4IIYA

Structure of mccf in complex with glutamyl sulfamoyl inosine
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
335
structure length
335
Chain Sequence
b'PLLAAPLAVGDTIGFFSSSAPATVTAKNRFFRGVEFLQRKGFKLVSGKLTGKTDFYRSGTIKERAQEFNELVYNPDITCIMSTIGGDNSNSLLPFLDYDAIIANPKIIIGYADTTALLAGIYAKTGLITFYGPALIPSFGEHPPLVDITYESFIKILTRKQSGIYTYTLPEKWSDESINWNENKILRPKKLYKNNCAFYGSGKVEGRVIGGNLNTLTGIWGSEWMPEIRNGDILFIEDSRKSIATVERLFSMLKLNRVFDKVSAIILGKHELFDCAGSKRRPYEVLTEVLDGKQIPVLDGFDCSHTHPMLTLPLGVKLAIDFDNKNISITEQYLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MccF
publication title Structure of MccF with substrate analogs
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 120
structure length 335
sequence length 335
chains with identical sequence B
ec nomenclature ec 3.4.-.-:
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02016 Peptidase_S66 LD-carboxypeptidase N-terminal domain
A PF17676 Peptidase_S66C LD-carboxypeptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Class I glutamine amidotransferase-like 4iiyA01
3.50.30.60 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 LD-carboxypeptidase A C-terminal domain-like 4iiyA02
4H1HA 5F5XA 1ZL0A 5F1YA 4MJXA 3TLGB 3TLEA 4INJA 3TLAA 3TLGA 4IIYA 5F9MA 3T5MA 2AUNA 3TLCA 4E5SA 4JVOA 5FD8A 4IIXA 3TLZA 1ZRSA 3U1BA 3SR3A 5JYBA 4MI1A 3GJZA 5K99A 3G23A 4EYSA 2AUMA 3TLBA 4E94A 3TLYA 3TYXA
chains in the Genus database with same CATH superfamily
3RSGA 2DBZA 4PZZA 2OBNA 1I1HA 4HQLA 1IUKA 3IV6A 4H1HA 2E4VA 1KC7A 5BMVB 4QUDA 3PGJA 1UBKS 1X7DA 5JQWA 4MUXA 3CC8A 1XAGA 2BMFA 2D0PB 2EL9A 3AF3A 3FBWA 3LY5A 4HEA6 3WA6A 4ALMA 5AFSA 2AUTA 2ZJOA 4ZYXA 4G8CA 5K0GA 3VJLA 2R6AA 5JO0A 3FPFA 2JLWA 1N3LA 2XDAA 4W5NA 3WNZA 1XXHE 1YAJA 3HJAA 3HM2A 3Q1KA 4WNIA 2BMJA 2UZAA 4BO1A 4EGJA 1YO6A 2H7XA 3F67A 2KW5A 1H2ZA 3WICA 4I5FA 1W2GA 1XZKA 4MB2A 4EKDA 1SCQA 1UXJA 2BFBB 2R1VB 1DJOA 4M0EA 4EPYA 1AZWA 4MWCA 4I81A 1E2UA 2Z5VA 3IOEA 2PH7A 2QTFA 1M6EX 3C6BA 1NUTA 4G24A 1M2NA 5JRJA 3UG7A 3AIMA 1B4DA 3GJ5A 4IJQA 3NAMA 1N8TA 1HV8A 5TY0A 3OT5A 2JAPA 1E7SA 1PJAA 3PA8A 2GBCA 4CLEA 5HDQA 1RE0A 2JCXA 2AI1A 2P4SA 4JJZA 4G07A 3VAYA 3ZV6A 5KYTA 4WQMA 3V4VB 4REMA 3ENNA 2NO4A 3FE2A 5B6IA 1PCXA 4JVOA 3MS2A 4F6RA 4OI0A 1HZZA 3SF8A 4F38A 1V11A 1XU7A 3DMYA 3W78A 2C04A 4ESOA 2QTWB 4WK6A 2XLBA 2O19A 3KSRA 5D86A 3GY0A 2ZYWX 3LM8A 3OZTA 4URYR 2Q3BA 2J3DA 1LSSA 2IEZA 3VR0A 2WB2A 1UXHA 2NVWA 1PJSA 2P7IA 5GONA 2EVWX 3TZCA 1P60A 2SNIE 3UYKA 4R8LA 5DSTA 5C7OO 5ICGA 4OGGA 3FYUB 1NV8A 3KPJA 3TSCA 1EJ0A 1V2GA 4TGLA 3DZDA 4F72A 3EVBA 5KYWA 2HT1A 1YI0A 1J2YA 2NXJA 3VHXB 3ZDXB 1OC2A 3DG9A 2CKMA 4PLCA 4URFA 2EFJA 2J6BA 3L07A 4AECA 2QP9X 3NTRA 3Q9LA 5B7PA 4MQLA 3BGWA 3IR7A 2A78A 2GPSA 3BFXA 5F09A 1E5VA 3MCWA 4HWGA 7ABPA 1RFLA 3H9BA 1LF0A 4U7JA 3CPSA 3MQ2A 3HJFA 2PJRA 4Z4CA 2W2LA 2XYHA 1YS6A 4AX8A 4HX5A 1JDBB 5L40A 1EXWA 1TO1E 2VSXA 4S2EA 1OH5A 1AT1A 4JV5B 4P0QB 3FZQA 3GRZA 2B4TO 1FYFA 4TKUB 1XTPA 4FDAA 3KTOA 5JZOA 1YMVA 2FSFA 1FYXA 2JBAB 3K72B 1TEZA 3WZLA 1YTLA 3PHCA 2GVZC 4IRMA 3U48A 5H9WA 5HQ3A 3EZGA 4QC2A 2I4OA 3DAGA 1T8YA 2VN8A 4CT0A 1J8YF 1XZBA 2WM8A 1HFJA 3I72A 1KAQA 1I3CA 4HWKA 2Z09A 3TOVA 4C22A 3B20A 4HF7A 2OV8A 1HYHA 2GLUA 2ORYA 4M0KA 4IMIB 5GONF 4FDTA 2P0AA 4HH4A 3OEHD 3KPVA 1T3SA 3K09A 3R76A 2M6SA 3BMCB 3H5VA 4OI2A 1HDYA 4FT2A 2FPIA 1TQDA 3TLXA 5EWMB 3N70A 1RKUA 4ZOLF 4H27A 2OT3B 4P2BA 3B1VA 2PEYA 4RORA 4B3XA 2JIDA 1ONSA 3CV3A 4YCCA 3U5ZB 1M66A 1X14A 1ZS9A 2QW8A 1B15A 4LJAA 5E1OA 1E3DA 2A9OA 3AF1A 3JWEA 5HGJA 2HF9A 3E1GA 2A86A 3A2LA 2P5SA 4FCWA 2BEUA 2G17A 3WLSA 2ONZA 1KBZA 3HHEA 3HRKA 3IILA 4DKJA 1K89A 3HMKA 4LSZA 4XUCA 2WJAA 4R54A 2QRVB 4LC0A 1Y6ZA 1NXQA 2C2XA 2IHYA 2G63A 3AUFA 4A2QA 1UM8A 3EH1A 3ENVA 3DZIA 3LDFA 3CS3A 4PIMA 5BQ3A 5EHZA 2EG9A 4C0LA 2WNIA 3DQZA 5F3DA 1FTGA 3E81A 1KY3A 5B30A 1JQEA 2GFHA 2YJ3A 4D9HA 1M3SA 1NG9A 3L1UA 2H17A 1IXSB 1U9ZA 5BUCA 4GPTA 3V8VA 3UB3A 1NTRA 1R8QA 4POAA 1UDWA 2C4MA 3UMCA 4JA2A 4KR3A 2FR8C 2NG1A 1NYRA 2EGHA 2PUGA 3HO1A 1P3Y1 1NOJA 2GBGA 4L9WA 3FCCA 3WLFA 1NULA 4EKGA 1KI6B 2AG5A 3NAQA 1N25A 4NV0A 4ID3A 5DN9A 4BRZA 2Q21A 2BRUC 1XWFA 2GZSA 3HB1A 3KQVA 3V1LA 4AZVA 4LRQA 1YACA 4EJMA 4UW9A 4HZIA 4BQQA 2QBYA 4P45A 1PI3A 4RVUA 3O4IA 2I1WA 1C41A 4XUEA 4UAGA 3TIVA 3WLAA 2H8KA 3W1WA 2W48A 1NBME 4P3NA 5JDCC 1WZEA 3UKOA 3JAMA 2W42A 3K70C 1XF9A 2GLXA 4M53A 4OY3A 3VR6H 5E9JA 1OREA 2XCOA 4F9EA 1P80A 2FW8A 4MW4A 4UXJA 2VG8A 2XNCA 4GF5A 3ND7A 4F91B 1XNGA 1XHLA 2AFIA 2O8DB 1TKBA 4OQQA 4LZWA 4GPZA 1W88A 3TZLA 3DB1A 2VDJA 3HI6A 4EHIA 1VLJA 4BZQA 3H87A 1XLUA 3O1IC 4GE0A 4EG7A 5KAPA 4F84A 3TLEA 5A4KA 1V9CA 1VL1A 8GPBA 5IWAB 4JXXA 1BCRA 1QIJA 3FTQA 4FGSA 3Q2OA 2FAXA 4IIHA 3MJFA 2E5WA 4GGOA 3TIGA 4MPPA 3URKA 1NNEA 1M6YA 4C8FA 5IWCA 1D2NA 1ZIPA 3TCXB 3H2ZA 1OI7A 2CVQA 4DTIA 1KQPA 2XUHA 3BE4A 3EGDB 2FMHA 3D0KA 4Q3OA 4LE1A 5MN4A 2CLCX 4UHKA 3EFOB 4URWR 3UQYS 4J2TA 3ITDA 4Z49A 1AK2A 1CUHA 1ID1A 4FLFA 4G37A 3DVSX 4ZI5A 1BE8A 4IO0A 5JWOA 1T36B 4Y2PA 1M2WA 2WD7A 4BQOA 4DJTA 1WSAA 4HPJB 1XXHA 1M9NA 4JJ4A 2FWPA 2D06A 1IBRA 3GH1A 4Z9XA 1Y6GA 2YNMD 1HE5A 1U8EA 1C7IA 3K5HA 4LY6A 4D8WA 4GI5A 2IEIA 4IV5A 1VMAA 3OFJA 