IT2A 4LQ4A 4E21A 3RNLA 1V4NA 5CG2A 4RLSA 4ACBA 3NAGA 2ZR7A 1ZCZA 5CA1B 1JEYA 2JGNA 3QPBA 3NH9A 621PA 1U90A 3TQRA 3L8FA 4YCJA 1VCNA 3UC9A 3L0IB 2DF8A 5LZ9A 4JVMA 1S0UA 2C3OA 2XUDA 3QLUA 5JSZA 3FBWA 2W5UA 3SHOA 3ESYA 1X3SA 2J0VA 2NO1A 2W37A 1DPFA 4MB0A 4LF4B 1BJTA 3EODA 2C2XA 4MQ4A 4IZHA 3S55A 1EZAA 4XFKA 2XYPA 3KQVA 1GZUA 4UM8B 4CFYA 2AR9A 3Q41A 4N3CA 5BWNA 1VLZA 1QM5A 1SKQA 3ADKA 3JQ9A 1WSAA 4PVCA 3TZEA 2ZI4A 3ND7A 1KBZA 5DSZA 4RTPA 3PC8A 3T41A 3PUZA 3IP9A 3BE6A 1AQUA 1YOVB 3WRWA 2B36A 2P4SA 4B8WA 3AWDA 5FTNA 4ENTA 3UUGA 5KSPA 2IZ7A 4QWMA 2VQSA 3IPCA 3PQFA 2BWJA 1JJ7A 2QOEA 2PZBA 3PLRA 3KYCB 4NSNA 5T4EA 3RIYA 1JQLB 4URUR 4C4TA 3OJ0A 4X66B 4Z0TA 4FB4A 1P8JA 2HSDA 2J7PD 3P9XA 5FA5A 3WKDA 3COWA 4CUKA 4GGOA 2F3TA 1E0DA 4XSGA 4I81A 1MENA 4BQSA 2P9EA 5PGMA 3OQNA 4L15A 2C0PA 4IXMA 2VSOA 4WZ6A 4YJKA 2D5BA 2H85A 5IEJA 1LQ2A 3V8NA 4Q4LA 5AHRA 2H4ZA 4JB2A 2I3DA 4TZ6A 5AUQA 3P0EA 1H9BA 4CL2A 1IL0A 2FN3A 4A8JB 4WY2A 4M6WA 2X5XA 3KK0A 4R2IA 2HBYA 3VDNB 3IMCA 4JITA 1JWLA 1OVMA 4R1TA 2IYUA 1AOXA 1IHXA 5KYUB 2BDEA 1NW7A 3IJRA 1JIJA 1OW3B 3K16A 2ZUTA 2V4MA 1NGSA 1ECCA 2VWHA 2YW2A 3GFBA 3R3SA 4M1SA 3AZQA 3RRFA 2XZPA 3KEOA 3QUBA 4LYFA 1JBQA 1IOVA 1GU7A 1PNTA 2Q5CA 4RPCA 5AKZA 3VPCA 2R5WA 1MX5A 4B6FA 1GN8A 1AMUA 1UBJS 1J90A 2JLWA 4C2UA 3FPKA 4OKSA 2FQYA 3PJGA 3DQPA 1DB3A 1QRDA 5C7OO 5JBQA 2D5LA 4RHFA 1DEOA 5CA1A 3GIDA 3LYHA 4LYGA 3IVMA 2LWIA 4MS3A 2JHCA 4C7VA 1U8AA 1AKYA 3CW9A 5BMVF 3EZ6A 1ZN7A 3BF8A 2DQSA 3MINB 2JLRA 5EIBC 821PA 1Q92A 2FLWA 3PUWA 2VQ3A 4RUKA 2HMTA 2LIVA 5A5EA 3P2YA 5HUQA 1U94A 1VIAA 3AB7A 3MRVA 5F78A 3ZH2A 3LUAA 3KP1A 4S2EA 1BVYF 3TTVA 3I5XA 4B74A 1G3QA 2O2ZA 1KKLA 5GP1A 3THRA 5KMGB 1QP0A 2HO4A 2VI5A 1NN5A 2ACVA 4YROA 4EFDA 3OJFA 4GQAA 3B52X 1J8DA 3MTDA 4D8WA 3BGDA 2PSDA 3GH3A 3PDWA 3UANA 5LYJB 3FHTA 3ZW9A 4AVYA 2VWGA 5HKKD 3AUTA 5FWXB 4PSDA 1XFAA 2XHZA 3UHAA 1SUSA 2EJTA 3QA3E 4FMCB 3O75A 4JP2A 1IDN1 4AU1A 2OL4A 2FPPB 2INGX 3HDJA 1E4VA 2XAUA 5LA6A 3VNSA 3ZG6A 2NWQA 4OXYA 2WJAA 1P4SA 2C2HA 2WJ4A 4K9KA 4GP7A 3UUEA 2H3HA 1KP3A 1J42A 1KYYA 4NCAA 1G98A 4IOKA 5LBIA 2ONYA 2GAFA 3IP3A 4KTTE 1S2LA 4HSGA 1WULS 3D64A 4QNRA 2OOTA 2YIVX 1WMFA 4DIKA 4PGHA 1F2DA 1T0HB 1XVTA 4NNOA 5KINB 3W8RA 1I4LD 3L7LA 4G8DA 5CNJA 1H4VB 3I2HA 1H3FA 2A35A 4S1NA 3OZDA 3BB1A 1B42A 1KXZA 1QR6A 3OD5A 1HF3A 5KU7A 1CT9A 2NU8B 4ZO6A 3D0RA 3B2QA 3MS4A 2O1XA 1MJNA 4EVRA 5J43A 1SBNE 4YASA 1CUHA 2I99A 2GAIA 3NIDB 2BEVA 4BFYA 4DIDA 3QTTA 3SBXA 2I8LA 2FGKA 4QL3A 2JATA 4E5UA 4IH9A 2WAOA 1WF3A 3QVMA 5DYIA 1HUQA 5EJ5A 2AMFA 4BP9A 4H60A 3QFCA 1CZKA 5IDVA 1NKSA 1U0TA 1DG3A 2XQGA 4KDCA 3C97A 1AKEA 3O2SB 5C0OE 4K9LA 4OLBA 5FOWA 1NDHA 2GFHA 2BONA 1K6JA 3GRPA 4FBMA 1HZZA 4IQ8A 4KAXA 4UVEA 3MOGA 2P2CA 4C87A 4EI8A 3J80A 2NU7A 1JJFA 3QK7A 1MT3A 3I9FA 3RR2A 4LF5B 5EINA 2W6JA 2QZPA 1O5OA 4G3XA 3VR1A 3HBAA 4O4HA 4LQGA 1LY1A 1BMQA 1EDOA 3PVZA 1GADO 3R77A 5D3ZA 5A9RA 2BI8A 3T5GA 4NYMR 3T3PB 5K0CA 1PW7A 2QRVA 1RI5A 3N3AC 9ATCA 4XYEA 4TM8A 3DD1A 4PNPA 4Z4FA 1UKVY 3IPXA 5DNYB 2IK8A 4L85A 3JR3A 2ZBGA 4GWLA 5CB4A 4F4CA 3JD1A 4X7BA 2KX7A 3OZVA 4NOJA 4HLCA 3UQYS 2EGHA 4JXKA 3FCOA 4IJWA 3BIOA 1UH5A 2V5UA 3A1CA 2FMKA 5DNWA 4ZU6X 1FFAA 1YKFA 4FCWA 2OC9A 4M86A 2O5VA 3RANA 3B6EA 2JB9A 2VSQA 4C5BA 2IY8A 1R8JA 5G1OA 3UKDA 5BYAA 2AT1A 3OFND 1SWWA 2MT9A 3BD9A 3H4IA 4YAWA 1ZOSA 5I7RA 4K5QA 4QXMA 4MYHA 3PFFA 4MW6A 4RDXA 1VB5A 4IUDS 1YZLA 5I4CA 2XZDA 1BDHA 3EN0A 1SQGA 3HKCA 1L5HA 3U4CA 1QHNA 4Q12A 5JMWA 1T8RA 1KSFX 3PR3A 3QHPA 2D1RA 1C80A 3AOEC 