4IIYA

Structure of mccf in complex with glutamyl sulfamoyl inosine
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
335
structure length
335
Chain Sequence
PLLAAPLAVGDTIGFFSSSAPATVTAKNRFFRGVEFLQRKGFKLVSGKLTGKTDFYRSGTIKERAQEFNELVYNPDITCIMSTIGGDNSNSLLPFLDYDAIIANPKIIIGYADTTALLAGIYAKTGLITFYGPALIPSFGEHPPLVDITYESFIKILTRKQSGIYTYTLPEKWSDESINWNENKILRPKKLYKNNCAFYGSGKVEGRVIGGNLNTLTGIWGSEWMPEIRNGDILFIEDSRKSIATVERLFSMLKLNRVFDKVSAIILGKHELFDCAGSKRRPYEVLTEVLDGKQIPVLDGFDCSHTHPMLTLPLGVKLAIDFDNKNISITEQYLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords MccF
publication title Structure of MccF with substrate analogs
rcsb
source organism Escherichia coli
total genus 120
structure length 335
sequence length 335
chains with identical sequence B
ec nomenclature ec 3.4.-.-:
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02016 Peptidase_S66 LD-carboxypeptidase N-terminal domain
A PF17676 Peptidase_S66C LD-carboxypeptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Class I glutamine amidotransferase-like 4iiyA01
3.50.30.60 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 LD-carboxypeptidase A C-terminal domain-like 4iiyA02
1ZL0A 3GJZA 4EYSA 4IIYA 5F5XA 4H1HA 5JYBA 3G23A 3TLYA 5FD8A 3T5MA 5F9MA 3TYXA 3SR3A 4E5SA 4MI1A 5K99A 2AUNA 3TLEA 4MJXA 3TLGA 3TLBA 2AUMA 4IIXA 3TLGB 4E94A 1ZRSA 3U1BA 4JVOA 3TLCA 5F1YA 4INJA 3TLZA 3TLAA
chains in the Genus database with same CATH superfamily
4TT3D 3SVZA 2C4KA 4A0FA 2PT9A 4BN5A 2PUJA 5A4AA 4WX2B 3V1UA 4TL6A 4MHTA 1H4QA 3ETLA 3PS9A 2FMXA 4C7BA 3SOPA 4AJ2A 4UTNA 1V5WA 3LX5A 2QN3A 2NT3A 2BFOA 3L6UA 3MCZA 2JKZA 1JBKA 4J0DA 1R8SA 4OHCA 5AMXA 5CCDA 2EXXA 5FLKA 4B7AA 4DM4A 1ZK2A 5I7RA 4C86A 1QWOA 3N2GA 1YB2A 4JC4A 3COSA 4LJ6A 1QR6A 3HJCA 3IMEA 1YNSA 2ET6A 3BE4A 3E9DA 4C30A 4PZEA 2WJ3A 1IB6A 3IOMA 3NVMB 3Q3VA 3U1TA 4HGOA 1T1IA 3SP1A 4QVIA 3KKMA 3V4RA 1JQ5A 2CHFA 1OX4A 3OX3A 4V0KA 3BCRA 3R8CA 1TI7A 1BSVA 1RFGE 3HUEA 4FUTA 4HFJA 1T13A 1Z75A 4F7WA 4W7HA 3L5KA 3K73O 2IIQA 3OKAA 5B7NA 5BN1A 1JDPA 4RA6B 4U9HS 3RFUA 5L4NA 5FHQA 2QP9X 3QMWA 4UNPA 5EG5A 3T54A 4KDCA 5JANA 5EJGA 2Q6VA 4DBVO 4MVJD 4O33A 4M21A 1QRSA 4GRDA 2VCYA 2CJWB 4JJIA 1T2AA 4Q4DA 4LQCA 1X8KA 5JAUA 2AV6A 3TQFA 1RM4A 2JLVA 2ZZMA 1VE7A 1IJFA 2AOTA 5IVHA 5KC9A 2C6PA 3L1JA 4FFOA 4FOLA 2Z3ZA 2C78A 1UFRA 3SZMA 1ZNWA 1NC1A 4DNPA 4J1SA 5CU7A 1DQRA 1SWVA 2YWBA 1FF9A 3GR6A 1IOZA 4WZAE 4J7AA 1MC8A 3LX8A 4K1LA 2JFYA 4YDRA 2I4RA 4JBNA 3DEJA 3QPCA 1UXHA 3BFVA 4MLCA 1F2UA 3TRJA 3X2FA 1IQ0A 1V1MB 3AVYA 4G81A 4RD4A 5CDFE 1H2XA 2BKEA 3E22B 4EY8A 4FBGA 5DKFA 4DKJA 4J16A 1NXJA 5JG7A 1TGYA 3GUZA 2OXRA 3RUEA 4ZOCA 2C0CA 3IIIA 1VP9A 4GBED 5JJLA 1E3WB 2FZLA 3AF0A 4RZIA 1IM2A 1DCFA 3VHQA 4HQ0A 5IC5A 2WA2A 1D2HA 2F9FA 3LY5A 1Z17A 2Z83A 3BB4A 3R3ZA 3BEDA 3HB4X 3RQIA 1TZ2A 3ZU3A 3SZOA 2NPFA 4TVKA 3TSWA 2JGJA 2Y92A 5AVVA 2YC2C 3VR6A 1UKAA 4MGKR 2CL6X 4XGQA 1ZLYA 3QX3A 1EDBA 5ALIA 2HF7A 4CM4B 2EQ5A 3EXEB 2C7PA 5HQ3B 4KXXA 2CMFA 5KAPA 1S96A 3EZ6A 4MS1B 5KHOC 1EXDA 4CEHA 2EKQA 1RM0A 3MTGA 3RRJA 1I10A 2QUZA 1JBEA 1G4UR 3K16A 5ALMA 1KMMA 2H08A 2VJBA 3TSAA 3OD5A 4HV4A 2IUFA 3CVOA 1Y1PA 2G5GX 2HJWA 2XUDA 3I30X 2IPLA 3QPAA 4WGFA 3JALB 2W2LD 1U0BB 4AAYA 4OC2A 1M8FA 3LD9A 4TROA 3F8TA 3ZQKA 2PKEA 1SRQA 3UJHA 3VDQA 3C74A 4JIMA 1AKEA 3KEMA 1ICEA 1RMQA 3EVNA 1TCUA 1W5BA 2JIMA 4RNCA 2C5QA 2QL7A 1OLOA 3DLTA 1R16A 3EUWA 5IYZF 4EAAA 5C1BA 2HW8A 1EFVA 2KI5A 2P62A 2V4ZA 5JJBA 4IWXA 4OIFA 1ZNQO 3VH4A 1CZNA 1XDDA 1LF0A 2CE2X 2WPDD 4B32A 1J8FA 1V3TA 2I3AA 2PYZA 3UANA 3R7DA 3LPMA 4F9TA 3MRTA 1OH8A 1XDZA 3ZHVA 3OLZA 1F9EA 3TZLA 1Z47A 2PMCA 4RM2A 3WFZA 4DV3B 2UYQA 4RETA 5BO5A 3QYAA 4YY3B 3GFFA 1E7RA 3PPIA 3B12A 3WOHA 4EGQA 1EGVB 2P1RA 1GNRA 5DGTA 3F7OA 4RE6A 1G0OA 1FX1A 1WSDA 4XWOA 1XC7A 4UULA 4DMUB 4KPUA 4GPD1 1C9DB 4IDHA 1CZRA 4FMDF 2R7MA 2Z4SA 1QHFA 1DC6A 4FFBA 1NXOA 3RIEA 4MIKA 1AQNA 3KZ1E 1T6NA 1MN6A 1OT3A 1DT3A 2O3UA 4Z4CA 1A9OA 1MW9X 3UAZA 4OMFG 4CKYA 3RROA 4P44A 3H2JA 4BTLA 1SHLA 2FR0A 1VG8A 4H60A 5ALOA 1VG9B 4ZP1A 2PAAA 1IG3A 7AT1A 4KXFB 1EEHA 2FG6C 3PCTA 4L28A 4LZNA 5K2OA 1AHIA 3D4PA 1C0LA 2ATCA 2NSDA 4MKHA 1ZGAA 4W9NA 1GPAA 2NN3C 3D6AA 4PRKA 2NUTA 4U7DA 4MR7A 5KYKA 1DI0A 2W6ZA 1Y5RA 3DQPA 2BTEA 4TTIA 2VDJA 1BU8A 1R6TA 4UUBA 4BO3A 3OJFA 3WB9A 3HO1A 3U7GA 2PWBA 3MGBA 1IEQA 2R6R1 4J3FA 1I4WA 4UM7A 5CNIA 3HCBA 5KVVA 1R4AA 3HCRA 1G20A 1A95A 2F9LA 4OLHA 1S1MA 5COQA 2C29D 1CUHA 4MUBA 5KCZA 1Y5MA 3Q0TA 2PUAA 4YREA 1ZZGA 4AY3A 2P4QA 1NR7A 1P4RA 4PZDA 3JTEA 3UMSA 1CB0A 1DNPA 2CJWA 3ZCSA 5LKRA 2A6PA 5I4BA 2ICAA 3D7HA 3BK1A 3K0BA 2P40A 4BUCA 1AX9A 2CYBA 2C2MA 3AIOA 1Q6YA 1ITZA 1K89A 2WJ6A 3AR2A 3K9GA 3FE2A 1U28A 4PZ9A 4TMKA 3ZY6A 3RUAA 2P1DA 2YRWA 4ES6A 3H04A 2LDBA 4ZN6A 3SEAA 1Z16A 1AM4D 4IIVA 3WLQA 3H9QA 4MQ4A 5TY0A 1JIIA 3DBHA 1KI6B 1ZI9A 2IYYA 3PP8A 1QHIA 1TMKA 3K9WA 3O3OB 4NE7A 4O4HB 1MAUA 2H1IA 5K45A 1XKXA 1JTVA 5CTJA 5KUTA 1N25A 3OZEA 1EA7A 4TKLA 3DOOA 3QF4A 4BO4A 1JLKA 2XTZA 5EN4A 5F1OA 4D0NA 5JZOA 2IZ0A 3OTGA 4FT4A 3SYLA 4KVAA 3PXAA 1EE2A 1KK1A 1L6RA 1REQB 3ZVLA 1UMDA 4LG1A 3IXMA 3NW9A 4FONA 1IXRC 4QXOA 3U37A 1Y98A 1UM8A 2GWRA 5DN6D 2YQZA 3TLXA 3PFWO 3PE3A 