4B3FX 1WQ1R 2JAWA 3O26A 3ZZ0A 2WTUA 1Y4ZA 2EF1A 1UJMA 2WKQA 3SXJA 2OAP1 1E3MA 1SN7A 1N2JA 3I3OA 4XGNA 4QECA 1Y8RB 2ZPAA 1CFJA 4I1OA 4M1EA 2XITA 3VR6A 1Q6YA 3DV0A 2IWHA 9MHTA 1XRPA 2JKZA 2QVGA 4UTOA 4ZOCA 4A2PA 1Q7GA 2HNBA 2AMJA 1XA0A 3A1SA 1REQA 3OOWA 5FO0A 2R1ZA 3PWKA 2L82A 2Y67A 4EEZA 5KWJA 1L3IA 1YHYA 4TTRA 3BAZA 4PQEA 3K8ZA 1TJ3A 5K5EA 1YB2A 2MINB 4D0LB 4JOCA 1UBNA 3GT4A 5DT9A 3ONWA 4JROA 3IOCA 3WQHA 5CBPB 1SUIA 2H2IA 5CU7A 2MOKA 3ZTTA 1SU4A 1PN3A 2YUTA 2F55A 2FSPA 2AG6A 4GOOD 2YL2A 4NVRA 5KWVA 3FYTA 2CV2A 2UXDB 1XZHA 2PUEA 2ECFA 4WOPA 2JGEA 3QOYA 4DV5B 4DWJA 1E4EB 5FUVA 1GPH1 2OCAA 2BGRA 3AUKA 4KOAA 1SVNA 4ON9A 2ONJA 3I12A 2Q5FA 1O3YA 1XO1A 2IK8A 2VHWA 5J59A 5IRCD 1PNTA 3L06A 3H8JA 4D3FA 3NDBB 2AW5A 3QUCA 3RVOA 1RD4A 3D4NA 2A6PA 2ZUSA 3BTUA 1DO8A 2ZJ6A 4ILKA 4M0CA 1J1UA 2XIQA 2P68A 2P8JA 2R7NA 4YRGA 2XYVA 4UNPA 1R9JA 2NMVA 3LYUA 4REOA 3ZHRA 3EMKA 3C8MA 1PZHA 2XXJA 1I24A 2C4VA 821PA 3F73A 1N6IA 1HDEA 1YASA 3TZ6A 2HO4A 3BIWA 3U13A 3KKPA 3UBMA 2CMGA 2QPAA 1ZGJA 2Z08A 4S0XA 4CMAA 3VXKA 2ZUEA 1M1NA 1Z2DA 3LQRA 4BGDA 4W7IA 4UNNA 3DGEC 3JQAA 4ITUA 4MWDA 5HTOA 3KWJA 2ACEA 3OLYA 1ABBA 1PW7A 1WCV1 2XWQA 4TTVA 1FQJA 1Y7TA 3BJMA 1T6YA 1SUEA 4PFJA 1H0KA 1H2FA 1W96A 1YVDA 5E4TA 2Q7OE 3RRBA 1KGDA 5KC9A 2X0NA 3BFKA 3BX1A 4QTXA 1R1DA 2YV5A 1EFUA 1H0SA 3GDGA 4B0OA 1DKPA 4CM8A 2RFLA 4NE7A 3SXUA 2QYHA 3UYLA 1Z0KA 1OXVA 2JJMA 2VDWA 3BHMA 2CFTA 1A76A 4QTUB 5T4HA 3WYNA 4WVLA 4A92A 5AVZA 5I5EA 3PR1A 4QVGA 4GI2A 2EWVA 4L07A 3L43A 1VYTA 2AZ4A 3IP9A 4JWTA 4BLSA 1ESMA 5JI2E 1XTZA 4D26A 2OD9A 1P7VA 2PGDA 4ZPJA 3HCRA 1USWA 1R74A 4WXMA 2O1WA 3VH1A 2EX1A 2OUIA 2Z5LA 2PX4A 2ZZKA 4MV6A 4A3SA 3ZQJA 5I3ZA 5KJ1A 1Y63A 3JPWA 1KI3A 3JQ8B 3S5UA 2NU6B 1HE1C 3N0WA 2YY5A 2XT6A 3PRYA 4NBKA 2W71A 2J7KA 3K0CA 2YVQA 1BMQA 2FPWA 2X58A 4N3CA 5JFOA 5GGYA 1J07A 5C34B 2V59A 3C24A 4HL6A 1O57A 4HLUA 1BWPA 2JGRA 3FUXA 3PDIB 4E46A 5JR3A 2OFPA 4ZAXA 3IKVA 1RHRA 3AR9A 3DL2A 4KRYA 2IV3A 3WMFA 4JYZA 3ASYA 2IYYA 4FEAA 4P9NA 3H4IA 2B78A 2VTBA 4YP7A 2NTNA 2B0CA 4IGFA 1JPUA 2W2KA 3FCAA 5CFQA 3F96A 3JWJA 1O8BA 1BYUA 4IXNA 4NBVA 4KR6A 3FPBA 1AKVA 3HP4A 1UMBA 1K75A 1A8QA 4ZVTA 3Q4GA 3V32A 3E8SA 2POQX 4I50B 4MVWA 3TD9A 2YMLA 1YRLA 3V2UA 4BKQA 3DOFA 3EA0A 1TFRA 3W04A 2FY8A 3K96A 1X7HA 1NQXA 1FP1D 3OKAA 1RC8A 1NBMA 3ANSA 3PF9A 4BFCA 4RD1A 3TO5A 3QVSA 1ZI8A 1MO6A 4OMDA 3DUWA 4XSGA 5ESDA 2WM9B 4DRYA 2DQ4A 2L18A 5HKBA 1QKJA 2EEPA 2C42A 4ENSA 5B4UA 5JZ9A 1CTQA 1E79A 2OOKA 3TNLA 4C03A 4HXFB 4Z7OB 2Y1FA 1M2OB 2I65A 2OILA 2XQKA 4HFJA 3SI7A 2IYNA 4DOMA 3F78A 4DXDA 2PS3A 2ZWOA 3EC2A 4N0PA 5JSZB 2HC9A 3OUTA 1C9YA 4R16A 5G3YA 3EQ6A 2YRXA 3K92A 1V6CA 3EVNA 1E1RA 4PWYA 2BEJA 3WGYA 2J1LA 2Z8XA 5B53A 2JRCA 4IQ4A 1P3JA 2XVYA 2B99A 3AR3A 4FN5A 1CPYA 1QIEA 1ZUD1 2GPWA 2YFKA 1XJCA 4EFKA 5HDBB 4ZJPA 3PQ6A 4C9EA 1SC3A 1L5HA 3OZUA 3WQQA 4G5FA 4Q7MB 3SQXA 5L3QB 1VPLA 4CR6A 4NGSA 4MP3A 2OAEA 3SEAA 5EKTA 1YU9A 2R5FA 4M0LA 3EXFA 4QOIA 4G56A 1GLGA 4JR0A 3BZWA 3KXLA 4FB5A 3KKNA 4DSZA 1QWOA 2IPAB 3QWIA 3G9ZA 5PNTA 2WPNA 2ZJFA 4XOUA 1ODIA 2BFWA 2FG5A 3W6UA 2DU8A 1XDZA 1E3JA 4PXSA 4LNUB 2B61A 4TV8A 2PRIA 2ZQZA 3IO5A 2B2NA 3GLQA 4Z9FA 4BQPA 4ABTA 4LX0A 3E5RA 4ZIRA 2GNAA 2ZT8A 3MWDB 2GFIA 3OPVA 4C7KA 3SYTA 4P98A 2I9KA 4XIJA 1LGYA 4ZU1X 2H31A 4H60A 1J0DA 1V35A 1YDHA 1IDOA 1XMJA 2IIVA 2QM8A 2W6NA 3GFOA 3INYA 3PPWA 3T52A 2PHZA 3PFCA 3ZGNA 3ZJVA 3CJRA 1KP2A 3T5MA 2BN4A 3NFYA 4Q9HA 5ALQA 5G1NA 5BSUA 3WGMA 2JLUA 1FZTA 3NYWA 4I2NA 4CF5A 4UVEA 2E5FA 2FP4A 5JCOA 2X9LA 1KHHA 4CYMA 2C9DA 2PN1A 4P08A 1LBTA 3X0DA 3DBHB 2C95A 2VKTA 1XNRB 4IYJA 5B3LA 4J29A 4TLBA 1AZSC 4JDPA 4MKFA 2VNKA 2PNFA 1XN4A 2PUCA 5KIAA 2ZJ5A 1G19A 3LVQE 3I9V6 1U6KA 3SE7A 5KQMA 4E31A 2XNSA 4HRXA 3UGKA 4TKMA 1H4TA 1Z6ZA 2PYDA 4M55A 4MCJA 3I01A 3LY8A 4Q9NA 4QOHA 2EIHA 4LBVA 4JLPA 4NF2A 4XYBA 1R4NA 2XNHA 3QX8A 5CX1B 4F86A 2CHGA 5KREA 5LR6A 1SHTX 4NDNE 2CJWB 3F7NA 4G5QA 5KINB 3M6LA 4UBJA 1DT3A 3LWNA 5E8RA 3MTAA 4C7OB 3EQZA 3C4JA 3I5MA 2BKAA 4DUPA 5DWDA 1JDUA 3TWOA 5C1OA 4P7BA 4YJ2A 2WV9A 3KKKA 3W8DA 3LZ6A 3SBEA 3I9MA 1J33A 3D9QX 4HNSA 1KSJA 4NOLA 1YRQA 4Y30A 4EHDA 2X42A 4XQ0A 2IWRA 5BR4A 3PHLA 4RMIA 2VF8A 1FUKA 4OKNA 3SBDA 4ISCA 5CT8A 1B73A 5FOUA 4BO4A 4EYQA 4RTLA 1BS9A 4DDWA 1GRRA 1T3TA 3V7NA 3K6JA 3QYFA 3GRVA 1QQAA 5KYXB 5LJLA 1LKZA 2DPXA 3OO0A 3QSYA 2O8BB 4A6DA 3I5AA 3ADPA 3E3LA 2VJKA 3GNQA 4MRVA 3V7FA 2HDWA 5ABPA 3SQWA 4E5UA 4KXUA 1RQNA 2VPXA 3EK2A 4BZPA 4X3OA 4YCBA 1MX5A 2VDVE 3I1YA 1Y89A 5ETJA 5HUHA 4ZVQA 2PRSA 1NJ8A 3R5FA 4ZCIA 3ONDA 5A7FA 5DNUA 3MF4A 2W2TA 5D84A 1FP7A 4PPFA 4KJZA 3IKTA 3ML1A 5TT1A 2J9FB 2WOOA 1S89A 2EWWA 4NMHA 3FUVA 3O91A 5EESA 4L2IB 3DDWA 521PA 3Q41A 4R9UC 3H3FA 4FDUA 2XXAA 1NBOA 3PL5A 1HQCA 3W9YA 4IDBA 4IIYA 5FR1A 1LW6E 2I2DA 4GYKA 1E6EA 4C01A 3OLZA 3L4SO 4EHKA 2YHSA 5EKXA 2LUOA 2OD7A 1M7BA 4V0SA 3WB2A 3WGVA 4YAJA 2O7QA 3ZD7A 5TMPA 2IYEA 5CJPA 2D8MA 1JECA 5EIBD 3NVKI 1AGPA 1W6UA 4OBWA 4XVQA 3IAS1 3ESRA 3MXOA 3FPKA 2UYOA 5AW9A 1KQNA 2G83A 1N34B 3QMMA 2H1LA 2AG0A 3G2PA 4URVR 2G67A 1A2OA 3NBQA 4QYIB 5FI3A 4D80A 4HDAA 4Y1FA 2KI5A 2C3YA 4OKSA 4W9NC 2WJHA 2V7XA 5F4ZA 1Y1PA 4JI6B 2Q46A 2PDAA 4DQ0A 4F3CA 1RZUA 5CDSA 