4IIYA

Structure of mccf in complex with glutamyl sulfamoyl inosine
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
335
structure length
335
Chain Sequence
PLLAAPLAVGDTIGFFSSSAPATVTAKNRFFRGVEFLQRKGFKLVSGKLTGKTDFYRSGTIKERAQEFNELVYNPDITCIMSTIGGDNSNSLLPFLDYDAIIANPKIIIGYADTTALLAGIYAKTGLITFYGPALIPSFGEHPPLVDITYESFIKILTRKQSGIYTYTLPEKWSDESINWNENKILRPKKLYKNNCAFYGSGKVEGRVIGGNLNTLTGIWGSEWMPEIRNGDILFIEDSRKSIATVERLFSMLKLNRVFDKVSAIILGKHELFDCAGSKRRPYEVLTEVLDGKQIPVLDGFDCSHTHPMLTLPLGVKLAIDFDNKNISITEQYLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of MccF with substrate analogs
rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords MccF
total genus 120
structure length 335
sequence length 335
chains with identical sequence B
ec nomenclature ec 3.4.-.-:
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02016 Peptidase_S66 LD-carboxypeptidase N-terminal domain
A PF17676 Peptidase_S66C LD-carboxypeptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Class I glutamine amidotransferase-like 4iiyA01
3.50.30.60 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 LD-carboxypeptidase A C-terminal domain-like 4iiyA02
3TLZA 4E5SA 5F1YA 4IIYA 5F9MA 3SR3A 3G23A 5JYBA 2AUNA 1ZL0A 3TLAA 3TLGA 3TLCA 4MI1A 3U1BA 4IIXA 3TYXA 4INJA 4E94A 3TLGB 5F5XA 3TLBA 4EYSA 3TLEA 3TLYA 5K99A 4H1HA 4JVOA 3GJZA 3T5MA 2AUMA 5FD8A 1ZRSA 4MJXA
chains in the Genus database with same CATH superfamily
1W6RA 3OHMA 3BWBA 3FZEA 3IWWA 2FPKA 3VBEA 4NNOA 2EWWA 3IT3A 5BW5A 4HPXB 2PH7A 2DGDA 4WZBA 4Z0TA 1MOZA 1SPXA 5H59A 1ZUNB 1OLSB 1H8HA 2B2NA 3C3WA 4CU2A 1GCGA 1BX3A 1MHPA 1RYEA 1TPYA 1Z0FA 2JGRA 1T10A 4JP2A 4WBNF 4GP9A 1CYEA 4Y18A 4C9RA 1RZVA 2I1LA 4DIKA 4N82A 4DKJA 5BV7A 4CDRA 3LBYA 4K28A 4V1CB 2B37A 3KAQA 1VJ1A 3CLTD 1NVUQ 2FWRA 2WLTA 3DTNA 1V8OA 4J0KA 4MQFA 5EPUA 1RMYA 3S2ZA 1IJBA 3X2SA 1C3VA 5FO1A 4LIPD 1CS0A 2BKUA 2ZR9A 3FYUA 1G21B 3LTNC 4RULA 3PYMA 4UM9B 1EFKA 4HDMB 2AOXA 1YTLA 3ICVA 3V3KA 4B34A 5BWCA 1FFGA 4ER0A 4JA2A 2A1UA 3QWFA 2ODAA 1K5DA 1AKWA 5A6VA 2XMRA 3AF2A 1R61A 4JIMA 3LW8A 3TQRA 1ESMA 1N2CA 4LV5B 4M3NA 1R66A 3X1JA 2R47A 4A6XA 2V96A 3EVNA 2X23A 4RU1A 4NKRA 2AK3A 2DH5A 1G20A 3GARA 3FKJA 3R20A 3T3IA 1A8PA 2IX9A 4D9KA 4L50A 1I3MA 2QBYB 1E3DA 2VG8A 4ZAWA 5BSKA 3G1UA 4BP3A 4LRXA 4CUJA 5FPKA 3A31A 5AESA 2XUJA 1Z3CA 1VG9B 1U7ZA 2W6PA 4M0KA 5FPSA 3BRQA 3W6PA 3ZU3A 1ZK0A 4WV3A 3TTUA 3TCKA 1TO1E 3ESXA 1MH1A 1OFGA 4QM6A 4RXMA 1XZLA 2Q3HA 2XGOA 4UHJA 3ZH2A 2AOVA 2FUEA 1CZLA 2ONCA 3DBRA 4HQOA 2I7XA 2SICE 2ZYAA 3QWAA 4CU5A 1UZUA 4B81A 2Q2NA 1Q2UA 4BMXA 4D42A 5F33A 1YC2A 2A9FA 5EINA 2VJAA 1ENOA 4OHCA 5EAIA 1SCAA 4ARBA 4P80A 4NFSA 4B9EA 1K8ZB 4D96A 1SWVA 2PXHA 3E8MA 4D97A 4IO1A 1QV6A 1IHYA 3F4LA 5C9ZA 1X8XA 4BUCA 4LK2A 3W5AA 1DKRA 3WJ1A 5DX0A 4MGIR 3TVYA 5AMXA 4M83A 3OBIA 4JC8A 3VPAA 1GL9B 5ES4B 4TUYF 2IH2A 3SN6A 1J07A 3AEKA 1I33A 2GZMA 3BF7A 1XIVA 3L4SO 2LR0A 4P35A 4WGFA 1JHUA 3EZXA 3ZXIA 4D0LB 5L8VA 1X1RA 3NOOA 5FWXB 4PBRA 2ZWIA 3UKOA 5KNBD 1DBPA 2W8BB 2F8SA 4EARA 4ZICA 1V9CA 1T36B 1UQUA 3V6MA 3SK0A 1UZLA 5E6SB 1VKZA 3NG1A 4M9CA 2ARKA 1FSGA 4B40A 4ENWA 2H1OA 1HYEA 1VKRA 5BQFA 2ETXA 1BE8A 2Q6LA 1Y6GA 2JIMA 4AJIA 2YHIB 1FYVA 4KYIB 4WE3A 4K7JA 1CHDA 1BXKA 1OBCA 3JX9A 3K9TA 1KAQA 4HS4A 2ZE5A 1YB2A 3OQ1A 4G8BA 3IUNA 1MF7A 2EZTA 2GTPA 3OJLA 2PKQP 1XAIA 3AF3A 4ILEA 4P0PB 2X4GA 5LQRA 1ODCA 2CUKA 4FCWA 4ER3A 4LHSA 1U7DA 1M83A 3NWEA 2PPVA 2CNWA 1M0WA 1ZI9A 1LS6A 4G25A 4Z54A 2OFOA 4HQ6A 3O4JA 5I7SA 3A27A 3ZK9A 1PNRA 5H7XA 3DC2A 7AT1A 1TC2A 4Q3DA 1XRNA 2ZDHA 2E48A 5F1KA 2D1SA 1Q7RA 5ARCA 3IULA 5C1BA 4FFDA 1C9MA 1ZAKA 3HO1A 1N4AA 5HX7A 2QRNA 2A0YA 2BMJA 3Q1KA 3VH3A 1LCIA 2H2AA 3Q8XB 3RWBA 3S1AA 5CT8A 4M0LA 4ERXA 4DV0B 3RYHB 2VXYA 2C8LA 1GGHA 2B30A 5KOJB 3H2YA 1F7UA 4TZ6A 4JI2B 1U8YA 3FMIA 3JWHA 4K9NA 3BJIC 3E48A 2OZLB 3OMXA 3OVMA 5F1YA 3HKDB 3F6BX 4MDEA 3KLMX 3KAKA 4YMHA 1H2HA 3RIMA 3SOPA 3UK2A 4ZWNA 1NBAA 4GAEA 3UH0A 2PNJA 1XTSA 5IH3A 4LZAA 1CE8B 5IR2A 4FP9A 2YXPX 3VUFA 2MR6A 4IPTA 1WPGA 3AETB 5L3SA 3COYA 5ALGA 4XWKA 2AFRA 4OKSA 3MIZA 1MNAA 1WF6A 4RK0A 5GJWC 3KJZA 3KOYA 3PX3A 2JLUA 4YRCA 4ZARA 5LSAA 1T4BA 1AKEA 2CZCA 1JQKA 5C81A 2FLKA 5CTAA 1BNCA 1U90A 4OXRA 2HKIA 2AJLI 5TPZA 3OD1A 3TR6A 2AQHA 5EZSA 5CA1A 1BGXT 1N6HA 1Q16A 4L22A 2EBFX 1GNRA 1UKBA 2R2AA 5CP8A 2A8YA 3ZZNA 5FL7A 4DB4A 3JRXA 3AVYA 3AHDA 3B1JA 3NHSA 1FW6A 3JY6A 3NKLA 2CLIB 1Q44A 3K32A 4RY2A 5HM6A 3TTYA 1E4OA 3JWPA 4EGAA 1Z8LA 3ZNNA 1L5LA 1PJCA 2WWIA 3AOGA 3BAZA 3SFVA 1FSSA 1G6Q1 1H3NA 4FR5A 2WJVA 4F2DA 1IZYA 4LFAB 2CSUA 3LO8A 5BT8A 4YT4A 3QU9A 1E8NA 1YDHA 3BKWA 2WHPB 5EVJA 1AGNA 2ZQYA 1I2ZA 3JYQA 5H82A 2NSYA 1NR1A 4Z8XA 3M5PA 2AI3A 3QYFA 4AG5A 1GFZA 3BHXA 1YMUA 1D2MA 3B1VA 3AC0A 5CLIA 3HGQA 4L02A 5KMGA 4ZVVA 1F1JA 1PTJA 4B2LA 1UBCA 1P0PA 1Q84A 2XY4A 3AXTA 5HOQA 5JJBA 1B23P 4NYJQ 2BFWA 2OECA 3FBWA 3G9ZA 2WW8A 4ASUA 2DMRA 4A8JA 3IODA 1KVRA 5C7YA 1PP4A 1ZH0A 2OBFA 1ZIOA 2A0UA 5DDIP 1JXQA 2JASA 1BW9A 2OAP1 4JQYA 3WHIA 5CB0A 1E99A 5DP1A 3ETEA 4P4NA 4K5QA 1M73E 2RH5A 4JXKA 1QCDA 2PFSA 4GX2A 3QPAA 3HBFA 4P3XA 2VAVA 5BNZA 1GZUA 5DYNA 1V11A 3BQMB 3PVZA 3FTEA 4YMGA 5EWMB 5BYJA 2ZKIA 4ECEA 1W5BA 