3RNOA 2XTAA 3TPZA 1LDEA 2W5UA 2XUKA 4EG8A 1J4AA 4LDAA 4X6LA 4I4TF 2FAXA 2NWQA 2UYGA 1BQ3A 1YCHA 3B48A 3HLTA 1UMKA 3KSZO 2V74B 1J7JA 3WTBA 1W87A 4NU8X 1IM8A 2PX5A 3UGQA 4CM4A 4BAZA 2FZWA 3GH1A 3X1JA 4AS1A 5K3SA 2GUWA 3ZE6A 2UDPA 1QHNA 3LHDA 4IQFA 2ZM5A 4G4IA 1QZUA 1YHNA 4LDJA 2EIXA 3A28A 3WWOA 4TMVA 2DUMA 1FVHA 3K1JA 4N6GA 3RUFA 4F6CA 3JQ7A 3RK0A 1GKKA 2H8GA 4I1UA 3LQKA 4KXWA 3H2BA 3VSBA 4EGAA 2Z5LA 2OV2A 3I32A 1KI8A 4DLUA 3KBBA 4IZIA 3UWSA 3UPTA 2Y8EA 2YCBA 3PLRA 1KJ9A 1TA0A 1BWRA 1SUDA 1VHLA 2QW1A 3F96A 1XKTA 3GLVA 3LRPA 4U2FA 3RWBA 3VDRA 3ZDFA 1EIWA 1A1SA 3ANSA 2ID8A 1QVZA 2FPGB 1JIXA 4DQ0A 2JLZA 4HCJA 3NKLA 1ZM7A 2FQQA 1TKRA 4QBFA 1X7WA 1WCYA 5IK2A 3ZCXA 1D2EA 4KN5A 2ZP1A 3GCXA 3AKCA 4TLLB 1K08A 4WUTA 4D43A 4D57A 2UVPA 3G0HA 4H7IA 4ZAYA 1GPH1 1R5JA 1NSFA 2NAPA 2EVWX 2X7JA 3EMBA 5L6LB 1K7EB 3ST7A 2B9EA 2EJVA 5ITSA 3PDWA 4PM4A 3RBVA 3HZRA 3URMA 4CMEA 5JCXA 1CHDA 3GLHE 4C7MA 1ADCA 2W98A 1POXA 4BE9A 3T4PA 4D4KA 1ECGA 4P4GA 4INJA 3A6FA 1QFMA 5AKIA 1QVVA 4R5MA 1QP0A 1Z15A 2BEWA 1NM5C 2ZS8A 2I03A 1F20A 4C1BA 2ZUFA 3GBPA 5AVUA 1OXKB 2QRUA 1X8XA 4K0KB 5C7OO 1KOGA 4L07A 5CB8A 3RJ9A 2JARA 1ENPA 4TT3A 3WL7A 1UBRS 1OI3A 3C70A 5L3SA 2W2MA 3HH8A 3AI3A 3EGWA 1V3UA 4KU4A 2ZCVA 3F0TA 3JQAD 3OE1A 2C5LA 3QEMA 4K9NA 4RD3A 1PEDA 4C0XA 4HT3B 5JV5A 2GP4A 2OWEA 4RIEA 2IPXA 4YUWA 2VJYA 2XOEA 2LZ0A 2V55B 3SZRA 2F8TA 4C4ZA 1XKLA 1X13A 3OKFA 5EQJB 5JMWA 3EPKA 2VPTA 1L1FA 3EZFA 4J3JA 3JSAA 1Z5OA 3QEOA 3T0IA 1T9CA 3LF2A 2DWCA 1ZL2A 2I87A 4YP5A 3ROQA 2AB0A 1L5KA 1JEJA 4CLRB 1O08A 5L7WA 3PZBA 3KASA 3RNLA 4OKNA 2FDCA 3RASA 3F6BX 3G49A 1C14A 2A1UA 2EP7A 1G5PA 3C4QA 3PHCA 1P4AA 5I9TA 1SOWA 5JATA 1ODCA 4M55A 1AXEA 4LI3X 5IN5A 1MZVA 3QSGA 3LBIA 4GOKA 3UJDA 2P9JA 1P4HA 2Y0EA 3OQNA 2FSVC 4HH3C 4LAFA 4M98A 2XUAA 3O2JA 1JPUA 3R09A 3N7TA 2P41A 1U2PA 1EM8A 1JR6A 3E0XA 1Q6ZA 1WCIB 4MVJA 2HA2A 2PM8A 4WLEA 1NT2A 3DF7A 4YT4A 4RD0A 1VJ1A 4Z9AA 2HQBA 1TJNA 2QPOA 4X84A 1P91A 3TO5A 2C1XA 2QZ9A 2WW8A 3QQ5A 3T41A 5CFRA 1LRJA 1ZDMA 5DDIP 5JD5A 4P4BA 3W6PA 1KJQA 2WUGA 5E8JA 5JJCA 4RH0A 2IY8A 5LP6F 4OHXA 3V7YA 1HNNA 2FWBA 1ACJA 2PX2A 1D09A 4WDQA 1UBKS 4PZCA 4PGGA 3WGYA 1QLHA 1K0FA 3QKSB 4K9MA 4W82A 4M8LA 3TRKA 1EWQA 5BURA 1WD7A 2NTYC 1BA2A 1CQPA 3RDPA 5LSAA 2JKYA 4IY1A 5C8YF 2RKOA 1SOAA 4HVTA 3L8CA 4WEQA 2BSQA 3SZ3A 2J9RA 4ZYYA 2Z9CA 2ZYHA 5FULA 4BLRA 5DP1A 1UBUS 1X1SA 1K5HA 4HB4A 3U1BA 5BQXA 3FFWA 4UFOA 4BOYA 4YPVA 1IZ8A 5CGQB 1Y3CE 2DUNA 4DSUA 5A5GA 4UCXA 4QARA 2Q5IA 3DNMA 3BDIA 5HUHA 1U0GA 3PKJA 4JU8A 4Z7OB 3QH4A 5IU6A 2XE6A 4CM6A 1EI9A 4TX1A 2DX7A 2EIHA 3IKLA 4G5QA 3QTLA 3ZJUA 4CV3A 2GN4A 1QQTA 1AHPA 2ODEA 1HTWA 3B6IA 1A2QA 1D4OA 2JLRA 3L79A 4MV7A 5DCLA 4AZTA 4DNXA 2AXEA 3DOEA 1D2RA 2JH9A 1RIIA 2OGUA 3V00A 4MV9A 5EXEA 2OEPA 1PR9A 4DLSA 1CUYA 1C3XA 1Z2NX 4M8IA 3GPDG 4TL7A 3LC2O 4HB0A 3S4YA 2QK4A 1WM1A 3NT4A 1OPRA 2VP0A 1V7ZA 1E2HA 1YBHA 3M1IA 5D3MB 1PFQA 1P1JA 1G38A 4U2KA 3GLQA 3OY2A 3QK7A 3ROKA 4HAUA 1FVXA 3E48A 4OMEA 1EWKA 2I80A 2IW1A 3F5QA 4GI7A 1KDPA 2F8LA 3Q8WA 1KZ6A 4GMDA 4MW5A 2XDAA 4QUBA 4TZKA 5J40A 4EECA 1N6HA 2QD2A 3ETJA 2WP8J 3P2KA 2JI9A 1TUEA 3A6DA 4G8CA 4RVNA 1HZZC 1TQHA 2NU8B 3ZOKA 5B4VA 3IHWA 4QXRA 1AK9A 2X7HA 3BXFA 4OK5A 2WPDA 1S3IA 2X0NA 1M1XB 4PZZA 1KYXA 1QZXA 4JB8A 3WBKA 5ELMA 2P9CA 3SS9X 1PUIA 1W52X 1PYGA 2YJTD 5K51A 5K6TA 4EARA 3OU7A 2H4WA 1TTTA 5E0KB 1T5TA 2IKQA 4Q6WA 3PFBA 5TMEA 3ZIDA 2J4FA 2DIKA 1U3FA 5KYGA 1R0CA 4HWPA 4JI4B 4QO8A 5T3UA 1MX9A 3D6JA 2WQ7A 1DCMA 3DZHA 1XU4A 4G4JA 5DM0A 3A4IA 4R2JA 1NX6A 4IKPA 1U5BB 3PUIA 2F17A 5LP1A 4AD8A 5SZJA 4P3OA 3HZOA 2Q8PA 13PKA 1N0IA 4V0OA 3LUAA 4QJBA 3C5WP 5C4GB 3Q15C 1ADBA 1C3OA 3LXRA 4IG4A 4BKOA 4N76A 2FRVA 2HPVA 3M2PA 5AKYA 2JPDA 2JBWA 3C3CA 3K9LA 4KIUA 4FW8A 4L27A 5C80A 5IC4A 2ZIXA 3TR6A 2NSJA 1GNSA 1GZ4A 5BYBA 4C0SA 2OCBA 3BL5A 3FB4A 4C7XA 3H87A 1JHUA 3IUMA 1XE3A 4D02A 4IILA 1GYRA 2YIVX 4PXSA 3IXLA 3OJEA 4EPYA 4ABYA 3UQYS 5I5EA 1MC4A 2IFTA 2GKOA 1OC2A 1GRVA 2QJWA 4L73A 2GFHA 4UCQA 4BJ1A 1CE8A 2WJZB 1DOAA 4H7DA 3VRHA 3TQIA 1F8XA 5FOXA 2EEZA 1DEHA 5K5EA 4YAWA 3HPRA 1A9YA 2HBYA 4LQGA 2N42A 4AJPA 2X5KO 3W2HA 1Q0PA 1EB9A 4INPA 1DZ3A 1FYFA 4WA7A 3DQZA 5CA0F 5DHUA 2LV8A 4HNAB 2GJAA 2O1WA 1PSDA 1T34A 1UKZA 4LXIA 3CLHA 3RSSA 3DMDA 3U4AA 4LDQA 1O95C 4O0LA 2VWPA 3UOWA 1E69A 1NR5A 1TCCA 3BMOB 3QXGA 1H0SA 3V2IA 4KQMA 3U44B 2C8KA 4C89A 5I51A 1M8JA 1KL7A 5I9NA 5JASA 2IBMA 4GE3A 4M1EA 1CJCA 1YQWA 2VTVA 4M1OA 5ICMA 5C1DA 3WIBA 2JZCA 2QGFA 3UO8B 5IKMA 5FFMA 3GBVA 2EFYA 4C6HA 4A5OA 1Z7BA 2ZT5A 1D4FA 1B41A 1JHPA 4KACA 4XQ0A 1DJLA 2HYDA 5CTAA 5D5QA 5AM0A 3WI7A 2GZMA 2JZOA 4V2IA 3JATA 2XUFA 4AJHA 3T0GA 1KRWA 4HLUC 4LF4B 1G6OA 2N1MA 3WRXC 4EPWA 1DQYA 1WEHA 1DWPA 4OQ4A 3RHSA 3LQ1A 1ZUD1 4DMMA 4QYIA 2H7CA 1PJAA 1QPGA 2Q3CA 4LMAA 3VKWA 3W8RA 2I4TA 4MJXA 3CZ5A 5HYVA 3CPEA 3KQHA 1QM5A 4DUZB 1JHAA 2HXSA 2Q5JA 3EGCA 3WLTA 1ZRSA 1IZ9A 1X7YB 2UZ1A 2ZTVA 3B8EA 5DN6A 5HF5A 3ZI0A 3A6PC 4MVWA 4WESA 4XI9A 3FZYA 3O0DA 4M88A 4X1OA 1F7VA 3WVNA 1WZCA 2PJRA 3HRKA 2CMDA 5HKOA 2C5FA 3UMCA 4D46A 4X8MA 3WL6A 1CNFA 2HHAA 2LUOA 5SYMA 2G6BA 3ZBTA 3L4SO 1UR5A 1TYCA 3T9DA 3DPIA 4IR7A 5ALEA 5DT9A 2VJPA 3GEHA 2X0EA 1QFZA 4QGGA 3W2GA 