3AM1A 1QQBA 2I03A 2ILVA 4JS0A 4OLAA 4H77A 4QQKA 1SCIA 2RBEA 1SQFA 1GNRA 1MEJA 1Q77A 3A06A 3ZW9A 2QOEA 3CVVA 4P4JA 1JTEA 2JIZA 2X3UA 4RW0A 3QWAA 1LFDB 4N7MA 1KZ1A 1G6Q1 2CEAA 1SKBA 1SWWA 3R7WB 2X0KA 2X40A 3AG6A 3GU3A 3IOMA 5BQFA 2I8AA 3HXOA 2O3TA 4EFMA 4HQKA 3UMSA 4B6SA 1YVUA 3TZKA 2JFNA 1ISIA 2FMIA 3COVA 4LDZA 1NWCA 5KOYA 2VS1A 4DLRA 3ER9A 3QPWA 2WZQA 4OHFA 4FS8A 2XEIA 1EZ1A 3DFKA 2UZ1B 3MJ4A 4ER6A 3UW3A 1M8GA 2GD6A 3MMNA 3LP6A 3WLKX 1MH1A 2YYAA 2PS9A 1NRIA 3K20A 3K7EA 5TVKA 4QDKA 2ZBQA 1I9CA 1WMSA 3AOGA 1FFBA 4QYWA 3T15A 1Z0UA 2DLDA 2QJFA 3CLUC 4MI3A 3OEED 2QSZA 3VV2A 1PJQA 1KMQA 3R3VA 3WJ2A 2JVIA 4JLVA 1HE2A 4JU9A 4AY4A 1Q16A 5JMPA 4RVFA 3D2AA 4I4NA 2H48A 1P5FA 2ERCA 1A5BB 1E63A 2C4TA 3EA4A 4DMRA 4ENQA 1WR8A 3KS9A 4FE3A 4OU5A 2JFXA 1P0PA 4Z4FA 4PGMA 5SZHB 4RD2A 3M6UA 3REQB 4D3ZA 4IVRA 2X77A 3PRKE 3T99A 3F2VA 3RSLA 3KSDO 3VSCA 5HEKA 4CMGA 4IAOA 2HCFA 2ZBVA 3V1MA 3NJRA 3JCZA 4O1MA 1T2FA 5DI3B 3BK1A 3VYRB 3DCNA 4N6OA 4D41A 3E35A 1QK3A 4QU8A 4X20A 1FS5A 1PJZA 2XDWA 4JC5A 3GLIE 1L4UA 2I91A 5AOAA 1U31A 2J3KA 4L3WA 3T5DA 2AQIA 4CCWA 2Y0EA 1H6BA 2FEPA 4TS9A 3GO4A 4NEHB 3TIXB 1JEAA 2ZSFA 5BWMA 5HUQA 2F1HA 3JWHA 3M4YA 3TUZC 2X2EA 3CW9A 4M22A 4P93A 4AZWA 1HNXB 1OAOA 5F2OA 2C57A 3M81A 5JADA 4FFWA 4HDMA 1U0HC 4B6RA 1IK4A 2JH9A 2YJ5A 1AKMA 2L42A 3N74A 3G2NA 5KYVA 1ZSVA 4CTMA 1JBQA 1PV4A 1JDSA 3USZA 5CA1B 1OYYA 3FX2A 3SHTA 4GC5A 5T4FA 4X64B 1X1RA 5L45A 2BMVA 3P5BA 4PNEA 2ZRQA 3A28A 5EJIA 3ADCA 3LXXA 4M88A 3EG5A 2TYSB 2OENG 3C39A 1ABFA 1Y82A 1TM1E 1XZIA 2IOFA 5F9FA 3DFFA 2ZG6A 5B3AA 1H1LB 4RNDB 3OQ1A 4ZALA 5AUQA 4D4HA 3ERCA 1F38A 1QC5A 3R23A 4Q4JA 2W2LD 3H99A 2JFPA 1D2MA 1VDMA 3NZEA 4H7KA 2WD9A 4Q01A 4Y2TA 1O95A 4IS2A 5L6MB 4KXWA 3Q7SA 1VRVA 3GBPA 1E8DA 2OHIA 3CIFA 4LA4A 3ADDA 1H8EA 1CJKC 1A2QA 3N6VA 5LBUA 2Q5QA 1J9GA 3BC1A 2M6LA 1Y7LA 1R27A 1Y3IA 2GRUA 3EGIA 5BRJA 5BR7A 4PG8A 1XPUA 3PNOA 3CM0A 1YL7A 3LO5A 2IA5A 1PZEA 3MTGA 1AN0A 3D2BA 1J70A 1QIKA 2FPUA 2DQSA 5JU6A 4MR8A 4A8JC 1TE2A 2PT6A 3U0BA 3FYSA 2HQ1A 3NALA 4F56A 1U9IA 2JF0A 1A7UA 2FU5C 1NRXA 3FPLA 4ZHSA 4QDJA 5LDDC 3AR8A 4J1TC 4KREA 3PCTA 2IYRA 3OOHA 5K3FA 4JC4A 5E7QA 4U9IS 1WB9A 3B6EA 4LF6B 1A71A 2D0DA 3ZWPA 3AEUA 2P9BA 1BJKA 1A9XA 3U44B 1DAGA 1NURA 3KHUA 4RLHA 2HI0A 4L4UA 2W37A 4P4NA 3BXGA 3G9TA 4TXHA 4X3PA 5HG0A 2IHZA 5LP6C 4CMJA 1XBTA 3DQQA 3GDOA 4U4AA 4CMKA 5AI0A 4DSUA 3VNBA 3T1HB 1XDBA 1OLUA 4LJ9A 3GLFE 3V1UA 5JFTA 4KJXA 3BOSA 4YMUA 2XTAA 2GXSA 2QWXA 5B1DA 2ZAGA 2YJGA 3EF0A 3HS3A 1WKVA 2FX2A 1FX0B 1IZ7A 1QH1B 1A9QA 5JJCA 3ZE7A 1Y98A 1LK5A 3QWHA 4G86A 3FHCB 3OWHA 1OR8A 3LQ1A 2W8BB 4Y1RA 4WZBE 4HWOA 1PYDA 3SJAA 2EP8A 2VQDA 3H5NA 4AP9A 2YXLA 5JMWA 4XQEA 2VAVA 3H6HA 4U9UA 3AHHA 2FQQA 2PWAA 3CLTC 1GJRA 3THYB 3B7WA 2J67A 3OM1A 3T05A 1Q0ZA 1CR4A 1C7ZA 2BH2A 3STXA 3BE5A 3PGKA 2I0FA 5ALXA 2OYRA 3HFSA 1WZNA 3B1FA 3UHOA 3U5TA 3KLNA 2GZDA 3EVEA 3P2EA 1VKRA 2ZIFA 2ZAOA 3W5UA 4YBRA 4NBWA 5F2NA 2V0GA 5EWJA 4FN4A 1ZNXA 3AYZB 1U2GA 1V47A 3H9JA 4QJ4A 4RK7A 4CNBA 1S8OA 4DR2B 2R6JA 5L3RA 2J6IA 5IF3A 1KVUA 1ZUHA 2HXGA 4F5ZA 2VXBA 2CVHA 3EJWA 3I61A 1IQRA 2MYPA 3L8FA 4HNRA 1M8KA 1XMSA 2VC2B 4ARVA 4IEIA 3EZ2A 3HLYA 1KVSA 2BHSA 1CLEA 5ITVA 4O4IF 3FLEA 5AKHA 4BEWA 1ISRA 1WUTA 4QVIA 1LBSA 1GADO 4TZTA 2QT0A 4WE3A 4YMIA 4EPXA 3AERB 2ZQYA 2Q9UA 1YZLA 4YRTA 2YZ7A 2XUJA 4R9RA 4IFBA 2CL6X 4XR4A 2XF2A 5F21A 2VHEA 2DP4E 2AN1A 5J40A 1XRRA 1JXAA 3CU5A 4BMXA 2BOVA 2XECA 4LYGA 5G0TA 1FTWA 1SVUA 3ANLA 1VIMA 3W4JA 1CHDA 4EELA 3RE1A 4QT0A 3H19A 1QYCA 4ARCA 4LOKA 4PZPA 3R3JA 4BMVA 4II7A 2H1IA 3RWMB 2Z1MA 5D1NA 1U11A 1GWNA 3HN7A 2YIDA 5DBEX 2FN4A 3JR3A 3UJPA 4D44A 3UBTA 4JVNA 2F3TA 4MWBA 1QXSA 2ZT6A 2XOKD 2AJLI 2AMYA 1J4AA 1VJDA 2I7CA 3QITA 2R1UA 2QX9A 3LRXA 3MJHA 2E82A 3IRUA 1M0WA 3M82A 3Q3HA 1G20E 4RSHA 5IJAA 5BXQC 2AUMA 4QICA 4CQMB 3DZ8A 4AJNA 4J1QA 2GB4A 5ECYA 1RI1A 4EY4A 1XPRA 1A5SB 2VBIA 1Z17A 2YWEA 4QRDA 2NSJA 3W2GA 3T7DA 1R8JA 4GM1A 4AWBA 1G8HA 2PLWA 4PS0A 5CNMA 2I6TA 1IY0A 1ISGA 3IIJA 3BWVA 2VDPB 2VZ9A 5GOTA 4JI3B 5B7GA 3VTAA 5ITZA 4NGQA 3B3FA 5EGNA 3SYNA 3ZY4A 1BC5A 3VR6D 3QTLA 4LS3A 1T8PA 1KH2A 4P3OA 4RA9B 3RASA 2BELA 3NEJA 1P7WA 3UAYA 4RU1A 2V6MA 1CUIA 1NQ5A 4R1LA 4ZO9A 5I6DA 1BEZA 3KEQA 3I9FA 2DFVA 5AVRA 3VRHA 4CLRB 2D2EA 2R6R1 3TLKA 3K0AB 1NVWQ 1UIMA 4R01A 5EZSA 1U0RA 4FCTA 1WHTA 4KQIA 4R1SA 1Z2EA 5ALTA 4WY5A 3RFCA 3WNDA 4K87A 4IGEA 3OU2A 5C3UA 3P9IA 4IHJF 3RHZA 1HURA 1LTKA 3CZAA 2BI4A 1EUCA 2QXTA 1E6UA 3GJ0A 3PNBA 4C8UA 3F9CA 1SKYB 4MAMA 2QTHA 2QY6A 5A9RA 4DDKA 1KAGA 2RB5A 1PLKA 1KEEB 4GMFA 2Y76A 4J76A 3EAQA 4TXJA 4FYJA 3WBFA 5K8LA 3GLGE 1H2HA 1D7OA 2JASA 3TZBA 4ES6A 3PNQA 3NBUA 3LC2O 4KFCA 1FF9A 4MQ5A 1Z26A 4DMFA 1MC1A 1KI1A 5KQRA 3BI1A 4M83A 3GZNB 3S7TA 1HSZA 3LL7A 1D4FA 5AQEA 2C5AA 4DKXA 2GHRA 4JZKA 2IPOA 1SVKA 1GIAA 3UJBA 3IALA 1MJFA 1YB1A 5E4JA 4Z8YA 3ZE2B 4HDRA 2HBRA 4K1LA 3UT5A 4FINA 3VISA 3T07A 4MQUA 1SRQA 2EOAA 1ZH6A 4K9PA 2Y0PA 1R0LA 4Y2VA 3CRMA 4C0WA 2YW2A 3WMRA 1YBAA 4U7PB 4YRFA 1XVIA 2BW0A 1OU0A 2YWGA 2FZGA 3C3PA 3EGOA 1PLJA 3VOTA 2QLJA 2O8CA 5TXGA 1MH9A 3AB3A 2AZXA 2ZYIA 1JA1A 4OP3A 3DE3X 1H2RS 4NGPA 1UMCB 5CT9A 1K98A 3MQ4A 1Y8QA 2C1EA 2EF0A 4R0VA 3TQHA 2PL1A 3DEAA 