1EVYA 1V8PA 1VPVA 2ZP1A 5THQA 3T3NA 1Z75A 5AI4A 3IHLA 4G0XA 1ZYMA 3WVNA 4AZ3B 3AT1A 4FSDA 3TK1A 4BPBA 1K8RA 1HYQA 2D0OB 2WUVA 2XEFA 3EOBI 5IAEA 1DIBA 1XVVA 2Y0EA 3D8SA 1TYEB 3NGMA 4WX2B 3WQHA 4K9DA 4QUEA 2IHTA 1HBJA 4H7JA 4W7IA 3HCNA 2A9KA 3NHJA 1THGA 1V7CA 3HSSA 1ZR4A 3LGSA 2REQB 3ZZ0A 1Y8QA 4YVFA 4AICA 2DPXA 1L5HB 2VA9A 3U7QA 5SY6A 1DIRA 1KBLA 2GD1O 2NV2B 3O3OB 3IBCA 3T41A 3ZCRA 5AJXA 4COKA 4QT4A 2GD2A 4EW1A 1PCXA 5CU7A 1N5LA 3LP8A 2HJWA 4DTIA 4CEHB 1Z28A 1CUJA 2HMVA 1YB6A 2WIBA 5C46F 2XGJA 1IRXA 4Q15A 1DWOA 2XCQA 3FPHA 1NF3A 4J1TC 4JL8A 4KMRA 4RGVA 4K6MA 5CIWA 5SZJA 3RSOA 3WQRA 4CGYA 2O7NA 1VCHA 1RYYA 2BP7A 3FWHA 4ZAGA 1YBAA 4ARAA 1NN5A 1YFJA 4WBXC 4YB8A 1O0SA 5DTQA 4E03A 1KYTA 4C2TA 1V9SA 4KK4A 3QEJA 5F3RA 3AJ8A 1G3UA 1YJBA 3DMTC 1PQYA 4GL4A 4NAUA 3ZU4A 5AUPB 2ZB8A 2NZUG 2XADA 5IT5A 4CKXA 1BRMA 1U9JA 1ORRA 4PW0A 1RIFA 3E1GA 4YRFA 5EC8A 4EHIA 1QG4A 3ICOA 2N3ZA 3JAKA 3DD5A 5L51A 4J0FA 1RXWA 2WFLB 1Q0RA 1IM2A 2YZGA 1LF5A 4YYEA 4EKEA 5B3AA 3KETA 4OH1A 2L0XA 4C78A 1D2EA 3NDPA 4ZCLA 2ZDGA 2VA8A 2JDID 2P2SA 4NNPA 4XH9B 3Q0EA 3GCZA 4XW2A 5EWJA 2HU5A 1MJHA 3ETJA 2YKGA 2NSLA 1F06A 2NUPB 2PT6A 4NDZA 2I3ZA 5I7AA 2WF8A 3EISA 3ZWXA 3TLZA 4R1QA 3MQ2A 4EFDA 5C5DA 3A70A 4P45A 4IQ8A 3HUDA 3FHLA 3UCXA 3B51X 1P5FA 4DR1B 5CB4B 1E94E 2RHCA 2J3LA 5CH3A 2FPPA 4ZVMA 5KI6A 5JJLA 1E7RA 2HIHA 4YJFB 2M1ZA 4JI3B 4IZIA 3UG6A 3AJAA 3S8MA 2F1RA 1H0RA 3H16A 2F43A 2ACWA 5A4FS 5I7UA 1UPTA 1GNTA 5C5EA 1F8YA 3NTQA 2ORYA 2QSUA 3LKDA 2XWJI 5M34A 4XZ3A 4QVIA 4I4IA 3WGHA 4BEWA 4WCFA 3W04A 1JEDA 3MYRA 5CFOA 3NYQA 4PN7A 3RU9A 2C2WA 2XV1A 2R4TA 1JGTA 2GNOA 4U2FA 1ZITA 5FD8A 4BNDB 3E3LA 2ZU0C 3OFKA 1CQXA 4LDAA 1ULAA 3CRQA 5DHQA 4D57A 4U2BA 4M0FA 1U7WA 2PRYA 4L3VA 2EHDA 3BGVA 3C5VA 4KQIA 4KODA 4WK0B 3GRVA 4AC9A 3IAS6 4DR7B 4DSNA 2CLKB 3JASB 4E4RA 3SQMA 5F9FA 4MROA 1Q1EA 2HREA 3MWYW 3PIIA 1RZRD 3JSAA 3R3HA 1NE7A 2BEUB 2CLEB 1FPQA 1ZUNA 4FOOA 3EZ9A 3JZIA 1LFAA 1U80A 3D81A 3C3MA 1YMQA 3N6RA 4J6FA 2NZVG 4RD1A 5I7OA 1OX4A 2A3NA 4Z9YA 4JSTA 4G1FA 2IKQA 1XSEA 3BGWA 521PA 1QC5A 1X1CA 3DZJA 4RTPA 4GLBA 5G2OA 2ECPA 3UFXA 4IJMA 1EVIA 2HN9A 5K1ZA 3KXPA 3NDBB 4FYWA 3N8DA 2B4RO 1XHFA 3VJMA 2BDUA 1Y3IA 4MQFB 3U3OA 1N0VC 2ZEJA 1U2SA 2GEDA 2RIPA 2XCUA 3ZE0B 1W2GA 2CNLA 3WA6A 5EFZA 4CKWB 1G21A 4GZ6A 1HM5A 1HMYA 1DAMA 3P9QA 4OB8A 4XSGA 2WAAA 5FFFA 4WLEA 3IURA 3L92A 5JCZA 4TKMA 2AJBA 4H7PA 4QDUA 3RS8A 4QBTA 3MJRA 1Q7GA 1GL3A 5FUBA 3EGXB 4DMLA 5AUOB 4IWXA 4ZEMA 4XCQA 2C5SA 1W96A 1NXQA 4EKNB 3KT6A 1QG2A 4P38A 4AIIA 5G1PA 3HZOA 1WM1A 4CMBA 3PUKA 3H8VA 1K2VN 4B71A 1U0TA 3D4BA 3KALA 3KXLA 2DBVO 4X6LA 3T4UA 3ZLBA 5TXGA 2CBZA 3Q7QA 2YHSA 1UM8A 4KV7A 4OTZA 1U5BA 1JE0A 1O95C 3TNFA 2AT1A 2AEMA 2I4RA 4DE5A 5CDUA 4BX9A 2QW8A 4IQGA 1AKUA 5DM4A 2B2CA 1YB4A 1ZBQA 5AVRA 1N25A 4OMCA 3W7BA 4P34A 1HDOA 3DV2A 2J9ZB 1V5IA 1VE7A 1X92A 3ZLJA 5EZYA 1DTWB 1RKQA 1C1DB 3EXG1 5AICA 3KJIA 1ZNWA 2K4MA 2WBLC 2WVGA 3L6RA 4Z3KA 4X3RA 1D3AA 2EJBA 2PXCA 3OZWA 1NVEA 2Y4OA 4ZV7A 4QFMA 2L18A 2VF7A 5DMHA 4UNRA 1Z7YA 2X22A 4L8LA 4DLYA 4PZAA 1KEPA 4R8RA 1SUPA 2Z8ZA 3TIGA 1N8NA 3TI7A 1KJWA 5B1HA 1FDWA 1NF9A 1U8ZA 3AU8A 1KZ6A 2KE5A 2BD0A 4TMKA 5L4NA 4G84A 1JEQB 2XE6A 3EUEA 3RVQA 3TDKA 3RTEA 2ZJFA 5DNDA 2WM8A 2CXOA 4IJ6A 4U6NA 3AKCA 5JRJA 1MO5A 4HTAA 3Q2IA 2Q5FA 4DLVA 3LUGA 4UMVA 3U0BA 1FLVA 3UCFA 4DZZA 5PNTA 2EW8A 4WA7A 2JGDB 2ASVA 2RHHA 1ODFA 2ZB4A 3GFOA 3WLHA 3LYUA 4AJNA 1CQWA 4ENTA 1E58A 5CCXA 5JJIA 3BB4A 3I2GA 4O2LA 1CFZA 2FRDA 3GZJA 5IT0A 2FMHA 3KVOA 3B1YA 1YI0A 2EKQA 2PLWA 2GJ9A 1K7YA 4YCJA 2FPGA 3D1LA 4GPZA 5ARBA 3MWKA 4BVFA 3VHQA 3BXEA 4PWZA 1VP9A 2HSZA 2CJFA 4FCTA 3VPSA 1PEAA 2JJ8A 3ADDA 5HDQA 1H5QA 1PW5A 1FJGB 2CWDA 1B00A 1QANA 1KJQA 3RJMA 4M1KA 4Y3UA 3JQ6A 5TX7A 4NZ9A 1W5EA 3EHDA 4D1YA 5JJ5A 2V98A 1NG9A 2L69A 1GUAA 1WXWA 2QXUA 1BG6A 1DOAA 1HA3A 4FFNA 3TOSA 4MKFA 2VRBA 4REQB 2YZ7A 3H6HA 2WYIA 3LI2A 3ROFA 1VHJA 5IVIA 4NEGA 3EFOA 2DOKA 2C5AA 4PCAA 4JLDA 3UB4A 5IANA 1XVAA 1TTPB 3CXRA 3KE8A 5H16A 1E7YA 1DWQA 4RVGA 2QU7A 3AR3A 1Z07A 4FYJA 4LPSA 4JI5B 1L0BA 4LYHA 4D9NA 3SEZA 2H4XA 4EJSB 4PC7A 1EFLA 3ZWBA 1OUMA 1XYGA 4P0QB 2OC9A 4EK9A 1NOKA 1EGQA 1KMHA 4ED9A 2CGEA 1ZOLA 5ALDA 2GHIA 4QXAA 4UMDA 1U2ZA 5AT1A 1VYUA 3PC4A 5SY9A 4XM2A 2FR8C 3VNAA 1SUCA 1G8PA 1NRJB 1OY1A 2FSGA 3KEQA 5ICFA 4Q9LA 4ESHA 5F3WB 1M8FA 2VK2A 4CM5A 2C95A 5B6JA 4ZJZA 3U5ZB 1K7XB 3K9HA 3VDQA 5LM3A 2PRKA 1UBKS 2B1RA 1BYIA 3PXEA 4QNNA 3BTOA 2H6EA 1R5OA 1R4NA 3I83A 3N5CA 5ANRB 5C2JB 1ZH4A 2A0WA 4PBSA 3FNGA 1GPWB 3PGMA 5JNLA 3TLBA 3CB2A 3HVHA 1RPTA 4AT1A 1EZ4A 4DIMA 5L3SB 2EIHA 1Z22A 2J32A 2R7LA 3GF4A 3ZDYB 2RSLA 5FL3A 3JRWA 3AZOA 4IIDA 3VOAA 1W35A 4FWBA 1EP1B 2E4YA 2O9JA 1JXMA 3FYDA 4U9IS 4P83A 4BEJA 5EIOA 3TZKA 4EUKA 4WADA 3INRA 2R751 2DXIA 5H70A 3IPXA 3BIWA 3EQ9A 1D1QA 2B4KA 1TC1A 5JH7B 2WWWA 4ARVA 4KQ6A 3H7IA 1Z9BA 3IP9A 1XPJA 3E9MA 2B0AA 4HT3B 2I99A 3L41A 4NARA 1DFGA 2WSMA 3TRJA 2QX7A 4EB6B 3FVQA 4IX1A 3ZOKA 4UZEA 1YA4A 2R86A 4HEHA 4J0HA 2XYPA 3DD1A 1EXVA 1FQJA 3OZTA 4RVHA 3SJGA 1EA5A 4FI3F 4MKGA 1BSVA 3AM4A 4QDXA 2AFHB 1CB7A 2Q2VA 5DJ5A 3GXBA 1IXSB 3D7MA 3R77A 2QR2A 2IEZA 4KFSA 4LHYA 3RG8A 1MEOA 3UF0A 5B7PA 5DSXA 2M32A 5FJIA 