4IIYA

Structure of mccf in complex with glutamyl sulfamoyl inosine
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
335
structure length
335
Chain Sequence
PLLAAPLAVGDTIGFFSSSAPATVTAKNRFFRGVEFLQRKGFKLVSGKLTGKTDFYRSGTIKERAQEFNELVYNPDITCIMSTIGGDNSNSLLPFLDYDAIIANPKIIIGYADTTALLAGIYAKTGLITFYGPALIPSFGEHPPLVDITYESFIKILTRKQSGIYTYTLPEKWSDESINWNENKILRPKKLYKNNCAFYGSGKVEGRVIGGNLNTLTGIWGSEWMPEIRNGDILFIEDSRKSIATVERLFSMLKLNRVFDKVSAIILGKHELFDCAGSKRRPYEVLTEVLDGKQIPVLDGFDCSHTHPMLTLPLGVKLAIDFDNKNISITEQYLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of MccF with substrate analogs
rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords MccF
total genus 120
structure length 335
sequence length 335
chains with identical sequence B
ec nomenclature ec 3.4.-.-:
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02016 Peptidase_S66 LD-carboxypeptidase N-terminal domain
A PF17676 Peptidase_S66C LD-carboxypeptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Class I glutamine amidotransferase-like 4iiyA01
3.50.30.60 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 LD-carboxypeptidase A C-terminal domain-like 4iiyA02
5F5XA 3TLGA 3TLGB 5F1YA 4INJA 5FD8A 5JYBA 4H1HA 3U1BA 3GJZA 3SR3A 3TYXA 1ZRSA 3TLCA 4MJXA 3T5MA 4EYSA 4IIYA 2AUNA 5F9MA 1ZL0A 3TLBA 3TLZA 4JVOA 4IIXA 3TLEA 3TLYA 3G23A 4MI1A 2AUMA 3TLAA 4E94A 4E5SA 5K99A
chains in the Genus database with same CATH superfamily
4V0MA 1C2TA 1FRFS 4DWOA 4WGFA 1IK6A 1A9TA 2ZDGA 2QMOA 2RJOA 5A5FA 3UFXA 1D5WA 4S12A 1SHZA 5TQ0A 4MNTA 5K9ZA 2QN9A 4GI7A 4V02A 3CZ9A 1PKEA 3UAYA 4G0UA 1ML3A 3QPAA 1EUDB 1XNHA 4GU5A 4EAAA 4B3MB 3MCVA 1J0EA 3VJLA 3WIDA 3ZGOA 2UYCA 4DREA 2CJXA 1G7TA 3P52A 1EFTA 1Y7HA 3A1FA 2C54A 4JOQA 4XLZA 4GXQA 1E7YA 3KKEA 4QUAA 4PPFA 4D6XA 2PMCA 3S9LA 1LW6E 2JGFA 