1L1QA 4FD2A 1FUUA 1ND5A 3IP7A 4Y1EA 2PL5A 2YC4C 3THRA 3HXPA 3VR2A 4MA4A 2H57A 1ECLA 1YIDA 1TECE 2C92A 1VCIA 3AEKB 1GXSA 1OXSC 3AKDA 3H3XA 2FE4A 3CB2A 3I52A 1NBHA 2Q4EA 1E6CA 1RAIA 3AV0B 4PSCA 2ALJA 2OR3A 2QQGA 4FYXA 2WTNA 4MICA 1GV1A 3RAFC 3NFRA 5DGDA 4IVNA 2CXTA 1T1JA 4II3A 4QU5A 4BE9A 1YQGA 2RH9B 1EESA 5FV7A 3A9TA 2R8ZA 1YC5A 5TB5A 4KPGA 4BMCA 4YAKA 3P5SA 3PUHA 4P8RA 4GL2A 3GLFA 1D8TA 1R3DA 2REQA 3I83A 1V5WA 4LTNA 3O4RA 4Q1CA 4QOGA 4YEDA 4LCJA 4EPTA 4ENTA 1E3WB 1V43A 4KQ9A 3KQYA 3LLUA 4B2YA 4BLVA 4KSCA 1JKXA 3C5VA 4XB2A 4MPDA 4XGIA 3SNHA 5JPCA 3SXPA 1T1EA 1L5LA 3L0YA 4RO0A 5D5QA 5DV9A 3UAXA 3AQ4A 3MWGA 1FRFS 3FETA 3JYQA 1TJPB 2XB8A 1ZOPA 4KX5A 4WZBA 5IXSA 4A4DA 1OBVA 5HMLA 3G68A 1U2DC 4V1CB 2WMYA 1T0BA 1P31A 1KZ7B 3JV7A 3N2IA 4L57A 1KK2A 4MGKR 1GZ3A 3AEQB 4C9VA 2B2CA 2EZ8A 2R7MA 2FSHA 3GLKA 4IUCS 2DAPA 4BVBA 4HXEB 1WO8A 2A3NA 4HTAA 4C6TA 4G9EA 4BYMA 1FQKA 4L16A 1RWQA 1GFZA 4XX1A 2C1ZA 4BFXA 3ON5A 5FL3A 3R7DA 1QTRA 3D6UA 3VVLA 1TKRA 4AQYB 1QV7A 3E4CA 1NBMD 2ZBEA 4TM8A 4XOIA 3DPIA 1NKSA 2CMFA 4OIMA 4EF4A 1VKHA 5TQ0A 2PQ6A 4UMEA 4BUZA 3GCDA 1KPHA 2X13A 4QIHA 3TSWA 4ZCPA 4MMXB 4DCOA 1E79D 4KXLA 3VUEA 4NABA 3CNHA 3Q6IA 4TLEA 4P4EA 3DBVO 3S40A 2VYVA 3GZTB 3WQRA 1DG1G 1PSZA 4ZZ0A 5EJGA 1SJ9A 3EX7C 3OFNA 1SVMA 3HH8A 4PAMA 1P0IA 2G9RA 4LF5B 1NSYA 2OO7A 3IAHA 1ONPA 1XVTA 3QVGB 4PLPA 3AVQA 3ZNQA 2H1VA 3B2NA 4ZQCB 4Z9BA 4O4HB 4B3RB 3U4CA 3HBMA 4JI4B 5J1TB 3DULA 2H4FA 1D0VA 1WPRA 2FRVA 1IYZA 3FXAA 1EK5A 3H5OA 3E22B 5FNVB 3SJBA 3U81A 3LDUA 3HJBA 5DASA 5INTA 4ZRMA 3ELDA 2POCA 4K9LA 4UDYX 4KMMA 4WLOA 3TOSA 3VBEA 1ATIA 3RTGA 5KYGA 4LAFA 4MW5A 4UVGA 5CLLA 2WAYA 1CS4C 1KO5A 4BV3A 2C2WA 1CB0A 4NK5A 2J5KA 3ZCXA 1PG5A 2C9ZA 2W6JA 5M2QA 3B7PA 3HVRA 4N65A 4C99A 1U7WA 3DL4A 4GFDA 3IESA 1DIRA 3VDNB 2EGGA 3ZCQA 4FP9A 4UE3S 4G8DA 1G20A 2GHTA 2MSDB 4L5IA 5JVLA 1F2TB 3T3IA 2J8ZA 4ZYTA 2V7TA 3MOGA 3QRWA 3RGGA 5KJEA 1ELOA 4XARA 4AT1A 1CEXA 5C31A 1SUAA 3WL5A 4L1KA 3NNNA 1AU9A 2IUUA 2VDRB 5KI6A 3VNSA 5SV2A 3REGA 5F33A 1ARZA 2GYWA 3V8MA 1V9LA 5JDCA 2VDKB 2Z43A 4CTKA 4RF2A 5TQJA 3GA5A 3PFKA 2R2GA 4KTTE 3KSBC 2XYRA 2C9MA 3EUFA 3GAFA 4X1KB 4LQCA 4CMIA 2PJUA 3GNSA 4U7TB 3DNPA 4IIJF 1U6JA 4BNUA 2QE6A 4XJSA 4U7GA 1JEEA 3IDSA 3UV6A 4UBKA 2B4QA 4V1CI 1KXZA 6REQA 5J43A 5L8VA 2R8PA 4XDZA 1KERA 2P2NA 1XL0A 3O9ZA 2JHCA 3R7NA 1T1SA 3G8CA 5I7WA 1WCXA 2WYUA 3A9VA 1PBNA 2ZT7A 4AG5A 2XKAA 3I9JA 4J0IA 4JI1B 4HVTA 4JP5A 1QZXA 4RPLA 3BAFA 3RKUA 3RYFB 1DZIA 1F2UB 1NJSA 4JR2A 2WA2A 4GDFA 4ASUA 4EL5A 3DXYA 3IAM1 4FKZA 4M36A 4NNOA 1KVTA 3X1YA 4R4JA 3ZG6A 3ZGYA 3RYCA 2HRQA 4PZAA 1RW4A 3Q7TA 4E51A 1PQYA 3GLGA 2CW5A 2WHRA 1G6OA 1LC0A 1C30A 5JEEA 5CB4F 2F59A 4XDGA 4ZQBA 3UB4A 4KAFA 1QFXA 4DNPA 5BSVA 4JBLA 4MHTA 3OJ0A 1EVKA 5H80A 2ADOA 3PPXA 1A9RA 2UVPB 3CGGA 4HHEA 4ARIA 4RWZA 5A9SB 4EKIA 1EZAA 2VPZA 2WILA 3SKYA 5B4VA 2TECE 4X1OA 2EFDB 1SELA 1CVIA 1XZJA 1ENYA 4XX0A 2GA8A 2Y9MB 4DLKA 2IQIA 3MRTA 2JLXA 3DEKA 3HY6A 3OIUA 4L85A 4R9SA 1S01A 3F8TA 1DRWA 3U3DA 2X5KO 3NHWA 2MR6A 3ABQB 3S4YA 1Y42X 4G2TA 4ND2A 3T54A 3FCEA 3VU0A 1KJYA 3DHEA 4MVJM 4O29A 1CK4A 4JT9A 4KXYA 4W4TA 1EVEA 5IAEA 4A8JA 5CCEA 2OR4A 4DJAA 3GRUA 1M7GA 2WIBA 1CUCA 4G0VA 4KWTA 4YMGA 5K45A 3HMQA 4J91A 1VE3A 2W11A 1NYLA 3MN1A 1MRNA 1QHIA 3K1YA 4PLGA 1RJEA 3FTCA 2BM8A 1DKLA 1KI2A 3LBIA 2CL5A 3KE8A 2HPVA 4YDHB 4AYTA 1P2UA 3LHFA 4PGGA 4XIGS 2B2XA 4N49A 1KA9H 3PE6A 1K92A 1RMYA 2AN5A 2KM1A 2AEMA 5GGXA 1IN1A 5EP2A 1Z56C 2VWGA 1I2CA 1VIAA 2P3SA 4LXYA 4B17A 3GROA 3ETGA 4WXYB 4TSRA 1E5DA 2B9VA 4JEUA 3ED1A 2OAQ1 4TXNA 5ALRA 2REOA 4DRZA 2H4ZA 3K1AB 3TTWA 2VATA 1KORA 2P0EA 3RQSA 1KJZA 2AJDA 4L73A 2GKOA 4BAGA 2P6PA 1WMDA 4HB4A 1Z4PX 2H1WA 2J5QA 2EW8A 3FZEA 3PWSA 4UZSA 2CFRA 1Y3FE 4OGKA 4MPTA 4FE4A 2IU3A 3HPRA 1DXHA 1AM4D 2QMHA 1FFXB 1KEKA 4LJKA 1YB6A 2XRMA 2IE8A 3THWA 3E9QA 2FDXA 3AINA 1IBMB 1CE8A 3RVLA 1ZISA 4I19A 3N3AC 3ESAA 1Z38A 2AFHB 3EWSA 1B6RA 3H04A 3Q3CA 3P71T 3FF1A 3PGLA 2FV8A 1GGJA 1CU1A 2JIZD 2QZSA 4RKEA 1KYYA 3GT3A 2B3TA 2ZE7A 1M8FA 4WZZA 4M2LA 3I1FA 3GEDA 1ZJJA 3OFSA 4KTVE 2DC1A 2QF7A 4LY3A 2R25B 1Z39A 3C16C 2KYRA 3SSOA 4AJJA 5EN4A 1RM4A 2XTJA 2QD2A 2RK3A 3ET4A 4N6GA 4PQYA 3R0QA 3QXCA 4I66A 4ND8A 3IQZA 2C7QA 2VYQA 5EAIA 4JQSA 2OUKA 1HYEA 3IEIA 2F1OA 2RCNA 1CF4A 5DGTA 4UTNA 5BPFA 4F4JA 4G41A 3E2IA 2ZRCA 3D5TA 1QYDA 3N0TA 3ZTYA 1NBAA 1HF3A 4NCBA 3JR7A 2OV2A 2X15A 3B8HA 3GEEA 3O38A 1G21B 5DHPA 5EVJA 1AGRA 2CCGA 3DHWC 3IMGA 3ZY5A 4UHFA 2ZTSA 5K0CA 3O75A 3KLBA 1UQUA 4HXGA 1LB1B 5JH7B 5B1HA 4Z1MD 1VPEA 4F3TA 4I7EA 4O2AA 3ZQKA 2WA1A 4N76A 2O8EA 1JSZA 4B43A 2DFKB 4IEEA 1LBEA 3HFJA 5DLYA 1O5TA 1JXQA 1RM5A 1V0JA 4P31A 3I2HA 1II8A 5BNIA 2IXFA 3EIOA 2HHJA 1H69A 1X74A 2PT5A 3BGDA 3STHA 5K0FA 5KQSA 4MVJE 1DBWA 1AUPA 1UKYA 1I6LA 2IF0A 4TL8A 1VMEA 1EK0A 2SHKA 2PJZA 4J4BA 4RL4A 3OG9A 3H11B 3IO3A 2ZUDA 4FFRA 4P7KA 1Q5XA 4B6JA 5AI5A 2LZ0A 2PVCA 3V6MA 1H2EA 4J7XA 2HPAA 2Y9PB 5ALUA 4FYKA 1H2XA 1N0HA 1WMFA 2JLCA 3WX0A 4KMOA 3FVQA 2WG0A 3OZEA 3HVKA 5EL0A 2OLSA 1ORIA 5F77A 2P4HX 1Z6XA 4AZ3B 1MHTA 3O8OB 5FWDA 1I1QB 2VAWA 5LYJA 4OQDA 4DM3A 3UPUA 3DVAB 5EFOA 1VJRA 1JAYA 3OJEA 1O54A 1CG6A 2WDPA 5C32A 4JYWA 2I4NA 3QQ5A 4GUDA 1QVZA 