4NOLA 4R2IA 3CPHA 3UCEA 5TGZA 1GDTA 3SEFA 3CEAA 2C2GA 4K0KB 4M7OA 3BXMA 3KLNA 3DHWC 4XD2A 4CN9A 1RC8A 1R4MB 4WKGA 1N3LA 2VF5X 5F12A 5FWYA 2JVJA 4IFEA 1F17A 2VH5R 4HDRB 1D4ZA 3IXMA 1RFGE 3QY9A 2ZJYA 4KGDA 4UU7A 1W29A 1T9ZA 3FIUA 4TLEA 1P2SA 4V3CA 3ST7A 4XX0A 1OWLA 4DM3A 4F5ZA 3WWYA 4A03A 1J2UA 3KV1A 1PTJC 1NDQA 3D6FA 1JYFA 1S1MA 1ATIA 4NV1A 1AQUA 1WHTA 1AA6A 2XMSA 1W4AA 1Z0DA 1ZD4A 1JLLB 2Z2JA 3CR7A 4MWDA 2LUOA 4ZQIA 4ARZB 4X62B 3THYA 3AM1A 4UFPA 3PQ3A 1I1NA 2LNDA 2DUUA 1H42A 1S2OA 5B36A 3P0FA 3OTGA 2PMEA 3ZEIA 4B4KA 4COOA 3GJQA 2PUEA 2IYPA 2VUSA 3S2UA 3VKUA 1TCVA 2VTBA 2R5FA 3NH6A 1E2JA 1ZK1A 2CJYA 4MPRA 4B75A 1KK1A 2BUCA 2DHCA 2VOJA 1QB7A 1KEWA 1QHYA 3FGOA 1PRYA 2QY6A 4Q4CA 3DM9B 1CUEA 2TMDA 2WWTA 3PHCA 2PX2A 4RPKA 1XNHA 4KFTA 4LF7B 5C3UA 2J4CA 5FL7D 4S0ZA 4LMRA 1DJPA 4TMZA 1QHXA 1OXTA 5ETJA 5IULC 5DT9A 1FNMA 3AILA 5M7EA 5EP2A 5FBKA 4DTCA 3U5TA 4DLPA 5KOHB 1Q3KA 4YROA 1AKYA 1FX0A 1CEYA 4P93A 2I54A 1Q77A 5DV9A 3DV0B 4DMFA 2ZYSA 1SU8A 1LPPA 5H3LA 3QLVC 2J67A 3ZDQA 4F8JA 4NOKA 2W6CX 4LI3X 4E2XA 4JUBA 5EPEA 3B8EA 2O50A 4A2PA 1RM4A 2XYHA 4JOQA 2IOFK 3DLBA 2QVXX 3RQIA 2E55A 1HV8A 2AN4A 3VTZA 1E2FA 5BSHA 2P68A 4GRDA 5KDLA 2WFLA 2B7CA 3INGA 1KC3A 2WNSA 3QBVA 5EJMA 3OOWA 3PE6A 2AG1A 2WYOA 3QLUC 3IT0A 3SHOA 3UANA 1G8MA 1M9NA 2ZRBA 1UPBA 2BHLA 2OPBA 3AR2A 3PNOA 1JYSA 1E2NA 4E5PA 1LNZA 1ORTA 3CMMA 4Z9BA 5AIBA 3ITKA 2I6FA 4HBGA 5FUMA 1PGOA 2JBWA 1A4IA 6ADHA 3I23A 2AZMA 5BN4B 3PLNA 2G36A 2LDBA 2Y4NA 2ADOA 2OCYC 1NZFA 1J8YF 1PUIA 2GXQA 1EJ0A 3S81A 3VJKA 3I4FA 4KPUA 4B8ZA 2A58A 3C3AA 4A7PA 1Z7GA 3LS2A 4MYCA 5EE9A 3I73A 5A7FA 3I9V1 3FF3A 4DV1B 1P1BA 3KB8A 3ZY6A 1RPAA 3QJGA 3RBVA 2YJTA 4GXQA 4DEXA 4M98A 5HRUA 2ZITA 2AOTB 3E5MA 4CQJA 2G08A 3HKBB 5KYYA 2V3WA 2ZIXA 4GHWA 4UEOA 3FPGA 3TFQA 2B3TA 3WGUA 2EARA 2NTVA 1FYXA 3DAYA 2GBPA 5BN1A 3MT9A 4M0MA 4RF4A 3SYMA 1MDFA 2O6LA 3B60A 5EUMA 2D00A 5GOTA 2VI5A 4JDUA 5EJFA 4WJLA 5JU6A 3LQQA 3R6WA 3H65A 3PIRA 4XJSA 4E31A 1A4XA 4MP8A 3HJGA 1RBQA 3CZPA 3TJRA 3R0XA 1QIHA 2OBMA 5KCZA 1XF1A 2CC2A 2HH9A 1WLSA 1YDFA 4RLSA 5L4LA 1SBQA 3R7SA 1R8YA 3I34X 3I6BA 2GERA 4IS3A 2VCYA 3EIUA 2NU6B 3P2OA 1XLTA 1REQB 3OEHA 3QWBA 3MTBA 1DC7A 2XZTA 1VG8A 2WB2A 4MYUA 4PGAA 5GM2A 1Z8FA 2AUNA 3OOYA 4CKWA 3O4HA 3CX4A 1JSXA 3RKSA 5JQGB 1RXVA 4ND8A 3ZKAA 1CRZA 2AKEA 3HY4A 3S0JA 4O1IA 4QYTA 4JLWA 4OJYA 4PXYA 5B55A 4QXQA 1SUDA 5KQLA 2GPNA 1L4BA 1CX8A 2UVDA 3JQFC 1AMUA 4YJ3A 2XDAA 4IGKA 4L7VA 1ONNA 5KHOC 1WIWA 1ZI8A 2JHCA 4FXPA 4GG1A 4YAWA 1G9XA 1QXSA 2JVKA 3ORSA 1KSFX 4L16A 3VR5A 2RAPA 1TAHA 3ZWKA 3AR5A 1J5PA 3SJFA 4MGKR 5EMJA 1O5OA 1VSUA 3JARA 4KR0A 2HHAA 4YJ2B 4YDHB 1ADBA 1BC5A 3AJEA 4PAWA 1ZG3A 1PNQA 1QZTA 3R5FA 4PC6A 3MS7A 4M1MA 4UMFA 1Q74A 4HAIA 5FOWA 5UKDA 2O8FB 4PZ9A 1LK7A 1UP7A 1EIZA 4FK8A 2HHLA 3BD8A 4HWOA 3UJBA 4CZ1A 4JT4A 4JA0A 3R7LA 1T6YA 3Q3IA 3QX9A 1L5FA 2B92A 4XDHA 4MUEA 3ESCA 2ZBVA 1I4LD 4IIJB 2ONYA 3KJXA 3TMYA 4IJVA 1NVWQ 4B85A 2E28A 4NONA 2I1QA 2XZLA 4H15A 4NS1A 4RHEA 1GSIA 3A1DA 1COZA 4BNJA 1VZ3A 5JLJA 3BL8A 4QU8A 1QNFA 4FEYA 3I32A 3C8OA 4H3KB 1SO8A 4NHEA 3GBSA 4X3OA 3A28A 3FGZA 2FFHA 1U5AA 1HQYE 2P9EA 3CN7A 2ZR7A 1F48A 1I80A 4UJ3A 3MGKA 2GWHA 2XWSA 4L5IA 5AXAA 4LG1A 1PKXA 4YRNA 1PG5A 4I5IA 3C43A 3H5RA 5CFRA 3ADCA 3D3WA 2VKQA 2EL9A 1LDYA 1GKIA 4C8FA 2WFAA 4B9AA 4QO8A 4WGGA 4N8DA 1VG0B 2AYYA 5C7IO 5LOVF 4N9WA 2PS1A 1UP4A 4HVAA 4OK3A 4TM7A 3E05A 3G6KA 2EAUA 3K0BA 4MCRA 1V3VA 1N5RA 2RKWA 3W5JA 2HDOA 1H2ZA 1U8EA 5DTMA 2FRXA 3EDYA 3MXOA 1EXMA 1TJ5A 3EEYA 4RVDA 4Q0MA 4LS3A 3OLVA 4OC2A 3LPAA 5C51B 2V45A 3HUEA 5CW2A 4CV1A 2Q4OA 5KWIA 4GSYA 5IC5A 1G21E 3MS2A 1BQEA 4FLFA 4IF6A 4NJMA 3WAKA 4AZ0A 4XVUA 1LF0A 1DCFA 3RSZA 2EZBA 1A72A 4LJSA 4N5HX 2FKAA 1UPXA 1W36B 1NIJA 3K9BA 2X5NA 4MS1B 1Y3CE 1HC7A 3EPHA 4G0NA 5A06A 2JLBA 3PP8A 2GK4A 3N2YA 4MXDA 4AIRA 2C7RA 4OH7A 3AUJB 5H4GA 3X1KA 2DVMA 1ZIYA 2FSVC 2V4UA 4EI7A 1PDWA 3HFJA 2IV2X 4CN8A 3OWXA 3U26A 4REMA 1G5QA 3PEEA 5EN4A 2VTEA 1HGXA 3FFAA 3PEVA 4IGAA 4D5EA 1NBEA 4F6RB 1DAGA 4HL6A 4ZYLA 5K05A 1RM5A 1C0LA 3RVOA 3ZLVA 4NQZA 2X9QA 5FI0B 1J39A 3WGGA 2D1YA 3KAJA 4ZRNA 1NKTA 4RETA 1NV8A 2GA8A 2BM1A 1ZGJA 2NUBA 3F4KA 1W87A 3KJFA 1O9BA 3HCWA 3LPLA 4FYVA 4ZCPA 3GG9A 4QOGA 4R8SA 5TB5A 4BO7A 5KTOA 2I4IA 3GLIA 3MWEA 4Z6KA 2VZLA 3ITDA 2A5DA 3E9YA 1RCFA 2QN9A 3IUEA 1CUCA 4MYRA 2HX1A 4RVSA 4K9KA 4M0EA 5E9JA 4EKYA 1DE4C 4Z86A 4MCQA 2XQJA 3MAJA 3K05A 5DN6D 3DMPA 2GCOA 2CF6A 2QRQA 4FE7A 5JMPA 3WGLA 4C07A 2Q6OA 3CUEF 4HDNB 2ZM6B 1EVJA 3C8MA 4YR7A 1OBVA 2GHTA 3D7FA 1E2LA 4KI0A 5GIPE 4M38A 1P7YA 5A5FA 4YAKA 5T6MA 1U0HC 2AOWA 4L5AA 4FOSA 4K6KA 1VECA 1NQ5A 2FUNB 5TPWB 2IZ0A 3SF8B 4X41A 4S1PA 1ZYUA 2C5GA 2HLDD 1L5NA 5ICEA 3IELA 1M5UA 2NZXA 4GXRA 2D8MA 4AI6A 1HNWB 4LNUB 1FBTA 2I8LA 4L07A 2IYWA 1Z4LA 3I1YA 1HE2A 4XWYA 1P6QA 4I36A 1QFMA 1NHGA 3IQZA 4OMFG 4FKZA 4Q4JA 4TV9F 3U60B 1X77A 2BIFA 1T4CB 3RU7A 5FPTA 1JWLA 3FDIA 3LUDA 3QE0A 1SG0A 5DNYB 3H9EO 3DGFC 2J7KA 2OV2A 3EXAA 2VJYA 5CM2Z 5GAJA 1SFRA 3OT5A 5ITSA 3EXHB 1N6KA 5KVCA 1K66A 4QOSA 1P81A 1U7UA 2HCFA 2ORVA 3I05A 3UWMA 2XR1A 1VPWA 5HQ3A 1YACA 2ZXFA 4ML3A 1YKFA 4HDQB 4O02B 3OWOA 4JBLA 4N5IX 3M9XA 3RS5A 2CVPA 4LYGA 3HCBA 4N7RA 3SYLA 