1JSLA 3R7NA 1OFIA 4WBXC 1EX9A 3MT0A 1I1HA 2XXAA 5FI1B 1UT6A 1QO7A 4YAKA 1HKHA 1MQ9A 1R9GA 2OG1A 3K4PA 3AEXA 4HKTA 4JI5B 3NOOA 1WEKA 3CLSC 2ZFUA 4GMFA 1RRKA 3MA0A 5B4TA 3D7NA 4G0WA 2RH4A 3K9TA 5EMJA 2FSPA 4RLQA 4D9HA 4TXMA 1F8YA 1RYFA 3G2JA 4C0QC 4WVFA 1YF3A 1QRTA 3BDAA 3KOXA 1YZNA 3D8BA 4HLDA 3R3HA 3VNVA 2CXXA 2QQGA 3ZWYA 2ORWA 1XTJA 2RHLA 1FSZA 1VKHA 3HQ4O 3R1IA 4W1SA 3TR5A 3P9CA 4IXMA 1YIAA 2Y1WA 2X1LA 3CJTA 3E1KA 3MC1A 4WNYA 3ZC3A 4JNKA 2PKQP 4G3XA 1YSCA 3HPQA 4ZCIA 1Y63A 1XCOA 4JEMA 4RYLA 1BZYA 1PQUA 1L3BA 1WUHS 1YJXA 3L7NA 3MNFA 2C9OA 5ILGA 5D85A 3TM5A 3JQGA 3HP1A 4BJ3A 4F3YA 2OAEA 4HB3A 1UM9A 2IC5A 3FPJA 1F4VA 5WRFA 4QYXA 3NU1A 2IW3A 1Z4MA 1OT5A 3AIKA 3EGXA 4KHZA 5M3BA 3GRAA 3JS5A 4OA8A 2D8MA 4QPCA 1GG5A 2VDUE 5A5DA 5IPFA 4R2KA 4EHAA 2B6HA 3GWGA 5CLJA 5JDCC 2VS1A 1UQUA 4NV1A 4O4JA 2R84A 4E30A 4M76B 3WGZA 4B9AA 4J6EA 1HDCA 5I7AA 1RWPA 2O2SA 2PAFA 5CRIA 3QVGB 3RC7A 2CIJA 1PJZA 2WTAA 4AC9A 3FGZA 1M72A 1AS0A 3I5MA 2VAXA 7ADHA 1IOLA 2Y1FA 3MSXA 4JXJA 4ALLA 3JWPA 5C1IA 4RPHA 3ETEA 4WOPA 3LGSA 2P90A 3O0TA 4FGLA 4OHBA 4EY5A 1LNZA 3DD1A 5CVVA 2FMIA 3P2IA 3H86A 4FUQA 3ZHUA 3NBUA 3BK7A 3E8MA 3K70B 1N33B 3PCRB 4NULA 3VOAA 1MAAA 1H6BA 3I2IA 3D8HA 1ABFA 3FHLA 3R5JA 2FFAA 4LZJA 4W6ZA 5KYUA 5DNYB 2WJWA 1MG0A 1ZISA 2B69A 1X1DA 1QKJA 3JQAA 4ID3A 3RVJA 1PKEA 2GBCA 1Z74A 2I34A 2YJ6A 4IHJF 4Z4FA 3FWHA 3DS8A 4LZZA 1S9HA 4BP3A 2WD7B 4K9OA 1FFWA 3FYSA 4NS1A 2GA8A 3QELB 4XB2A 1E98A 1DBVO 4XQGA 4YRJA 3KDSE 1YDHA 5SYNA 421PA 5JEDA 3JAMA 3KE9A 2O8CA 2GSWA 4HDMB 1FFGA 6Q21A 3IVAA 2EZ9A 5DTJA 2Y0CA 3EQ7A 1XVLA 4BP9A 2SKDA 2WJAA 1Z2OX 3IT2A 3WSVA 3RU2A 1EP1B 2DR0A 3SIPA 1SZJG 3LVBA 2AFVA 4XQEA 5CLHA 2R1ZA 3QFRA 4AY5A 3DF9A 3ETGA 1W88A 1DP4A 1GP2A 3JTMA 4QOEA 1ND5A 5DVZA 3WB1A 2YXNA 3BMOA 2QN6A 3WFJA 1NVAA 3CW8X 2PGLA 3MB5A 4NFHA 4MQFA 2HHHB 3B82A 2CNNA 4DCSA 2WJIA 1AZWA 3ZD7A 1OU4A 3AFGA 5DHQA 1EK1A 2ZT8A 4JL8A 3WNCA 4YR7A 3I0ZA 3WC4A 1AT1A 5BVGA 5I9MA 2OOTA 3I9KA 3OJCA 4PBRA 4YA6A 4DC1A 2PXCA 2PO5A 1W5AA 2J85A 2HZ7A 4LRSB 2AJBA 5ALRA 4AYXA 4P80A 4IH1A 3WAGA 4CM9D 1UKEA 2H2IA 4G0QA 1RS0A 3ABZA 5FLYA 3JWIA 5NULA 4CG3A 1YQGA 1GL7A 2YVAA 1DQSA 2QTVB 3SDBA 3TLGA 4IO0A 4ABTA 4COOA 2X3UA 1N7JA 4NP6A 4TKUA 2JCGA 3IT1A 2WWHA 2HSZA 3NIFB 4NAUA 3VX4A 1T9KA 1V8OA 3GUYA 1JMVA 2IQ5A 4AS3A 1HE8B 1O9HA 4WCFB 2EBUA 2XECA 3NFRA 2DUJA 1YKSA 3OECA 1QQ6A 3PUJA 4E7OA 4CCAA 4UOQA 5ELLA 1SB9A 3VNBA 1CZOA 3U40A 1Q3HA 3EW9A 3FY4A 3UTDA 4TYPA 4JR0A 1F51E 3HRIA 3V80A 5K09A 4QQ8A 3IIJA 4XE5A 1HYHA 1PJCA 1SU8A 3OTIA 5AFSA 1FU4A 2J9FA 2X42A 1U9JA 3VYSB 4LYDA 4P81A 3W5HA 4MR9A 1VKRA 4LXHA 4CCWA 1Y89A 1BJRE 5HIAA 3CF0A 3BMQB 2PTHA 5D8DA 2RJNA 2FX2A 5F4BA 1P2FA 4LF9B 4L3WA 1SVOA 4PBSA 3EASA 1GPLA 4H35A 1CJKC 5DB4A 2YQ5A 1P4GA 1OZGA 4HX2A 1T2CA 3Q8KA 4OK3A 5SY9A 1U8ZA 3LUHA 4AI6A 3F98A 4C85A 2QA5A 3OQ1A 3KJXA 3N75A 4QHSA 3OTWA 2NVOA 2I6SA 1PLKA 1UP4A 1IY8A 2AN1A 1H2YA 1CRPA 4V38A 1T36A 5FUYA 4I1IA 2ID4A 3NC0C 2K7ZA 1BVUA 3H9UA 1ZMBA 4H3VA 1E6MA 1JYFA 3FVVA 3G0CA 4UAGA 2BHLA 2EARA 3V8QA 4OC4A 4D0LB 1VCMA 5K8LA 5LP6C 1EINA 2CHUA 1XWFA 3WYCA 2HRDA 2QSUA 2VJNA 1YH3A 2BR4A 3BMCA 4KI7A 5EWMA 4ZAXA 4YMLA 2YJTA 2NZ8A 5HK9A 1N2HA 2BFAA 1TT5B 5GJCA 4BX2A 1T0PA 3A06A 4NCAA 4JEIA 3TGWA 5IVKA 1I7PA 2A2ZA 2QQ5A 2WSBA 1C80A 1J7KA 5CM9C 3TNYA 1NRIA 4WUVA 1EG2A 3HBNA 2ZJ6A 1FDWA 4YGXB 3KJHA 3RHFA 3VAZA 1B42A 4XB6B 4LFBB 2EWVA 2N3ZA 2Y76A 2UUAB 1ZG3A 3LY9A 5HMLA 3RRFA 4CI9A 1VSTA 1P7YA 4WXRA 5KAMA 1G55A 3C3DA 4EHJA 1JPVA 1NN1A 2OWDA 4HP8A 4WWHA 5G0UA 2DG2A 3W2EA 2C2OA 3IMKA 5AVJA 3WDKA 2CLFB 1JV2B 4JVSB 3RC8A 5LUAA 2ZBPA 2ZAYA 3RVLA 2VKQA 3JZIA 4B8WA 3KOOA 4CUKA 3C16C 1II0A 3IAFA 5HG0A 1QVWA 3WWYA 3WJAA 5D84A 1AUXA 1BOFA 1MEOA 2PUTA 3QY0A 3KB6A 1Z8HA 1T35A 4JSRA 1JIQA 2ILTA 1DU4A 4PLPA 4N5HX 1FPQA 3ETDA 2ZYVX 5K3FB 2A9VA 3SJGA 1F12A 4EFLA 1PJRA 3DNFA 4AECA 5JD4A 4XXHA 2FPLA 4XX1A 4AZ0A 4PO3X 4XJXA 3ESBA 3K0HA 1XZKA 1YGPA 3DOHA 3E8XA 4W7SA 1QUEA 3T7DA 2JASA 4ONEA 4ZOLA 5I7OA 1JI3A 3HKEB 3UUWA 2TRSB 4F4UA 4CLRA 3GJ0A 2GM5A 3I3SR 1D1PA 5DFAA 3F9RA 2GPTA 5E1BA 1CJBA 1FMCA 3HDYA 4IQ4A 1XWWA 2ZWOA 1LCIA 1Y3FE 3QE0A 3R3YA 3BJZA 2RBKA 3SDZA 3BTUA 4Z7QB 2DPHA 3FUXA 1KFKB 1GAEO 4W1QA 4OEHA 5FWDA 1U0SY 4N01A 4MRVA 3BIOA 5TPWA 2HMTA 5EJ5A 1Q0TA 3VGJA 4R2XA 2A4KA 2JLXA 5E2IA 4NJEB 1AZSC 3TSZA 3U4GA 1XAHA 1G3UA 3BBLA 4JP1A 3ZTYA 4FDVA 5JNWA 4R8MA 3WX0A 1IRIA 1Y4SA 1CVLA 1ZJ4A 4I8IA 1BXGB 4GAEA 3VO8A 3GFQA 2CFIA 5EIHA 5IT4A 2DE0X 1UAAA 1BGXT 2VRNA 3LUKA 5BSWA 5J2TB 3J81A 3ZVRA 4UTOA 5CPFA 5E4YA 4BEWA 4QOJA 2QMEA 1LWNA 1X1CA 3F3YA 3C7TA 3GARA 4KDFA 1MXFA 3UXEA 3ZU4A 3D6MA 2B30A 4WOCA 3ASUA 1J8QA 3INGA 4IP0A 2E85A 4XD2A 2MT9A 1QYWA 2LCQA 1JQJC 1MB9A 4PYRA 2GBLC 4XB1A 8AT1A 1E5QA 1OA1A 4OF4A 1XEWY 2IE8A 3L49A 1M2NA 1T6BY 2NACA 2XUPA 1M1NA 5EKUA 3LGAA 2HMAA 2R96A 4L15A 3AEZA 3GJYA 2CVQA 3AJ9A 2EFGA 1XMXA 2RMKA 1I0IA 4QNNA 2ZRPA 1KBLA 2PH7A 2JK1A 3EG9B 3D3NA 1ULAA 10MHA 3DMYA 2R2GA 3IEXA 2JFWA 4HNHA 5K8JB 1FTNA 2VDLB 3GUVA 1TQ8A 3GGJA 3MOSA 3JQ8A 3AM5A 4MICA 1H2AS 2I1QA 4GP6A 2GPAA 3JYOA 4BVBA 1QHXA 1K6EA 3B8HA 3FOWA 2GASA 4O3FA 3ZWNA 3ANMA 3MWEB 1YR2A 3MCUA 2IXFA 1NVVR 2GN1A 2IYUA 3GEPA 