3COPA 1XQVA 4BN4A 4C0SA 5B55A 1U0TA 1G8GA 1NDHA 2CMKA 3H5LA 4URHA 4YI5A 2WEKA 3UK2A 1NP7A 4C4TA 1O95D 4O6VA 2QLNA 4D7AA 3LOPA 1IPFA 2ZDGA 3GFVA 1N9GA 3NTUA 4U2BA 5GM2A 3ZCRA 3NOJA 4Q4LA 4QG7A 1BU5A 4ZT2A 3GGSA 3VKUA 2VP4A 5CFPA 2NXEA 1H8ED 4H6VA 1QRUA 3GRPA 2HROA 1TQ6A 1SOMA 2J30A 3E15A 3ITEA 2IY9A 4FZVA 3DW1X 3BS4A 1Q0RA 5JRZA 3PNKA 1H0HA 2O9JA 4PFQA 3GR6A 1JWAB 2R96A 1Q20A 2VZLA 5EYPB 3LDHA 4JKYA 3TBHA 2I3AA 4L4RA 4ZT3A 2YWHA 3P2MA 7MHTA 1V1MA 4FXPA 4BJ5A 2PMEA 3MCAA 3LWBA 1JFRA 2IZZA 1K6EA 5FWNA 3S68A 2FPXA 2Q6OA 2P2ZA 2GEBA 4F71A 2PWZA 5ALWA 4PHTA 4RDIA 3TYXA 3GVPA 3X43A 5KYUB 4TV9F 3H7IA 4HMPA 3DZKA 1C0KA 3PR2B 1LI4A 3EG9B 3LHSA 3NBFA 5D29A 4NYIQ 5D5HA 1A69A 4RYLA 3OEWA 1QG0A 3O73A 2Q8PA 3DDHA 1OZGA 4HAZA 3ZK9A 3CKMA 3AHJA 1IQPA 2ZSIA 4V3BA 1ZP6A 3NHUA 1L5VA 2WIJA 4UVIA 1MA0A 3P7MA 2E87A 2RGRA 4MDYA 4PC1A 2R5NA 1RRFA 4RVGA 1EDZA 1I14A 2WF8A 3R44A 4D0GA 3KHTA 1TQ2A 1XK7A 2PV7A 1GNQA 1I3MA 3A10A 1WXHA 1FYWA 1ULAA 3H86A 2NU8B 4ZHQF 4PZCA 1AS3A 2G06A 3RTBA 1LK7A 1KE1A 3NHPA 5KYYB 3GCWA 1ZD4A 1H5UA 4N5MA 4PM4A 1NW9B 3F90A 3FUUA 5M5BA 3ZU4A 1B0AA 5CGZA 1NXJA 1A8PA 5KBYA 4Q7QA 5JHHB 3K3PA 3RABA 2C88A 4ALNA 4D8XA 1OBHA 5T3YA 1HDIA 1DP4A 1PGNA 4G8JA 2PVPA 3GWGA 1M2EA 1PL8A 1XMVA 4WT7A 4EENA 4XYEA 2FGKA 3GQBA 3NBMA 3PX3A 2WUGA 1GILA 1FB5A 4WDQA 4ZV4A 3I92A 4Z6KA 4PBRA 1WDLA 2JI6A 3ZK7A 3DWGA 4MW2A 1Q2UA 1OV4A 3CNOA 4HLDA 3SP1A 1UCFA 1DMRA 3H4VA 4B47A 2FPRA 4TWBA 1PSWA 1IJFA 5AJUA 1UINA 3OTOB 3BT7A 3A14A 4GO1A 4RLSA 4UAUA 2HLPA 1QIFA 1U81A 3MB5A 4J0KA 4ME6A 2QTGA 4DM7A 1K63A 1GTRA 3TFQA 1ZM9A 4M1QA 3ELUA 4AKEA 1GKIA 1MA3A 3AR7A 2ZU0C 2ZAYA 3RC2A 1VB3A 3VM6A 2X0SA 1AO3A 1MPTA 1TO6A 2P62A 3V4FA 1KSHA 2M32A 4MVJH 4MS3B 1YJXA 4JEIA 5I8ZA 3ZWQA 3I5XA 3V4RA 1OW3B 2HK9A 4A0FA 2X9GA 3TLZA 3MNFA 2IHJA 2R7AA 3NHYA 3RUEA 1HL3A 1NLUA 4WZ6A 2HK6A 1SK8A 1B1AA 1WXXA 1BSVA 3I6QA 3VX3A 4MCRA 3BKWA 1SIBE 3NNDA 3EOAI 1P4GA 5H5JA 3SJEA 2HQBA 1JG3A 4W5RA 2NQ2C 4YJ3A 2HA3A 4CEJA 1UWKA 2HM7A 4XYMA 3JQCA 4HT3B 1MZVA 3CRZA 1WD7A 3DE6X 3MSCA 4AWAA 1H2WA 5GJWC 4Q1DA 1ORVA 3LFUA 5CCDA 4QBTA 2G08A 3EYAA 2OCKA 4DMCA 5E95A 1KH3A 4WXRA 4M1OA 3WLQA 3DZFA 4FHGA 3JQFC 3M6VA 4FLMA 1HK7A 1EFHA 1VHDA 1YZGA 2Q5CA 3O31A 4V0QA 1ECGA 1GUAA 4GYJA 4NV3A 2WFZA 4BZZA 4MMZB 1GRCA 1NZJA 4GXRA 1EFVA 3QY9A 4TVOA 5K0LA 5T57A 1G8PA 5TVGA 1FBTA 1JDPA 4EY5A 3GHYA 3LQYA 2E89A 3BILA 2D8AA 1DNPA 1SCKA 2NZJA 3ESBA 4G8BA 3KOUA 3NG1A 3Q5GA 5E6UA 1AS0A 2FMTA 4EY6A 1UEXC 2Q5IA 5H16A 3EOZA 3KT0A 3EMDA 3AR4A 3I6ZA 4R40A 5DCUA 2HQOA 4MTLA 1K9SA 4MRRA 4YRNA 2XGJA 1SOWA 1VCOA 4E2FA 1PFYA 3EIUA 2FN9A 3FHLA 4ZEWA 3O93A 4YT2A 1NI4A 3JD1A 2DG2A 4NFHA 5FOXA 2NYVA 3E5MA 2I4TA 3TQRA 1U7UA 3DFUA 1KZYC 1WOMA 1XA3A 3KR1A 1QR2A 1NVXQ 1D1PA 3F2IA 4MVJA 4E13A 5I9BA 1N1GA 1U2TA 1SCBA 1UBHS 4I6JA 5JMOA 4X6LA 1L7QA 1XX6A 2PBZA 2GCNA 3D8UA 2BUCA 3PI6A 4TQAA 1OY1A 3D3JA 2FW7A 2PGNA 4G81A 5D1HA 4TZ0A 3JATA 1C1XB 3B1YA 1G5TA 2D74A 3DMDA 3DD5A 1LS1A 1U0OC 2GEVA 3EXHA 4LQGA 1K6XA 1RJFA 4K9SA 1ESZA 1G9SA 1SUCA 2CFCA 2UYYA 3G2KA 3JVVA 3OLCX 4FOOA 4X24A 1CY2A 2QIOA 3C3WA 3FTDA 3HCPA 3ZN2A 3JWGA 4QOJA 4NPHA 4BE7B 1DKUA 2M98A 4M0DA 2BF4A 2QUAA 5BNWA 4TRRA 1C3XA 2BEVA 5I4CA 2O2JA 2X41A 4HX2A 2GAOA 4MPJA 2JGDB 4DA8A 3OM9A 3PXBA 3ZHXA 2HA5A 4X7BA 2P91A 5FWYA 1ZX1A 4IIFA 5JDIC 1WS6A 3M1YA 3D3WB 2JD1A 1S5PA 1T24A 3GQVA 4OC2A 3BF8A 3L1IA 3CLRC 3O1HB 4PICA 4OHVA 2JCGA 4FDLA 4MYSA 1ZK2A 2WUVA 5M3BA 3WGJA 4ZGWA 1C7QA 1L8AA 4OFBA 3VPDA 4FYHA 2HA4A 2RGAA 4TX1A 4HVCA 1UFVA 1R6DA 5HUJA 5GINE 4OLFA 4DV6B 2Z1NA 1U2SA 1BIFA 1GUDA 1LTHR 2WR8A 2IZOA 2IEBA 2FF7A 2UAGA 3DR3A 2AYYA 3B3GA 1IIBA 1E3EA 4LHSA 2B8WA 4MVJF 5J4YA 4CEIA 5AI4A 1U8ZA 1VSUA 4ZXPA 3EAFA 1T2AA 1VJCA 2E49A 4ZQEA 3ZWNA 2VRBA 1A7JA 3OZBA 3A8TA 2Z2XA 3HXKA 7GPBA 2FZLA 2BEWB 2IP1A 2VXYA 3EVTA 5L3ZA 2DERA 4JA0A 4CPDA 1PR1A 4G0QA 3QPCA 4HQ6A 2JCYA 3CINA 4AJ2A 2X7XA 2HPZA 3WKCA 2MR5A 4YPVA 1WUIS 3L5OA 3L77A 1J99A 3DFMA 3MWYW 4ER5A 5CYOA 3LZCA 3PS9A 4H3VA 3VV3A 1J2JA 3G89A 3GAMA 2F48A 2PE5A 3K6SB 2Q62A 1S8AA 3WTCA 4H17A 4HNQA 2B69A 4I08A 5F98A 1GG8A 2KMLA 3N3BC 1TX4B 4HQFA 3COZA 5AYVA 1RI2A 4ZYWA 3MTIA 3A3YA 4FGJA 5K3EA 1NYTA 1TYEB 2A2ZA 2NTYC 3PG5A 4RD6A 4Y6QA 2VQEB 3HO8A 5IB9A 5A5VA 2RGGA 2W6OA 5IJ0A 1FDRA 4C9BA 2RKWA 1DHRA 4JP2A 1TXGA 4S3MA 4P4TA 3CG0A 3KAJA 3KYCB 3QPVA 2CUZA 1UKZA 1U4OA 3GXOA 2F64A 5CYPA 1LH0A 3T5CA 3TTVA 3WWDA 2OKCA 1HRKA 4GKAA 5JTTA 4N5IX 2C9BA 3K0FB 4CHTA 4I55A 3DDUA 4P5EA 1RZRA 4L5AA 3U1TA 5JMTA 2D5LA 1ZIYA 2ZKIA 4KU4A 3G8YA 4RZHA 3L01A 3QE9Y 3LPDA 1WP4A 5AJVB 2EQ5A 1QB7A 4DMUB 4ZHQA 2OV6A 1HSOA 3T5BA 1JPJA 3NIGB 3UH1A 1MJNA 1ENPA 4PAGA 1HFEL 1LY1A 2JLAA 2QVLA 4HN2A 2RH5A 2PSHA 3RIHA 3QVTA 2HH9A 1KRXA 1DL5A 4GQBA 5L7WA 4PHGA 1S3GA 3PC7A 4ZJYA 1RYFA 4G1CA 3SF8B 1ZC4A 5GZ1A 2AC7A 3HBJA 2O48X 2D5AA 4DCTA 1MNQA 3DNMA 1JEYB 5AM0A 1MIHA 1QHHA 4KN9S 1CJTC 1DIAA 1Z16A 4J1TA 2SECE 2VYVD 3IX7A 2UXBB 4YXWA 3ONNA 2BFNA 2VOEA 3QFCA 2E4YA 1P1RA 3T7EA 5IT0A 4WLEA 3WQSB 1N92A 2N1MA 4JHXA 3CT4A 2IYVA 4XJXA 2Z2ZA 1QYWA 1KI8A 4UDNA 4ATNA 5LP6A 1NM5C 2QLFA 4RV4A 3CUUA 1FFAA 2Q6VA 1Q15A 4Z3KA 1AXEA 1V4BA 3AW8A 4QU0A 5A3VA 5GVSA 4QGGA 4HCJA 3MSXA 1JE1A 