2B34A 1NI4A 3HB7A 2CSUA 4OQLA 3U80A 5IVHA 4ZJPA 2CNKA 4MINA 5IHXA 1GLNA 3IVRA 4GX1A 3RRJA 2Q2NA 1JNXX 1ZQ1A 1N9KA 4ROSA 3GFFA 1HNWB 4UMVA 4WKCA 5IMSA 1RI2A 3DZHA 4J7UA 4MKRA 5EQJB 3V32A 1V25A 5HCNA 1OXUA 5AKHA 1FDIA 1YK1A 3D7HA 5FPPA 3GH3A 3HRIA 1VGVA 3HKEA 2UVPA 2XXAA 2BV3A 4DQUA 3RVBA 1Q5XA 3EZNA 4AICA 1V71A 5DNWA 4CKXA 1VBGA 3HA3A 3AVYA 2B92A 3QEMA 3SEAA 1VL2A 2WP0A 3CJTA 2IYRA 3DZJA 4I1IA 4LAFA 3F1KA 4XCXA 5A5GA 3DEHA 4H4EA 3E8XA 3AJ8A 4HR7A 4AURA 3GT4A 4YRAA 1XQ6A 4JVMA 1ULZA 1J5XA 3D4PA 3FF3A 1U99A 3Q0IA 2VQDA 2VQEB 2R7NA 1NVWQ 1XMIA 4QFMA 3V9PA 4CMCA 1WXXA 3WADA 2FW8A 3VPXA 2PBZA 4C3ZA 3AKEA 4RJLA 3K6KA 1ZBQA 2J33A 5IH7A 4DIEA 1GKYA 2Q9UA 3TW0A 1RABA 1RYDA 4BTVA 1CQWA 5JH7F 2PKYX 1RWBA 4PGHA 5DB4A 1WUIS 3HP4A 3W4KA 4AJOA 3HFJA 5JISA 2GK3A 2AJLI 2XKAA 2L69A 4PYMA 3R8FA 5F33A 5ICFA 1DIKA 1ATIA 3V7FA 2IV3A 2BKUA 2DWOA 2A9FA 1LNZA 2BFFB 4CHGA 5M2QA 1UDCA 1U98A 2D1QA 3UY4A 1RKVA 1DIBA 2QX6A 1XBTA 1GPJA 1QGUB 1U3TA 4M98A 1L1FA 1O9HA 3VH2A 4BMCA 3RNLA 5IYZF 4GBMA 1GUYA 1H0KA 2GBLC 3DHNA 3AINA 4ZAXA 4B85A 2G1AA 2P77A 4G8BA 5IK2D 3FRHA 3U44A 1G59A 5M3BA 1E9CA 1GNVA 2PR2A 1YOBA 1HEYA 2QUBA 3QYPA 1Q92A 3H4TA 3RH0A 1Y48E 1ZGGA 3CCFA 3FNQA 5IFKA 3UWKA 2QYTA 1Q3TA 4RTRA 1ISPA 4ZYWA 4UCQA 1YA8A 1ESMA 4MUYA 1TLLA 4BLVA 3C4VA 3C8UA 2PL1A 3JYLA 4Y3UA 2QW0X 4HXGA 4Z9BA 2C7OA 3ZD6A 4LDNA 4QPZA 1OYOA 2ZUCA 3AW8A 2CDAA 5HRAA 2V7PA 2VHZA 3BD9A 1W52X 4EFLA 3LYLA 1UJ5A 1DG1G 3TRIA 4M21A 4QU5A 2PZJA 4MEJA 3G2OA 4ZDWA 3RSHA 4FGWA 3EZ6A 3IODA 4FHCA 5FWXB 2V7QA 4WUTA 4YQZA 3O9VA 3SXPA 2ODNA 1FFXB 2X86A 3MTGA 2OZKA 1N7HA 2YICA 3L7AA 3QIVA 1O94D 2QDKA 3Q9SA 7MDHA 2R1VB 2UYGA 5L3QB 2UUBB 1XD2B 2WTEA 2EZTA 3TI9A 4REQA 3D7KA 4ZGGA 1W73A 1Z8NA 4C5AA 4DUZB 1YI8A 4WLOA 4YQYA 1KIAA 5L6LB 3TBKA 1T9KA 3NHZA 5D87A 1EKXA 3PEFA 1QC5B 2J9FA 5IZ4A 