1YWGO 4U7FA 2Z8YA 4EX6A 3I8OA 4QGFA 4UUQA 3QXHA 2ZT7A 1BKSB 2IHBA 1NTOA 3V3TA 1I2DA 3CZQA 3OKCA 1WY7A 4KFRA 4KBYA 3IAS1 1K86A 1RRGA 2MP0A 3CR3C 1GTG1 1U5CA 3I39X 2DU8A 2KSQA 3QKTA 3S2EA 1E9CA 4RORA 4IDDA 4AKTA 5BSKA 3OZSA 4UU8A 4DABA 2ZQYA 1U0JA 1VDZA 2VHYA 3DYIA 4K9QA 4PO8A 1K92A 3R6TA 4IYJA 4RL4A 5IUJC 2VDOB 4UEQA 3LECA 3L1KA 4DKXA 1C1DB 4V0LA 5A05A 1NL3A 4XGRA 1VFNA 2VDQB 4E2YA 1E6LA 1M33A 5IABA 4W99A 1C9YA 4NH4A 4LXTA 5JE8A 4YRNA 3V7FA 2UVDA 3I9JA 1M2OB 4QDXA 3WLJA 4R6XA 1AS3A 2ZRBA 4J6FA 3TW4A 5J5VA 3THXB 3PC6A 1WF6A 2O1SA 1BCSA 2ILVA 4Y6PA 1RZRD 5IVIA 3I9V1 2XA2A 4RQTA 1H6AA 1W34A 1V2HE 4FKMA 3G9QA 5B3JA 4BC0A 3MN1A 1PR6A 4JASB 2QW0X 3DKRA 3PUHA 1LK7A 1OAOC 3E1GA 4EEXA 4ENQA 4RVSA 1A2OA 1CIJA 3C24A 2KW5A 3HLYA 1EUDB 3MB8A 4MPRA 1JG3A 3RC1A 1KTIA 4R05A 3SYNA 1KDYA 1KY4A 1SVUA 4EJSC 2W58A 4QAQA 1QHEA 3HEAA 4PLHA 4B4DA 3H6GA 2J1LA 4I5FA 4J91A 2C98A 2O07A 3NC1C 1TU3A 2VNIA 1V4VA 3NGXA 4IDNA 4UUAA 3OE4A 3BMNA 3BHIA 3Q6IA 4TQAA 1L8XA 1NLZA 4BB6A 2CGEA 2D2EA 2X0DA 2WZBA 3IALA 3QKIA 1M6VA 2H5LA 3GFPA 1WOMA 4G5RA 3DOUA 3CLVA 2HGZA 1IFXA 2FX3A 2WIFA 3EZ9A 4LMBA 1CS4C 3WAKA 5LYJF 3MS4A 4UM9B 3PUKA 3UHAA 3I3OA 4JC8A 3DXXA 5LU8A 4ARSA 3FMIA 1WETA 2PBLA 4FHCA 1NI4A 1QGOA 3AHIA 2YYYA 1UJBA 3M4XA 3B85A 3QXJA 3HZZA 4ZQIA 3NNDA 5FBLB 2D7JA 4LVCA 4QQNA 2RIPA 3RS3A 3T0FA 3T8YA 1NU8A 5I9LA 1IM5A 5BSRA 1ZH8A 3KAJA 3PTLA 1VJCA 2VJMB 3N7AA 1QQ7A 1TQ4A 2B34A 4LSMA 2WUDA 2WTNA 3DDOA 4FC6A 4MW1A 4U1RA 4UDXX 1QZ3A 1A9SA 3W2TA 1FLVA 3LM8A 1THMA 3TW8B 1EB8A 1DCTA 1KQ3A 3C6XA 3EH2A 3LVRE 4ZVPA 3PHBE 1NPTO 4JOSA 3ON5A 4WEOA 2PO7A 3C6BA 2IVFA 3FMOB 1GZ3A 3QGMA 3W9BA 3ZU2A 4CM9A 1EESA 4RCYA 3LZ6A 1R27A 1E92A 1KJYA 3I6ZA 1PGJA 1U7HA 2V7EA 2VBCA 2GJSA 3SZGA 3V9PA 1JXOA 3VHLB 1M2JA 3IX7A 3QKRB 2RGNA 4H4DA 4MWDA 2VOJA 2ZJOA 4HAYA 2G8NA 3VDNB 4G1BA 1HLGA 3M6AA 1BYIA 2X14A 2PUHA 3KWLA 1E0AA 1L7DA 2ODQA 4TMYA 5EIOA 5HNKA 1LJLA 3HKDA 1TT7A 3RIXA 5KYXB 4S05A 4DLZA 2H5JA 1UDAA 1V4BA 5JYDA 1JA9A 1ZESA 3QPVA 4R0MA 3CHYA 5KYWB 4D5EA 2V0GA 1MQSA 3Q7TA 4PZPA 1I14A 2EZCA 3ASZA 2R1VA 4NMHA 4UD2A 1DQNA 2OORC 3HUDA 3B5JA 5HP4A 1QRUA 3L05A 1JDBB 4U3JA 2B99A 5LA6B 3TCXB 3O4IA 2D5AA 1QDEA 4QELA 1P4JA 1FP7A 1XDUA 1HT1E 1XRJA 2W11A 16PKA 3DZGA 4YRLA 5B5SA 7YASA 5AW7A 1TF2A 3IMGA 2O4CA 1C3JA 3A11A 5BMVA 1VZ3A 4N0QA 2G0TA 3A3YA 2HOQA 1A27A 4YBZA 2L69A 4CQLB 1LVHA 4JYBA 3LIPA 3T3MB 3UJNA 4XLTA 2E1RA 3LLUA 4BLTA 3D8RA 4Z7JA 521PA 2QTNA 4QBTA 5G53C 1QNLA 5BPHA 4GBGA 3BVPA 2QV0A 3SJBA 1W30A 3OLCX 1NVEA 1ULSA 1C9MA 1MT3A 2HEIA 1N0WA 2OCYC 2V6BA 3G1WA 4HQFA 2XYPA 4GX0A 4I36A 4UD6A 5EE5B 2FUG6 5J59A 1XVAA 1PW7A 3KVNA 1Z2CA 3AFOA 1N2CB 3PZRA 4F3NA 3WGIA 2ETVA 2B6NA 3KELA 1H5QA 4H7EA 5JO9A 2IZZA 1NUPA 1M5UA 2OHGA 5ABPA 3JVDA 4M9ZA 3C6MA 3UWKA 3TDNA 4TRNA 1AQ6A 4B0OA 2IH4A 2CLEB 4ZZ1A 1TTHA 2FNAA 4MVJM 4BMZA 5DMXA 5AD1A 2LD4A 3AONB 3KWMA 5BV0A 5FLXA 3ND6A 4DF3A 2YY7A 1SK8A 4U9UA 3AO0B 1OAKA 4Y6SA 2Q4EA 5JYBA 4FEEA 3LYAA 1YQUA 5IXSA 4QGBA 1EX1A 3G85A 1W96A 4YCMA 1YOBA 3MTEA 5FADA 1J70A 1LTKA 3S40A 2HTFA 1YACA 5CK5A 3D3JA 3BE6A 2W4QA 2Y1CA 2GZ3A 4DW8A 1GNPA 1W36B 1KGDA 4HUQB 2QG4A 1NY6A 4E3WA 2XKBA 3OAAD 3KD2A 5EKSA 5EXSA 5KWVA 4F38A 3KJZA 2XDQA 4CU5A 1SCQA 1DQPA 4J90A 9ABPA 3OLVA 2ZB4A 2QD5A 1R6BX 1LW6E 4M53A 3KQYA 2E5LB 2NQ2C 1ACLA 1RWWA 2OV1A 1E8MA 3D54D 4FDMA 3TTXA 3WKEA 4JLWA 3K31A 2J3QA 3FAZA 1EJ0A 2GBFA 2XMSA 1NZDA 1PV2A 1Q77A 1Z5NA 3DZCA 4ZAZA 1A9QA 4IJMA 1FY2A 3ZUPA 5FUQA 4P86A 3OLWA 2JGAA 3GGDA 5JVDB 1MENA 1SD5A 1JEQA 1LRKA 5IAJA 3NDRA 4BXOB 2VQFB 1MVOA 1CY4A 3UJBA 3QVLA 3AFNA 5CA1A 2WILA 1GJRA 2XR1A 2J5QA 3HEBA 1GLVA 1USKA 4JLAA 5DI3B 3IT3A 5HW0A 2ZXUA 3I6SA 2O7VA 3NTVA 1YQEA 3PFGA 4AM8A 1BHSA 3H13A 7REQA 1DIBA 1DZIA 2G82A 4KE8A 5EPOA 3UAOA 1ZWKA 2QY6A 2BH2A 4BDTA 2AHOA 4IAOA 3ENWA 4X1YB 2VTBB 5KX5F 4UE3S 1CUDA 1G8MA 4ZVVA 3H1TA 2V5VA 1O6GA 4B6QA 1OROA 4ON9A 1LDBA 1Z7YA 1S2NA 2B21A 5BSUA 2J6HA 3D5TA 1Z08A 4Q39A 4R2WA 1US8B 5FD8A 3U9TA 2C03A 3S70A 1V16B 3QE2A 4G85A 5BOSA 1ZK4A 3GJ3A 3GEGA 4IPTA 2AI1A 2BHTA 2ZUCA 3C1UA 5CPBA 1O94A 2GPNA 3VR2A 1UBMS 5JY1A 1K98A 1Y7LA 3IYLW 1RI3A 2DKOA 2QYSA 3LPNA 2QQEA 4URFA 3PB3A 4IG9A 4DMHA 4EUKA 1J5EB 2JIZD 5KNDD 2BLNA 4EQ6A 5J2UF 3ZU5A 4K3VA 1ZC4A 3I1FA 3I9OA 2H59A 2ZR7A 3AIMA 2QJFA 3CS3A 4PZAA 5AJWA 5TT1A 2XNHA 1O57A 2WJVA 3SF8B 2V3CC 4LHZA 1XMQB 2VCHA 1ZFNA 4S2EA 5DP2A 3C3YA 3A32A 1PBTA 3GQBA 2Z8ZA 1MW8X 4IF6A 5FTNA 3OA0A 4OC5A 4MDFA 4PQFA 1OXUA 2NNWB 5AVTA 3QU2A 4NOJA 5EWLA 1NFQA 2QAGB 1FNNA 1I7QB 3RSQA 3AI2A 5CDUA 4ACBA 5FUXA 3X1YA 2I7TA 2O8FA 4NGTA 1EZ1A 1KH3A 2IOFA 4ADSG 3KTAB 4M9XA 4ENWA 5KSOA 3UZUA 3C1AA 1MXHA 1T24A 2V6JA 3TLEA 2X58A 1F3LA 4MZDA 4BGIA 3R3JA 4DRZA 2EZBA 4GRAA 5ILQA 1P3DA 4TLCA 3ZV6A 3W5JA 4ALKA 4BIMA 2PLWA 2VDNB 2BBTA 3IHKA 4KGVA 4QXMA 2WFLB 3T3GA 5C7YA 4KQFA 3EF1A 4IEFB 3ZJ4A 3EOBI 1UZLA 2TECE 1FC0A 1N9GB 3OOYA 2B0JA 2D2IA 3DV0A 2QSYA 3GJSA 1GV1A 4L76A 3F97A 2XV1A 3VNSA 1A3CA 2Q7XA 1T9GR 3JYPA 3WIOA 4POAA 3ILXA 4F4FA 5BSGA 5LLSA 4F91B 4AKGA 3ZWXA 1N7IA 1ZQ1A 1CPYA 2I9PA 1V47A 1LS6A 1TJPB 4KPEC 3K8OE 4YDSA 4N41A 2AQKA 2UV8A 3V7NA 3R9XA 3DV2A 2C99A 2R8YA 3K5WA 1MKYA 4UQOA 3RABA 3TJMA 1RMYA 1P31A 