2QRNA 3LRPA 4TSKA 4AY5A 1NYQA 1NVAA 4L5YA 4PG6A 4C4RA 1TQ4A 1Q11A 3FPJA 2OP1A 4UM9D 1TK2A 1L9KA 2XMSA 4I55F 1GL7A 4DT1A 4C30A 3VR5H 5EXEA 1TT7A 1GYRA 2YZGA 4MYUA 2C5EA 1QAMA 3QMWA 4YRJA 4R83A 2QSUA 4ZYUA 1PQWA 2C99A 3H6KA 3NI2A 3VJMA 3SAJA 3WFJA 4PHCA 1T9GR 2XPCA 1VE9A 1K7XB 2W6JD 3CZ4A 4NWIA 2P65A 3UY4A 5JNSA 3E9DA 4RIGA 1U3CA 2BONA 5IVHA 1UT5A 3FZGA 3WK8A 2PA3A 4CIDA 1EGMB 1NUPA 1VB5A 1ATZA 3KZXA 4MLDA 2OE2A 4M76B 3E3MA 5HQ3B 3TSOA 3GZ4A 3D5EA 4LRUA 3ZVMA 3MT0A 1SOAA 3OT1B 4M54A 2A88A 1KFKB 2PBFA 4C06A 4FT4A 1TD1A 4YMLA 3WL7A 2G9NA 3TTTA 3KJEA 2Q5LA 4S05A 1ULZA 2I2CA 1D2CA 1LPMA 4MEAA 2PK3A 1BE6A 1JLLA 3PT9A 2P27A 4MKIA 4OAOA 1L4HA 2P3QA 4WLNA 5CX4A 3DL7A 5IMBA 4EJFA 2FPIB 1YCFA 1XT6A 3KB2A 5JXIA 4YI3A 1USIA 1WY7A 5CTAA 2CXUA 1OD6A 2XEJA 1U8YA 4B7ZA 4F4IA 3P0IA 3LYLA 4JWKA 4B6PA 1JJVA 3WYCA 3IPAA 2W4IA 2G72A 1X9HA 2DH5A 4X93A 3ZH2A 1FRQA 3SYMA 2BEUB 1RPZA 2A14A 2JBJA 2MSLA 1O58A 3WL8A 3JQDA 3B1KA 1E5QA 1GZDA 1UZNA 1G5QA 3B85A 1BJRE 3DYBA 3IE0A 3TNFA 4Q9LA 1JH9A 1FP4B 4CHGA 4DDMA 4ER3A 2F17A 2MYNA 5LYYA 3PUVA 4ASUD 2PPLA 1BGWA 1RJGA 1LU9A 2XZPA 4B6FA 2D2IA 2WG2A 3SQOA 3AR6A 2P2SA 1G8YA 1G3MA 2VHTA 3G7UA 4AU1A 3JQBA 3OPNA 1QF7A 2ORIA 3PJFA 1E18A 1OXKB 4ZEXA 3VR5A 5EQJB 1RAHA 3RJMA 4C8AA 2OLKA 4QXRA 1PT7A 2RK6A 2G80A 4P34A 3TSZA 5AIBA 1F0YA 1M6HA 4BQSA 1O94D 1GM5A 3N39C 1CY6A 3VPCA 3K35A 1N33B 5DM60 2MSEB 3RVRA 3U26A 4D46A 3V1KA 5F1YA 3KQWA 4PTLA 5CT5A 1YFZA 1FFCA 4FCCA 1F3OA 2QBYB 1W87A 2W2NA 4L8FA 1EVLA 2BBSA 4PPYA 3Q8LA 4KGDA 3S70A 2NZUG 1M1YE 4IMPA 1J1ZA 1PYOA 2HLNA 5E2AA 3ZHCA 4EM6A 5C8VA 1THMA 1UDAA 4F5WA 5KJ6A 1IVNA 3NTOA 2YICA 4LYHA 5KU1A 2INGX 2BZSA 4GMHA 4L0DA 3NT4A 5LNK6 1FVXA 3ZBTA 4O8ZA 2A33A 4EPRA 1TIKA 4EYSA 2X5NA 3LIIA 5E2IA 3A1UA 3BFJA 3O3CA 3BULA 4BLUA 2AFIB 5EIOA 4DCSA 1ZHHA 4AICA 2JI7A 5E1MA 1W88B 2H00A 4UREA 5DM2A 1BOOA 3G59A 4DNFA 2HWKA 2H16A 2XNDA 2GK4A 2Y1CA 3CF0A 1XVAA 2WMNB 2VJOA 3PNMA 4TOIA 3T3HA 3ZE8A 4D96A 2LKCA 1FTSA 1P6QA 1SUWA 1BCRB 1E2JA 3L0CA 3P0RA 1JPNA 1WNTA 4TVKA 4WEOA 3C85A 5AW8A 2EWMA 5DLDA 1QRSA 2JGMA 1NMSA 3O4FA 4IW3B 3SFTA 4F11A 4EG6A 4MKXA 3S9LA 1D5CA 2HMUA 3A2NA 4P7JA 2ZETA 4UBNA 3O1LA 1NAHA 2EBHX 1DEXA 3HFGA 3NJ8A 2EX4A 3T3GA 2JH3A 1BFUA 2FMXA 3U7QB 5HRUA 1CJVC 1KDTA 4LHXA 3LSTA 3L1KA 4DLVA 3HRIA 2QJWA 2OG1A 4FMCB 3NVAA 4PZDA 5EHGA 5CH5A 2GAIA 5G4KB 3TAXA 4A2CA 1QBGA 2PUWA 3Q3EA 3VPBA 2YN2A 4AYWA 4F2PA 1U9YA 1JSLA 1XVVA 5JECA 3ZGZA 4A1OA 3K9TA 1ZJYA 2PGAA 4FIZA 7REQB 3T94A 3IDFA 4XGQA 2LW7A 1EFKA 2ZYRA 3WNBA 2A1TR 2VJYA 3HNPA 3PBKA 4FSDA 1FOEB 4HDOB 1EGQA 4L9SA 4UBMA 4UEQA 4QTYA 4WRRA 1YZVA 4BRSA 1LPNA 1AE1A 4UTXA 3P27A 4E5VA 4I1IA 3O1JC 2PEZA 2V6GA 1MGPA 4ARAA 1S3IA 2F67A 4UHBA 1EGVB 1X80A 1T4BA 1UF9A 3P0HA 2C4HA 3SG0A 1VHWA 4P5DA 4WBNA 2B34A 3A0RB 1BEEA 3I09A 3DV0B 3C7DB 2Q9BA 5MGNA 2IZ0A 1KC1A 1VKJA 1FMCA 1SAYA 1G3UA 2BJHA 2Q6KA 2WJ4A 3AI1A 4KAJA 4PZUA 3RAGA 3H5RA 1HG0A 1UBCA 2SCUB 3Q3VA 3RG8A 4CV1A 2NUPA 3P19A 4NJMB 2VEDA 1REQB 4NOJA 3ZUPA 2C82A 2JH8A 4Z9AA 2IDJA 2PVSA 2WTBA 3TTUA 2OZLA 1UEIA 2GVNA 3N28A 1QS0B 4D82A 1OBOA 3SSAA 4UCWA 3GJRA 4OHKA 4IIGA 1SUDA 5DYIA 4RJLA 3WLRA 2EW2A 1RR6A 4TLDA 5FFFA 2HCJB 3PCXA 1Q50A 3ZIAD 2ROQA 4G1BA 4NCKA 5LKAA 3FNFA 3FVTA 4KNYA 3JD2A 1LV7A 1XLTC 3P9QA 2YOFA 3W0LB 1PW5A 2QZZA 1K4MA 4HQOA 1T2DA 3H2IA 4MS1A 5CM9C 4BFYA 2V7WA 1B8NA 5ESWA 2PT7A 1HUQA 4HRVA 4IICA 2PL9A 5IFKA 2FZKA 3GJ8A 4BNLA 3G17A 4OF4A 1VRWA 2BT4A 2Y2UA 4LYAA 4INZA 1PS8A 5JV5A 4DILA 4OB6A 2YQ5A 1YF3A 1YZUA 3ACDA 3BCSA 1T8UA 1OKKA 3QHAA 2BE7A 4DR6B 1YH3A 3MCUA 1FTQA 1BHQ1 2C9CA 3SC6A 1IXZA 3OU6A 3JQGA 3LNCA 1H8HA 1QFMA 3AI2A 3FLBA 5CXSA 1JMKC 1V95A 3D6TB 1ZOIA 2R7LA 2BGTA 4KZKA 1U2DA 4KQEA 3IB3A 4WSOA 1YDWA 1JLHA 1M1NB 4YRLA 1P9NA 2QORA 3B3QA 3JQAB 1KO1A 4HLNA 3CLSC 4FOLA 4IV0A 3EGXB 4JBHA 4L22A 4PYNA 4QARA 1FFGA 2RAVA 4DDUA 1M2FA 4LOAA 2ODAA 1OFGA 2VNHA 4J2OA 1ZJ6A 4CDNA 4GBMA 1PEDA 2X8AA 4EF6A 5FUYA 4RK0A 3SXUB 4CM8B 4DARA 3DXXA 1NMXA 2Q50A 3CH7A 3T1OA 4OQZA 4Z3OA 1QRTA 1DAFA 2NM0A 3OCCA 3KUXA 4U39A 4WOKA 3A70A 5F1OA 4CTJA 5JAZA 1G1MA 4YLGA 5HM8A 2ZBUA 1ZKMA 1KKLA 5DWVA 5TE9A 1KMCA 2P4UA 2X8JA 3LBNA 4M9QA 1E98A 4IL5A 4BX8A 1H2AS 3TD6A 4Q19A 1W2WB 3LBYA 4EHHA 5CK5A 2ZB8A 3LVBA 4KN5A 3W7VA 1QP4A 1R88A 2B4AA 1YJ5A 1YJBA 1G8AA 3DM5A 4OHBA 4IGAA 1RS0A 1CJUC 2ZRMA 1JUDA 4P22A 3G2LA 4Q6WA 3R9IA 3KYJB 3LLMA 1CRQA 5BV0A 1F8YA 4YUZA 5JFGA 4DV3B 3I2YX 1I5EA 3Q98A 2NYUA 1NQTA 2ZBPA 1QPGA 2H7CA 4NARA 5AW5A 5LQNA 1Z6YA 3AVXA 4ZXFA 2AOUA 1Y3HA 1J00A 1WE2A 2P4EA 3CR7A 1T5BA 3NKVA 1C14A 3HY4A 4ZJUA 1C9JA 3LC0A 2GJSA 5H3HA 1MQAA 1V37A 4MV7A 2FJUA 1U6IA 5ERXA 2NPFA 1JDTA 4HP8A 4D45A 3OOEA 2RIPA 1N8NA 4JQOA 2W2KB 3W1VA 1GFSA 1O6GA 1J0XO 2V58A 4Q9IA 5AHOA 1D4ZA 4DY6A 3C6ZA 2IIPA 4OYLA 2O7RA 4TLAA 3WI7A 1T9HA 1RABA 3FAZA 2R1VA 1QHSA 2BFBA 4KIWA 1N1MA 2RHMA 5JYEA 1EZBA 1TCUA 4L7VA 1PDWA 1Y8CA 3O7WA 1TZCA 2I2WA 3ZWWA 4DY4A 1XEXA 4FD3A 3TCNA 1LPPA 4U2FA 1M1YA 3PEYA 2Z3ZA 1NXVA 3G8BA 4KRXA 4Q34A 3NYQA 3MCTA 5I48A 2PNJA 3KEFA 1QANA 1XYGA 5ECWA 3CY6A 3L0PA 3T8YA 3WLOA 5TS2A 4GPD1 3LCCA 3ISVA 2RHCA 3WGQA 1KYIA 4YP5A 2PM8A 1ITZA 2WE8A 2CVPA 3RS5A 4O3FA 4RHYA 4EVQA 5KQGA 5JD6A 