4X65B 3A1VA 4DZTA 1PYOA 1TJNA 1TZJA 4MO9A 2HSEA 1JALA 3C70A 2JGAA 5E1DA 2WSLA 2ANBA 3LWZA 2BY4A 3HU3A 2ZIFA 4X1KA 3ZWOA 2CXUA 2LKDA 3OPXA 1J0DA 3ZIUA 1HEYA 3L0OA 1Z4KA 3L82B 4PO9A 1FZQA 2VTBB 3NB0A 1KRXA 3BZWA 5A5EA 3R41A 3WYCA 2VDWB 5BNWA 5FNVF 2FM4A 1S8AA 3NRJA 2ZI7A 2PL5A 1JNXX 4FHDA 1NU8A 5TIIA 4RTOA 1WB5A 2YN2A 3R6LA 4DIDA 1IC6A 4AWXA 2GCEA 3L02A 4H31A 5A7HA 3EGDA 4A1OA 1RCUA 4N7MA 3FZNA 2HMUA 3PNBA 4BNYA 1EUDB 4Z4HA 5JSZA 2Z2IA 3Q72A 4BEVA 4TLMB 3I8OA 5FNVA 4JBYA 3I62A 1PFQA 3E9DA 4MWTA 3F78A 1OFTA 1LBEA 1N6NA 1FDSA 3ZGXA 5AKJA 3G2OA 4RD3A 3V8PA 1LLQA 1Y80A 4PG4A 1QZ3A 3U39A 3N8NA 3R7WA 4HWGA 3S2FA 4RQUA 2Z8XA 2W6QA 4UUNA 3CHYA 3UWSA 3GUYA 3TJZA 4LYYA 1UKAA 1Y98A 1I94B 5AI6A 2OXEA 3R76A 2G5GX 3HCEA 3LBHA 2ID8A 4Q66C 1XWIA 3DMFA 2E5WA 5CLLA 1W8DA 5EIHA 5NULA 4E11A 4G3XA 5I4BA 3W05A 1CIPA 1TZKA 3L7NA 1V5WA 4JROA 2BFCA 3ZU6A 2IXFA 2CFTA 3K3PA 2ZBRA 3KB2A 1FQWA 4OBEA 1PDVA 2H1IA 4LOLA 4B45A 2DQ4A 4ZJUA 5IFKA 4NMHA 2BZ1A 1RMQA 1Z0ZA 2X3FA 3HLYA 4LNHA 3B1KA 3TLKA 5JHHB 1SHJA 3BL5A 1TQ4A 4Y6LA 4LJ5A 2W2TA 4JJKA 1I9CA 3W6ZA 3LCMA 3ZIDA 1XCGB 4IDOA 3ZE2B 3ZWYA 3IOYA 2IXGA 4IY1A 5G0TA 2VHTA 4GICA 2ZUDA 4WCDA 4I3HA 3VKGA 2IIVA 4F45A 3ZD7A 4LY9A 2PYIA 5G3YA 4B6RA 4QG7A 5E3JA 4F92B 1CVIA 2BAGA 2G04A 4O8ZA 2VYND 4KH0A 2GAIA 4U0KA 3B5IA 2BJWA 1WVGA 4Y7CA 5BQOA 4D46A 2EFYA 2IPOA 3FWYA 2WF9A 3KJEA 4Z0PA 2AF3C 3L7DA 4WIAA 4ZZ2A 4OC4A 1EZZA 3MBKA 1ZONA 2VTKA 5C52B 4TV9A 2DTXA 2Z2KA 5IVPA 1EDOA 3VDXA 1P44A 2G80A 2FSFA 4H0NA 2RK3A 3KNZA 3MBIA 1YZHA 4C4RA 1TJ3A 4FZ5A 4BV3A 4C29A 3WLQA 3H13A 2BMFA 1Y7HA 5F1PA 3UAYA 1BE6A 2Z3WA 4LE0A 4DMUB 1LNQA 1RYHA 2BSXA 4I4LA 5JVDF 2IYUA 2QE7D 5CJ2A 2LCIA 3OSUA 4RCVA 5FQNA 4PX2A 4TLAA 2BCJQ 2X7JA 3DEIA 2VJCA 4OQQA 5EOVA 4F8EA 5JUWA 3DOOA 5SYAA 1QE5A 3W5VA 4TTVA 1M1UA 4ASUD 3EBOA 1H1LB 1OXVA 2PGXA 4LJKA 4GWKA 5SZKB 1RD4A 3DVAA 4IG4A 4BVJA 4CTJA 3T1HB 2P6RA 5TVGA 2GJ8A 4KRGA 1HUQA 2PXXA 3K0KA 1C1XB 1WZEA 4YCBA 5AK0A 2BVNA 2V7QA 2EKPA 2V0NA 1ZC4A 2J0SA 1CUAA 1IDOA 3QH4A 3QSGA 3RVBA 3L8CA 4EPTA 3WOVA 3CJRA 2PR2A 4ROTA 2REQA 4TTIA 3IEMA 3ELUA 1T0PA 5MFZA 3QUBA 1NN0A 2ZS8A 4NU8X 4RKFA 2WZQA 4TVSA 3PHIA 1H4QA 3HDTA 2H2WA 3JD1A 1REQA 1MAHA 4IMJB 5BV1A 3DPUA 3R6DA 3QQ5A 3K6KA 3TZLA 3SM3A 1QH1B 1W0KD 3WGJA 2Q4DA 4FDVA 1M5RA 1CY8A 3CCFA 2BFAA 4LHWA 3ZHQA 1KH1A 1EM8A 1X86B 3HJHA 4B80A 4QXRA 2VJNA 1M1YB 2XE4A 1HKHA 1YI8A 3H2JA 5FOVA 5BN5B 4CF3A 2QNRA 2FXVA 2Q29A 3GMTA 3QPBA 3CF6R 3UPDA 2M6RA 1CCWA 2OK7A 3PZRA 2V3CC 2QD2A 3A6LA 1WUYA 2RGGA 1R9NA 4PG8A 2FGKA 3K2QA 4IOKA 4NCKA 1RWBA 5FYDA 4AJPA 2C9MA 1JN0A 1TMKA 1FNCA 1PG2A 1QFXA 4H6WA 1Q50A 4KWEA 4PZDA 3ZY5A 4DN6A 1GUZA 1WVMA 1Z13A 2QTZA 1JHRA 4G0VA 4RA6B 1J00A 2EW2A 3I61A 1IB6A 2N46A 2QS9A 1L8XA 1TECE 2ZI4A 4H1TA 1C7QA 3DEJA 5EYPA 1CBUA 4YJ2A 1CC1S 3CF4G 1OFVA 1VKJA 1PX0A 1E9CA 3JPWA 3O92A 4QDZA 3ZKWB 2IHJA 3W5CA 2OCDA 1TTHA 2CDAA 1LZLA 2XCRB 2FK8A 2TMYA 4AY6A 2ROQA 3VR0A 1NWCA 5HFAA 1U9IC 3NW9A 1GDHA 2WYWA 5HWSA 2UU9B 4TSFA 3ZE6A 2VH1A 1FB5A 4KAXA 4KQ1A 5ARDA 4M46A 2VT6A 3ILXA 3WYAA 2BEWA 1U28A 4IIJA 5IC4A 2WB4A 3FSRA 3N8GA 1IEXA 2HTFA 2FPPB 3GH1A 2NX2A 3GLGA 3D2AA 3RC8A 4NATA 3LDHA 3IV6A 3NFYA 2HRQA 1M6NA 4CBVA 2PX5A 2IEBA 3EAQA 3PRJA 2KJQA 4LA4A 2C83A 1IEVA 2I3GA 5E4YA 4BCCA 2J08A 2EW1A 4Q00A 3AR8A 3G0IA 1RAGA 2FZGA 1M1NA 3AFNA 3I9KA 1EVQA 4DL9A 4DA9A 2E5LB 2ZYUX 4XTCS 3IRVA 1RRVA 4OHWA 1ISPA 2EFJA 4C4AA 2DCMA 3T06B 4PLTA 4A6DA 5EFOA 3ROZA 3ORQA 5E9AA 2BE9A 4KWHA 1AMNA 1SBTA 1U02A 1XN4A 2W71A 4CR6A 3HKEB 2VPQA 4ZAFA 2XCTB 4OUKX 1MOSA 1WQ4A 5ALHA 1GN8A 1GP2A 1OZFA 1XAJA 4KR6A 4TL6A 1DADA 3T7TA 2WV9A 1KDPA 3FYCA 2JAWA 3HJFA 4MV5A 2GLXA 2GS9A 4U7PB 5JHGB 2V8OA 1BU8A 4GIBA 4RS4A 1QLJA 3OZAA 4IFBA 4JUCA 4TTQA 3FNFA 4FEGA 3V4SA 4HZUB 2YFKA 1R9MA 4F5WA 4F71A 1ZICA 3CCBA 1PJRA 4HDSA 3KHUA 3SDSA 3M33A 1BH6A 2ZSFA 1NLFA 3HA2A 4EFLA 4BC0A 3B6MA 4FI3C 1YZKA 2XTAA 3SYKA 4ZREA 3ZQKA 4JT8A 4XIFA 3WJAA 4OC0A 1T5SA 2EYQA 1L7OA 5DXAA 2IBMA 4I9HA 1XL0A 4MQMA 2C5EA 4YBRA 4CL3A 1HDGO 2C9OA 2R00C 1E7WA 3F5SA 5LBUA 1SU4A 2QI9F 2QXTA 4FCCA 5DYYA 1MJNA 1UMCA 3UBMA 2AQ8A 3CINA 1ZXBA 2RG1A 2I2CA 4UVHA 5JLAA 1TF2A 3JD0A 3N2NA 3C8HA 2OCLA 1KIAA 3EG9A 1KU6A 3FCXA 4UNQA 3W5DA 3NDJA 3C24A 5I9LA 2CJWB 1LVUA 5IKXA 3ISJA 2RJNA 4DLWA 4B6PA 2QX6A 3USCS 5F2NA 3G2LA 4M21A 3HBNA 3I9JA 3UWDA 2ZCUA 4FSXA 3O73A 4IDEA 4W5WA 2PE5A 1OW3B 2I2BA 3I6QA 4A16A 3QMMA 3UHPA 4PZ0A 2H2HA 1W48A 1KPHA 1K3TA 1EX6A 3HU1A 4HAOA 4X7RA 4YCAA 4RA9A 5AXCA 4NU0A 4CTNA 2FMTA 4IIBA 2PSFA 4NDNE 1O0CA 2C6CA 1R0SA 3OQPA 3H18A 1AIPA 2RC5A 2ZI3A 3DTTA 1JEJA 3DHVA 4EYKA 4FGJA 4RZUA 1M54A 5CPBA 1P1JA 4NAVA 3H2HA 2P4QA 1YR1A 2XW6A 2O2YA 2WJ6A 2JD1A 3FMGA 3HU5A 4QBHA 3OKCA 1ES9A 2YL2A 3AL3A 3MOSA 1H2EA 4B33A 4DADA 3P71T 1YRYE 1M72A 3BXHA 3LHKA 1HOXA 3WK4A 2OLEA 2QAJA 2G1KA 3AERA 3HZRA 4KV9A 4MO2A 5IC6A 2PZKA 4QXMA 1UL1X 1QG6A 3NHMA 1CNEA 2NTJA 1XWWA 5JNVA 1IXYA 4DWVA 3RUIA 4K3VA 1I36A 2D5AA 1N5JA 2GVNA 3LF2A 2E7ZA 4HWTA 2YQ5A 4E1VA 4F06A 2H52A 1W0JD 1FUIA 1B1AA 1JR3A 1PL7A 4MVJI 3FUCA 3RJ5A 1LC3A 4R1TA 2ESRA 1Q15A 4PQEA 3BM5A 3FTCA 3LC2O 3AVOA 1PV1A 1NYTA 4XQGA 1XWFA 3N2GB 3DVLA 3UMGA 3FVWA 1MIOB 2QRGA 1LQTA 