4DR1B 2VDPB 4NEGA 2XE7A 1C0IA 4AO6A 1O8BA 3KWFA 2HEIA 4ED9A 4IBOA 1PYGA 4WX2B 4XM1A 5JWRA 1FDUA 2IHYA 3KZCA 3QVUA 1FP2A 1OKKA 1T6ZA 4LQCA 2HTFA 1OFIA 4JASB 4M83A 1OAOC 3EVCA 4P0TA 4BPRA 1MHTA 2NU8A 1EJBA 3D1VA 3PWSA 5D5PA 3CH7A 1N0IA 4KHZA 4P38A 2RHCA 3K5WA 3OI7A 4YRIA 3UJPA 2HTEA 2YWBA 5BOVA 3AJRA 4CM8A 4CM5A 1NVDA 1Q6ZA 3TB6A 3H83A 4D9MA 1FLNA 2V1UA 1HQDA 1BIFA 1M73E 4KWIA 1QFJA 1NVGA 2ZB2A 2PUJA 3K4HA 5DBEX 4S12A 5FLYA 1M8JA 3U4DA 3TTYA 4CIVA 4QDTA 5FWAA 5IKMA 3THWB 2YBEA 1G64A 4L4RA 2HJRA 4EVIA 5KNLA 1ZM7A 3I32A 4ER6A 1Y89A 3O4GA 1VYHA 3BB4A 3E22A 4CTNA 2YJTD 4OGFA 6GPBA 3ZE8A 1MOZA 2R0QC 3E61A 1H5UA 1AN0A 1NJFA 1VPTA 2CW5A 4FHDA 4UULA 3WOVA 4J16C 4RSHA 3PSAA 3ZBTA 3U62A 4F6CA 2H4YA 4H6VA 3SF0A 2YXLA 4I3FA 3BMCA 4A0GA 1QDUA 4B2LA 5F5NA 4H1WA 3M5CA 3EMKA 3L7YA 2DT8A 1IZZA 1XNHA 2BEWA 3LY5A 3ZDXB 2BZ1A 2V7UA 2W2MA 3NRBA 4TQAA 3MXOA 4C0QC 1TLTA 5FBHA 3L0YA 5K2OA 4FEYA 3T7SA 3IV9A 1HEYA 3L5KA 4AK9A 1GKUB 1L5OA 2LXNA 1KEVA 4E2FA 1VBKA 1EWQA 3VM6A 1RJWA 3PEUA 4LYDA 1KRWA 1NW5A 4E2WA 4JP3A 4H7JA 1G38A 3Q5DA 1ID8A 4PSCA 5EJ2A 1AGYA 1GFSA 3PDUA 3OTWA 2CLHB 3LT2A 1PP4A 1OWMA 3VV2A 3BFXA 2WW8A 2O2CA 2V7QD 4XW2A 1KO1A 4EO7A 1OWNA 4MRPA 1GL7A 4CU5A 3BREA 1EVKA 3JQ6A 4M4SA 2OYSA 5F7XA 5K4HA 2EF1A 3BXFA 3JU3A 4FX2A 2FPMA 3WDLA 1EGHA 2XRYA 4ZODA 4PAOA 1CNEA 1SBTA 3ONEA 3MUOA 3A1EA 4IF6A 4RH1A 4ZCPA 2ARKA 1F06A 3I23A 2R44A 3ZGXA 1CNMA 4W7IA 5K01A 3WAJA 3Q0TA 1OE0A 3ZTWA 1QCCA 4DM7A 4QUJA 3GB9A 1XJ0A 2AHOA 5GM2A 5KPJA 2H2HA 3PHIA 1PI3A 1NXJA 3TYXA 1K8YB 2ZXFA 2PT6A 5IDQA 1JMKC 2BGLA 2ZUCA 1BE6A 4FHCA 2QP4A 4JFAA 1OFHA 1A8IA 3F74A 4ZRMA 4A73A 1YI0A 5CT4A 3FPGA 5DCUA 5I7HA 1T4MA 3HJRA 3G88A 3L7CA 3G1TA 1LNSA 4MV5A 5IDYA 2Z6UA 1JXOA 2FUG6 1E4OA 2M1ZA 3OPVA 1C30A 1H8HD 3MJHA 3FDJA 1WSDA 4U9IS 1JNYA 3EXFB 3T7KA 1ZH4A 4BX9A 4KXFB 3GLSA 3L4BC 1V2GA 1CUFA 3ILSA 3L93A 4RXTA 5IC6A 4YV2A 1CS4C 2WZQA 5BORA 1BS9A 2HHLA 5AT1A 2COUA 2O8DA 3B3AA 4RHUA 4YI5A 1V5IA 4X20A 3N7AA 1E77A 3BH0A 3N8NA 4FVTA 4OB6A 4TL8A 3W7VA 4GZMA 3STUA 1MVLA 2H7XA 3ZZTA 4GHWA 1C5KA 1U2GC 4JEUA 3CTPA 3D0KA 3DOJA 4RHEA 3RI3A 3WKEA 4EJ2A 3LP8A 1DV2A 2VDWA 4WT7A 4WAUA 4CKYA 4ENSA 4A15A 5E7QA 4AQDA 2VF4X 4EPWA 2W6ZA 2EYUA 4BXOB 4EKNB 1ITZA 3A1NA 3HKDB 4DE5A 3C4QA 4PR0A 1KEUA 4ZMSA 5EJ4A 1WY7A 1PF7E 3IT1A 5I7WA 5HCNA 4DDVA 3NXSA 4UZFA 5F1KA 5ARCA 3STHA 1KERA 3VYUB 2WDZA 3AJEA 1J2UA 2NVWA 5E6SA 1T2VA 3W3ZB 2O8CA 2XEGA 4ZT5A 1E20A 4TUYF 3Q3HA 3SYMA 5A04A 4TLBA 4RIHA 3VGJA 4Z51A 4ZZIA 1DHTA 3G13A 4FNOA 3SJBA 1LW6E 2Z04A 3NBKA 3PNSA 4R9RA 5CA0F 4N39A 1QRRA 1E32A 3TG2A 2YDXA 2V65A 1H2AS 1A8UA 2VDMB 2ZUVA 3QPCA 3R76A 4AZ0A 3A6ZA 1ESNA 1HYGA 1X1TA 1N5MA 3GJYA 1MB3A 2Q4DA 3CV3A 4J0QA 3UVEA 3I9MA 3MD9A 4F97A 3WX0A 4J4TA 3E03A 4LC1A 1ADCA 1M75A 4QEDA 4N12A 3N6VA 4DIUA 1LNZA 3ETCA 2DTXA 3R3YA 3ZWVA 1IONA 1NF9A 1XX6A 1E8NA 3I42A 3O3MB 3KYDA 1TT5B 5TXGA 1UXIA 3KV1A 8OHMA 5I8WA 4U6QA 3DW3X 4F9FA 1CRLA 1I13A 3F6EX 3RKRA 1XZJA 1D4OA 2HXGA 5E2BA 1SXQA 1C9YA 4P4LA 2G5TA 4P54A 3RWMB 4ES6A 1UUFA 1T15A 5GIPE 5FV7A 1GQRA 2BDUA 2FQXA 3H13A 4OC2A 1DV1A 2RG1A 1GL3A 2YXBA 4F2GA 2ADOA 4WKPA 3EJWA 1YSCA 3R3ZA 4EHAA 3FZYA 2MP0A 1VLJA 5KYVA 1Y1QA 3H84A 3C3JA 4MQUA 5AJUA 1AV6A 2XB6A 3NYRA 3H05A 3IL2A 5C52B 1LW7A 2ZJ8A 2ZJOA 3IQFA 3OT1B 2OV8A 3D8UA 1SA0B 5E8RA 1TM7E 5TB5A 4BFSA 4F4IA 4GBGA 1Z5WA 1M2JA 3PXDA 4J16A 1CP2A 1DMRA 2GILA 4HAOA 3CX7A 4GKAA 4PQGA 3TOZA 5BMVA 1DBRA 3MCTA 3UCEA 5EWLB 4GRDA 4HH4A 2A9PA 1YZQA 2WKRA 3SZOA 2GERA 3VU9B 1JIVA 5FP0A 3WL4A 2VJLA 