3HTXA 4CKEB 4BNKA 1VJ5A 4W5NA 3QX8A 3JQ6A 3DPUA 3A1SA 4ZYZA 3Q0TA 1MZPA 1BQ3A 2NAPA 3K1AA 3OJLA 1YZQA 3URKA 9ABPA 1MG5A 2DBRA 1RJFA 3IBTA 1KZHA 3DE0X 3K9BA 4NP6A 4EUFA 3KEOA 4IRMA 4OLAA 2PX2A 2VJPA 2WT4A 4XPZA 3G17A 4Y2UA 2PY6A 5HF8A 1UQRA 2HA6A 3TLCA 3AUFA 3T12A 2PH3A 4G0PA 1FDRA 3MHTA 1IG0A 5F52A 1YJCA 4RZQA 4EMSA 3D3QA 1Z0SA 3OUTA 1B76A 1BA3A 4NZYA 5GJVC 3RC1A 4B81A 4DPMA 4WFQA 1QX4A 4RLHA 2Q3FA 1C3OA 4XPIB 4ID9A 1Z22A 3LOUA 4TMKA 3PUJA 3CVUA 1IK4A 2ZANA 5LZ5A 4TL9A 2E4XA 4I50B 3P45A 4XJVA 4K26A 4MUBA 3ND8A 5F77A 5DCYA 2IOQA 1ISIA 3LV8A 1QFMA 3DAYA 2VF5X 1ZCBA 3RW9A 4CDGA 2V4ZA 2C9OA 2ZAGA 3JYHA 3QX7A 4TT8A 5KNCD 1ZI9A 3AR5A 3OAAD 4OCZA 2GBPA 2H48A 4WN3A 3U13A 1W2HA 4HC4A 1RDFA 3C15C 3GA5A 3HR4A 2K5UA 5FV7A 1XMJA 3SC4A 1PEAA 3ZK7A 4FQ8A 4LZWA 4PAMA 3SS9X 1FFAA 3U9TA 1CUXA 3Q7TA 1S01A 2V8BA 4F4CA 3JWIA 4MQBA 3U56A 4F5DA 2ZROA 1O54A 3QLVC 4KNYA 1JHZA 1SQ5A 1I3LA 3C16C 4B5LA 2G0TA 1PGJA 4R71A 1DAOA 1T0IA 3DHEA 3IHLA 4B76A 1A0OA 2I6FA 4W8GA 1YZFA 2XRFA 3ROXA 1AK1A 3ZHRA 2DRIA 4E5MA 1RXEA 2VPZA 4A6PA 4FFLA 2EV9A 1KH1A 4RJTA 3ETJA 4BRUA 2ZSAA 1II8A 1U0GA 4XGKA 1U6KA 2J3HA 1SZPA 5K3OA 1TMYA 3U7EB 5C81A 5DYWA 1L4LA 5IC5A 1RHMA 2V6BA 1TUBA 4OFBA 4ZP1A 2CNWD 4PGMA 4PX9A 1P1KA 1GA1A 1NDHA 3K31A 1O95A 3GJTA 3H5LA 1LQUA 2WUVA 3ND5A 4Q82A 3DZKA 1E5XA 2EF0A 2IL1A 4JNCA 4WDRA 3DZCA 4I2NA 4LPKA 1CE8A 3TQSA 3Q1LA 2ONYA 2DEUA 3WXBA 2YNMD 1VECA 3CX7A 4Q3DA 3WWYA 4EI9A 1HLFA 2PRSA 2PH5A 3EF3A 1XTJA 3I3SR 1QLWA 3ABQB 2PZGA 5ULLA 1UBNA 4LDZA 2HWXA 3E15A 4LWPA 3GG2A 4L3OA 3SAJA 5ECYA 1KO8A 1AMUA 4KE8A 4C0JA 7REQB 2CW5A 3L8DA 5CP8A 4OYHA 3KT3A 1QP7A 1DB3A 4L27A 2JJ2D 3DE5X 2R44A 1WOYA 5JXJA 5CFOA 3WMRA 1UC8A 3EYWA 4MKXA 3QPWA 2X3UA 5KWEA 1FJHA 3BHIA 1GCGA 2AMYA 4PYNA 1YHZA 2AD1A 1QJ4A 3L84A 3TQRA 2DETA 4A6XA 4D79A 1EXMA 2CMKA 1H5NA 1AF4A 