3ELDA 4TKUB 1MB0A 3BQNB 5DHPA 1EP3B 2XI4A 4IHQA 1NNI1 1SKAA 4ZK2A 1T0BA 4HZIA 3NONA 4FKMA 4UE2A 1OGJA 3H9BA 3MPUA 2QSYA 1SGWA 4JVLA 4GL2A 2IYFA 4MKHA 4PXAA 3UG7A 2SHKA 1CYDA 4KXQA 2NSJA 2Y92A 2MU1A 4RYLA 4U7HA 1V4NA 2DM6A 4Z5XA 1SH7A 2NP7A 5EP3A 2IH4A 2OQRA 1Q92A 3LLCA 1E1DA 2F1HA 1EWTA 1KR5A 4AKIA 4KXUA 4DA6A 5HIIA 2PFGA 1IWPB 5LMUB 3VU1A 1RRFA 2WICA 3ZVNA 5HZKA 3GLUA 4AX4A 2HGZA 3LYLA 1C4XA 3NZEA 2JGNA 3ABSB 2C57A 1NW7A 3RAJA 1Y89A 2B1JA 2JJQA 3Q9LA 4IEEA 4M88A 4CL0A 4BQRA 1WV0A 2QTLA 1OGIA 1OXBB 1RP1A 1TJPB 4FBGA 4MPDA 4Q7MB 5A4DA 3I6MA 3M4JA 3ZEAA 4ITRC 4OHRA 4XQ0A 1XQVA 5IMSA 2O8DB 1FFDA 4Z8YA 1DNPA 1N9ZA 3ONFA 2HOQA 3S2GA 2F59A 2EKDA 3WGTA 4BLTA 5LJLA 3UTCA 4MLZA 5K8IA 1QH0A 1J8FA 3JQ9A 3R7FA 3RSCA 2UUOA 4MB6A 4H60A 2Q50A 4JLNA 5JSZB 2Q9BA 2W37A 1QYIA 5KHLB 4ZODA 1ZN2A 2OESA 3AFHA 3UYLA 4WOPA 1F8UA 1W0KA 4JK3A 3BGIA 2X1LA 2JBKA 5FI5A 2IELA 4JWTA 2P3LA 4RKYA 4PTLA 4RFLA 1OE0A 1ZDMA 2DE0X 3A1TA 5DH9A 3LOQA 4CLOB 4DY4A 2Z6QA 3L1UA 4YGXB 4TS1A 1JSZA 1MFZA 2D59A 3NXKA 3NHRA 3EVEA 1X13A 3L18A 4MW9A 1MQ9A 3ENQA 1E4EA 5B53A 2ACVA 2TMKA 3CBGA 3JCZA 3KJQA 4YMSA 4MDHA 1IY9A 2IZ5A 4IHKA 3QEKA 3EQ2A 3OZEA 2BHSA 3V1MA 2DFVA 3L7YA 1FTQA 1T3HA 3VO9A 3EJWA 4AXBA 3HADA 4EKDA 4BP9A 5FR1A 4JASB 2YC2C 2P9GA 3GAFA 5LOVB 1JFFB 2Q46A 2XUGA 1N0IA 2CJPA 2QM7A 1AGPA 4RHUA 3B3AA 5DBHX 1JLKA 3ELBA 3ZGOA 4E88A 1ZGGA 5CG2A 4X7PA 2ZT6A 2Y3IA 4Q6WA 1YF3A 1N34B 3ZHOA 4EW6A 1I0LA 1E7QA 1E2GA 3MMPA 1P1HA 5LWQA 3WIVA 4NP6A 1HDCA 1QGYA 3EQZA 1O96A 3AWIA 3IVMA 1N32B 3ETNA 2QW1A 2Q6VA 2WM9B 4F6RA 2WIJA 5CVEA 1GUFA 4BO5A 2EOAA 2XNCA 4E21A 4RSMA 1YR8A 4O4IF 4GKAA 2G0AA 2FAXA 2ZUTA 1SD2A 4QELA 3C7AA 2BMWA 4HRVA 1TMGE 4X8OA 1A7KA 2P75A 3G0DA 3R3WA 1K9VF 5HF6A 5E9WA 3WGKA 2BR4A 3DE0X 5GGYA 5GVRA 3COZA 1K7SN 3HJRA 4ZYVA 5LQNA 4EABA 4PR3A 3PJRA 1KJ9A 2QE7A 1JDUA 3DAPA 3UWOA 1MH9A 3BMQA 4XX0B 1BKDR 3M6MD 1V1RA 1QU2A 4CV0A 4U7DA 1E3TA 1FY2A 3M0EA 2KYRA 2QP9X 4Z4IA 1CUFA 3JQ7A 4W8HA 5J4HA 1CF2O 1WHTB 4KXMA 5JDCA 1UAYA 3NJ4A 3V6LA 4FUQA 1VRVA 4JJIA 3RROA 4MB2A 1SCUB 3RYIB 3AQIA 2ABWA 1UC4B 1P2TA 1Z18A 2VUTA 2TRSB 3AB3A 3CT4A 4FJ0A 1KXZA 1RSZA 4KSYA 4DEYA 1F2TA 1USIA 4F2HA 5JVLA 3FZGA 3DDHA 3U17A 1XMIA 4EHNA 3LC0A 5JI3E 4CLDA 5FDFA 1I5OA 5KMGB 3PVSA 1ML3A 2QUBA 5F2OA 2WYVA 2D54A 4PZUA 2FWJA 2ZRMA 3NUGA 4M1EA 1K98A 1PR1A 2WQZA 2G4VA 5L45A 4XGKA 1VLJA 2PVCA 2YH2A 4GI5A 4YAFA 5CLFA 1BMFD 1MA3A 2QHXA 2FG5A 2IHBA 3K0FB 3KWMA 4FBLA 2R84A 2Z09A 3GRPA 4G5HA 4JEUA 4UVGA 2QUZA 4W6ZA 5CYOA 1M1YA 1QKJA 2GT1A 3R2JA 4HUTA 1FX0B 3SC4A 1CF9A 1L1EA 4EEZA 3WO1A 3ZI0A 3JAWB 1QQ7A 3G2KA 4R68A 4BFTA 4C76A 4GR9A 2D8AA 1FXSA 4AZSA 1H69A 1NXWA 4IJWA 3VSAA 2VCEA 3E9ZA 2QVGA 3PNQA 5FT9A 1MT3A 2Y2UA 2Z5LA 3NOJA 1E1RD 1C30B 1U1EA 2ZWAA 2PL1A 4NWIA 1SCQA 4PZZA 1Z68A 4G81A 1ELOA 3LZCA 2PLNA 3TFOA 2P2NA 1GPDG 3EIFA 3T3DA 4S1VA 1SOUA 3C3EA 3PI6A 3TMAA 4LF5B 4M1ZA 4DR6B 4CEIB 1L4UA 1S8OA 3PQ6A 1FCJA 3H2KA 4DHEA 4RQBA 3WQSB 1UBGA 3G8AA 2X0DA 1L5QA 1Q0ZA 3IQGX 1COWD 3LBNA 4UPVA 4G0WA 3PTZA 4ZT2A 3RLFA 1ZCAA 1P4HA 4CHGA 3A4LA 1L5KA 1GGMA 3OPYI 3VVMA 1SK8A 3KFXA 2EIXA 3I45A 1CUUA 4MVJF 4BQSA 1ACMA 4I1UA 1Q83A 1U3TA 3D5QA 1Y8RB 1SK9A 2MSDB 2WJGA 2IUFA 3Q2OA 3A6HA 4KX3A 1A9XB 5JYBA 4C22A 3AVWA 2UYHA 1AXGA 1Z0IA 4KSBA 5HILA 3KPYA 2I4TA 1XP8A 2M6SA 1KO4A 2W6ID 3WNZA 1PV2A 1BMQA 3A3OA 3LT5A 3TBKA 4CQMB 1AO0A 2FSIA 2VQDA 1U04A 4S04A 4XJVA 4C88A 1EZBA 2QMUA 5TC4A 2G70A 3LIPA 1NX6A 1TCUA 5LUBA 1GJRA 3GJ6A 2QTAA 3EXFA 1BOOA 3WKBA 1SNYA 3P0HA 2XUIA 1Z34A 2DY0A 3JQ9C 3JQAA 4HLQB 1P77A 4KMOA 4MA0A 2F4NA 3AY7A 4OL9A 3PKJA 1CR2A 4J91A 4QREA 4RACA 4HADA 1N6OA 1Z82A 4NENB 5JD4A 1XMOB 1XZPA 4HAUA 1RWMA 3QRWA 1H2FA 5A0VA 3LO5A 4AFNA 4DVJA 3P5BA 5EWJB 1XKXA 1F6WA 1L7AA 3KR1A 4A0RA 1QO9A 4HEA6 2B1GA 1WU8A 2PKYX 3E3AA 4G65A 4K9RA 3WWZA 3HDHA 4C43A 5JTUA 2JEYA 3IMCA 1EBBA 2JKVA 4N0MA 1O89A 5L3ZA 3L9WA 3EZ7A 5GONA 1TVCA 3WI7A 4GC9A 3CPJB 3E61A 3IQEA 3PT9A 4YRTA 5AKGA 5ER9A 4WA8A 1LRKA 2IYXA 3MF4A 1KKLA 4OLAA 5F4BA 2RI1A 4FS8A 4EY4A 2O54A 2MIIA 4GVLA 3BL6A 4E32A 3DNFA 4MKZA 3E4CA 4AS3A 4ZO8A 3U1VA 4OJMX 1WMFA 2WKRA 3VR3D 4HG2A 5H83A 3EVCA 5CJPA 1I2AA 1BS1A 1NQUA 2FUG6 2IDKA 2BV3A 2C42A 3HA5A 4RPGA 4Y2SA 4FQ5A 1GG2A 4KTTE 3KRVA 2HLNA 2JLWA 1YHNA 1DMSA 2JKYA 2V7BA 4BX8A 1K3UB 3AY0A 3GRRA 4V0NA 4DCSA 2F64A 1FSFA 2I78A 2C2MA 4DDHA 1ZFNA 3A6FA 2C2BA 4YWJA 4RESA 5AOAA 2W2OA 1P61B 2R4UA 3C6MA 3P26A 1DAKA 2Y1OA 2A5LA 1SVWA 1UT8A 2IPXA 4N4AA 1IN7A 1CPYA 4IYRA 4D9BA 4JBHA 4DLSA 4NZMA 3PGVA 3H8SA 4A36A 1AQ6A 4GBJA 3NBXX 1YQ9A 3IR5A 3EVDA 3VR5D 2C2HA 2VP5A 2FWPA 3E6AA 5AOBA 5EUCA 1QTNA 3OOEA 2KS6A 1L9KA 5G02A 4C5AA 3CZAA 4B3IA 3ITEA 2PRZA 1GADO 5CURA 2JJ1D 4CM1A 3P9IA 5DBGA 1E3MA 1IBSA 1S7CA 1D07A 1XDDA 4A8PA 4F4IA 1ONOA 3PBKA 2ONJA 1E69A 2P6MA 3ILYA 2QOEA 5CW1A 1XNGA 4WBSA 2IYRA 3H87A 4AXXA 3M3HA 4GM1A 1KE1A 3TAHA 2WKWA 1GAEO 4YT2A 1FFHA 4MYSA 1G3QA 3QXCA 4UVEA 1JVBA 3Q3JB 3U9TA 3WJ2A 4PAQA 1VHLA 2VT7A 1SVIA 4HCJA 5TVKA 4JI7B 1TYAE 2HU2A 2ZYWX 4IVNA 4B74A 5K6AC 5L53A 3W1WA 2AYZA 3V4LA 2FDRA 1C2TA 2ERXA 4JI1B 5A9SB 3I72A 1XTPA 1IN4A 3IYLW 3AG6A 4ISCA 4R9RA 3GLKA 2PKRA 1JQJC 4L4UA 3LP5A 2YFQA 7ABPA 4EA7A 1FS5A 4I5EA 