5FL3A 3WOHA 5CK5A 1K08A 4P53A 3MVEA 3P2IA 4HAIA 4YJFA 5TF0A 1K86A 1P81A 5E9JA 3T3EA 4HWSA 1B3RA 3RHSA 5E9QA 3H2BA 1PX2A 1O2DA 3AILA 3TCNA 4AZ3A 2JL1A 1GL9B 1XKXA 3A6JA 2AG1A 2W2LA 5HZKA 1E89A 4FCTA 4URFA 4RZHA 3HQ4O 2GCOB 1ORRA 2QTBA 4EQZA 2V7XA 4N82A 4N3NA 1RM3A 2IXTA 4B09A 1M5UA 3PFGA 1VXRA 3GLFE 2Z3WA 3PWKA 1UDXA 2R87A 3ZHVA 5IFKA 3MHTA 3BA1A 2NU9A 4PO9A 2VHZA 4LY9A 4C30A 2C96A 3FWKA 4DR3B 1NRXA 3IBYA 3G6KA 4JHLA 4MLPA 4TGLA 3VTAA 4AZWA 3G2HA 3E1GA 4HB3A 3H9EO 2WFLB 4PYOA 3MWGA 5FWYB 2V9CA 3PDHA 3QU4A 5BSHA 3D6FA 5HM6A 3NHAA 1E7WA 4RPHA 3GMIA 2D06A 3GQBB 3UMMA 1EBFA 4JD5A 3P8ZA 2VNKA 4EYEA 2HFKA 1AUXA 3OUZA 3GJZA 3LT1A 4G0NA 3LRPA 4PSAA 4AO8A 2PMFA 3QVTA 4LRWA 5IVIA 5LKRA 2CLMB 5HF8A 4E88A 3TRFA 3U09A 4HDMB 2PZMA 2IYRA 4I99A 4UMDA 3IEKA 1EG2A 5A3SA 3D3EA 1Q7GA 3AY3A 4Y2YA 2YN4A 3RJ5A 4NESA 1RCTE 3DDZX 4UREA 3WNVA 1VI4A 3CJRA 3EVFA 4M0MA 1FW6A 5FTJA 1OZAA 4CKZA 2ZJFA 3BK1A 3L0ZA 4RVFA 4NCNA 3G0OA 2E3JA 3QWAA 4HLQB 4M1YA 1FBTA 4LXQA 4P45A 1P3DA 3Q11A 5ETJA 1BVUA 1JQ5A 3RVNA 3JAKB 1OYOA 1BXGB 3E9CA 4IH1A 1QFZA 3FZGA 3U44B 4A0SA 4CMIA 1XJ5A 1U80A 4JBLA 1KO8A 1XMJA 1ZKDA 2NUPA 2Q5LA 3FHLA 3IUJA 3L84A 3SZUA 2FPXA 2PZLA 3GRYA 1OILA 3RSGA 5BV1A 1QYVA 4JC8A 3MT9A 2FFJA 1E64A 2YUIA 1IATA 4KRYA 4Q93A 5UKDA 2BGTA 4Q16A 3WRXC 3G02A 3WHPA 1TMGE 4N6NA 1MW9X 3DOEA 1ZVQA 1XMPA 4Q7QA 5KWEA 3INGA 1KFEB 4Q4AA 4QTUB 4IZOA 1G5FA 1ZESA 3LRXA 2XBUA 4K05A 4I3HA 1QRTA 5DXAA 2Q2VA 4DIEA 1ZN8A 3AO0B 4AYTA 1Z36A 2OO3A 3R6DA 1NRJB 4PYNA 4ZU1X 3NKVA 5LUBA 4R84A 1NFRA 3DWGA 2CWDA 1DEHA 1CZLA 2C5HA 3JSXA 4M7PA 4ZAWA 1MABA 3U7IA 2FZWA 3CSUA 3EXHA 4R2LA 5HS6A 1NVBA 3O91A 1IH8A 3M7IA 3D7HA 4W5WA 3ZJ4A 3NTVA 2NTJA 2J3EA 4B2YA 5CH3A 4CMKA 1O0SA 1SKYE 4FSDA 1UEXC 1XP5A 3L6UA 5AK6A 1OREA 4OHPA 3TK1A 3VR6D 1R37A 1KVTA 4B4WA 4YRCA 4OJQA 4L4XA 4GC5A 1JT9A 2C97A 3O8QB 1HEUA 2D0OA 4LF8B 5TIIA 2O52A 4D9KA 1V11B 4EW6A 3ZR4B 2NVUA 2ECFA 2PDAA 5HIIA 4JLMA 1V16A 4AS2A 3UBTA 1Y81A 2YC2C 3FJYA 3FOCA 3WL6A 4ZYTA 1NNSA 2ZE6A 2X0DA 5FI3A 1RFGE 1Z4LA 3L04A 3DBRB 3MFQA 4GYJA 1Z7GA 4B6SA 3W5DA 5DNUA 2HWGA 2ZSDA 3L43A 5CH5A 1EUDA 2RGEA 3WJ2A 5IM4F 3LH5A 3OPQA 3L7KA 3SBDA 1SQFA 2LKDA 4UKDA 5BSFA 5JC8A 3HFGA 2NTYC 2NTVA 3IPRA 5JMOA 1ZMOA 2AFHA 1WR8A 1I33A 4OXNA 1G3MA 5I8PA 3EZXA 3QEJA 5AI8A 3FETA 3U0VA 2JGLA 1VKRA 5SYAA 3NONA 3C3WA 3FD8A 4QXQA 3OMLA 4ZRNA 5JJIA 1Y9JA 1TQ6A 3AVTA 4E5SA 2EWVA 1E8DA 1ONSA 1UL1X 2IS6A 3F6CA 3PC4A 1SXPA 1KAHA 4XAQA 3TBFA 1RAHA 5AH0A 3CZ4A 2GLXA 4FFBA 4MI1A 1DAOA 3T3GA 3D8TA 4G67A 3K0KA 4ZT2A 2PYIA 2V6IA 2I8CA 3TTSA 3BCHA 3OY7A 4QRDA 1U9ZA 2OHIA 1DTSA 1VP3A 4HZGA 3U17A 3KQPA 4IEFB 3W79A 4K9QA 3MYRA 1NXVA 1T5DX 3MA0A 4FMDF 3DEAA 2YMLA 5LZ7A 4KBYA 1YRYE 3R6LA 5EIHA 1UBRS 2XWQA 3ODPA 2HWWA 1DEKA 1W30A 2BFMA 4Z7OB 1QIFA 3IO3A 4KR7A 1XD9A 1FX0B 1CIJA 3HP4A 1ORIA 3KYIB 2DZDA 2FYTA 1KO5A 1GNQA 2C1EA 2D2XA 2OAQ1 1GGJA 2XNJA 3LVFO 3T9AA 5JS7A 4X9XA 4U2EA 1DQSA 4MVJM 4EJ0A 5CYFA 2C9YA 2C2GA 1JSLA 5FR2A 4KVZA 3T1NA 1NKTA 4MAMA 5HCIA 2YWXA 3F7TA 2WE8A 1TO1E 2C94A 2DX7A 4IAOA 4XVQA 1GFZA 2OFWA 3OU6A 1CF2O 3MWEA 2UVPA 4NG4A 1LRKA 4KKXB 3ZDYB 3M9XA 4G1CA 4RYDA 4DCVA 1JMYA 5ALPA 4J4HA 5A02A 3HEAA 1ZH8A 3O92A 2O8FA 1G7CA 3AFNA 4LFBB 1PK7A 1T6BY 2IU6A 2ZUUA 1E2DA 1E98A 1ULBA 1VMIA 3DFIA 3MWFA 5DWDA 3CNEA 3CGGA 5L51A 3OT4A 4WN9B 4GFDA 4FIZA 1JEYB 4Z2AA 3ZVKA 2DPGA 1OA0A 4QXRA 1XTTA 2IOYA 2ACKA 4ESOA 1FFCA 3BILA 4NK5A 3UAGA 3IQEA 1X7HA 4PLCA 4WWHA 2Q0HA 3CEMA 5AW0A 2NUTA 2D5IA 1K6XA 1UWVA 3GLKA 4B8YA 4C5CA 3ZC3A 