2H4XA 4MO9A 4K7JA 3EODA 4KYVA 4BLSA 3R5HA 5JFTA 4HDKB 1MA0A 5E9AA 1ATZA 3H8VA 4C43A 5FPYA 2YW2A 2YWCA 5EHIA 1E6KA 1XX6A 3HJFA 1VKJA 2H2GA 1E1CA 5FYDA 4HDNB 4WZBB 5G0WA 1ISMA 1FLAA 3H9BA 3DWGA 3DH0A 3WLIA 2QF7A 3KKZA 2OBBA 4B3FX 4TOIA 4R7TA 4U7WA 4CCYA 4M89A 2HIAA 3KT3A 2JGKA 4GNRA 4REMA 3JQ9A 3NRBA 1NVGA 3CEJA 4B85A 2VJLA 3HGQA 5AOAA 4ZHQB 5GONA 3MBOA 3FKQA 2JL1A 4YPOA 3GD7A 3ZE0B 4FHFA 1V6CA 3CF4G 3SQNA 3IUNA 1UBGA 3KT8A 1CJSA 4NBNA 5E9QA 3PPXA 5HCUA 1WX1A 4A10A 3PJFA 1S02A 4KC0A 1OX6A 3CKKA 3WL5A 4IX9A 1WHSB 2PUGA 1JWAB 1Q7TA 3QX7A 2F9MA 4MV8A 1WABA 2V97A 2H6EA 2ZIWB 5IDQA 1CJUC 4HMPA 3RF7A 1CG6A 2C5HA 3TIVA 2VHJA 1FRFS 1G5RA 5CGZA 5DXAA 3W9SA 5IBQA 2GR9A 3I1JA 3FUVA 2JRCA 2RFLA 1Q14A 2B3TA 4JBGA 4RELA 3KV1A 1H8HD 2DUUA 2Y05A 4TTSA 4E2ZA 1UH5A 3TZHA 5ENVA 4DLYA 1DUSA 3DHWC 3DT8A 1DAMA 3JD3A 4OIMA 4WVLA 1Q5PA 1O3YA 1OTYA 4KN9S 3DHVA 4KWEA 2WJPA 3G3EA 1GNQA 4S1TA 4UARA 2OAP1 5EJ8A 3WKDA 3H9CA 3Q12A 1TDJA 4AF8A 3TZQA 1IE3A 1Y6FA 1DTWA 4RHTA 3ZBUA 1JG6A 1WZUA 2AZDA 4QBIA 1QHGA 3BRCA 3FUWA 4KIWA 1EDDA 3MJSA 4N3BA 5E0OA 1W8IA 3LC1O 3ZWDA 4AJLA 1X1AA 1P72A 2C2BA 4IIEA 2SECE 2XHZA 4YVFA 1AA6A 2VUTA 3NTXA 4FS8A 2C4MA 4MVJI 4XIJA 1RADA 4XCVA 2Y2UA 1YZ3A 4BFYA 4X90A 3M4YA 4MRNA 1ZMXA 4O6VA 4D3FA 2PWPA 5I7UA 2GEJA 1H69A 4FYWA 3ORYA 3GRCA 1VPEA 5EHNA 2R62A 5B3LA 3FYUC 4Y2JA 2GERA 1LPAB 4HR7A 4RVDA 4EVIA 4XH9B 4YHHB 2OV4A 2RG1A 4L74A 2BFCB 5ICFA 4EG6A 4D9GA 3ZD6A 3HVRA 5LZ2A 3DYVA 1QTRA 4MPPA 3MJDA 3GDGA 3UWPA 5LOVF 5JXJA 4JI2B 1Y8RB 3SSOA 4FMCB 2B4RO 3DT9A 2BGJA 2H8KA 2K5UA 4IJKA 3A04A 5AJUA 1QORA 2FSFA 3BGOS 3LPCA 3BXHA 2BM8A 3EUFA 3BWBA 3FM9A 2EK9A 5KPDA 4B79A 4FFSA 1GWNA 1CS0A 1TLTA 2I2CA 1NN0A 3RS0A 4WACA 5C4MA 4G24A 3PI6A 4NCKA 3ZH9B 1U1EA 3QI2A 1Q7CA 2LKCA 3SHTA 4ARVA 1ZNYA 4LX8A 2WUEA 3UJPA 1DKOA 4FVTA 4C4YA 1MO3A 1CZLA 3CT6A 3O8LA 1B6TA 5IANA 5ELYA 2ZR0A 2NVBA 3WRYC 3LDAA 1IAVA 2ERYA 1FXSA 3JARB 3EFEA 1O7JA 5AM3A 6ADHA 5F5NA 2ROQA 2I3GA 4RA9B 1E2LA 4GUDA 1LK0A 2WWXA 4N3AA 4IJQA 1R5OA 3QBJA 4OOEA 5AW4A 2YYAA 4XSGA 3HB1A 3TZ6A 4OHZA 3LWDA 3KOMA 1EIZA 4G56A 2A8YA 4UZEA 1CR0A 1DL5A 4GR9A 1WW2A 5EJ2A 4A2QA 3IOYA 3OIWA 4N5NA 2ZYSA 4DG5A 1PG2A 1RQRA 1S89A 1ZD5A 1JQBA 2W83A 3EWNA 4Z4HA 5JMOA 4HQRA 3P5SA 1HTBA 4G0MA 1CR1A 1YZYA 3B60A 3PD7A 1ZD4A 5G1PA 4O2RA 3UH0A 2FV8A 2PA0A 4OMDA 3WWZA 3SEFA 1B8NA 4IW3B 3DAPA 3O9VA 4B7XA 2X5OA 5JTTA 4U5QA 4JI7B 1N6NA 2HJHA 4XIYA 2CFSA 4EPVA 4DV2B 1UFOA 2I2BA 2FQYA 2VDKB 3I5YA 4UUMA 1VLZA 3WYDA 1YDGA 3CUKA 4OHWA 1FNCA 1LPPA 4HRVA 1Y80A 4ME6A 3MUFA 2IZ1A 3TIGA 4RTKA 1EFAA 5A9SA 2JW5A 5AYVA 1DG1G 2I29A 3SG0A 2HI6A 2C07A 4IFIA 5EQTA 2LVBA 2BL4A 4X24A 4JOBA 5M2QA 3NM5A 3FDJA 3G17A 2J9ZB 1DV1A 1DPFA 2RHMA 4HZUB 4YCBA 3VM6A 4PG8A 3KZCA 3M6FA 3OAAA 3KB2A 1GCAA 4MUKA 2YW9A 1YQDA 4ZAFA 4DC0A 4F04A 3L7MA 2DBZA 1NVTA 1RXWA 1XTTA 2W2KA 2ZREA 3ASVA 1N2CE 2QW8A 3OZVA 4XFJA 5FQOA 4GQBA 2AOUB 2AJDA 4MI3A 2C94A 4LF5B 1GITA 4R40A 2PJDA 4N0PA 4QXPA 5LJLA 6REQB 1UXGA 3FEEA 4NJOA 3LUDA 1GARA 4FR2A 1NIJA 4RGVA 4ZO4A 3RIGA 2VT6A 3KPJA 3RTEA 1E3EA 5CEJA 1KZ9A 2ZVJA 2PCJA 2Y1DA 4QDTA 2C42A 1DKLA 1OFGA 1U2RA 1KK3A 1OLXA 2F7SA 1Q1AA 1TNDA 2O2YA 1JX6A 3JR7A 4LA4A 4ZYTA 3NBKA 4PSCA 1HLFA 3B2EA 1EHIA 1GAXA 2VXYA 3UW1A 2Q49A 1IBMB 4P4DA 4CZ1A 4GR4A 1QGYA 2BE9A 3KSBC 1HE5A 4DJ5X 2EC5A 3RUIA 1B23P 1ISPA 5H9WA 3VPGA 5FUVA 1U99A 2GFQA 1UC4B 1GCIA 2X13A 5EWJA 3SOZA 1KDRA 1M6EX 4X95A 4P4LA 4EGCB 1NXTA 1JLLA 4OQQA 4AUEA 5KZMB 4KH0A 5EXPA 3C14C 3MWDA 1C8LA 4B6FA 2V3VA 2Q29A 2FFQA 1K9VF 2WWTA 4LXGA 2CNBA 1ZBDA 3PTZA 1P75A 3RM3A 1NTRA 1UT8A 1E1LA 3HWWA 4KVFA 2R00A 4LTNA 2VBIA 3P9KA 4R1PA 1WB5A 3F47A 4LHWA 3T4XA 4BO9A 1V1RA 5GV8A 2BCJQ 2IZ5A 3C5HA 3CWZA 4NEGA 3UXHA 3RHTA 1XVTA 3HU5A 2ATVA 3V8BA 4YB8A 3ETNA 3ROFA 1P2VA 2WTBA 3GK3A 3BZWA 2VJKA 5FTWA 2JIZA 5KNDA 4JFRA 1FXUA 1SQFA 2YX1A 3SQWA 2QT1A 2PMDA 1P9WA 3EZGA 5D86A 1ZR4A 3OM1A 3I2JA 4OGGA 5H16A 4UNQA 4JODA 5DSXA 4A2CA 2V6MA 4JHLA 2FRDC 4TRMA 3V4VB 1SCBA 3FDFA 3DDSA 4KHPB 5EESA 4JLJA 1CUWA 1YR7A 5LVAA 1D5CA 3KUDA 1IZYA 4JBLA 4ZDWA 1PL6A 1JXMA 5EEHA 3DAFA 2EZAA 4TTPA 4CDMA 4WXEA 1HMYA 4CF3A 5AOVA 5C5EA 4ZKEA 5DLEA 3QUSA 2YICA 1EWTA 2KBFA 1WXDA 2PZEA 1JLRA 1SHTX 1Z5PA 2HWXA 1F0PA 3ID6C 1NWHA 5IXJA 5DHRA 2DT5A 3PJGA 5ALQA 2AC7A 4D92A 1U7OA 5LBIA 2IEIA 3UW3A 3OEED 1TZBA 5JZVA 2H2FA 3LLSA 3SGLA 2VOEA 2RKBA 4QU0A 5GAJA 2H1VA 1IWBB 2ID7A 2HTEA 5G4KA 3SYMA 1YZLA 1RHUA 5MDHA 5ERXA 4I19A 1KE2A 4NNPA 3OA2A 1O1YA 1Q1ZA 3FETA 4K81B 4QBGB 3SS8A 2GK3A 3WQQA 1TU0A 4DWOA 4E4TA 3T7AA 3I1IA 1BW9B 2YXEA 3FTNA 3K6RA 4COGA 1FTYA 3BTSA 4FCCA 3BD6A 4LY6A 3ZHSA 2XCTB 1M34B 3LT0A 1PR2A 2HF2A 1RE1A 1KXZA 2J9XB 2VJAA 3OM0A 4DXAA 1MABB 1ZM9A 1OR8A 3NUZA 3MOGA 2YN2A 5B37A 4L9WA 5KNCH 3KZXA 3O1IC 5F3DA 5TDHA 3WIUA 2DERA 1QG6A 2UZ0A 2IEAA 2IZ7A 2O0LA 4HJXA 1LDNA 1GT91 1YJBA 2IWRA 1VMIA 3TQSA 4E07A 1SNYA 3EX7C 2DTXA 2J08A 3GLFB 3PU6A 2VBGA 4DCPA 3K4QA 4D3ZA 5DLDA 2ZU6A 2ZYDA 1XTVA 1A9TA 1Z68A 3DBRB 4QOGA 4RJJA 1RPZA 4KR3A 1YE5A 3J81k 5HUJA 3DL4A 4GOOD 1SBIA 3HYSA 4BIIA 2XUZA 4LBVA 1Z63A 3PUWA 3NIBA 1A8PA 4O25A 3QOYA 3GYBA 4NG5A 4NR0A 5TQJA 1XSEA 4HOYA 4I2NA 4LNUA 4QVGA 4CEIA 1PDVA 3G2QA 2V7QD 3JRNA 