3C3CA 3FZEA 4BL5A 1D09A 3N7UA 4FYXA 4EPWA 4G67A 5BSRA 5I3CA 1XA4A 2AZXA 1BFUA 1JZSA 2VCHA 3MCWA 1BE6A 1LDNA 2C29D 4RESA 2OXIA 3CNBA 5TGTA 4BUJA 4E09A 4MLPA 2FEAA 2JFBA 3QQ5A 3TLGA 2EGHA 4FX2A 2F3QA 3EB9A 3Q5GA 1I0LA 4LRYA 2QTAA 2GZ2A 3MSXA 2XVXA 4HN4B 2I1QA 2R2AA 1AGXA 1B3RA 3VR6A 3OZDA 4HLUA 1QJCA 1IEXA 4LFAB 2XMRA 2F17A 2CDNA 2JNWA 3I1FA 3FSRA 5K7SA 3T0TA 1L7XA 2HA2A 3AVPA 1RRMA 1DJOA 2GN2A 4I5GA 4BE7B 3GLGB 1YASA 1ZXXA 3MF4A 4YC7A 5DEIA 2YQ4A 3JQFC 2G63A 3PFWO 3OZAA 5IN5A 1E94E 1VSUA 2WMOB 2Y0EA 1K89A 1IPEA 3HE3A 3P0FA 1N0HA 1JFVA 3GQVA 4HB0A 3UGJA 4OSOA 1DRKA 1WKVA 3IQGX 4YI5A 5EMLA 5FDFA 1ZK1A 2EGGA 2AXPA 1ZD8A 1ZMBA 1YDEA 2X1VA 3AQ4A 4IIHA 1QFXA 4XSGA 4UOZA 1H6DA 4E15A 1Z8LA 4DJAA 2B82A 2CHVA 2ZJYA 4ND3A 3TH5A 2OD7A 3H7IA 3MINA 4Q66C 1O0SA 1NMXA 4PQRA 3FYUC 2ONJA 3QVOA 3WYNA 2AEFA 1J0XO 1EJ2A 2YBDA 5U1PA 2OOKA 3RIHA 1X1BA 3AZOA 5HM6A 5KSZA 4OB8A 4YMLA 4U6NA 3R3XA 3FDZA 1KE2A 4UKDA 4IUYA 1Z13A 3JD1A 2GAJA 1U7DA 2XMPA 3KR2A 4MUXA 1OQAA 1Y1LA 2OFPA 1VLLA 3INRA 4HXEB 2QDXA 4Z9XA 4D80A 3TW6A 2CXNA 1S8OA 2PKXA 3HXLA 3C5EA 4ER3A 4JJZA 2WHPA 4NPHA 3T1OA 2GCNA 1GZSA 5BV1A 3QKWA 4MGKR 1JLKA 2AJ8A 2JI8A 5IKMA 1RQNA 1RW4A 1KTVA 1YB4A 3Q87B 2WJZB 1TM3E 2GHQA 3DFMA 4HRVA 3GT7A 4RW0A 5KDLA 1L4YA 3CF2A 3K9NA 3LJKA 1X1DA 2XV1A 3G5AA 3JWHA 4N5MA 4WINA 4I55A 5CNKA 5J4HA 3T3NA 3OCYA 2QAGC 4AP9A 2XMGA 3L4KA 5I3ZA 2PGNA 421PA 4XGQA 2XXBA 1E20A 2X8BA 2F62A 3D7SA 2QI9C 3OLWA 1VIDA 5GIPE 3UKOA 3JW8A 1WO8A 3AESA 3CPEA 4DSOA 1GITA 3PZBA 1YUBA 2W4QA 1GADO 2Q7DA 1R0LA 4MR9A 3DTTA 2I2CA 4EECA 1PJ3A 1X7ZA 3A3NA 3EZ7A 1I6LA 1UIMA 5TQ2A 1JDPA 2WIKA 3E0QA 4Y0AA 3T7KA 4EY8A 4BBAA 2IYSA 2RHDA 4BKMA 2QE7D 4QDJA 5AVQA 4YJFB 1ZU5A 3B3JA 5C8VA 1U5CA 3WL7A 4RQBA 1KMMA 1C3XA 4U5XA 3KOXA 1X8JA 4BMZA 3P32A 1S8AA 1XPJA 5HK8A 4M54A 2GFIA 4I4LA 3HUEA 