2Q4OA 3CZQA 4CM4B 2BHTA 1QHHA 2DKOA 4MUYA 4BHTA 4O3MA 3I01A 3WYNA 3VSBA 1GD1O 2GMWA 3GLRA 1TJ4A 2PMKA 4GR5A 2W6OA 3QE3A 4M9ZA 4P31A 2XEDA 2E87A 2I6UA 1ZRNA 1GNPA 4KNYA 5ICCA 2IHKA 1C1HA 2IQIA 2XYHA 4GE0A 2HB6A 1NYTA 3OG9A 1YOVA 3G79A 4HYQA 4OHRA 5A6SB 1EESA 1B6SA 1EUQA 3CRVA 2WWFA 4KQ2A 4ZIRA 1R2QA 2ZRFA 4RTSA 2XA1A 5F3DA 4ZKDA 3IMEA 1P60A 3DDOA 4PCAA 4REOA 2JKZA 4W6ZA 1NM5C 3PG5A 3KOXA 5AKLA 4CMCA 1D6JA 2BTQB 3Q7EA 3BHMA 3U3OA 4KPYA 3QWHA 1KBOA 2J3JA 1LJ8A 5CCXA 2WD7A 4N0EA 1FRQA 4LNUA 3GFVA 1T5BA 2QMUA 1E9EA 4G2TA 4AROA 5EIXA 2QN6A 5DTEA 4ZCMA 1KIAA 2VHJA 1PS9A 1E6MA 3GU3A 1PDVA 5J2UB 1U2PA 3OIWA 3S5JA 1IXYA 3T6KA 1L7NA 4OUKX 4CM6A 3LDGA 1KO4A 3TZQA 3OOYA 1O5TA 4QOIA 4A16A 4KH1A 1H93A 4TL7A 2WSYB 3B5EA 3GXOA 5JNUA 3T9EA 4DDKA 5FTMA 1S2GA 4AKEA 2ESRA 5F76A 4Y1EA 1C7JA 3HB4X 3U3DA 1OLSB 3ED5A 5HILA 1NI3A 3CUSA 3OQPA 3MWEB 1VCHA 4YMIA 4KEAA 3ZKAA 1WE2A 2WHPA 4QPZA 1BMFD 1UAYA 2TMKA 5ALYA 4TT8A 2VZ0A 4EAAA 4IRMA 1EFHA 1R0CA 1T0JB 3ORFA 4LAFA 1Z6ZA 3EEFA 4MHSA 4UZEA 5KKAA 2O8DB 4W1QA 1S2NA 3QVOA 4A2WA 3FEEA 2D8MA 2HNBA 3E22B 4JLJA 1O5IA 4WNCA 4XGKA 1A1VA 1BOFA 5IBRA 3OPYB 2Z1DA 5DNDA 2ECKA 4HN9A 4WN3A 2OAGA 1IPEA 1G41A 2IHBA 1HC7A 1WV1A 2WIGA 3I92A 3JSAA 4MKZA 1U5BB 1B93A 3U7EB 3H9QA 3REGA 4E5MA 5KOJB 1JFVA 3GJ6A 1E3WB 3LUFA 3ZDBA 2W11A 2B21A 2KWIA 5DGDA 4HG2A 1K0UA 2YMQA 4GX5A 4IDOA 4TXNA 4E5VA 5FNVF 4RZ3A 4IXDA 4XR9A 5SZKB 2XEIA 2HCFA 1MGOA 5HEKA 1J2YA 3LW8A 3K6JA 2DYKA 4DQKA 4FFWA 3VDRA 3AOEA 5JSUA 2B69A 4R1MA 4D4GA 2VPYA 3GDGA 3GCGA 5KUTA 1O4WA 3PXEA 3OE7A 2UUPA 4XIJA 4XVHA 5ANRB 2NZ8A 1KC7A 2UV8A 1JLLB 2ONJA 3Q7QA 3QOFA 2MYPA 1GA4A 2H17A 2LUOA 3ABIA 3PNQA 3D5QA 4LK2A 2OZVA 2R2AA 1KZHA 4AP5A 4EGCB 4JLSA 4KIJA 4C9VA 4YCBA 3IKLA 1MTZA 3FLBA 4JENA 3GHYA 4DMHA 4R69A 3QMPA 1SURA 2QL7A 2JGDB 1ISJA 4OXXA 4C4OA 2QUIA 2NO9A 3SE7A 4EPYA 5CVDA 4MCQA 4JB3A 2CSXA 2I1QA 1IHOA 1B6GA 1RMQA 2I3GA 3ENZA 1S9HA 3IHTA 2XD4A 3GN1A 4HI0E 4PHTA 5HJ2A 4B44A 2YXDA 1H69A 1HE5A 3C3XA 2ID8A 1H5QA 2WP8J 3J81k 4FC6A 2A86A 1HMYA 4L27A 2QLMA 3HL0A 3ACBA 1CF4A 2NSDA 3LJKA 4IR7A 1RXYA 3A7DA 4QJ3A 2BFCB 2ZTLA 3ETDA 1Y4AE 4MPDA 4NICA 4TMKA 3VJKA 1I2BA 2VSFA 3QUTA 4RVDA 1DCMA 4DY6A 1JU3A 4DANA 2KW5A 1DKQA 2FEWB 3CU5A 1WDLA 1YS2X 2ZTUA 4NJOA 1L2TA 3TECE 3N0XA 2DUNA 5CLHA 1VPVA 4X1KB 4IIYA 2HSEA 2JD2A 1X42A 3IAS1 4MIEA 4J3NA 3TDNA 3BK2A 2IGTA 1BYIA 2RHLA 2ONKA 3LYLA 5B3JC 2G4VA 1L4EA 2OSVA 2WYVA 2Z98A 3D7NA 3KXIA 4GOLD 2WF5A 3LQ2A 4NCKA 5LQJA 2HROA 4OBBA 1P4HA 4O33A 3W8FA 3U60B 2LGJA 2CBZA 3GVCA 5AI6A 3A6FA 3E2PA 3PB3A 5A5FA 1K63A 3JYOA 5BN3A 3AKZA 2BGGA 3NFYA 1KZYC 4RDIA 5BWLA 2PRYA 1P0CA 2CLDX 3EMVA 2FEMA 2QZ4A 1CU1A 1UWLA 5BN3B 4YJFB 1AHNA 4MKHA 5FO1A 3A3OA 1UBEA 3T7RA 4OC5A 2H5JA 2QQGA 1QOQB 3Q87B 4J29A 4X41A 1D8TA 2WYOA 5EFZA 2C7QA 3RB8A 4D4KA 3QF4A 5BR7A 3IELA 3ANYB 4C43A 3QE9Y 2CC2A 1QB8A 2EBWA 2C1ZA 3RJZA 3ID6C 2XEJA 1A5AB 3PCXA 1VJTA 4G89A 2COKA 4PNEA 1QR2A 3M83A 3LA6A 4HVTA 2FZVA 2XCUA 1G4HA 3ZYZA 4AUMA 3C1UA 4P92A 4KL8S 4LTDA 3KR0A 5AXCA 2WNSA 4XVUA 1RQXA 3PHJA 4BFVA 4YUYA 3OFSA 5IULC 3NWPA 3VH3A 4CQJA 1PS0A 1PVVA 1W87A 1YBMA 5E1MA 5IUKC 3IDZA 4TV8A 5BW6B 1HQCA 1VKHA 2BGKA 5J5CA 2PLFA 5IAAA 1YQUA 4BN4A 1T5OA 4BV8A 3AUKA 4FGSA 1CZOA 4GPAA 3WSWA 5ED4A 2XUAA 1S2IA 1M6HA 1SUPA 1PJ4A 3IP7A 4I6JA 1CDOA 4Y2XA 1TGYA 3BWBA 1NP6A 2IYPA 4X7RA 3ZE9A 1T13A 4BNFA 4RTQA 3GNSA 2XJ9A 1YGPA 2RGUA 4BZQA 5EESA 1LVHA 1R0BA 2DY0A 4HFNA 4KNVA 5FOVA 3H86A 5DX1A 2WWIA 2VAMA 4F6RB 2Z2XA 1XELA 2R7MA 1I80A 4UMFA 2IPLA 