1PTJC 1Z5PA 3IAAA 3MGCA 4BJ1A 4A0RA 1SR8A 1XTKA 2D3TA 3TPCA 5KYNA 2BFFA 4E94A 5DCLA 1MO4A 1ZGZA 3A1VA 4PFKA 4WKOA 2R6CA 3I30X 2PH5A 3H9UA 5BMVF 1SXJD 4GP6A 4Y0NA 1RZ3A 3O9MA 1V7QA 4W8HA 3P0EA 1G6HA 1NBIA 5FA8A 2LR0A 2HNKA 3J80A 3QEJA 1HM5A 2D2XA 4RZXA 4W5JA 3CO0S 1IJBA 3IMEA 3LGXA 1XLVA 1L5HB 1X8LA 1QE5A 1Z0DA 2AXPA 4YWHA 1SVSA 3WYDA 3VKFA 4W5WA 4W5QA 3RROA 1NZFA 1NY6A 5C35A 1CQZA 2QVYX 3G5MA 4NBUA 4TL6A 2PD6A 4A8TA 3WKEA 2X1VA 5JI3E 1X8JA 3H16A 3DDNA 2A0YA 4LZJA 2JI9A 1HT1E 5L4SA 1JB9A 2ZVDA 1ODTC 4B4OA 1EDBA 3NHZA 3VSEA 4MGYR 3TOCA 4N1AA 3WWEA 1V5GA 2B1JA 5KVVA 4TV8B 5EEGA 2OHHA 1SVWA 2LIVA 4QYSA 4XLTA 4WOBA 3LVRE 3UHFA 2XD9A 2JLBA 1OXUA 2LVBA 1IHYA 3BYZA 3PQ3A 4X8MA 3KD3A 1RE1A 1GFIA 1XMIA 5TX7A 4HVLA 5LJIA 1KS2A 3DKVA 3DOCA 2JBAA 3NKLA 4CM6A 3VVMA 3RIYA 3PIIA 2HIGA 1Q0HA 4QPNA 2ZJ7A 1DGQA 3AUXA 1YJ8A 4TYPA 1RFGE 3USES 4E09A 1YRAA 4L08A 4DA0A 2VXOA 3EN0A 1VL2A 3IDOA 4ZQFA 3SX0A 3LT2A 1NW8A 4LE0A 2FP4B 1MDBA 2C9YA 4JLJA 4KUEA 2QTMA 3ZOKA 3L3BA 1Q0UA 1U9CA 3Q7IA 2V7BA 3E70C 4EO7A 5KEIA 5H59A 2UU9B 4KXXA 4IFEA 4KGVA 3D6MA 1W30A 4YUVA 3OAAA 5ENZA 5EWMA 3UFXA 2PO7A 5ICEA 1TM5E 4RMHA 3KUUA 3WQBA 5A0VA 1B8UA 3ZK8A 3D5QA 2MP0A 3IPRA 4QRHA 4L76A 4E7OA 2A4KA 1R4NB 1ZNWA 4ZOQI 4URUR 2J87A 4F9FA 4JLOA 2FW1A 1COWA 3L7BA 2A35A 3UCEA 1B6GA 1S2GA 2R84A 3KFLA 5EJ9A 4D92A 5EOVA 4JI8B 2HJRA 1Q0LA 3M0EA 1SH7A 3I3SR 4OFZA 4YJ2B 2WRZA 4DYHA 3R4VA 4PE5B 4UVHA 2H5LA 2ODNA 3N2KA 3QELB 2XX3A 1MO5A 3UWOA 1ZW1A 3FWKA 5BQ5A 5DBGA 2HU5A 5I9TA 3EMVA 4OHXA 1Y6JA 4MVJD 3GAZA 3ND6A 3LHIA 3NM6B 1GAJA 3FOBA 1QP8A 2ADMA 2AH5A 3BJEA 4CTNA 1QB8A 1WX1A 5IEJA 3W5AA 4QUBA 3VKGA 1CIVA 1BZYA 1KI6A 2VBFA 1W75A 1IFXA 3A1CA 3VSAA 3WFIA 3I2KA 4R2KA 4YV0A 3FOCA 1GYPA 3COWA 1VYHA 1FXWF 1JT2A 3KAKA 4IX9A 2CV1A 5BQPA 2ZJ0A 4ZRNA 1EJBA 4IJUA 1AMOA 2BZGA 2YV4A 2WP0A 5LN1A 4FGZA 4EYEA 3R5HA 1EINA 1APBA 3MCZA 3QBTA 4FFNA 4GR4A 2JNWA 4DV4B 4HB0A 3FPGA 2G0AA 3ER8A 2EKDA 2ZJ8A 2PU7A 2OMKA 4FTWA 4B7AA 4DBLC 5BOSA 1AZTA 3WISA 5MDHA 2J48A 2JL1A 3KCNA 4QTZA 2GRAA 4R41A 1QHFA 3D54D 4CKBB 2O8DA 3GYBA 1WD5A 4CF6A 3GBSA 4GMKA 3RSSA 4LOHA 1AUQA 1UXIA 3FTNA 1TQHA 3GFFA 4GSYA 5JBNA 1F3LA 3TLGB 1P19A 4M9XA 1DQYA 5C9ZA 5IAAA 3TGPA 1OFTA 4D8UA 1KETA 4EFLA 3HCWA 1XRLA 3SBOA 3K15A 2C6GA 2DLCX 2DB3A 2HK7A 2WF9A 3N8HA 5IDVA 1EEHA 2IDMA 1USKA 1WG8A 2VSYA 4NX2A 3G23A 2PCJA 3JRWA 1YONA 3LG2A 2JVKA 3PLRA 4OC1A 3EGDA 4GM4A 4KBFA 1P1KA 2GN2A 4X6UA 4H08A 5DTQA 4DEXA 2ZYGA 3EFOA 4EGFA 1OCEA 3J7TA 2DUNA 1OF1A 2PZLA 1QAQA 4I36A 4YHBA 5FBZA 4MWOA 4LFBB 2RI0A 1L6IA 2HJSA 3Q6MA 4AX4A 4MLCA 4IQ8A 1M67A 4OMCA 3IB6A 4OP2A 1WTCA 3OQ6A 4UOQA 3SC2A 4BVKA 721PA 3IJRA 2Y1WA 5IPFA 2QMOA 3BXZA 2C3UA 1E9FA 1X1QA 1Z4IA 1GCUA 3EBPA 2AVNA 1UMKA 3KFXA 1XDGA 2A9RA 3MB8A 3OZAA 4JAVC 4RX1A 4UJ3A 1DAOA 1JV2B 1IBSA 4K28A 2OYCA 3KL2A 1TW3A 4K26A 4Q1AA 2HMAA 1ODKA 1Z06A 1QU2A 1NN3A 4RF5A 1P1BA 2R8EA 1GZ6A 3OY7A 1IOLA 4D02A 1QJ4A 4HAXA 2FR1A 3QF7A 4EITA 4LV6A 1YUNA 1Z45A 2HV9A 4HZUB 4LDNA 4LUCA 2I6SA 5IDYA 1Z2AA 3ZY6A 3DTVB 1NF8A 1SK9A 4R1NA 5LQSA 5EQDA 1XCJA 1GR0A 1AG9A 1L5KA 5C0OE 3DOHA 3TAHA 2YZNA 3IQXA 4PG7A 3ZEIA 5DLQC 4GYWA 4Q1FA 3BVPA 5EQFA 1ONOA 1IOZA 1IULA 2GTPA 3L4EA 3L6DA 1P74A 3LBAA 3LCMA 4HR7A 5A5GA 2GYUA 1SBQA 5YASA 1C5KA 4DYDA 2QRGA 3OC0A 2QRHA 4BKPA 3I9KA 1QVAA 1FDSA 3DTNA 4TYQA 2W6CX 1J7JA 3CHYA 5DW3A 4WK0B 3TXAA 1R5BA 4YUYA 1ENOA 4NECA 3ZDQA 1TLLA 4M1WA 2WF7A 4NAVA 3WLLA 3U19A 4Y0AA 2FX5A 4AWXA 1RM0A 3VNRA 3WJAA 3IBTA 3E1KA 4G36A 4CQJA 4O3MA 4Q66C 1IAQA 2A57A 2EW1A 3F97A 3H9QA 1RIFA 4Q7JB 3TQOA 3C87A 1GDDA 1P4HA 1Z0AA 1FYDA 2GHQA 3C6YA 1CY1A 4FX5A 2WWWA 4MWTA 5FADA 3FECA 2QD1A 3MBKA 4WLFA 3TVTA 2ATIA 4C3OB 4YXWD 4S1VA 1H6AA 4CT4B 4KYUA 2Y99A 4MB6A 4DIKA 4AO6A 1E20A 1FU4A 1UPUA 2RONA 3QU2A 1E2FA 2ZTMA 3BZUA 2NZXA 1PKXA 4OM7A 2GAAA 1MOPA 3P4XA 4V24A 4MKHA 1NR5A 4HBGA 5LQJA 3U31A 3NORA 2RH8A 1YI1A 2WU1A 1UXGA 2VTDA 2VF4X 3K73O 1Z2CA 4A10A 3GVXA 3GGPA 1FFWA 5KQLA 4Z4EA 4MUJA 3AFOA 1C0EA 2VHVA 3QTBA 4GLFA 1N4AA 4ZEOA 2XVXA 3IBFA 2XWJI 4DLUA 3VPSA 1Z28A 3IEKA 5GV7A 3ZC3A 4OG2A 5HQJA 1TB4A 3CWZA 2JS7A 2IIBA 4Q7KA 1XEFA 4ZP1A 3ABZA 3LC7O 3ZWDA 1CX8A 3NPAA 2WSLA 1QC5B 3FFBA 2HX1A 2FHPA 1COZA 3V4OA 3F5SA 2OGZA 1CY8A 3GEBA 2R7KA 3Q2IA 3OCJA 1PDOA 1G4UR 1RC1A 2FQ1A 4M8SA 4R81A 1IJEA 3IQIX 2PJDA 2PUVA 4MQEA 3H84A 3QVOA 2BFEA 4Q3CA 1CEYA 3W90A 2FR0A 3COSA 3D2LA 1LW7A 4RVCA 1HDCA 1Y37A 3RVSA 3IPYA 1GQFA 1XYVA 3G3EA 3IVMA 1I0ZA 4WKBA 3VHQA 5FLXA 2GWRA 3U3XA 1XA4A 2QYSA 4YIHA 3QVLA 1MC8A 3M1LA 3RSOA 3D3KA 4MCSA 5EJ4A 5AXBA 1TT5A 3L7IA 2WG1A 1U0NA 4HGPA 5BUQA 2MJLA 3NTVA 2WUFA 1E7WA 2YBDA 1G8KA 1C8LA 1GGMA 4GWGA 2CWWA 4KO3S 4MR8B 3PDHA 2G3YA 4N01A 3C3CA 4RM2A 3FOZA 5SYAA 4US1R 3M34A 3A37A 3JQ8A 3RFFA 1VYVA 2NU6A 3A7DA 1M0TA 4YRQA 1WUYA 1Q14A 1VC2A 1C50A 3LLVA 3HJTA 3IVCA 1FUEA 3DMTC 1KK3A 5K3FB 1SC4A 2QY9A 1UH5A 3AW9A 2DPHA 3AEUB 3D4LA 4OQPA 2BGJA 3GGOA 1E0SA 3FCYA 5JWHA 1A95A 3LQ4A 4QOFA 1S1MA 1Z37A 2HQRA 3AHDA 3QUAA 5AVOA 2VF7A 5AJYA 2WKRA 3PUZA 5IVDA 4PYOA 4QDOA 1WCIA 3E3NA 1K66A 1NFQA 1Q57A 2YJVA 4F04A 1UFQA 1TLFA 7MDHA 3ZHBA 4I50A 3M6WA 4MXDA 1C0IA 1ZVJA 3LV8A 5AVWA 3CF2A 1VG9B 1G2IA 2CZQA 1JWLA 4LEIA 