2BZSA 3M3DA 2WFLB 1JJAA 4P44A 1MO6A 2D1SA 5AI5A 4Z3KA 3G2PA 3WISA 1R50A 2RHCA 1NJ1A 2PGAA 3ADOA 2V5VA 1QE0A 1XRRA 3BXOA 1JE1A 2IHKA 1Z63A 1TIBA 4YTEA 1OBVA 1TPYA 4FLFA 5EMNA 1HQYE 1LSUA 1TJ4A 1P5RA 5DI3A 2HIHA 4AX8A 5E1DA 2W11A 4ZI3A 4E46A 4E31A 3K8OE 1MV5A 2QENA 1UT6A 1M1YE 1IZ7A 3S28A 2O3RA 1SBZA 3OOYA 4UJ3A 2JLSA 4P5PA 1WB5A 3CZQA 3FVWA 5B1SA 3RU7A 3OTGA 1FIUA 5THKA 1CUYA 1NXXA 2NO6A 4M8LA 5JBNA 1M2WA 5IFLA 1PUXA 2HREA 3QPDA 1IY0A 5FO0A 2CYAA 2YXEA 3C3YA 1AKMA 1GT91 1JEJA 3QXHA 1JB9A 1K2WA 1I2BA 1T8PA 2DUNA 2WUDA 4MPPA 2EVWX 1AF7A 1B26A 1LBTA 2V8OA 1PZXA 5EE0A 2AMFA 3K53A 4NNOA 4DXDA 4QG3A 5LD2B 3WL8A 1HDRA 3NZEA 2CHUA 3EBLA 2FZEA 1OX4B 1Z25A 4OREX 1T43A 4UM8B 4ZHQF 3RFFA 1LTHR 3L0YA 4YJ2B 3HO8A 2IY7A 3I1IA 4HSEA 4QSHA 1B6GA 5B3AA 3OEEA 4JLUA 4EY7A 2P68A 1AVTA 5LXTA 4WN9A 4CG2A 3FNFA 4ZGWA 1JU4A 1NUUA 2WG0A 4Y6GB 2IUUA 3N70A 4EG5A 4DSTA 3OE7A 2PKWA 2VA9A 1BIFA 1F6WA 3I39X 4NBLA 4RM3A 2D0OA 1OFGA 1ESDA 1XCPA 3DMGA 1UBCA 3DDWA 1YSCA 2JFFA 4TS1A 3JZFA 5TC4A 2AFIB 4CIAA 2R86A 3BFJA 1RWQA 1UKCA 3GL9A 3JTMA 4UE6A 3VYTB 5EUBA 3ZZ1A 4EITA 3GAMA 3MGAA 3RJ5A 3G7NA 4IWYA 4TWBA 4UNSA 4WZAA 4BN5A 1LGYA 1E0KA 1BO6A 1OLUA 2OUIA 2P8SA 3A26A 3HU5A 2GARA 4FZ5A 2NU9B 3VPAA 4DWVA 2WKPA 1AXRA 3ED5A 3N7AA 4WGGA 3QU4A 3FJOA 1PUIA 1DL5A 3HK2A 5FUMA 5FLYA 3GN1A 2QWXA 1A8UA 1VPDA 2IUSA 2Q3DA 5K6AC 1B14A 4TV9A 1DX9A 2QN2A 1V1RA 3W8DA 1XGKA 2WV7A 4AJ1A 4ARZA 1RQRA 3HN6A 2V9ZA 4RKEA 5DMHA 5TMPA 3SBEA 4V0LA 3B1YA 3U5ZB 1SN7A 2J5BA 2PVPA 2WJ4A 3WBJA 4TTJA 1TK2A 5AOAA 3LVQE 4FLMA 4M7OA 2N47A 4PLZA 1QCCA 4CETA 5KSOA 4D9CA 2WRZA 1FU7A 1NOIA 4QODA 1Z26A 1Y7LA 1ZVQA 5C4MA 2KPOA 4IJKA 4B4UA 4D8XA 1HDEA 4ENPA 3H3FA 1YJQA 1B16A 1WV1A 4JXKA 2I78A 1L5KA 4DV3B 1QTIA 1PZNA 2HNAA 1S2LA 3UKDA 1E5TA 1P81A 1U65A 1Z62A 5DIFA 1N2CA 2H3HA 1WXEA 3AF0A 1F60A 