4U7HA 5ESXA 4FWTA 1X1EA 5TDHA 4WDQA 2HYIC 2HAEA 5REQB 4PYMA 3QBEA 3OTGA 4FXOA 5LLDA 1F8GA 1MXFA 4YJGB 2UZIR 4P2GA 3DE1X 2EVWX 1CJUC 3UCXA 4LSGA 2JGIA 1TQHA 3VYTB 3CO5A 4PZZA 3RTBA 4RESA 1G4AE 4RV4A 3UFXB 1GG5A 2WHPB 4ZQBA 1EFDN 3BMNB 2CV1A 3M4ZA 2R4UA 3IJ5A 1I3LA 4HDAA 5K3AA 4JX9A 3E15A 3SZRA 9ABPA 2CLOB 2Q2NA 4C4PA 5JZVA 2UXBB 4OL9A 2QVGA 2J3IA 2AQ8A 2R62A 3BFKA 1BKSB 3RVLA 3WG9A 4IFTA 2HK7A 4DCNA 4EFLA 3PFBA 3GP3A 5ELYA 2P0YA 2OBMA 1JHUA 3T8YA 5HIAA 2P8JA 5D29A 4CETA 2OZEA 4YIHA 3S99A 1ST3A 3QFRA 2HJSA 2Q7OE 5DTQA 1B76A 2ZKLA 2XE6A 4GE3A 2A9KA 5EJ6A 2O6LA 4R8RA 1GRNA 1TMOA 4LISA 1EXMA 1QE5A 1WNTA 3NPMA 1DWOA 4L5AA 4MJLA 5AMXA 3L4BA 2JJMA 3NTQA 3WGYA 1TVMA 5IW8A 4FILA 3JWEA 3H1PA 4JBGA 4TQUS 2DWOA 3AKCA 1M1UA 1TQ2A 1YKSA 2QSJA 2L69A 3U9TA 2XHEA 3W6PA 4CNQA 4B87A 3MELA 4CQMA 2C4NA 3V7UA 2A1TS 4ID3A 5BSRA 2SKCA 2FE4A 3H9JA 1HL3A 2J4DA 2RGRA 2O8CB 3IQWA 4YWJA 2X0IA 4Y2QA 5K6AA 3DYIA 4E30A 4G5YA 1PL0A 4XYMA 1P2SA 4HWGA 4Q15A 3GNTA 3UOAB 4BLTA 5BW8A 1R16A 1RPTA 1XZAA 1BE0A 2NIPA 1XDUA 2HL6A 3DUWA 1X1CA 2WTMA 3EW9A 1C7ZA 3AV0B 2LCQA 4C4XA 3S29A 3A4TA 4J07A 3SJXA 1JHXA 2QTWB 1LLUA 4L5JA 1XCMA 3A7EA 4EX7A 1YS1X 3R3JA 1I4WA 1ZJWA 2ACEA 4MCIA 2J8ZA 4KXWA 4C3ZA 4DWWA 5IUJC 1DNPA 3T4XA 5BN4A 3TPZA 3OU2A 4EF5A 2IP4A 4JEMA 5DMHA 3KUDA 1OC4A 2PTHA 2JFOA 3KQKA 4YUWA 2XMQA 4YRQA 3NEPX 3AR7A 2CJPA 4DV5B 2WKPA 1BYUA 1AM4D 1ZK4A 3CRRA 4D99A 1DTEA 2ZK7A 4MRMB 1ZQ9A 4BRUA 1BXGA 2MSCB 3K1ZA 1M2KA 1ZDMA 3PC2A 1YA6A 3Q7IA 1P73A 3H4VA 1XA3A 2IYZA 1DIHA 3WNQA 1P2UA 1GTJ1 3IAS6 4DC1A 2W2NA 5B4UA 3SJAA 1PJCA 3WB0A 4JI4B 1JF8A 1N2SA 2MU1A 2HJGA 2RJOA 3RUCA 1B1AA 1NJ8A 3RQIA 3LPLA 2AG0A 1QYXA 2YCBA 2JA2A 1RTKA 4RVSA 3KSRA 4DUYB 4OTZA 1OH8A 5CDYA 1ZIDA 4AY5A 1AJEA 3E9ZA 1FSGA 4FN4A 1J97A 1TU0A 2FV8A 1KY5A 3RTGA 3MB5A 2P4EA 2GPAA 3ZI4A 4BBPA 4BNHA 2ZAOA 2G40A 2VDWB 5G4KA 4KAFA 1DJOA 2FUCA 5DLQC 521PA 1YA4A 3L49A 4RX1A 4BJ1A 5SY4A 1JPNA 2Q3MA 4UEQA 3RIGA 3EXHB 1FK8A 4Z2YA 3UXEA 1ML3A 1BKDR 1D0SA 2I62A 2PS0A 2BKXA 2I2WA 2O7QA 2QDKA 3H1AA 4GOXA 1U8EA 4J49A 3TO5A 3PBKA 2J45A 4N41A 3H3XA 3HCPA 1Q0LA 3FKJA 2FG7C 3ICCA 5BYBA 2EQ5A 4B0OA 4MP3A 5FPHA 5FJJA 2FRDA 2HCTA 5BNZA 1N1MA 2NQ8A 4CQMB 3R5KA 3S1SA 1ATZA 4JY7A 3L40A 3I5UA 3H97A 3EC2A 3KQSA 2NACA 1BFUA 2BMWA 3K4QA 2YBDA 3HCBA 4K6MA 3RC1A 3E5RA 4H1HA 4DG8A 3BMQA 4TMFA 4N5DA 4PZUA 1PTJA 5FBLB 2BCEA 2UUCB 3T7IA 1HYBA 2IEZA 4X63A 4QPCA 5J40A 2EGGA 4FDTA 3GUUA 3ZI0A 4DBVO 3AL2A 1FYDA 4M1WA 1A4RA 1M1YA 3D31A 4C9BA 4LWPA 4RY8A 3RFFA 3W5UA 3FPLA 4P7GA 3PCRB 2HRQA 2ZRKA 4BO2A 3EZGA 1QP7A 1E5XA 2O8NA 3C5EA 1G60A 1W96A 5C1IA 3G59A 4HQ0A 1XTQA 4MV3A 2Q28A 4ZHQF 2YIMA 2HREA 1VB3A 3UUWA 2QTLA 2DKNA 2CL6X 4K3UA 1EGVB 2WB4A 1A71A 1FNSA 1EDBA 4REQB 1GLNA 5CTAA 2C4WA 4FGJA 2X7JA 4KJXA 3SC4A 1EA7A 1RZRD 4QIHA 1FFXB 1I4OA 4OP2A 1COWA 4PX5A 5DBOA 5TGZA 3TVTA 2O5CA 4FZ3A 1KP2A 1JYFA 1TCAA 2F90A 2VLBA 5CVVA 1RXWA 4NR0A 5DZSA 5BQOA 5FOTA 1E18A 3NNNA 3OA2A 3MMZA 5K3CA 4ODIA 3RC2A 1UBNA 4UE2A 2FZ4A 2VF7A 3HC7A 3NVDA 3WSVA 3HR7A 3M33A 4LBZA 1NP7A 2XB9A 3C3EA 3PD0A 4KWHA 2JFBA 1HLPA 5K0LA 2VP4A 2EEPA 1HETA 4FFLA 3KQWA 1QMGA 4ZZ2A 2H07A 1Q77A 1B00A 3M4XA 1TRKA 1HDOA 3COZA 2FN7A 2Z56A 4FI3C 1YCDA 4OQLA 5CAEB 1S7CA 5FULA 3Q8LA 1FS6A 5LOVA 5IB9A 4ID9A 2OVFA 3FYCA 1TF5A 3OSZA 1TO6A 5EQFA 5B1YA 2VHTA 3OTQA 5TRTA 4RORA 1L9XA 2X8JB 3PGVA 5FPKA 1P1FA 1SN7A 3F3YA 2JCXA 3AW9A 3H2YA 4DXHA 1G5TA 3PNKA 1GT6A 4HPWA 4NBUA 4ZHSA 5EZQA 3UJ6A 4V3CA 4R16A 2F59A 1Z2EA 3FNRA 1T9BA 2XUOA 4HDKA 2KMLA 