5KJ1A 1TPYA 2WT4A 3FNRA 3D2BA 5KREA 3QZUA 5IDVA 1IK6A 1HNXB 2ZR8A 5JMPA 4W5RA 1GFWA 5ALVA 3NWBA 3FTDA 3IVMA 4FB5A 1AV7A 3I05A 1U6JA 1EAMA 3GOHA 3PR2B 4WL0A 1T2VA 4AZ3B 2YKGA 1GRQA 5G0TA 4M49A 5JS2A 3W5VA 1T3SA 6REQA 4ZI7A 3AR3A 4FZVA 3UAWA 1XDGA 3C7DB 4DT1A 4EGFA 2XMZA 2Q1SA 1H8HA 3AUKA 3DPSA 4Y1GA 3UQZA 1LVUA 4MUAA 1JFFA 3A1TA 1E4YA 1P0IA 3HABA 4WZBE 3EDOA 2NUAB 1GTSA 2AUTA 4C87A 3VQTA 1IUNA 3UYKA 1B3BA 3GCDA 5FBZA 5H81A 1E61A 3W34A 1GZUA 3KSUA 4ER3A 5I7FA 3C3JA 4UUOA 2W8ZA 3I4CA 4ZOAA 3BGDA 2FWMX 4QDJA 4URVR 3WYNA 2QVBA 4F4DA 2PCNA 1L5RA 4EKNB 1Q0RA 1JMYA 2GZ1A 1ZNZA 4KMSA 1ICIA 1N5JA 3UPDA 2Z5GA 4G5GA 4MW6A 2J07A 4Y0AA 3U7IA 3ZV7A 2QTBA 2AVNA 4Y9RA 1UXJA 3GZTB 4HAOA 3W4KA 4JQZA 2HDWA 2Z8YM 2XLCA 1NNI1 2PQMA 3H9JA 3HA2A 2D1YA 2R8BA 2B7CA 2X0IA 3LCRA 3T9EA 4C7JA 4MRMB 1CZHA 1VBFA 3DXZA 2AJTA 4FEYA 3TKAA 2BOVA 1P5JA 5LNK6 4HGPA 4C8AA 2ONYA 4TSKA 4ZQHA 1XD9A 3T1QA 1XTZA 4ZVQA 1PT6A 5JNSA 2TSYB 4K40A 2B1JA 2GS9A 3I0MA 1U1IA 1EFPA 3BE5A 3UJAA 4C76A 4R98A 1BDHA 3JWGA 2KB0A 5JDIA 3EC1A 3GB9A 4PYJA 3GVIA 4ACAA 2JATA 1FFXB 1JRLA 2I76A 4OQMA 121PA 4Y6QA 5L7YA 1PS9A 5K0EA 4Z9BA 3I9NA 1RWOA 2BEKA 3MHPA 4LMPA 1ZAYA 4HGZA 2YWHA 5DCWA 4BASA 1Q1EA 2OVBA 1P2SA 2FN3A 5LC1A 1H2EA 3PEUA 4EI2A 4BMOB 1CY8A 4EUSA 1EP9A 4OB6A 2AG5A 3VKFA 3ZS8A 3KQOA 5DNUA 2VT3A 4TV9A 4ZU1X 3CNHA 2JBKA 3ZZ0A 1X1TA 2WKWA 3H42B 3B6EA 4P22A 1NVUQ 2GBGA 2QGNA 1KEPA 3CEMA 3ZWWA 3RR2A 2GXSA 3MTAA 1J1UA 1KO1A 1U9IC 2PCLA 3UMGA 4NGNA 3KUKA 5BV7A 1A76A 4IZOA 1XO1A 4E5VA 2AJ8A 2CXQA 2G07A 2PLFA 1RYHA 5DWDA 4BGDA 2D6FA 5JJIA 1KPHA 1L4FA 3KYDB 3EFBA 4M7RA 4GXRA 4I5GA 4CDRA 4I6GA 1UOQA 3OOEA 3FWKA 5AKGA 2IOHA 3KR1A 1JHRA 2D7CA 3O9ZA 3QOXA 3LOQA 4L5AA 3TQCA 1ZH4A 4M0DA 1JB9A 1RC1A 3PNKA 4MXDA 1V3VA 4NYIQ 2ABWA 4HEHA 3HWRA 3LI2A 4EI7A 2WJGA 4MULA 1RBYA 2Q5QA 1Y8ZA 3HP7A 5ESXA 2EJTA 2JVKA 4K2HA 4RAOA 2G3YA 1QDUA 4YJKA 3IHTA 3PIRA 4PIVA 4D81A 5AW8A 4B3TB 3S2GA 1PQ4A 4UU0A 1BRMA 2J09A 3MXOA 2MMGA 3DAGA 5JRDS 1G291 5BUCA 4A36A 2PR7A 3CNQS 5DYYA 4QOHA 5KNBH 1FMFA 2CT8A 2HIGA 2I8AA 5I7WA 4R1SA 3DOJA 2EQBA 3I76A 4D96A 3K1AB 1UMBA 4KMMA 1LBHA 1RBQA 3K92A 2BFEA 4LYGA 4PFKA 3VH1A 4PAWA 1ABBA 1QPBA 5ALGA 2E28A 3RK1A 5SICE 3A0UA 3O93A 3SJCA 4N9QA 4EMBA 2GCGA 4HTFB 2HO4A 4R1TA 4RCZA 2ZWVA 4TYWA 4YQFA 4Y2GA 4B3IA 1ZUIA 3SC3A 1QIKA 1GAWA 2ZPTX 4ZMSA 3BB3A 4L1KA 5CB4B 4MEJA 2ATXA 3D4BA 3TWOA 3VR6H 3L7KA 4GPZA 1WZNA 1KO7A 3IEVA 4AZ3A 3RYCB 3OX2A 1SMKA 1Y3AA 2Z58A 4IIJB 3ZYCA 4L4XA 2GXUA 4R8KA 1FYXA 1CFJA 1JIJA 3AJRA 3KR9A 3VPBA 4B82A 5B6JA 2CWDA 4MCHA 1KA9H 2Z2XA 2JS7A 4TVOA 1V8ZA 3PC7A 3L0OA 1D8AA 1NM5A 1T8YA 2IA5A 2W93A 5DBFA 1X7HA 4AJOA 4C08A 1HRDA 3WYGA 5AK6A 2OD9A 3GAFA 3U80A 3B13B 1II8B 4KB5A 3T5CA 4XDYA 2DBVO 2AZXA 3HC7A 3RODA 2V9PA 2C77A 5IDYA 2PLRA 1TGVA 2AF4C 3UB2A 4GFDA 4UUNA 5CVUA 1Q1QA 3ACDA 3WA6A 3TEJA 2POCA 4A8TA 1DEOA 2IYLD 5JHHB 3Q5GA 4JUFA 3DO8A 3ACBA 3GF4A 2H2AA 2KPOA 2CXRA 1X1EA 1A4XA 3OEHD 3PITA 4NOMA 4DA7A 3O4VA 4RZ2A 5CB0A 3MM4A 1ZHHA 5CDSA 4P4NA 2FFBA 2WJ4A 4N5DA 4WLOA 5FEMA 2X3FA 1CEEA 3NWJA 2YV1A 3HJAA 3DC7A 3NS7A 4LCBA 4TV8A 3RVKA 1DMSA 1T2NA 2R1TA 3UT5B 2DF8A 1E9SA 2M2IA 1Y81A 1FQKA 3SHQA 2CN1A 1LTHR 1XP5A 4ARZA 1TECE 3VHRA 2EBFX 2BCEA 3V4PB 2ZYGA 2FSVA 2FW0A 4L3OA 1DAPA 2AMYA 2Y27A 4GE0A 3BN3A 4X94A 3SQMA 3DB2A 3V4ZA 4LZLA 3ZQ4A 3UK1A 3ROEA 1XWIA 4PYIA 3B6KA 3LFUA 3CUUA 5A4MS 2O6LA 2Q2NA 2J6IA 3RVBA 5BNFA 3A7EA 3AILA 3ZCTA 1K5PA 2OOSA 4YCNA 5CVJA 3IOCA 6CHYA 1LPBB 2JEYA 2P5TB 3BZBA 3IUJA 4TWEA 2HIHA 4WXMA 1DBSA 1SPBS 3ET5A 5A6SB 2WHRA 1E9VA 1HK7A 1PO7A 4ZA2A 4UQLA 3TCKA 2PX8A 3OQIB 4Y7CA 5KHAA 4MQEA 4AP5A 4EBFA 1DJMA 1GHTA 3IA2A 1YJ5A 3DFUA 1G60A 4LDZA 5AUNB 3DZ8A 2XCOA 2VP4A 1DX6A 1GPMA 1P62B 2QXUA 3BSFA 4L50A 4PTZA 3VR1A 5CFPA 3CVVA 1R3DA 3BYZA 1DX9A 4J1TC 5CFNA 1RQXA 4MVJF 4C2AA 4JDPA 4YUAA 2W48A 3OEEA 4LJ4A 4LYFA 4ARUA 4DJJA 3RPEA 1FYDA 3TINA 1JZQA 5IZ4A 4OVKA 4Q4HA 1ZUNB 1XNGA 3KQQA 3OQHA 3IH5A 3JR3A 4FFRA 2OY0A 3DWFA 4BP1A 3UK2A 2AEFA 2WFZA 2FUKA 5BRAA 5HQTA 5L3ZA 2OHOA 3DTVD 4O29A 5JSUA 1EM6A 4Y6RA 3CZPA 2AS0A 4HEA1 3SR0A 1YJ8A 5C18A 1O6CA 4LE1A 1B73A 3N8HA 1LGYA 3N0VA 2FP3A 5H80A 5EVJA 1FXWA 5HF8A 5L40A 3NOXA 4MUNA 4Q05A 2VHUA 4H1HA 2NZ2A 2GXQA 4MGYR 1I33A 3S29A 3ENQA 3IUYA 1P9RA 1UDBA 1UMCB 1KYVA 2B4QA 2OM2A 3EIQA 1BQ4A 3TFQA 4BKRA 4W9MC 2R7NA 4F4IA 2PUEA 2UUOA 1HQCA 2RGEA 2A5LA 4FFDA 1X7ZA 3TX6A 2WT8A 2RKWA 4X20B 2FW8A 3KZMA 1IY9A 2DFPA 4LI0A 4M60A 2GF2A 4BQFA 2C8LA 4EKGA 1FZTA 5AM5A 3B3JA 5HOQA 1BS2A 1YRBA 1ISFA 2GQ0A 3BAFA 3HB5X 3L01A 3MT8A 4Y9DA 5C34B 4Q4CA 4KQKA 3EMKA 5FTLA 1WZEA 2V7QA 1YQTA 3VJRA 1TVMA 4IM7A 2CHGA 1VI2A 2GH1A 3A3PA 2FEXA 2H1HA 3F6YA 4ZOBA 3CZCA 5DEIA 4C84A 5SZKB 1GPWB 1I6MA 1L7RA 1M34E 2M6RA 2X9LA 3EDYA 3U7QB 2OGWA 3N0RA 1GCUA 4HRXA 1SCUB 4RACA 1WD5A 2Q3MA 3E9ZA 3N7UA 3NVDA 1NMSA 1R00A 1V5IA 2GEUA 3KTDA 5DTIA 2OA0A 2F64A 3EXG2 4KRYA 5HKKD 3V1YA 4ZI3A 3QV2A 4OLBA 2JFOA 1D8TA 1E32A 1I1NA 1X87A 2JFHA 3NHSA 4XVHA 5B7PA 1CUAA 4D4HA 2BKLA 1U2QA 4MWTA 1L7NA 1P17A 1Z6QA 2VPYA 2FXVA 4JEUA 1V9CA 3CLRC 3MTQA 3Q3IA 1L5HA 3I53A 3DHYA 2W43A 2MYPA 3FWYA 3WP0A 1EFUA 4RVGA 4AJIA 3IPCA 4QREA 1E2FA 2GK6A 1Z34A 3P4YA 2ARKA 