2QPAA 3LKVA 2XDQB 2QN3A 4RMGA 3R0IA 2HK6A 5DBOA 3QXSA 3NM4A 3ZHBA 2WWHA 1SUAA 3E9QA 1KMCA 3OUZA 4PG4A 3M5WA 2YV5A 2XTAA 3GJ7A 4TL8A 3U48A 2A57A 1J8VA 3GDWA 1N6NA 5IT0A 4GOXA 5BWLA 1ZCZA 1T2AA 3IBYA 2O8DA 3VHQA 2AC2A 5H59A 5HKOA 5KU7A 1EVJA 1PEKE 4Z2YA 2FU5C 4W8OA 1T8UA 2JCXA 2ZRAA 3DJYA 4PSAA 3OY7A 3JVVA 1PT7A 3H6HA 2VJCA 2XB8A 1G9XA 4OGWA 3IIMA 5GQSA 2P9EA 4HBGA 1I7QB 3N2LA 3ZGYA 3CR8A 2IZ0A 5BN4B 4XYGA 4W5TA 3TECE 3HY3A 4FEAA 2YFYA 2A88A 1M6VB 5F76A 1AJEA 4GKBA 4HWGA 1P2BA 2Q28A 4MI3A 4OQMA 1TW3A 4TQ9A 2QLNA 3DCNA 1DI0A 2BFCA 3JQFA 1JHQA 1LDMA 1J8FA 3DWEX 4PX5A 5IM4A 1XMQB 1NBAA 1HT1E 2XOKA 3G0OA 5KYUB 1ZH2A 1ULTA 4GSYA 3UJ8A 4J03A 1W0JA 1H85A 3RS7A 4GI5A 2Y67A 2WTMA 5L8VA 2O6LA 1QZXA 5B1EA 2AK3A 1FP4A 1GIAA 1PYOA 4QO7A 1UWCA 4IL5A 2AIRA 2NQTA 3RAGA 1TF5A 1YUNA 3RK4A 3K3PA 2C4HA 2XE4A 4U2GA 5CIQA 3IUEA 1P7PA 5JAZA 3CVVA 2J0SA 4MW9A 3MIZA 1PE0A 2F7SA 2H2IA 5ALRA 1PG0A 1E9AA 1MP0A 4UXJA 4PSKA 3BT7A 4M9UA 2A4KA 4QTTB 4RDIA 1XTVA 2IXBA 3O84A 2FPPA 2BUBA 3BCUA 4X54A 2VQSA 1HOTA 1RWKA 3H8VA 3MK31 2YW2A 3O9MA 3SXUB 4YV7A 4X65B 3TB4A 5EIXA 4B4KA 4GLLA 1M6YA 2V3VA 1XVLA 1DCFA 1SVKA 3DYVA 3ECAA 3ENWA 1N77A 4Z53A 3ESDA 3OLYA 1N6OA 4Y0NA 5EKDA 3QE2A 3DOHA 3WLIA 2IXFA 3WV4A 3VAZA 1C4XA 1IEQA 3H4IA 4LZAA 5CDHA 3ITEA 2AL7A 4RVCA 5FH9A 1IOZA 4NENB 5HKLA 3KSMA 1H8ED 2UZIR 1RJEA 3MRXA 4HLCA 2ONCA 1QF6A 2RAVA 2AFHE 1GPMA 3SQMA 2XQIA 6ABPA 2QUJA 3JV7A 4AKTA 2ADFA 4MCSA 5GM2A 3ICVA 5LC1A 3DAHA 2FHSA 2ABWA 1YQUA 3PFBA 5EMJA 5K4AA 1YUMA 1KU0A 4MB6A 3M9LA 3DW3X 3PTLA 1A9XB 3GRCA 3EVBA 1H22A 1L5MA 1V1MA 5DCUA 3RROA 2B3TA 4HQKA 5E6SA 4ZTZB 5F7JA 3DCJA 2IW3A 1JR4A 2WSBA 4PAGA 1BXGA 1SCUB 2HUPA 4P5DA 3UT5A 5JXHA 2I2BA 5IKEA 3T07A 2JDIA 3E5RA 4GYWA 4RIHA 3SJZA 1WRBA 1PQPA 2FE1A 2JFZA 4GYJA 3QMWA 3W3AA 3DOFA 4KI0A 1PW5A 1W88B 3BH7A 3T3OA 