2E0IA 2F1RA 4Q3EA 5HA5A 3HY4A 3RVRA 4TKUA 3KB2A 4JHXA 2BUCA 5FR1A 5CCDA 1GZ5A 2P7HA 3ZWKA 3O6VA 4FFVA 4YK7A 2DLNA 1YOBA 4P3XA 4AICA 2Q46A 1ECPA 4ZMBA 1PO7A 4KSCA 5L3SB 1DHRA 5KOIA 2MSLA 4DILA 4YAJA 3QELB 3SFZA 2JI7A 3A1SA 2ZBDA 3SF8B 1L4GA 2VSYA 4R8MA 1ZWKA 3B89A 3UWKA 4FFRA 5L3VA 2HRBA 5KSOA 2ZJZA 2PRJA 3WC4A 4GWGA 3VKVA 2YVQA 4JBYA 4EVSA 1GGMA 1DKUA 3HCCA 5U1PA 3ABQB 1TJYA 3S2EA 2HHCA 4WA7A 1NBEA 5A3RA 3OAAD 3JYPA 1YB2A 3H4TA 1WXWA 3O84A 3OVMA 4L0CA 2A88A 5ALRA 3BFVA 4FXPA 5AYVA 3V46A 1T9AA 1D07A 4TVBA 3LECA 3L9XA 1PDOA 2QAGB 2Q4BA 1Q0SA 1YS4A 4MHOA 4BVKA 2DUUA 1DJLA 3CMMA 4F85A 3Q7SA 3EXFA 2IDMA 4QJIA 4QYSA 4OB7A 2RHGB 3DZCA 4WZAB 4CQLA 2VF2A 5G41A 5KKCA 6Q21A 4PAMA 5EJ8A 3Q7TA 1Y6RA 1Z73A 2PEZA 3PKIA 4DMRA 2ZDGA 5IZ4A 2AMLA 3SS7X 2QW8A 5F98A 1WW2A 4OQFA 1T1RA 5JSYA 1B41A 3HY6A 1FMCA 1Z0ZA 5IVPA 4WZAE 4BZZA 3GCWA 1R61A 3LX4A 1NAIA 3D6NB 4I6GA 1UJ6A 1CS0B 3OMWA 4KSYA 4X8LA 2G5PA 4NLLA 5EA2A 2GRUA 1T8UA 3T94A 3UB4A 5LMCA 3H2ZA 3W1WA 1QE0A 1Y8QA 1YUNA 5BRNA 3SZLA 1KARA 2W4MA 4EZIA 1HM5A 1P31A 4G1EB 3FMVA 1CZNA 4LJ6A 2AQKA 1PEAA 3JY6A 4QELA 1WAMA 1SH7A 2BFFB 4ZPJA 2ZJ3A 3U9SA 2AFHE 3MAJA 3ZIAD 2DTEA 2XNKA 4DB4A 2ODQA 1FRVA 4IHJF 1ORDA 4CCWA 3O1IC 1BA2A 5CA0A 1DZIA 4ZOQI 1R0YA 5EJGA 3RIMA 1YDMA 2A1IA 3OZEA 4X1IA 1XRPA 4WBSA 2BEKA 4CCYB 5JXJA 1LF0A 1Y5MA 3PQCA 1SEPA 2VP0A 4ZYWA 2CUZA 1M7BA 2GEUA 3RTDA 4DCUA 1JFSA 4XA8A 3WGJA 2W00A 2H1FA 5KYUA 5T6MA 4EYOA 1U2GA 3KALA 4ZOAA 2OBXA 1LTHR 1ZW1A 3O8LA 4FYYA 2A57A 4QQKA 5GVRA 1U3DA 3TAHA 4TKVA 1PJRA 5CDFE 5CNMA 3OESA 3SHTA 1VLMA 4GNRA 4M6WB 4H3SA 4MUEA 4BLPA 4DMUB 2EFEB 3CVUA 1TQ8A 3CRW1 1JHQA 3T34A 3VMMA 1OOEA 3DV2A 3N53A 3OFVA 3R7SA 4HDQB 2O5EA 3U61B 1OH5A 3G85A 4CLEA 4L07A 1ZUWA 2CYAA 4JP1A 4M0DA 1ZJJA 1U9IC 3ZGLA 1YR8A 1F0YA 1J33A 3H8VA 3L7AA 4NC9A 3UMBA 3CCBA 4QVIA 2ADMA 4LPSA 5ICFA 1W76A 1K6EA 4QM6A 5EKXA 1Y3DE 2KYRA 3MJDA 5D6OA 4F60A 5AM2A 1XVUA 4CIDA 5CT8A 1EUDB 3HEBA 3LSTA 1GSHA 1E3DA 1L8AA 3CX3A 4E08A 4EMUA 3VPGA 5CVCA 3ST7A 2OQ2A 4O2AA 3KWLA 4Q3NA 1QANA 3GD7A 3QGMA 1L9KA 2FEPA 3CO0S 4FS8A 121PA 4P4GA 1H2BA 1QIHA 5L3RA 4LZZA 1UAGA 4D9FA 5BVGA 5A4DA 3HV0A 4CBVA 5I4BA 2OECA 3TRIA 3R9WA 1WQ3A 4QBKA 1PR5A 1OT3A 3LC0A 5F1OA 2IBMA 4BVFA 1OASA 1R9MA 3EXEA 3Q0IA 1IWOA 1Z15A 2H7CA 4CQLB 5IJWA 1N77A 1FZTA 4E13A 1N2HA 4EW3A 3CG4A 1YJ5A 5JZBA 1I4EB 1VA4A 3AB8A 2R00C 3TMYA 3PQ6A 1T0UA 3LFTA 4QJBA 1FXWA 5DCWA 2WFMA 1U3GA 2OBFA 3IILA 5KAPA 3KJIA 3BB3A 2ZITA 2GN0A 4QGAA 1LK0A 4C9EA 3LCUA 1SU7A 2QNBA 4WERA 1N5DA 4LYHA 4DDHA 3AK4A 3BWXA 3IIMA 3JASA 1U0JA 3D5TA 4R6WA 3BE4A 3WBBA 3PJRA 2Z8YA 1HPLA 4YQFA 5BUZA 2ALJA 2DQZA 4V0QA 4C8PA 4FYPA 1IJBA 3VYSB 1M6WA 1NN0A 1KTIA 1IVNA 2HI6A 2G67A 2W6ID 4EABA 1RJ9B 1HOTA 1RPAA 3IXLA 2UXCB 4II3A 1TA0A 2QE6A 1T2EA 2H16A 2VXOA 2Z6VA 3BF7A 3KKZA 3P9KA 4XQCA 4F12A 2R68A 5ALWA 2ZBEA 5KZMB 5JSFA 5I9MA 2R8XA 3LLUA 4KMSA 3FAKA 4R2MA 5AM1A 3R0XA 3LBIA 1R9JA 1RZRA 2F3UA 1H1LA 1XJCA 3HPQA 4D3DA 2J30A 3DVLA 4CCSA 3IMFA 4FONA 5HSGA 3R44A 1P1KA 3GGGA 1K5PA 1L8OA 1QNLA 4I50F 3NFRA 3R0QA 3KX2A 3QLJA 4NBTA 2W22A 4TWIA 2VJMA 3BMNA 4C6HA 1V7CA 1T2DA 3U7QB 2FZLA 2QJWA 1ONOA 1ULAA 1RC0A 2XLBA 2Z2YA 4F5EA 1EXNA 3CUEF 5I9TA 3FZEA 1J0AA 5KNCH 1X1AA 1JDSA 1T2CA 2YFHA 1EFRA 4I4TF 4I7EA 3A9TA 3P2KA 3CZ5A 4JYPA 1AK2A 1NNLA 3OZCA 4M0EA 3SCZA 3IP8A 4Y2TA 3L7BA 3WA6A 1J21A 3O26A 1PZXA 2FK7A 4HC4A 4F2DA 3FXAA 1W4RA 2EKQA 4MEBA 5E6SB 3KZVA 2HJVA 2WJWA 1J9GA 1I3NA 3G2OA 3PL1A 4H59A 3WL5A 4BRSA 2FWAA 3KRVA 5KYWB 4JJ4A 1DOHA 1Z6YA 