4QO7A 1FU7A 3PUYA 3TL2A 3LTNC 1B0ZA 1S2MA 3CX4A 3GJQA 4XRGA 1LD3A 1U65A 2Q0SA 2FWNA 3E7WA 1PU2A 3FPCA 4HEJA 1M5RA 3BERA 3RAPR 4MYTA 3H9GA 3KPYA 4J0NA 3DA8A 2AFIB 4AJ1A 1HEYA 1USVA 1A9XB 3DUFA 3VJLA 2PQ2A 1RKQA 2I4LA 2GAJA 2IY7A 4J16C 4N1AA 5FTKA 1E3IA 4DA8A 3KUCA 1ZOSA 3P9YA 4ICIA 3U3DA 2A0UA 1NC3A 3GPBA 3RU7A 1B8PA 3UEOA 5BN3A 5K0BA 5EHZA 2YZGA 5I9IA 5COBA 1EJBA 2FUEA 4EM6A 1B6RA 4H08A 1KDZA 4C4XA 5JSHA 3MFQA 3AI7A 4NH0A 2HMYB 4KGXA 4UBMA 3CUVA 4PAQA 2EX0A 2IELA 1P4SA 3EIEA 3K7EA 3P71T 4XPIB 5GADl 1GL3A 2A88A 4H9GA 4PY2A 3OIVA 3BF7A 4P4SA 3I6IA 5JYCA 1QUFA 4A15A 4PPFA 5BSHA 4GSLA 1DO0A 2DY1A 3AVOA 3CPSA 1KJNA 2PKWA 3GRKA 1VYVA 3NTUA 4MWBA 5LZ8A 3REQA 3R5SA 1NBMD 1SC1A 3THYA 2O05A 1DWUA 1U7PA 4FFNA 4L5IA 3VC3A 4AJ4A 2QX9A 4EUNA 2HX1A 4F5YA 5DASA 4AO8A 2C61A 3WQRA 1P5HA 3JQRA 1LH0A 3OZGA 3PWZA 1T1EA 2GRJA 3H5IA 4GYKA 5ERGB 2GKGA 3FGOA 4KBFA 3K09C 4TVBA 3C6KA 1JP7A 4F84A 1DRUA 2IJGX 3EVBA 2VRWA 3A4NA 4FJ0A 3DE7X 2B4AA 1USUA 2PL5A 4M1QA 1C1XA 1LQTA 1RJ9A 4N7JA 4HLUA 1HYEA 1ZD8A 1PR4A 3AR7A 3R77A 4PVDA 5F2OA 3IV7A 3WRXA 3G2MA 4LRXA 4BGEA 4CXMA 1Y4ZA 4EOGA 4RBNA 2E4VA 4DXHA 1MGPA 2WU4A 2GZSA 3DLIA 3FTFA 3IJ5A 1W1WA 3M6IA 4NICA 2Q3JA 5MGBA 4EZBA 4UEOA 3JD2A 4F96A 3KKPA 5AOBA 4XSVA 1XZBA 3BJRA 3LYLA 1GGFA 4N3CA 2A7XA 3AR5A 4ZCMA 1NXXA 4G67A 3IJPA 1T2EA 3MIIA 1Q84A 2VDWA 5J4YA 3P9ZA 1WLYA 1GFIA 4QTTB 1LB1B 1M0WA 1U6KA 1R3UA 4ERNA 3ZZUA 2FEPA 4AWBA 5KYYB 4AKSA 2IXEA 1O96A 4C06A 2YXBA 4WK6A 4OQEA 5JAPA 4R8SA 4NQZA 4I81A 3E6AA 2HO5A 1EK6A 2GOYA 2X15A 3MRXA 3GRPA 4INOA 3M5CA 4MGZR 5KOJA 4P53A 1WSWA 2V7GA 1VL5A 3IJEB 1NAIA 2PVSA 3KAKA 5BORA 2FMTA 1JI0A 1CUCA 1TVKB 1R74A 1O0SA 4I1SA 1XZCA 4HBGA 5C37A 2M1XA 3L7BA 4OGFA 4IV0A 4H0CA 3NYRA 2WI8A 3GJ8A 3DDWA 4M0FA 3LDHA 2F90A 3PENA 4QLAA 1PS8A 2GNOA 4Q3CA 3IS3A 1E5XA 1BAPA 1JQEA 4D3SA 4TYQA 2TMDA 3J80A 5EXDA 3IO3A 4RD6A 4LRUA 4AMZA 1N77A 1XI2A 2HWYA 4YS6A 1F38A 1VPVA 2J0VA 3KEFA 5J23A 3TTYA 4YASA 1GCOA 4PSAA 3DWIA 4EPTA 3UHPA 3BZUA 3CUEF 1IHXA 2GPBA 4YP9A 5KYVA 5JAQA 1Q17A 1ZO8A 2J30A 2INGX 2R47A 3VMFA 1XRNA 1IMOA 2CCJA 5JDCA 2P3SA 2GPSA 2HLNA 2DKFA 1L4HA 4YV1A 4B4VA 5AW1A 3SE0A 1SK9A 5IZCC 5EMNA 2AN9A 4UNNA 4N03A 5A4FS 4K6OA 3DEKA 5A4JA 3S9LA 1G8KA 4MDHA 4QC2A 1V6SA 1W47A 3F1KA 5GWXA 3ODPA 3G2OA 4Q7LA 5A5VA 3BCHA 2R6AA 4PSDA 3NATA 1IATA 1IWOA 1NBWB 3QVSA 1VIDA 1KOFA 3SX2A 4GMKA 4EA6A 4BVGA 2BELA 3U81A 3H5AA 3N3BC 3N59A 4BNLA 4H6VA 7ABPA 1JS1X 5AHXA 1VKOA 3I72A 1PJLA 2EZ4A 3MVEA 3OSZA 3WLKX 4D9MA 1VJDA 1NJ1A 3UAXA 4GHWA 3DE1X 5KQGA 3PR1A 2P30A 5ALWA 5GOZA 2QYOA 3OEHA 2ZI4A 2Z9DA 1Z45A 5CMLA 1L4UA 2QEQA 2UZ4A 4XM2A 2OCPA 3EXHB 4D9NA 5F12A 1GGKA 1LI4A 3CRZA 1JFRA 1J25A 4YP7A 5IUKC 3TD2A 5A2GA 2WWRA 3FH0A 4QOSA 1HSZA 1SCKA 5J4HA 2IH5A 1GT6A 1XCLA 5KJFA 4BCDA 1KYQA 1N6KA 2ZTLA 5B1YA 3QITA 4RSRA 2ACKA 3EEFA 2YRFA 3PA8A 2PUWA 4PCAA 5DHFA 3IR5A 4X8HA 4FGJA 5I3ZA 3G79A 4LRQA 2CLSA 4K5QA 1U4NA 2X23A 4MI1A 2FW9A 1U90A 5TEWA 1XNHA 1KK0A 5JQGA 2FPPA 2KM1A 4OQLA 2IRWA 3WYFA 2FX5A 1QHHB 2VUUA 1EBBA 2ZBRA 3AETA 1H94A 5LQKA 4KTTE 1BN6A 2XX3A 5ITZB 3C45A 3TLZA 3L46A 2QX8A 1I1OA 3L40A 2KMLA 1U8CB 4DQUA 3RC3A 3VR3D 1TAUA 4XWTA 1KHHA 1N36B 4D6PA 3RC9A 3LCUA 1SPXA 3S0JA 4ZO6A 4RTJA 3VJMA 1BMDA 5MN5A 3LUCA 1MNAA 1AF4A 2AOXA 4N3GA 3CISA 2GN2A 3CN7A 4NFLA 2VSOA 3WLFA 4WXYB 5FBHA 3CUTA 5HQJA 4LZWA 3GEIA 4O0MA 1CQJB 2PVPA 2DOKA 4KW7A 1SH7A 4PR0A 4UW9A 2WUFA 4UVIA 4DOMA 5GPBA 2VZ0A 5HXAA 5J4LA 4QTYA 3QLJA 4B0PA 2O8BB 2IYOA 2A84A 2CJPA 2OZVA 3AKZA 3B20A 1CSEE 1S01A 4N8DA 5J43A 4DB2A 4KR2A 2B37A 3IO5A 3FOAA 3WLLA 3R40A 3D4LA 4ZTBA 2ZUDA 3HJTA 4A7PA 4RADA 2RHGB 1PTJC 4A16A 1UPAA 2NUPA 3DTVA 3GFSA 5DNDA 2VJOA 2X8LA 4UJ5A 5DX8A 3IP6A 3RWOA 3SVLA 1E4VA 4F2HA 3JWEA 1C9NA 2KJQA 3K0SA 2YJZA 3BCUA 3LP5A 2N9UA 4B6GA 3D3WB 2PL3A 3NONA 4RSMA 1G9XA 1EP2B 2OV3A 1EFCA 3JZFA 4XFDA 3PD1A 3UGJA 3ZVNA 4MTCA 4E70A 3QBDA 1IULA 1JH9A 4MW4A 2QIPA 3EQZA 3HG7A 5B2ZA 2H48A 5K3DA 4A4DA 1UJNA 4C0WA 1E2NA 2XB4A 3OE5A 4MR8A 4NENA 5HHTA 3EGEA 3KQUA 1YK1A 1KMIY 3DCNA 3GFRA 1I2MA 2FH5B 4KPFC 3N05A 3R20A 2VDRB 3INTA 2JH3A 4J03A 5JSQA 1SXJB 4BFCA 5CD9A 2RARA 2V6GA 1MTOA 3FXAA 4JIGA 1SC4A 4KR0A 2OFOA 4I8DA 3T5TA 1L8OA 3UXMA 4CM8A 4DPMA 4Z6KA 4WKOA 1Z9BA 1PZXA 1RJEA 3MCWA 4MJLA 3FA2A 3Q72A 1FTQA 5DIZA 1P2BA 1ADJA 1WUIS 2FWPA 2Q2WA 4HL6A 3TW6A 1IRXA 1DBWA 1ZGJA 3DW1X 4LWPA 4TQ9A 1K9SA 4PS0A 3ZV3A 3JAKB 4NBVA 5C8YA 2BJWA 2VF8A 4B35A 4BLUA 3VA7A 2QLNA 2E7ZA 3OZWA 5AP9A 2MU1A 3QPDA 2C3UA 4JR1A 3U4HA 5HKKA 1S8OA 5DM70 1FBTA 1AZLA 3LPDA 1V0JA 5EC8A 4QPPA 4C1NA 2GPJA 2O7QA 4J0HA 3ZWAA 4J7UA 3AJ8A 2BDTA 2PL9A 1G1AA 3KRVA 1OLUB 1VMKA 1GIAA 4GLOA 3QENA 5EOVA 1EP3B 4HLCA 3QFFA 4C0BA 3A25A 3TXAA 1QONA 1SVIA 3A9VA 4CPDA 2P7HA 1C7JA 3H05A 1H3FA 1N2BA 5ALUA 2OYCA 2WRZA 2PKYX 3MAGA 1R0SA 1XRRA 4GI3A 1BDIA 3I4LA 3AVVA 2H52A 4DLRA 3G0OA 4IUDS 5AXBA 1VCIA 3BJMA 1K3TA 1KO4A 1JL3A 3Q8XB 4Z4GA 2WPNA 1FB5A 2A94A 3BAZA 1PP4A 1B14A 2LCIA 1GL6A 3HWX1 3SSAA 2JLAA 1SHKA 1Z2PX 2ODTX 1Y7IA 1T5LA 2BFNA 2HU2A 3U5ZB 3DFZA 3O38A 2GHTA 2D54A 4D9FA 2CVPA 1GQ2A 5JRJA 3IL2A 4LJRA 2QENA 4OC0A 1GUFA 1ZJJA 4GEGA 5JS8A 4JB2A 3N8GA 1IN5A 1N6LA 1DTSA 3KYBA 1IVSA 2FE1A 1SWWA 