1RXWA 4HVAA 1C41A 4Q9KA 4DXHA 4ZYTA 3ONEA 5DI9A 3CKYA 1XZGA 4ISCA 1I01A 2LVBA 3FZYA 2GBGA 2PGJA 1RE0A 1FP7A 1KA9H 5F2NA 4A7PA 5J47A 1E9SA 2BOVA 4KV9A 1UBOS 2ZE6A 5AKLA 2JCBA 3STVA 4RMNA 2M1ZA 2D62A 1T36A 2XQFA 1WB4A 2ZWMA 3IA7A 1U31A 4N82A 1CULC 5FI3A 3DXXA 2NSYA 3KO8A 4G23A 4GWKA 4ICIA 4OM7A 4PLFA 1ZNWA 5ELXA 1EUYA 1YR9A 4K9QA 5AJUA 5ITZB 3TNJA 2B25A 3WFJA 1BSVA 2Q8QA 1Z16A 1EXVA 4HEA1 3RF7A 3STWA 5BN4A 4Q12A 4M2LA 3S68A 1V3UA 4YT8A 3PBKA 4OHZA 3QP9A 3LTNC 1MVLA 3AV0B 5TS2A 3KASA 1A3CA 1EHCA 2BBSA 1T8TA 1QVWA 2Q5QA 2X0KA 3QPVA 1H05A 2ZBQA 2NXCA 4QUBA 5CT8A 5TY0A 2FMHA 2XZOA 2H1HA 2W2LD 1VPVA 2XMBA 3KYCB 5FNVB 4C99A 4JI6B 1VCIA 1MEJA 3CG0A 5T4HA 1P7VA 3EXG1 4ZI5A 5K3CA 5FTNA 3S2UA 1DEHA 4C8AA 2VDNB 5FTLA 1OE0A 5AM0A 4PO9A 4S2UA 2I8LA 1I1OA 3C2QA 4L16A 1M1YA 2IKSA 3BH0A 3WA6A 1J6UA 4RADA 1N2EA 4RE6A 4HNHA 4JHLA 4DNFA 5CA1A 4X3CA 4RFSB 2XAUA 3FNHA 3M4YA 3EPLA 2JD2A 3K9QO 1WNFA 3SYKA 4AP5A 3BC1A 3AKZA 3V48A 1TCVA 2FSVC 4IO0A 1IUNA 1FDTA 1N92A 1YDMA 1NBWB 1CD5A 1UKAA 2BGLA 2H8KA 2ODEA 1PL0A 2R8YA 3U4IA 4DLKA 3LQRA 1X2EA 3EVGA 1PSDA 3H5AA 5J4LA 1J0DA 4F11A 1JHMA 3DP7A 3H1EA 2VZ9A 2FPXA 2QY6A 3M4XA 4OUDA 5ERGB 3U7QB 3WICA 2C6PA 3P2IA 4WI1A 1N2BA 1BS1A 1GCAA 5CT9A 4F3RA 3I62A 2MYPA 3IDQA 4LXXA 1BVRA 1J3LA 1A4IA 4I8XA 3RCBA 1VIVA 3BGOS 5EINA 5J3JA 4CMIB 2OV4A 2HLNA 1YB2A 2YWFA 4K9DA 1RFGE 1U6JA 1DPFA 3F9IA 3HL4A 3WWCA 1R00A 3H6KA 4BHTA 3KDSE 1CZLA 1Z5ZA 1CF9A 2H1OA 3IAUA 4MRMB 2OGTA 2P4UA 4YAWA 2IGTA 5BVHA 3I64A 2PS9A 2ZYAA 5HPYB 4Q24A 1JFLA 2FWJA 1VFPA 3BXXA 3QVKA 3WV5A 3GQBA 4Y1EA 3RKRA 3EDMA 1LU9A 1ZQ9A 5CHEA 1TTQB 4LRQA 1UIRA 1EAYA 4YT2A 1K4MA 2YTZA 1NXJA 5B7PA 3DKIA 2WEKA 1UJBA 1U1IA 3JWPA 1Q0ZA 2G4LA 2YZNA 1L4KA 3AJDA 3MMXA 3Q7RA 3WMXA 3ADDA 4GKKB 4ONEA 5JJIA 1VL5A 13PKA 2WWXA 4FWIB 3DV2A 3RYTC 4BJHB 2PA0A 1TCBA 