1NF3A 5JHGB 2VEOA 3HU1A 3VJKA 4UQLA 4Y1RB 3VR5D 4MW9A 4N5DA 4LNHA 2V6FA 3UJ8A 5IHPA 1UQRA 2KX7A 4E0BA 3I32A 2ODEA 2QJOA 3BMXA 1U1EA 5F9MA 1SCUB 1YSCA 1ML4A 2P7HA 2MYTA 3N0VA 4JUFA 4YV2A 1V5EA 4QRIA 4ZI2A 1L8LA 2WY2D 2YXPX 3V2GA 3IVAA 2HCTA 3G5UA 3QVXA 4KXMA 4NULA 5T67A 2E4UA 2AW3A 1I01A 1UBOS 2HJWA 4KQFA 3O8LA 1TIPA 1ZGGA 4DIDA 2ZIVB 2ST1A 4NU5A 1RAEA 3FGNA 2ACKA 2AIRA 4LXHA 3QPAA 4G6ZA 1P2VA 4H6PA 4MJ3A 3TRHA 1PNRA 3P9KA 1EAYA 1RNLA 3CYFA 3LT0A 2CNWD 4LDJA 4CO9A 1AS2A 2QD5A 4O59O 3EVAA 4TRNA 2F7SA 5IKXA 1BN7A 2I99A 1YKGA 5DNDA 2GR9A 3RS4A 2QRJA 3WL6A 5A1JA 4P36A 3ILVA 5DK6A 2BPOA 1WXDA 3AKZA 4ZV9A 2XUZA 3LCUA 3SY8A 2QN2A 2AUNA 2GCEA 4ED9A 2V4ZA 2RGYA 2SKEA 4IIXA 4E88A 5DMHA 3NXSA 1XLWA 3RFTA 2NTVA 1XMOB 3JZMA 1VKZA 2ZI9A 1UBSB 3NUGA 3DHYA 5TPZA 3W79A 3LC1O 1EQUA 4I50F 1E96A 4YVFA 2A0WA 5AKGA 4CT5A 4JCCA 3SQLA 4ZMSA 2Z0MA 1A8HA 3KOMA 3PC2A 1RAAA 3GEMA 2NSDA 3N75A 3QXJA 4KCGA 2DZDA 2PXAA 3OO1A 4N3NA 3QENA 4YRBA 3CVYA 5SY4A 3OKCA 2FTKE 3CPHA 3IOBA 4MIOA 3ZQ4A 1GTL1 3NBXX 4QGAA 1T5SA 1YAHA 2VDMB 5H7XA 1WXQA 2VP2A 1BG6A 2X2FA 3DMNA 4BMYA 3N0RA 4QPPA 5JD4A 4LWZA 1G5HA 2QW1A 1PR3A 1VM6A 3BL8A 2EKBA 2WLSA 5HF9A 3RV3A 1DS6A 2N47A 3IUNA 3IYLW 4DNXA 5C4MA 5HW0A 2W5UA 3G88A 2MU1A 3HSKA 1KWGA 1OIWA 3RRZA 3PQCA 3QTTA 5K0ZA 2AHOA 3NUZA 3QKUA 4JGIA 1N7IA 3FBTA 1SCAA 2P0YA 4K86A 3OQIA 2JEOA 3ZXYA 4OUDA 4JXKA 1ICEA 2OCLA 2VA9A 5JDIA 4FWIB 1VLVA 2BP7B 3CZ5A 3MAJA 4NC9A 4E14A 5F35A 4NU0A 3WV4A 2D2FA 5ITZB 2O1SA 4AJ1A 2V6JA 2ACWA 1NUAA 3M6FA 4GZ3A 4S12A 5K0EA 2WFLA 5JJKA 3I9OA 2R0QC 4I5DA 5CX1A 5ENDA 3GFSA 4J4TA 2CJWA 4ZV7A 1VE6A 1ODFA 1KJQA 4U2DA 5KWIA 4D3DA 3K0KA 3X1DA 1V4VA 2K2QB 3GOHA 1WHTB 4OATA 2DKNA 3GLIB 3ZXUB 2BBTA 2FMFA 3E1SA 4JUBA 3FEEA 4BUCA 2Q4OA 3K9FC 5B1EA 1FP6A 1BAPA 1R8YA 1W4AA 4LZZA 1KY2A 1R5OA 4ZVRA 3SDZA 5HIKA 5AJHA 3DP9A 3FSGA 5SZJA 3WWZA 3ER6A 1C4WA 3KJQA 4EUKA 5L4LA 3MGKA 1ZUNA 4XQCA 1M76A 1O0CA 1L7MA 1U0EA 1XQWA 2UV8A 4ZVSA 3FI0A 4V0NA 4X45A 2QTRA 1CF2O 4L4YA 3Q9NA 1YZYA 2LCIA 4C05A 5KYXA 1SC1A 4N0EA 4W9YA 4TMYA 4XLLA 1ULTA 1WQ4A 1OFIA 3PENA 4NOMA 4O5AA 2R3SA 3QKRA 3V33A 5I8PA 1OKKD 1SURA 3TX2A 3UT0A 3I6YA 3M6XA 4KFUA 3UT5B 5KZMB 1HR0B 3A05A 3OIFA 3ZLBA 4I9GA 5C5IA 3D3EA 5FFNA 3BL6A 1VSBA 2OSVA 3E58A 4DWWA 4CZ1A 4UEJA 3GNTA 1V26A 5JNVA 1YR6A 1T2UA 3OE7D 4LFAB 5T7BA 2WVHA 5BP7A 2J9FA 2QB5A 5HNKA 4IG4A 1K8ZB 1I13A 3UJAA 1DCTA 4YJDA 5KO2A 1DWUA 2WIGA 3ME5A 4RKFA 4YROA 4C7VA 5B7NA 3GN2A 3JVUA 2VK4A 4X94A 2D0IA 2VH5R 1P2TA 4JI7B 5G3ZA 4HEJA 3R7BA 1PZFA 3QEBZ 2JGIA 2BDUA 3S1LA 1E9CA 2NV6A 2OPHA 4AUEA 4P80A 1TGVA 3ILHA 3NHLA 4EMTA 5GIPE 2JPDA 4JYBA 1ZW6A 1GXSB 1Q1BA 3TOXA 1XU9A 4E4TA 4EL0A 4O08A 4X66B 4QYIA 1VLLA 3FTEA 4EVIA 1F5SA 3EDQA 1T1IA 4XDHA 4BNIA 1PR0A 4A36A 2E4ZA 4NZNA 5JXJA 4GQAA 2P41A 3GELA 3OIWA 5AKKA 2WV7A 1IL0A 1X3SA 3EISA 4YRPA 4CDMA 5C7IO 2H85A 2ZJ4A 3M2PA 3KDSE 4ZO7A 4ZAGA 3RBUA 1ISJA 2VYFA 3SZRA 4DCGA 4CR7A 1NM5A 2OGTA 5CDHA 3GLFB 3WFZA 1OXXK 2REQB 4W1SA 1PJ2A 3VJRA 5JYDA 3LP5A 4AY3A 1LJ8A 2GF2A 3AUJB 3DZGA 3F3SA 5MGBA 2EX0A 2CJYA 4LBWA 1BVYF 2LGJA 1XU4A 3R5TA 4RACA 1L5FA 3UXMA 3R3UA 4WNAA 4MMYB 3QUTA 4WZBB 3A6PC 3HP7A 4URZR 4EZEA 2VT3A 1DDOA 1QYVA 3TMAA 3MRSA 3QEMB 1U0GA 1INLA 5AW3A 1FFSA 3LKBA 4ZDIA 3EVFA 5LMNB 5BW8A 3O21A 1MPXA 3MT9A 3QZUA 2HJGA 1W5BA 1TEVA 4C6TB 3UJHA 1AUOA 5BV2P 3CNNA 4QL3A 1GL9B 2VYNA 4QVKA 4KHPB 3QKTA 2E48A 2SKCA 4QOSA 4CMEA 5K03A 3EPKA 4EAAA 1WABA 3PEWA 4UM7A 4E32A 1SXQA 1KI4A 3IFSA 1JPVA 4YYEA 5CJJA 5TQ0B 2ABWA 3JSXA 3ZS9A 3DKIA 1VJ0A 1MAVA 3B78A 4CM5A 2IS2A 4ANFA 5CLGA 4Y6GB 5H3CA 2GOYA 3L7JA 2JHGA 4G85A 4LMAA 3S8MA 3TM5A 3U56A 3GMDA 2JJ2D 3NNSA 3SFVA 3V3TA 1X7WA 4PO1A 2C8LA 1N4DA 5BWOA 1CYEA 2YDXA 1ZH4A 3F6YA 4C4YA 5B4TA 2GJ8A 2HEGA 2QUZA 2MT9A 3RWOA 4G1FA 1RXYA 3PJRA 2JLRA 3KJZA 2GXUA 2OCYC 2EBWA 3AHFA 3U3ZA 4M1TA 3ONVA 3SNKA 1DIBA 2RHBA 2R1TB 4RGQA 4BASA 3U6BA 1I4TD 3WLEA 4ZICA 5IXYA 4J1SA 4XYLA 3BHIA 3H13A 4XPIB 4PCUA 1Z88A 2COEA 4DLPA 2VR1A 1FP2A 4BN0A 1EM8A 3TAUA 5JSFA 1K3UB 1PUJA 2ZYAA 1NRJB 1CC1S 3BD8A 3GCGA 4NSNA 1XE3A 1Y3CE 5C8YA 3IT1A 3TNYA 1N6RA 3O83A 3WK6A 5J5VA 2VP9A 2EBUA 5ICCA 1Z7YA 2CLSA 2VRCA 3H4TA 4HI0E 4JVLA 4OBXA 4QXPA 3WB1A 2HFJA 3KIPA 3F6PA 2NQTA 4X7PA 2BHNA 5IBCA 5BT9A 4MAFA 4QFCA 3VR4H 4D4GA 4L6AA 3G79A 1L5ZA 4JLUA 1L4BA 5DHSA 5L9AA 2OQVA 2G0NA 3WMEA 2D1SA 2YWFA 3FA2A 5B2EA 4XVRA 3PSHA 2JHPA 4K5QA 1P1IA 3R8CA 3GIDA 3RS2A 4K6OA 4DZZA 2HSEA 1XD2B 4N0QA 2HHHB 3BSYA 3T9AA 1H9CA 1LPSA 1JWBB 1BN6A 3U0VA 2LPMA 5FYDA 3W7BA 4CMIB 1AQJA 4FUTA 1P44A 4BIIA 3M70A 4FQ7A 4OL9A 3HACA 3ZCPA 1F0NA 1XHFA 1DQRA 2ZRFA 5DEIA 4A0QA 6REQB 2IZ7A 1W19A 4EABA 1J0EA 1PT8A 1T3LA 4B40A 1J2TA 1YE8A 1W94A 2JZCA 1SM4A 2XQVA 2F00A 3MOSA 5D51S 4CM3A 2DLNA 3IHTA 1WMBA 4EFDA 5CA1F 5JVDA 2CGEA 2P5TB 3UGQA 3UAWA 3RYCB 3RLIA 4L51A 3R0JA 5EHNA 5IBQA 2V98A 1VGVA 4EJ0A 1COWD 3OQJA 4MWEA 4MUBA 4GI3A 2OHXA 4KGXA 3TTYA 4LJ6A 5JAUA 1C30B 1G63A 2GARA 4LFCB 1L5YA 3G0CA 3O0DA 2JVJA 2DBRA 2AZDA 4FOTA 1FFHA 2FF5A 2GM9A 2LNDA 4J4HA 3X3HA 3W5SA 1EP1B 2PBRA 2JIMA 1ILWA 4CM1A 2C00A 1B00A 2HWUA 1EBUA 3G1TA 1S9HA 3H0KA 2V9CA 2W8ZA 4B33A 3SIRA 4BEBA 2XW6A 1V16A 2AZTA 3L6BA 2GA9A 1WSWA 1ZMRA