1GY8A 4R1SA 3TSYA 2PVSA 1ECCA 1MQAA 2IW1A 1QVAA 3AKDA 1QOZA 4ZQGA 1QZUA 4N5NA 5IWAB 1C8LA 1PZGA 1CWUA 2RIRA 3NUZA 3LBIA 1T8YA 2WAYA 3GH3A 5AI9A 3FUTA 3JYOA 4TROA 4O4HA 1DDIA 2K5UA 5K7SA 5CHEA 3T7SA 5LFAA 2MSNA 4NE7A 3WBBA 1VBGA 1UMBA 3U6BA 2XT0A 1GGNA 4YLGA 2CLFB 2IOQA 2Q9UA 5GADl 1KI3A 5DCWA 4XYEA 2RGRA 2UKDA 2VN8A 3T3PB 1A96A 1PR3A 4ALKA 1GQRA 1TT5A 2G4LA 2WMDA 4XPIB 3RI3A 4YO8A 1Y1QA 1P4JA 2OO3A 3H5WA 3SMVA 2FYTA 1LA2A 1V0JA 4BX3A 4ER6A 1JTEA 2V6GA 3G0HA 4KHPB 3RASA 4GU5A 2YS6A 4A92A 3BS4A 2O48X 4C6RA 4RPIA 4XR4A 5AW1A 3OUTA 1JEQA 1NJGA 2DX7A 3G6WA 3QPDA 4MS3A 4XCVA 4P7BA 5AI0A 5FPYA 1KDYA 1PD1A 3TRFA 5F76A 1ZUIA 2REOA 3L3BA 1US8B 2PU5A 1YB1A 2LCQA 1GPYA 2GCGA 3B9BA 3V32A 5EJ4A 2YYYA 1ZVJA 2BN4A 3BA6A 1F20A 4RSGA 1NPTO 5H3CA 4D4HA 1MB4A 2CDNA 3CLVA 1NX9A 1I30A 2XPCA 2ADMA 4LAFA 1OYVA 1ACLA 1GLGA 1ZK2A 1ODJA 2GFIA 3WICA 3I52A 1R1DA 3UXEA 4RCYA 1GYQA 5KYWB 5ADUS 4M0CA 3AF4A 3LHSA 1INLA 4G5XA 3BOSA 1DKLA 4NGTA 3VM6A 4AN4A 4LZJA 4J76A 4OAOA 3RTBA 4BKMA 4B2PA 3BHIA 4HD8A 4D4KA 3A4YA 1S89A 1H2XA 1M34B 2PZJA 3H99A 3G59A 4YT5A 4ZMSA 4RUKA 5AJZA 1UJ6A 3ZWVA 4XWOA 6GPBA 1HXHA 3P45A 5LC1A 2UUPA 2J9FA 1K68A 3Q7PA 4L6CA 4PN3A 4JHLA 4LGYA 2NU7B 5GVSA 2IYSA 5JPDA 4QTTB 5TS3A 4RGYA 2O06A 4I46A 4I1SA 1BEEA 3PRYA 4OXIA 1NXJA 3IVGA 5HCNA 4UUOA 4BNUA 2PUHA 4KVZA 1J8VA 2GCOB 2BGRA 2OOTA 3AEYA 3W90A 2QZSA 4L0QA 1UOPA 2OTCA 3DH0A 4PLYA 4FMDB 4WASA 5IVDA 2C9BA 3R9IA 5KU7A 4QULA 2ZK7A 4UD6A 5C35A 5K0JA 3IMKA 1EQUA 1PG0A 1NUSA 2O3SA 4QDOA 5EZ5A 1H9AA 2FP3A 2WKQA 2V7UA 2LRHA 2Y1WA 4FZRA 4GOXA 2I29A 5LOVA 3RAEC 5JJKA 3D4PA 2IF2A 3FXAA 1I3KA 3CISA 2HV9A 3Q5GA 2P4HX 4TXHA 1HKUA 3ROKA 4DSOA 1SRQA 4G67A 4PYIA 5G4KB 2WU3A 1E6LA 1MOQA 1O96B 5HEKA 1N2ZA 2KHZA 3O9MA 3S55A 4BFXA 5BSVA 1OYYA 1LS1A 1J24A 3DONA 1E18A 2AEEA 2XDQB 1SEVA 3EH2A 5DU2A 4O4HF 5CVUA 1N2GA 4C8TA 4DCGA 1JZTA 5HOEA 5AVTA 1SXJD 1QO7A 2WZCA 1JS1X 1HTTA 2EC5A 4H59A 4NGMA 2QTVB 2C1XA 1NQOA 2GEKA 2NO5A 3FMVA 4CDNA 4S3MA 2PQ0A 1JR2A 4POOA 2XKKA 1K27A 2HWKA 1I2BA 4IHJF 6YASA 2O2SA 1IN6A 1T8RA 1LPOA 1DBRA 4GQAA 4MV3A 4TYWA 3QVLA 3D6JA 1E61A 3H0KA 3MB5A 1E1CA 5AHOA 1QRRA 1LW6E 3DGEC 5KYGA 3L43A 3DQQA 3GQBB 4C9AA 3RJ9A 1TKCA 4Y98A 1CDZA 4O25A 1B76A 4I08A 2IEGA 3I58A 1J20A 3AEKB 2WM2A 5FR2A 4YCLA 3BB1A 3ZLUA 4EB6A 5DN9A 5IBRA 3EQ7A 3L6OO 5CVJA 2P2ZA 3MTEA 1DBSA 2IHUA 4ZOLB 4L2IB 3A3YA 2C94A 1W19A 3C7TA 3ISTA 3OCYA 3ESQA 1L3IA 2PH3A 4OUDB 5E1OA 4C6SA 1G6OA 3NS7A 2PSHA 1R0XA 2CD9A 2ZTMA 5CH8A 3OZGA 4LVCA 2AR0A 3E7XA 3GLSA 1AGXA 3CU5A 5IXJA 3IAFA 2ODTX 2DYKA 4FPXA 4C7OB 1NBWB 2DLCX 1RW4A 2C98A 2Q5QA 3OAAA 1AHPA 1VQ1A 3Q8WA 5ECWA 1U1GA 4PFJA 1OHHD 1W1WA 5B3KA 4KE9A 5FWYB 3HABA 1W46A 1SZDA 2PA3A 3ZVLA 3B9RA 5FNVB 5D5HA 3W4IA 4OA8A 3REQA 4CJXA 4ZN6A 4JC4A 3NC4A 4I9UA 4GD3Q 5BUCA 4P44A 1HTWA 4C9VA 1WSAA 3A25A 1T2CA 4H3SA 3JATA 2E4WA 2ZBPA 2D3TA 4ZCMA 5CVTA 3OMLA 3IUSA 3V1UA 2KW5A 5DTRA 1SMKA 1VI5A 2QN3A 3GT3A 3I2HA 4FMCF 4BN4A 1T5BA 4D3SA 2OM6A 4M1SA 1FK8A 4ZKDA 3LA8A 4LJAA 3TXAA 2A9QA 4EYGA 3V8MA 4XLZA 3U80A 2BFFB 3SX4A 2HQSA 4E6PA 2WU4A 1XEAA 5FX2A 5KCMA 4X66B 1T2UA 3BXGA 4HN9A 4I50A 4OKIA 5CX1B 1ABFA 2BPOA 4MGHA 1M6EX 1WB4A 2B94A 2DSNA 2GDJA 3KUCA 2QVZX 4UJ5A 4ZCIA 2QI9C 1UBUS 4C20A 1BA2A 5E7MA 1GKKA 2V6JA 2ZSDA 2PBLA 2FW8A 1PDOA 4R9SA 1LB1B 1XMXA 1Z5OA 4KE8A 3PGXA 5LIRA 5LQKA 4GLOA 3KKKA 2PAAA 4CEJB 1AZSC 2ECQA 1E9RA 1HK7A 2AN1A 2H5LA 2Z08A 5EXTA 5FUWA 2FN4A 3KQMA 3LBAA 4K0RA 2D06A 2GHRA 2QUHA 3EE6A 4LXXA 1NMYA 4QFBA 4BLQA 4HRYA 5JATA 2DCUA 4JJGA 4E5UA 3RRNA 1EK5A 4IJUA 4DDVA 2JFWA 3PUWA 3ZNOA 2OB2A 1KJ8A 1QHGA 4O0LA 5D3KA 2I6XA 4NGQA 3IBYA 4F1WA 1FF9A 1JKFA 8ABPA 1LXCA 2JC3A 1IZ7A 4BVGA 3CIFA 3FZQA 5B1YA 2B8NA 2AB0A 5HZHA 4UQLA 4DM4A 5ED4A 2ZUEA 1P7WA 4I19A 2CNNA 4NENA 4ESVA 3QVXA 2GTHA 4ZYXA 2WG1A 4HNQA 5JO0A 2IZZA 2ZSIA 1UXHA 2GVDC 4L1KA 5JDIC 4TMYA 3KIPA 4PYRA 3IEIA 1FS6A 1IE3A 2AI2A 4MCJA 4RY8A 2YWCA 4AURA 3SGLA 1AK1A 6AT1A 2HK9A 4RANA 3EODA 1B6SA 2JBHA 1C1YA 4M6WA 2JAHA 1PJZA 3EEIA 3LDUA 1GAQA 4KN8A 721PA 3KU4A 4O4LF 4F86A 1C14A 1KO5A 2BLNA 1WXFA 1LDEA 4KBGA 3M81A 4LMBA 1GLVA 3IR7A 2PVPA 1X1DA 3P2JA 2ZBDA 3T1OA 4ENUA 1Z4IA 4URZR 2HR1A 3UJ8A 2OV8A 4TXMA 5FTJA 3RS4A 3S8YA 1SVNA 1NNLA 1E79D 4QUAA 1RABA 4AG3A 3TSZA 1GKLA 2H06A 1M7GA 2A4MA 5JV5A 2D0PA 3SI7A 2WPNA 1KMMA 3IPYA 4HGNA 1HL7A 3V7FA 4OXXA 4OQYA 3GBVA 1ECBA 2H4HA 4IX9A 1RI5A 4RIIA 1U63A 3RUCA 5EWMA 1PS8A 1M66A 4JXXA 3VQTA 1CT9A 4GPIB 4P3PA 3WISA 3BE5A 2E1RA 5DI9A 4PHGA 4ZHQA 1ISJA 2JGKA 1USKA 2HNKA 2QPTA 2GN0A 1VPDA 3E3NA 3NHUA 4RSHA 3VSBA 4BJ5A 4Y0NA 4MYDA 4DIUA 3ASVA 4YA6A 1W34A 3H5IA 3IPCA 3ICCA 4GECA 4JJ6A 4B5KA 3CLTC 1QOPB 5DASA 5BSWA 1MLDA 1EWKA 3NUQA 3H1PA 4I1OA 3QVGA 1I7NA 3BIOA 3NIGB 2IBSA 4AYWA 3EXIB 3U7QB 1EVEA 2G63A 3KL4A 3VH1A 3P2MA 1EDDA 1GA6A 3WC4A 5BV2P 1AV6A 5K3CA 1NUAA 5EIBC 5AXDA 4A0GA 3EQ8A 5BWOA 2E89A 3F98A 3HJUA 1IHUA 2JI8A 3JD4A 1PJAA 4LMPA 3DXFA 4CUKA 1Y9JA 3V8EA 2Z30A 1TVKB 2J6HA 2PKQO 5T64A 5CNMA 4KNGE 2D7CA 4C8UA 3VR4A 3TXXA 2ZYDA 1S8NA 5BV0A 1QGZA 4IGIA 3ETCA 2BM8A 4YAGA 1Q5PA 2ZJ6A 5A0FA 3V2GA 3DQPA 3T95A 1UC9A 3E58A 5LPNA 4R51A 4IHAA 2G8LA 2RMKA 4R6WA 5DBEX 3HWX1 4DG9A 5JAZA 3L8DA 3E9EA 