2NX2A 1WUYA 2Q6TA 1JILA 2YIDA 3CF2A 3HMQA 4GAEA 1KK3A 4ILEA 4KE9A 3K1TA 4KQCA 4HGQA 1BOOA 4H3VA 3U3RA 3G9TA 1ZEMA 4ZAXA 5EZYB 5L4NA 1Y3CE 1E60A 3SQXA 2QD1A 3EIQA 2RHJA 2PJDA 1EUYA 5DEIA 2BI7A 3E5MA 1NIPA 5JXWA 4EPRA 3AF5A 3DAHA 4FWBA 3R5JA 3S2IA 4QJ4A 5C37A 1JR4A 3AHDA 2C6GA 4GX2A 1W2GA 4U5XA 2CLLB 3DCIA 2ID4A 3SG0A 3H5IA 3DV0A 4B2IA 1YI1A 1MUUA 3ADCA 1OTXA 1R66A 3CS3A 1TEZA 2VPZA 3CBGA 2AXEA 3Q1LA 2AYXA 2QR2A 2ILTA 3AU9A 3BM5A 1TFRA 4HB2A 4L57A 3T38A 5I3ZA 4O2BF 4TPKA 3L6DA 3DBLB 4NZMA 1YT5A 4RS3A 5IAOA 2JGKA 2C29D 2JGDA 4NV1A 4F8YA 1EZ1A 4MW1A 5KCMA 3RF6A 2WF6A 3PT5A 2XWJI 3ISVA 4QLOA 1KSGA 4E1VA 1SHJA 2QBYA 2HT1A 3L07A 1YBHA 3BWCA 3WYCA 3PC3A 4E51A 1V96A 3GUVA 4Q9KA 1BVHA 4LWZA 1C4XA 1XROA 2CWWA 3QKWA 1EFUA 1K06A 3BPSA 1ICIA 1IWPB 4MYTA 4H7HA 5B57C 3JYLA 4WXPA 2RBGA 3U3ZA 2GHTA 2FDXA 1LJLA 3L1UA 3H99A 1ZCJA 2ZBQA 2RARA 2EC5A 4TLLB 4YRFA 4TRRA 1U3WA 1NNI1 4KWCA 1QKKA 2JJYA 4OBXA 1SIBE 4RE5A 4Y98A 5G02A 4XGNA 3R7NA 2HOQA 3O2QB 1R0KA 4YDHB 5BN1A 2IHTA 4C88A 5I7OA 3HZZA 3T7EA 2GXUA 1V8DA 3G5TA 3B8HA 2CV2A 4W8GA 5C46F 3FRHA 2F2TA 2BRUA 3AHCA 1N2GA 3QELA 5DX8A 4MV8A 3WMRA 2EV9A 2Q7DA 3T7CA 4K9OA 3DBRA 1IOLA 2HCBA 3IT3A 3P1JA 4ITUA 4J9UE 4JK3A 1ZYUA 2A7XA 2ZCJA 4F04A 4D42A 4MQFB 3VU3A 3H11B 1KIMA 2LZ0A 3KJQA 2RJ3A 2JEOA 1ONPA 2VEDA 1L5SA 3K5PA 3KS9A 4JR0A 4TTAA 4NGRA 3TW0A 3RG2A 4DM3A 3PQ4A 1SBHA 1BWPA 1MVOA 2M6LA 2PSFA 1P3JA 4OHFA 1SG9A 3E3AA 2Q1SA 1ZSVA 5H0IA 5KNBD 1LX6A 2XQKA 2IPAB 3N8HA 1H2YA 5EY5B 3WLFA 1FOEB 3A6PC 5IN4A 2Y4OA 3WMXA 1R8SA 4G0ZA 4MKRA 2PNJA 3VO9A 3QXSA 3Q7RA 4D9BA 2VTBB 2DVMA 1VDZA 4OU4A 1HMPA 5FUQA 5FORA 2W4QA 3NWJA 1PJLA 3K0CA 3O31A 2PYDA 3OIYA 3PFCA 3RAPR 1ABFA 4KSBA 4BQEA 3PYMA 2XCLA 4YLYA 5TY0A 1SOMA 3ZY3A 4A8TA 2AE1A 3TXXA 1YZNA 4LA4A 5L8VA 2GFQA 3CLTC 3L7MA 2DR0A 4UFPA 5LU8A 1KYZA 1N9GB 2YWRA 1KGSA 4W5OA 4CDNA 2WD8A 3DQQA 5KOHA 2HV8A 3FTPA 4OBWA 2BMJA 2WOOA 1WUTA 4B0PA 1KP9A 4FE4A 4OHWA 3TD2A 4DOMA 1XUOA 4NBSA 3FA2A 4JSRA 3FMIA 4JI3B 1PHRA 2V03A 2E5LB 1VJ5A 1T91A 1FFSA 3NKLA 4DKXA 3FF1A 3AMVA 3V8QA 1U3TA 1ZGGA 2FSVA 3J7TA 3RLIA 3O4FA 4E5KA 3I2GA 5GJBA 3L6EA 5IASA 4YCLA 1PT8A 2H7VA 4DBLC 4ABTA 3VYRB 3NORA 5LR6A 4YT5A 3VXKA 3C8ZA 1E2QA 1X13A 4JVLA 2N47A 3O94A 3V8VA 3E5HA 1WBBA 3BXMA 4PV7A 1ESMA 3KG2A 5ABPA 3AF6A 2H3EA 4E6EA 2GN6A 1Q1GA 2H48A 4P3KA 4NZYA 4IV0A 3EQ7A 2PIAA 3T06B 3HFRA 1ZG3A 4KRGA 1IG3A 1IIBA 2OCIA 2WAXA 3IVXA 4N0DA 4BMSA 1MDBA 2OGZA 3IIEA 3QA9A 4KV9A 3IKTA 3U7QA 3W5VA 4P6VF 4HDOB 3GLIB 4FCCA 1TKCA 1NUPA 3DDNA 3OHMA 4I36A 3S0JA 2O2DA 5CB8A 3KT3A 2RHMA 5HW0A 5DM0A 3TLEA 2Q9UA 2HZBA 3CLSD 5KNCA 1NW4A 5IRCD 5D84A 2YXPX 1TB4A 1VCIA 2BMFA 2ZR9A 4FBLA 3R6WA 4LY0A 3LWDA 4TWBA 5GINE 2JJ1A 4B5KA 2C3MA 1ZMTA 1NJSA 4MUXA 4O2LA 4M1MA 3W06A 1PR6A 4BO6A 4D74A 4DUGD 3UB3A 4RQAA 3KSMA 4CV2A 4TJVA 4QQ8A 2GB4A 5IKOA 1YI8A 3R1IA 4ZVSA 1C7IA 2M32A 5AXBA 4KIGA 1X8JA 3LYAA 1CUCA 1QHHB 3WMFA 1RRGA 1GUDA 3DGEC 3INYA 3DMNA 3AIKA 4HAZA 4HZUB 4GKJB 3LUDA 4Z1MA 2A5FA 3QTLA 4MARA 2VHEA 4Z0PA 2J5KA 2MSKA 3U9LA 3D3KA 3ZVMA 4ZCRA 3KJEA 3PTZA 3V9PA 2DPHA 4B3JA 4W9YA 4P3PA 4XQ9A 4C9UA 2PCJA 1U8TA 1JLLA 4FFOA 3ICWA 4PFKA 3U4GA 3TZBA 1C3EA 4G8JA 5ADUS 2QZSA 4IFEA 4LXHA 5JNVA 4WOBA 5FA8A 1YJ8A 2ZRJA 3ZIUA 1RXEA 3CX6A 3H8JA 3V6LA 4DYDA 2AA3A 1L7DA 2YYZA 2QZJA 1E4YA 3F8SA 1Y8RB 2I6GA 3PF9A 3PNVA 1FTWA 5AW8A 2VWPA 4LRTB 5DMXA 1TD9A 5EHGA 2CYBA 2V5VA 3HJHA 3R5TA 4AD8A 3GWZA 3LXXA 1Z63A 1DKPA 4OPMA 4QGHA 4PPYA 1XMOB 1E79D 1XVVA 3STYA 3R3UA 4IWXA 4PZ9A 4UTXA 4RK0A 4CMJA 5IC4A 