1KI3A 3ZZTA 5H9VA 1ZCAA 4YMSA 3GZNA 4L7VA 1H1TA 5A3RA 2ZYTX 3U3OA 1MO5A 2QVCA 5IRCD 3T1YB 1MEJA 4E4YA 1E1NA 4IJUA 3OTOB 5F9FA 1E2EA 3O4HA 3E3LA 2Z98A 2I2DA 3DDZX 2RB5A 3EJWA 4QUGA 4IRMA 1QQAA 2XGJA 1QU3A 3BKWA 5AW9A 2GYUA 2J0UB 1G8PA 3AP1A 3EIUA 3GUUA 3CRMA 3LQ4A 4FYYA 4V24A 1S2GA 4BMXA 2E3JA 5EGSA 3OOHA 3A7DA 3S27A 5KKCA 3LKZA 2W00A 3NX4A 4IDQA 4YC7A 4YRPA 4MP8A 4ZOLF 2OL4A 3QIAA 5IP5A 3UJ8A 3VI4B 3TECE 5TSDA 2OCXA 1GADO 4MYCA 1VA4A 1SM4A 2RGCA 1ZM2A 3FBTA 1P29A 2CYAA 4EW3A 1H8ED 1DGQA 5K3BA 3SQLA 2CF6A 3GVCA 1C0EA 1KZYC 1QE5A 5K0LA 2GBLA 4JHXA 4DDUA 4S0XA 3PDHA 1UIRA 1YR9A 3ZLUA 3SBEA 2P1ZA 5FPKA 4DDWA 3BIJA 1OBCA 1G7SA 1XQXA 1WU7A 1ZNXA 2E5WA 4KN6A 4DCGA 4GXQA 1JFSA 1ZN2A 1JQDA 3KFLA 3WGKA 4U7TB 2JAPA 1DBIA 3EH1A 3B52X 1KEUA 2FLWA 3VO1A 2J3JA 3RAJA 3V6LA 4IMIB 3P9XA 3K6KA 5AHWA 1GGHA 1M10A 2W6NA 5AW5A 1QH8A 3PPVA 3T3DA 3C6ZA 2J3DA 4BEJA 3HN2A 4G8DA 5BQPA 2GLTA 3E3AA 3VZDA 3F74A 1P74A 3NKVA 1C8KA 4TTRA 5D2CA 2UYOA 2O3JA 4YJGB 3R75A 2NVUA 1L4KA 2E4AA 4J76A 4XUDA 2GD1O 4RXMA 3SNKA 3WWDA 3OPYA 2BI7A 3K96A 2PNJA 5BUSA 5KINB 2ZWIA 2RGXA 2RSLA 3WJ2A 1KVQA 1PRYA 4CGYA 1FLNA 4LFAB 4G26A 4PYNA 3U6KA 4IV8A 3ZDBA 4FE4A 2IIVA 1PWXA 2QRZA 2FQXA 2FPUA 3BWCA 4UBIA 5KQSA 1TA4A 1U0FA 3R0XA 4CVNA 2OUIA 1NRJB 4DQLA 3IB6A 4OU4A 4F8JA 4F97A 2Z57A 3O75A 2V1XA 4NKRA 4NXMB 2EW1A 2QVYX 3TAHA 3ZD9A 1CUGA 1FNMA 4BVJA 5DNCA 1QIIA 1PEYA 2OXFA 1XJQA 3H65A 4E5SA 1AK1A 2PMKA 1OWLA 4HXFB 2ZIZA 3AJAA 1F48A 4G1CA 4QLOA 3OHMA 3B1VA 4O2AB 3S2FA 4QPDA 2B8TA 1JEYB 1KFJB 1FRQA 3H97A 4R3UC 1U2ZA 3RKRA 3NHPA 4B3DA 1W44A 1V9LA 3VU1A 4GVPA 2QMUA 1EVJA 3TMAA 3PQ6A 3B6JA 2VEDA 2FCAA 1WMFA 3BL8A 3HVHA 1TX4B 4M37A 3X2EA 4DRXB 4WBNA 4ESVA 3ICWA 4PSKA 3GMDA 3HJNA 1JSRA 1K6XA 2Z04A 2CL7X 3P0RA 3E27A 5HJ5A 5CH5A 2NU7B 1JKJB 5KOYA 1FSGA 1XRQA 3UMFA 1L9XA 1Q20A 4NMWA 4C0HA 1OAOA 2ISQA 1Y6ZA 4IF4A 4RABA 3L4BC 4CKBA 4PVCA 4WNAA 5FNVA 5M29A 2JI4A 2AN3A 4HLNA 1G8YA 3RTAA 4B3JA 1E5TA 1MJHA 2CL5A 4TTAA 4CMIB 2HROA 1ZEJA 3HFJA 1UZUA 3AK4A 5KU1A 4BB5A 2CEKA 2D5CA 1OBFO 2O5VA 4W8GA 3MMSA 4QDZA 1HURA 1P39A 1Y4UA 3Q88A 1ZU5A 4KR9A 4JOQA 1YE3A 4Q93A 3NDIA 4QYTA 4TLMB 2P3LA 1L7OA 1XR3A 2DT8A 3N2ZB 2REQB 3OKPA 4RKRA 3E3OA 4EG4A 1R7RA 1U7UA 3FCAA 3VZBA 4N3NA 3QA3E 4I4CA 1ZCJA 4S0ZA 3O73A 4HB2A 4XOUA 6NULA 1GPNA 1OWNA 3CB4A 5LXTA 4CV0A 2K2QB 1ZUWA 5KYTA 5T5QA 3DUWA 2ODWA 2CNOA 3OT1A 2J48A 3UMRA 2OR3A 1F17A 1NXSA 2NU9A 5FRDA 1SRRA 2QLFA 1AC5A 2VQSA 1IJBA 2JANA 2Z6QA 2JAHA 2ERXA 2REXB 1R6UA 2VPWA 2JIRA 1WPXA 2RK6A 3J7TA 2ZYUX 3N74A 4AO7A 5U9CA 4FXPA 1ECCA 3F5MA 4G2TA 4HAWA 3T5GA 4HBZA 1V1JA 2CB9A 1S2IA 2C4HA 3EXIA 2IYTA 1P1BA 3GLGB 1X80A 2AD5A 1KORA 4JYCA 5DCYA 3RTDA 4D41A 2Q07A 2ZXFA 2WYHA 1CVRA 1M76A 3CX7A 3DHNA 1CHNA 2NO1A 3NM6B 1TADA 1EU1A 4YI3A 1ST2A 2EGGA 3E70C 4LJYA 3VOTA 3V1TC 5EJ7A 3GNSA 2QQ0A 3VR3A 3AW8A 2Q41A 4ZOQI 3AUYA 2PXHA 2C1EA 2ZSJA 2ZRNA 4OB7A 3SM3A 4KPGA 4QPNA 1DSSG 1ZINA 1TVCA 2O2CA 3ZH2A 3RS5A 1Z0AA 3RRNA 5HTOA 2KHZA 3FVWA 4FGWA 3RT9A 4P0QB 1AKTA 2ZJ4A 4KJZA 2Y93A 4X9XA 4FOSA 2X0JA 4E6EA 2G4VA 3N5KA 4R2MA 2BGWA 3IKMB 4KFTA 4NABA 3P0HA 2BRUC 1PLLA 3MD0A 4UC0A 5CJ2A 2XI4A 3FMFA 1YR8A 3L8GA 4QBHA 2AG8A 2G1JA 4AG3A 5FWNA 1QV9A 1TOAA 3U17A 8ADHA 4MUEA 2R6FA 3C1OA 1VSBA 4J0IA 4CQMD 3GAMA 1XB2A 1ZGBA 2J7PD 2QAIA 4UMEA 1R0YA 2OORA 3HWSA 2Q5OA 1B00A 2YV3A 1N1MA 3DLCA 4O59O 3H1EA 1IYZA 3FGPA 2P67A 3KQMA 4CUJA 5KKNB 4BFUA 3IBCA 5AVWA 3UYLA 2DPMA 4LDRA 1HQDA 3TK1A 2CDNA 4C99A 1Q12A 3HCNA 3A1VA 1DQZA 1QKKA 3LK6A 2ZE7A 3QJ5A 3ZHRA 4YRSA 4PG5A 3MJHA 3T9BA 1I6WA 2PIDA 5LQAA 2HV9A 4WJZA 5JEEA 2ZRQA 3O95A 1CUUA 1QB7A 1H93A 1KHTA 2WC1A 3M70A 3RQSA 2MSEB 4E08A 3IAEA 5E1DA 4NMXB 1RTTA 3G5LA 4IGAA 4QSMA 4Y2PA 2R3SA 4QFBA 2IU0A 5AVZA 4C22A 1GQYA 2XWSA 1BXRB 2BGNA 2DPYA 3WNQA 4B09A 4EYSA 1XVVA 3FB1A 1TEHA 2CJFA 2SKEA 3G7SA 1JDEA 2VATA 2W6MA 1VHWA 1K4YA 1A5TA 2VDVE 3SC2A 1T8PA 2EKLA 3IIEA 3KXLA 1IN7A 1K8RA 4JVNA 4X41A 2EW2A 2XPCA 3WWEA 4YQYA 2NU6A 4FQ7A 1DIGA 1SUFA 4ZAWA 3IBSA 1FL9A 3R4VA 1V2GA 1PFVA 5JBNA 1E96A 4QUIA 3KR0A 3KG2A 5HE8A 4KPYA 5E7MA 2SNIE 3VGPA 1IUKA 1L3CA 2J7KA 2Q3BA 1ORVA 5CX4A 5ER9A 3B1WA 3RU9A 2YRXA 1EXNA 1L4YA 1KP2A 2Q27A 2YUTA 4XLZA 4EELA 1OZFA 5JD6A 1X7XB 4NOLA 3SQOA 4J4BA 2DQ4A 2FYTA 1T9BA 4URYR 5DXJA 5A62A 3LHSA 1S2LA 3AVUA 4K03A 4QM7A 1WR8A 2EF0A 4P7JA 1CY7A 1RT9A 1XHLA 1ZSNA 2E37A 3OC0A 1HH4A 2ZKIA 1VL2A 4IXNA 2E4XA 2PFKA 4OYRA 3IKJA 1QANA 4Q03A 3UGTA 3C39A 4AO6A 2CD9A 5G0SA 4W6QA 1K5GA 3BF8A 3QVJA 4JT4A 3MXTA 1LDYA 3PQ2A 2ZRHA 3IULA 2DJ5A 2CV0A 3SWWA 1DEAA 1CY0A 1SXJE 3IT0A 4TWRA 1F6BA 1VIYA 4GLFA 3BBPA 2YWDA 4WBSA 1A8SA 3LDUA 5GIOE 2YIMA 3IQWA 3L8MA 3AEKA 1XA3A 2IIPA 3QOFA 3QU4A 3OICA 4JJGA 2FLVA 4G1FA 4IIBA 4LZOA 4OXYA 4OSPA 4GXNA 1Q7EA 3ZWOA 4RF2A 2RIRA 4BAGA 5JCJD 2E5FA 3QQPA 4X92A 2QM7A 4YRRA 2WSMA 3WDLA 3RWMB 1OXBB 4JN6B 1XT6A 4BJHB 2A9PA 3H6HA 1DJOA 3PQEA 2JGDA 3TKLA 1PHPA 2A9RA 2FW6A 3P0JA 4HDAA 5CLIA 1E4EB 2O4UX 3M83A 3A05A 3KVRA 5LBUA 1NONA 5BWNA 4ENSA 1XZPA 2V4MA 3BA6A 3THWA 1R0XA 2G72A 3R7LA 3D1JA 1IZZA 1HM5A 1QFSA 3A6JA 3GG2A 3Q2KA 4U9IS 2Q7OE 3HJHA 3TBHA 4OXIA 3AM1A 5HZGA 3GLTA 4OHFA 3KZNA 1K8XB 1EK0A 2AT1A 2YV5A 4MZXA 2IUEA 3PUVA