3EXHC 5HKKA 5HUQA 3HM9A 2XYRA 3CW8X 4ZU1X 4Q34A 1X19A 5AVQA 4TSKA 2HO4A 3OPNA 3L7JA 1WX1A 1W2HA 3VPGA 3D8TA 4AUMA 1YOBA 4NEHB 2VS1A 3UTDA 1Z73A 2OEPA 2J5RA 2VP6A 2JZCA 3VR2D 3BWVA 3WP0A 4HLNA 1MXFA 5A3RA 3KCQA 1SKMA 4MAAA 2Y1CA 1EVZA 1TK2A 2H8KA 1OFUA 3JQGB 1EGAA 1AY0A 2YWEA 4OSPA 3DL7A 1N2JA 1RYDA 1Z4JA 4WK2B 3L8FA 2PU7A 4NGRA 5EIAA 4CM6A 2IFTA 3FFXA 4WCFC 3ED1A 5BYKA 1RWQA 1FQKA 1VSVA 4LC1A 5HG0A 3ZOZA 1TZCA 2ZSKA 2X9GA 4KVAA 2F62A 5GV8A 4YHBA 3IC5A 4FJ1A 1M33A 3G79A 4UUAA 5EP1A 4ZCSA 3SEAA 4BO2A 3ZNPA 1ESCA 1Y3HA 1V95A 5FBLB 5JXIA 3O5AA 2ZR8A 2H08A 4H7IA 3H1AA 3LUJA 2YHUA 4BFZA 5CA1F 5PGMA 1N2SA 3VU9A 1J8QA 2XE7A 2XOKA 3CIOA 3E1SA 4LX8A 4S24A 4EO4A 1SIBE 1BDJA 2NW6A 3BD7A 1B1CA 1TO6A 1SOWA 1EK6A 1BE0A 3QHAA 4W7SA 4NMXB 1XFAA 1EX9A 1UWLA 3AI7A 3DOCA 2I3DA 4B7AA 3D4LA 2DFTA 2C9CA 2QL9A 4KQ2A 4PLVA 3SOZA 3ZCXA 3JASA 2PMKA 3GJSA 2JDIA 2NZ8A 2XA2A 4Q48A 3V2HA 1KAOA 4HWSA 1U7XA 1X0XA 2GH1A 4JVMA 3ZCUA 2FCRA 4GOJA 1WXGA 1IOVA 4B3SB 1ANKA 1OQAA 4P8RA 4JLPA 2ST1A 3D43A 4TLDA 3CJTA 1ADYA 1FP6A 1JAHA 3U3ZA 4DNPA 3NR2A 2GKOA 3W5HA 4Z3OA 2DPLA 2R65A 4MQBA 1D4FA 1QB8A 3F5DA 4BO3A 1QUFA 3HR8A 1JHYA 1GNLA 2MSLA 1AKMA 1ZJZA 3BD9A 1XVIA 5EJ2A 3SE0A 2ZFUA 3KOWA 2QTNA 3WXBA 3NOQA 4NQRA 2FZEA 1B2LA 5I4CA 2QTHA 1DAOA 2NQTA 2EFGA 3OQVA 2XDWA 4YRBA 1LBSA 1IQRA 3W06A 1YHYA 3WRWA 3GDGA 5CIYA 1G3MA 1AUVA 3KQOA 1X9IA 2FZVA 5LYJA 4H16A 1T24A 4H6VA 4JB2A 2OXTA 3SQOA 3ZHXA 3OQHA 4F1JA 5CEFA 1N2BA 2QN6A 3LDGA 4DRZA 4PY2A 1WMDA 1Q7BA 1VGVA 3PDHA 4HFRA 1CS4C 1ZISA 3GGPA 4IFIA 4R98A 5DYGA 4QJ4A 1I10A 1SELA 2O0JA 5D5QA 4UEWA 2VJDA 3T5PA 3NHKA 1EHCA 2QM8A 1VJ0A 2YRXA 3CZ4A 4R81A 3E82A 4X8LA 4IMIB 2YWDA 1JP7A 2E18A 3ZWDA 5DEIA 3SQWA 4GLJA 2XWPA 2I4MA 4JVOA 9ABPA 4H0CA 1VSBA 2UZ1A 4YJHA 3KEMA 4GKBA 1FBNA 3LF1A 3WYGA 4F3TA 1PFYA 4NYMR 3Q8LA 3FMPB 4OMUA 3Q7SA 1XKQA 3MC1A 4P31A 1T1JA 2CK3A 2YDXA 3RIEA 5AVYA 1OYWA 5BXQC 3HXOA 4JSRA 2CXXA 1F2DA 3UA4A 3UJ3X 1D0SA 1P5ZB 3W1VA 4KWIA 3TTVA 2QTVA 5FEUA 4MIKA 1SB9A 1YUNA 2WVJA 4PRYA 3WGMA 4UUMA 3NBQA 3LUAA 3R7NA 2JH8A 4JI6B 2ZM5A 3MXTA 4WLVA 2FE4A 3UVEA 1E1CB 4MKRA 2HW8A 5EMHA 4R3NA 5JISA 1CETA 4C89A 1TYCA 1YOVA 4HBZA 5FBQB 1EK0A 4HRAA 4F7DA 2RGEA 3AHGA 3CF4A 3G9UA 3OA2A 3SIPA 2D6FA 1BVHA 4I5GA 3DVQX 1ZD5A 2B7BA 1L4MA 5L3QA 2NTEA 3ZV3A 3C3KA 3OE5A 2NO1A 4YAOA 5ALUA 4G63A 5I8ZA 2ZS9A 3U4QA 2IXEA 1YBFA 3I64A 3MMXA 1PWEA 3AR6A 4K1XA 1A5SB 2GK3A 3DT8A 2C82A 3SF8A 1RJFA 4EY8A 5KHAA 1SUFA 2AZXA 3ES9A 1XG5A 3ICQB 3U4AA 1XRPA 2JI9A 4TV8A 4CTMA 2FRVA 7MDHA 4MP6A 2EGUA 2J9GA 2GJAA 3K71B 3ICPA 4WUTA 3QYJA 4FGKA 3GRZA 3HGMA 3NHFA 4Q4JB 5CLQA 4C7OA 1RAFA 2XLCA 3O21A 4L8WB 4RD4A 2HSWA 2O1SA 1OAAA 1NUUA 4H4DA 1M6HA 1N8TA 2CLOB 3OUUA 4J29A 4OBBA 1I7SB 4CKZA 3T54A 3TLMA 3I76A 2G9RA 3QGMA 2AZDA 5KYTA 1EP2B 5A2GA 2LXNA 1KI1A 2Q1UA 3EXHA 4JU8A 3R3UA 4NEQA 3U4DA 4CTOA 3IAXA 1Q3HA 1I32A 1RBZA 3GX1A 4EPVA 3BB3A 2XHEA 3G3EA 4RZSA 4Y2GA 3QVMA 2ADFA 1H6BA 4IIJF 3NWBA 3WIDA 3H2SA 4CLOA 3O8CA 3OAAD 4QAJA 4W82A 1QIJA 1TCBA 1WXIA 1WUTA 1ZD2P 1GNQA 2YWJA 3QTLA 2F1JA 3DB2A 2YIVX 3INNA 4KGZA 4CW7A 4LXIA 4BBZA 4F2GA 1RRGA 4IXNA 5CFPA 1O0BA 2G09A 4LJ4A 3B1ZA 3IGFA 3HNPA 4I55F 3DFKA 3L06A 1FYDA 4II7A 4GRIA 3UAWA 4U7JA 2Q2QA 3C87A 4I1RA 2OD2A 2P62A 4NYJR 1OYOA 1B4DA 4A2CA 4ZRMA 3RDPA 2I7TA 1BD4A 3ONVA 4I50B 4JEIA 4ZC1A 3TUJC 3O0TA 2G76A 2VDWA 3QI7A 4OGWA 5EZQA 3RWMB 1EMDA 2Q3EA 1GGKA 3GVPA 4BBAA 4RCZA 4FGUA 4JB3A 3D7NA 3SBEA 2YYAA 1KNQA 3EY4A 2QRJA 3AIOA 1G41A 3H5LA 1C8KA 3PEFA 3ZG6A 4ADSG 3M9LA 3UUFA 2ZIVB 3WOHA 4LRSB 1QK3A 4CKEB 2VTVA 3PWZA 2X1HA 3RVPA 5JFGA 2QJTA 4B83A 4CM4A 4QYSA 1H66A 3QTTA 1RXUA 4CCWA 2GTIA 4FDUA 4WFKA 1XTBA 2OAQ1 1JTFA 1E1QD 2VIIA 1QNLA 1WCIB 2VSOA 4I9GA 4R3UC 4ENQA 4RENA 3U4HA 4UAVA 5I7VA 1KA9H 4R1MA 3DM5A 5LP6C 3FNQA 3SIXA 1U0NA 2CK3D 3CUVA 1V4VA 4D45A 2H17A 2W2LD 2H2IA 2AEJA 4Q01A 2HJVA 3NCHA 4O4JB 4QVGA 4R40A 5G40A 1R00A 3PUHA 5E6RB 1U3CA 1YCGA 2PTHA 4MVJH 4CDGA 4DV2B 1EGMB 1KAMA 1WNTA 4HO1X 2Y1KA 3MLEA 2FFRA 1B74A 1FP4B 2GPJA 2P9FA 1AKTA 4NG5A 4PINA 5JH7A 3PC7A 5LLTA 3NKFA 2IZOA 2PMFA 3DW1X 3VKWA 1DBQA 1E1MA 2FJ0A 4M8DA 5IKPA 1NM5C 1MUUA 1SCUA 3N2LA 5JS8A 1CP3A 1E1NA 1J23A 2FR0A 4EJ0A 2FJPA 4KO8A 2OE2A 1T0HB 3LAWA 4BE9A 1IAVA 1FOEB 4DM7A 5KWSA 1KVTA 3QHQA 1HFWA 4RTJA 4LXYA 4B3FX 2BJHA 1E5VA 1YKSA 3NYIA 2NUAA 4ZAYA 4ZT7A 4UPEA 2P2GA 4Z2AA 3FPKA 3P2YA 5HRCA 3B8HA 3CONA 3PXCX 1YE8A 2HPHA 1YBHA 5DLQC 4Z1MD 1NWHA 1Y8CA 2FZCA 1WY7A 2A59A 2G77B 3KXIA 3GUHA 1KPIA 2FCAA 2IUSA 1KDVA 3DLPX 4E5DA 2J3HA 3UC9A 5K3OA 3VHLB 3VHXB 1PHRA 1E2EA 2BGUA 3LX6A 3QXJA 4KZPA 2BYTA 3AJDA 3IP5A 2GK7A 2IYLD 1BQ3A 4C0HA 1HLDA 3F8SA 3MELA 1YUBA 1ZH6A 2QDXA 4I6EA 5F35A 3KDPA 3DAOA 2B1QA 1J0XO 1IN1A 1Z5NA 1F38A 1JLLA 1ZMRA 4HEJA 3THYB 1O94C 2Q7OE 3D64A 1JG4A 2EL7A 1F2UA 1H65A 2WDPA 3CYFA 4YRZA 3Q98A 4HXGA 4P7KA 1O57A 5DHTA 4KDFA 2E5FA 2ZRLA 1C1XA 3GC6A 4ZTUB 2BGWA 2C61A 3GP5A 1SXGA 2J6CA 3PX2A 1VPEA 1C30A 3CG0A 4EGFA 2ZUCA 4IIYA 1EVLA 3CLHA 5B7QA 1W85A 4HNAB 3AUUA 2GK6A 4MUHA 1SEPA 3ZWAA 3M9WA 5INTA 1BYUA 2IE8A 3MT8A 1L7MA 1A2QA 2EYUA 2FTKE 3UUWA 3GCWA 4K8RB 1KDRA 1NULA 1TTQB 1EDEA 1U7TA 3QKSB 4ME6A 4WXRA 4TN1A 3OPVA 3NTRA 2NPIA 