2ZFUA 3G2LA 2JIMA 4EQ6A 2QSZA 1GARA 3G8DA 1DG9A 1FCJA 4KG7A 3IAEA 5AK0A 2HW8A 1V8FA 1M8KA 1XLTA 1IK4A 3MTJA 5HJEA 4ZI7B 2BFEA 4CG3A 3IAM6 4CI9A 3I8XA 1MDFA 2AJCA 3L8HA 5A4JA 1OLUB 3OEED 1Z68A 1OWPA 1XRRA 5BV0A 1W44A 2BFEB 4G6ZA 2J9XB 2AOTB 1XGKA 4M89A 3FZQA 3SMQA 3G7UA 1UJ5A 2NYVA 4JODA 5GAJA 2CNKA 4A6XA 1R9GA 4FGUA 1PSWA 4P0QB 1WQ4A 2OK7A 3SJCA 1JBEA 2Q3LA 4LTNA 4DSAA 4JQYA 4G5XA 2J0UB 3SQMA 2EDCA 3HBLA 4AG5A 2C77A 1WXXA 2QLJA 3I45A 3GG2A 1RQPA 3PPYA 5BSVA 2J41A 3B1XA 3NTXA 3OUUA 2AOXA 4LGYA 3ZY5A 1TYBE 5HRCA 2WWXA 4I55F 1FXSA 1Z5ZA 5FUYA 5HF9A 3AEUA 2OPHA 2GF9A 1ATIA 4NMXB 3ELUA 4X6LA 3VZRA 1L3BA 3IMKA 1FFGA 1DBPA 4DLNA 4X71A 5IZCC 5B36A 1CYEA 2OHVA 4ZU3A 2K7FA 1H6BA 2R1ZA 2ZJ5A 3K0AB 5F9MA 3UAWA 2Q3HA 1CB7A 4A8JA 3JQRA 4BKUA 2ZYVX 4Y2JA 4XYBA 3QOXA 5I4IA 5LP1A 1QU3A 1NE7A 2DKFA 2JS7A 2A0KA 2Y6UA 1I1QB 4Y2PA 2XGMA 4S05A 5JV5A 1YZFA 4IDBA 1EM8A 1QTRA 4DCSA 5KSWB 4UTZA 2P79A 2UVPB 5AM5A 3K0FA 1HR0B 1E2LA 1V5WA 3EEIA 3GVXA 3R0ZA 1W5TA 2GVDC 1K9VF 2FDRA 1Z6GA 1G8JA 2JAOA 1DIOB 2H92A 2YJ5A 2PR2A 2ZJYA 1U9IA 1E1LA 1QORA 2QP9X 2RCYA 3MJTA 5BQ5A 2ZETA 1RYMA 3E35A 3OHPA 4HHEA 1HYHA 1IZ7A 3UMVA 1IY2A 1OROA 4NATA 3SD7A 1E2NA 3DCJA 2ILVA 3PA6A 2LCIA 5A0FA 5L3ZA 1P61B 1H94A 3D59A 3OZ7A 4D8XA 4ISBA 1IQPA 4G4JA 2JLYA 2HI0A 2JNWA 3EZ9A 4CKCB 2H65A 2E4UA 3VPSA 1RRCA 2UUBB 1CX8A 2VNJA 1GCUA 1OI7A 1NF2A 2D13A 2O06A 1FTSA 1RWBA 1U2TA 3OM9A 2IS4A 4PM4A 4DCPA 4Q3KA 3W5BA 2C98A 2QMEA 4J0GA 5G0WA 1C4WA 4CGZA 4YP0A 5M7EA 3BG5A 1QRAA 4EQ6B 2B9EA 1FJ2A 2B1GA 2EFCB 4G23A 3I3SR 4WKBA 5LXTA 1TMKA 4C14A 3M5WA 4DNQA 4GVLA 3W5JA 1DI0A 2UYHA 4XWAA 4AQ7A 1AZSC 2VAVA 2YVUA 1CJBA 4OV6B 4Q9AA 1IXRC 4TOIA 3LFHA 1ID1A 1GRCA 4PQRA 2A58A 3VR2A 3T3DA 1U8YA 3GF4A 4OJMX 4K8OA 4RC9A 2R8OA 4C78A 4KREA 1P0IA 4JXJA 1YJAA 1HT1E 3L7JA 4NV0A 3AL3A 3CYFA 4ZOEA 2X8WA 4IJ5A 2BE7A 4HWTA 1LEHA 3IE0A 2P2NA 3MJEA 3NEAA 4UUAA 3NHPA 2PPVA 3EXHC 2Y0CA 3ELWA 3F96A 3HB0A 3FUCA 3ANSA 5BMVB 3CLRD 3ROKA 4J7UA 1C2TA 1ESDA 1O58A 3JQFA 3KSDO 4JSTA 5BSMA 3W5SA 5HTOA 1FMTA 2QUHA 3L9WA 4NCHA 1BNCA 2TMDA 1OX5A 1ONBA 3PP8A 1DKOA 2H51A 4UEOA 1NZJA 5AVUA 2G1PA 3KHUA 3QUAA 3RHFA 1SBZA 4YV0A 2O59A 2OV2A 4KUGA 1TUIA 4WK0B 1RKBA 2F1HA 1DG1G 1CUDA 2B4YA 5EXXA 1HDRA 3RRJA 2HRCA 2E4XA 2XE4A 3PZBA 4KCGA 4R4JA 4DJAA 5CAEA 1ZRHA 2OT3B 3GBVA 1V6SA 1J24A 1M6VA 2XV1A 4AS3A 3HU2A 3E5NA 2WPDA 3FECA 3ED1A 3O4JA 1R0SA 1XWFA 1KJYA 4TKVB 1M1ZA 4WK6A 2ODNA 4ZC1A 4IIHA 1XALA 4CDGA 4CZ1A 1Z83A 2JAUA 2WYUA 2C8KA 3C3MA 1L5LA 3SYRA 3UMCA 4F56A 4AY2A 4C9AA 2HSJA 3NGLA 3IOYA 1U63A 1CTQA 2Y1GA 4LVOA 4N7BA 3U7HB 3K9TA 2BR3A 4G1UC 4MS1B 4MW2A 5A9TA 1SD2A 3IPYA 3WXBA 4AY4A 2XRZA 2QTRA 2IUTA 3VKUA 4DEXA 3F6BX 3UT6A 2IH5A 1N6OA 3I9JA 1JKIA 2V3WA 1N7IA 3GNQA 1XZNA 3NM4A 4MPRA 1Q19A 3GPDG 1X9HA 1P0FA 3TSAA 2O0HA 2GZDA 3K9CA 4EFMA 1U7DA 1YKGA 2AUMA 4ZMRA 5B30A 3LDAA 1SCNE 2BHRA 1M7HA 4LGMA 4BMDA 2JLUA 3FYUA 4WESB 1GUFA 4W7HA 1X7WA 3W2TA 2E82A 1M1NB 1V41E 3Q15C 4ZGBA 2B5OA 3KRTA 4REQA 1JQDA 3B3QA 4OXIA 3LF1A 2IE0A 3AFGA 4CL0A 2ZI6A 3H1FA 3GLTA 2Z2ZA 1E3TA 4GXNA 4DTCA 3DOHA 4TXHA 2J0EA 2SCUB 4J0KA 5DGXA 1Y98A 3BOSA 3EHDA 3OLCX 5KNDH 3PLAE 1ZNWA 1P5FA 2A9OA 1JMVA 5KJEA 1I24A 5AJHA 1MIOB 4G5OA 1YCGA 4B6EA 1U3UA 3H17A 3WGZA 4LRQA 4F5YA 3K9WA 3MLBA 1HK7A 4YT8A 2VQFB 1D9ZA 1M34B 2XMPA 2PG3A 1AHPA 1JPUA 3AJDA 4P5PA 1XLVA 1GGFA 4PHGA 3RUAA 1LFAA 3DXYA 4V2IA 4ZQGA 1CJVC 1D1SA 3IC5A 1KDOA 3N2NA 5JCJD 3QQPA 2GCGA 2PBRA 2ZP1A 3T9DA 1DCTA 1J1UA 1SQ6A 2PPLA 1B4DA 1CZHA 3LHKA 4HQKA 4KUHA