1E1YA 4AJLA 5IDWA 4Z1OA 3M8KA 1XZIA 3MUNA 4BVKA 2WFMA 3HV2A 4RGQA 2ZT7A 1PZNA 2ZBFA 1NYQA 1QH1A 1EEXB 1KERA 3E7WA 3FUWA 3OIDA 4JBNA 4NTZA 2XBMA 4JYCA 5A0TA 3OY2A 1JFTA 1Z0AA 1E9BA 3UT6A 4QJIA 3PFKA 3WBFA 4HNVA 4LF6B 5DW3A 2BZ0A 3DNPA 3OPYA 3IDSA 4JWKA 4XX1A 4DLXA 5AIAA 4EUEA 1JG6A 3RS3A 2FV8A 4YY3B 4G4IA 2PYZA 3C3DA 3BBPA 2W6JD 3QMWA 4M8KA 3EZ6A 3R7DA 2X8JB 3RWOA 3SU8A 4LSWA 2P9JA 3FWPA 5DGHA 2JW5A 4HS9A 1XL1A 3W78A 1GYPA 3AUXA 4TWEA 4DC0A 3H17A 3VOSA 5ICGA 3KDAA 4RX1A 4YRPA 3BSYA 3GEHA 5EYPB 3IOMA 2HF8A 3QNWA 3KHTA 3C6QA 3RF6A 3GGDA 4OHMA 1P8AA 3WK6A 1VLMA 1P1IA 1J1ZA 1TYDE 1OX6A 1XHLA 2W2QA 1N2OA 3K94A 5DYTA 3GFGA 3K9NA 1J33A 2FOXA 3CURA 5DM60 4NYIR 2V7GA 3I53A 4HGOA 4H3HB 4UFNA 3JV7A 4HYYA 3SXUA 4BMCA 2CFOA 3BHJA 2C6PA 1IHDA 1LI7A 5P21A 1VOTA 3VPFA 3FTDA 2W4MA 4Q24A 2JAQA 3G9TA 1VIMA 3THXA 5FA6A 4NAHA 1KK0A 1QYCA 1E3IA 1T9GR 3F2VA 3LX8A 1OI3A 4BNXA 4DFDA 1U2QA 2QR5A 4XJXA 5IJ9B 1T5HX 1OROA 3NYWA 3HDVA 4A0SA 1VFNA 3PU6A 1SD5A 5HA5A 1EFPA 3FDZB 5EQDA 3O2JA 5KNCD 3CSSA 1XVUA 4COBA 5D3MA 2NXWA 4MWZA 2D0DA 1WBJB 3L04A 5CNKA 1ULUA 1ZD9A 3PWSA 1N8KA 4E5KA 1V3QE 3QYAA 1YR7A 2D2VA 2H1CA 3JTEA 3LXRA 3DDNA 1MA0A 1RKBA 3HKEA 4PX5A 4ZVTA 3RR2A 3V8BA 4CF4A 4TRRA 1ISSA 2SECE 4UU0A 3KRTA 5KJ1A 3DBOB 2GBLA 3PPXA 3ISVA 2FSSA 2DHRA 1GZ4A 1ZNZA 2GASA 4RELA 1PUJA 4LQLA 4Y0VA 3TLCA 3IBTA 3RBXA 3VZQA 1FYEA 2Y8EA 4RXUA 1GZVA 4E1AA 1AF4A 3LC7O 4YH1A 3D54D 1L7DA 1P2GA 4BV9A 3AR4A 4GQBA 3NETA 3PQEA 4PPYA 3L05A 4F85A 4C0WA 3PFIA 1IY8A 3O2NA 1WUKS 2PS9A 4W1PA 5FA5A 1TK9A 4ZVSA 2QMYA 2WD7A 2WJJA 3ACBA 4II2A 3FLEA 5KVSA 1THZA 2GEFA 3RC9A 4H27A 1V7QA 2HFKA 1RLJA 2BM0A 2IZ6A 1Z5WA 4HDSB 3WWEA 1L5OA 2A9PA 4NDAA 1KYYA 1CEQA 4F12A 3KTFA 4WVLA 4LCJA 5E2BA 3OZDA 1BQ4A 4PFKA 2ZULA 3TEMA 3ANSA 3EVBA 1FTWA 4UUQA 3OC6A 5JEDA 2PJZA 2J59A 3U7RA 2EFDB 3TZCA 5IJ0B 4DV6B 4R2LA 1L1QA 4Q6BA 2NO9A 1IDN1 1NA5A 3PFFA 2GM4A 3AL0C 2XUDA 4KSCA 1WAMA 4I6GA 3TJMA 4RHXA 4XOUA 2J85A 1ULZA 1XCLA 2BFDB 3LM8A 5DXFA 1CZUA 3RFVA 5CYGA 3DOFA 3S4YA 3C5CA 2XGMA 3PFHA 2Y71A 2QA5A 4BO1A 2CXSA 5AVWA 4OJQA 1GARA 1OT3A 1CFJA 1D1TA 2CJWA 3LUKA 3FCOA 4IEIA 4UXHA 2GRUA 1XTVA 1KO1A 1PJ4A 2P27A 3AEZA 3WSTA 1JEYA 1U3DA 4URWR 2VUUA 5IAGA 1KK3A 2VJOA 3ZGLA 4K9LA 4YNBA 2CY0A 2B0CA 3AOEA 4X1OA 1XVTA 1NFFA 2H9YA 4I1YA 4L8FA 2XIQA 4OJKA 5CVDA 2Y0DA 3G89A 5F2KA 2VWHA 5KU1A 3S7ZA 1T5TA 3KJHA 4CIAA 1KFBB 1H23A 3ZXSA 2C0PA 4YK7A 1VSTA 3I9NA 1C80A 1KJIA 3B1XA 4MRAA 4J9VA 5BMOA 2H1FA 1O94A 1VMDA 3SC2B 4XIJA 1DPFA 2IVFA 2HU7A 2QRPA 4HH4A 4WXHA 3PF9A 2Q1YA 1YL7A 2C7BA 2H1SA 2VVTA 3KZCA 3FGNA 1JKMA 5LUAA 2NNLD 4KMSA 2Y93A 3CXUA 1IEQA 2J4DA 3CX3A 3D02A 3NVDA 1AC5A 3QFFA 4QHTA 1U7HA 1HNXB 1QM5A 3R4VA 4I8DA 4WXEA 5HMMA 1XCBA 1KP3A 1YNOA 3LUFA 4OBXA 3TO5A 2ZTHA 3RT9A 4AP9A 3ZQJA 2Q0SA 1UBLS 1Z56C 3PR1A 4A2WA 5DHRA 1ZK3A 1HT2E 3U9SA 2BBSA 2O0HA 3DZ8A 1P9LA 1WSWA 1VCIA 1XXHA 3PGA1 1DBVO 3O84A 1FU7A 3UGQA 2CMKA 3NATA 4AYTA 2OYRA 3ZDRA 2DJ5A 4BV8A 1CUWA 3M4ZA 3R3YA 2RHOA 3FX2A 1J56A 1D4OA 5E6SA 1AB5A 1COWA 1O8CA 2NXEA 5FEMA 3RVKA 2I6SA 5AQEA 2R1VB 5HIKA 1Y6FA 1TM2A 5BOSB 1DGQA 1BVUA 4XYLA 1V2GA 4BU1A 5CYFA 2VP4A 2ZTSA 4HNSA 3HVRA 2W5UA 2VXOA 2J09A 1V8DA 2VP2A 1M34A 3G85A 4BZZA 1NQXA 2IVZA 4M9UA 2QUIA 5EERA 3PNKA 4JQSA 4XRRA 4LJRA 2B2XA 1L7EA 4PLZA 5JTTA 4OXYA 2G7ZA 5AVXA 1K0FA 3WK9A 4DBLE 1Z6ZA 4GMHA 3ASUA 3Q88A 3W2EA 5ALYA 2B69A 2GNPA 1ZSVA 2ODBA 1GSHA 2BI4A 3Q3EA 1VMEA 5BSFA 3H9GA 2RH4A 2R6GA 4Y6PA 1LJ8A 2B35A 2BBWA 2FW9A 2HMYB 2YASA 3DLTA 4PANA 2VHQA 4DYVA 3M6WA 3F49S 4Z51A 2YVKA 2Q21A 1L5ZA 2F8TA 1KZ4A 2GFQA 3HACA 2J3QA 5CYPA 3OEWA 2XCLA 4YP0A 3PXGA 4B79A 3T07A 1CUVA 1GPNA 1SOVA 2XBLA 3GT4A 4Y2PA 3W3AD 3ZWCA 4AJOA 4YV1A 5LVAA 2GETA 4MV7A 3RM3A 4YRKA 6REQA 2VPYA 2OLSA 1NVFA 2EX4A 5K0NA 1E89A 1ZZEA 3PK0A 4ND6A 3AF6A 4HDKA 5FWNA 1HEUA 3Q0IA 1CUSA 4FFSA 2BR3A 3OZUA 3V1LA 1Q2XA 2I22A 3MJHA 3MINB 2J6IA 4FZVA 4LEIA 4R31A 5CFQA 4LQDA 1QIEA 1R0CA 2HY7A 3T3EA 4DC9A 5F5XA 2IHNA 3E5RA 3R09A 4M8NE 4CCYB 4RF5A 1JIKA 2W9XA 3FPAA 4CQMD 3AKZA 4TX1A 1PFVA 2H0QA 2HK8A 4EA8A 2WF5A 3LCJA 1HLPA 4W5JA 2H2DA 2VHZA 3ZR4B 1RQRA 2EQAA 4LV8B 2PKEA 3DZCA 3OEEA 2YWGA 3KKNA 2X40A 4LKRA 3B9QA 2C5HA 4TKVA 1E4EB 1E96A 1RJGA 4G0OA 1H5NA 1MORA 3KUUA 3RTGA 5HQTA 4OC3A 4HNTA 3ZS9A 3RFFA 2LD4A 2LWIA 2N47A 4NMMA 1U7PA 2AMFA 1WZCA 1BMDA 1Z36A 4HKTA 1CUBA 4XUCA 1T3TA 4S1TA 2C54A 3OE4A 5EKUA 2GAOA 3KOOA 1NRWA 3UAZA 5EJ6A 1T1IA 5B6PA 2PGAA 5IAAA 2HL6A 3PC8C 4XYMA 3EW7A 2BJVA 4BUJA 2IWHA 4UHDA 1MB3A 3OFJA 3ESZA 4U1RA 1VL5A 3O83A 4KU4A 2NSDA 5LZ9A 1K7CA 3FR7A 3QVTA 3S70A 2VAMA 2RGAA 3NVMB 2ZJ7A 2SCUB 1ZUD1 1XZBA 3RC2A 2ZWPA 4Y9TA 1QP0A 5KZMB 4QLOA 4FR0A 3K2IA 5K3SA 3OT4A 2BCEA 1FMCA 1EUCB 2B61A 2NO4A 2Q99A 3RRXA 4C3UA 1HNZB 3GT0A 2PX0A 2BKAA 4BXOA 1RBMA 4U5XA 1U2GC 4XDGA 3DZHA 4XM1A 4YASA 4OMEA 1UC5B 4V2IA 2O0LA 1G291 3LL7A 2DBZA 3HB4X 5DULA 4MV8A 3VHXA 2WJZB 3AZQA 4NABA 1GIAA 4MQ5A 2OENG 3VSDA 2A0FA 5DGDA 3R8XA 1EGHA 4IOLA 1DEOA 2OOKA 1JA9A 3A9SA 4YMUA 3S5UA 4CF6A 4X1IA 1DKMA 2R60A 5DNVA 2NYRA 3LWDA 3ZK7A 1FLAA 1NW3A 3C1OA 1DRWA 3JVDA 4MRMB 2Y77A 5IYZF 1X9HA 1FP1D 4RKQA 4AZ3A 4V0KA 5GM1A 2YICA 2HJSA 1P31A 1NDUA 3PGJA 1AKRA 4I50F 1E8MA