2PUTA 2Y8EA 1DEKA 2O2ZA 1CUBA 1ZRMA 1T5HX 2V6GA 3AG6A 4WE3A 4YMTA 5CJ2A 2DP4E 3GEGA 4DUYB 2F8TA 3F6YA 4CVNA 2EFYA 3GVPA 1MV8A 3UPUA 1GSOA 3OZCA 4ZT5A 1Z0FA 3CQ9A 5JXWA 1YT5A 2GA8A 2X6QA 1HLDA 5J63A 4F3KA 4F85A 1H6CA 4BZPA 5FUWA 2XWJI 2CK3D 4JUCA 4ND8B 4PYQA 4P4JA 2CD7A 2GB4A 2Q6IA 4ER6A 1AKTA 4REQB 1WPQA 2XMSA 3VU3A 1JS1X 4KQWA 1CV2A 3WAGA 4OUDB 5KDOA 3UXMA 3A25A 2IU3A 3H0KA 4OJQA 1IBKB 1DZIA 2A5JA 5ITSA 3P26A 4NZOA 3V46A 2V96A 3DZGA 4XFDA 2QT9A 3CZAA 4EG1A 4XM1A 5FJIA 3ZWVA 4PLPA 4YROA 1FA9A 4AC9A 1ISRA 2O8VA 1VXRA 1PHPA 1RI4A 4M1KA 4HQNA 4B1FA 1VLQA 3AHHA 1D0SA 5MN5A 1T8WA 2IOFA 3GRPA 3W9SA 3X1JA 3LA6A 1VPEA 1EQUA 3L93A 3TAUA 4QHYA 1VJ0A 1W85A 2V55B 4URZR 2AG8A 3JVIA 3QXJA 3AGPA 4AZTA 4CGYA 2ZUFA 4MYDA 3GGCA 1F7UA 3LF2A 1QGDA 3F5SA 3HR7A 3MSCA 4DPLA 1W5TA 1PR1A 1PR3A 2BCJQ 3GLKA 5FNZA 3BTUA 1K7YA 4H0CA 4CDKA 2YCBA 3CH5A 4MP3A 5AW9A 3A31A 1DS6A 5JNLA 3ESBA 3NTUA 1BQEA 1NJSA 4LSMA 3GW8A 4NJOA 4D8VA 2O7QA 4MLCA 4ZQEA 4BFTA 4FE7A 2A5GA 4K05A 2C6CA 1CRQA 3AYZB 3MBIA 2Q5IA 2ZAMA 3C3PA 3NB0A 2VNIA 5BN5B 4MA0A 5ICGA 3RDPA 4BB6A 3D0QA 4QXAA 2R87A 4EJSB 4ZFNA 3ZDRA 4A5SA 2CLMB 2QRZA 4Q1CA 3UM9A 2FUEA 3ZE1B 2PFGA 3GROA 4DLRA 2BTQA 3BMNA 1XIVA 3BSWA 3I0NA 3S9NA 4P3PA 2XDWA 2HMTA 4JX9A 2RGDA 4LWZA 1NT4A 3X1MA 4CCWA 2BMAA 1J90A 5CA1B 2HDNB 1G41A 2CL0X 3I5MA 5ANRB 3ZWMA 3SJUA 1NUHA 1PJZA 1Z33A 3PCXA 4L8LA 1JSZA 1YC2A 4ASUA 4G63A 2RAPA 3ZDFA 1EVLA 1RAFA 1EGMB 2QT1A 2RGBA 3K1AB 4HGQA 2EX0A 4MSUA 1RE1A 3TNFA 4AY3A 3N2GB 1KBQA 5EKSA 5PNTA 5AICA 1Y6FA 3BDVA 2F4NA 3G5TA 4Q7EA 2JFNA 3O90A 5CUQA 1KQNA 5EZYF 4B9EA 5A4JA 2GLTA 3HI4A 4K9PA 3JWGA 3EXAA 5EHZA 4JYZA 2X0IA 2Q6VA 5LXTF 1MO2A 4N47A 1C1DB 1XXHA 3WRXA 2AFRA 4EI7A 3KJEA 1EVEA 4Y8VA 4W8HA 1BE0A 1L7AA 1XO1A 4JP1A 2Z09A 2V0CA 4M9ZA 1DTSA 1PS8A 3JWEA 3P8ZA 4W5HA 2G40A 2QRVB 1EK0A 3QK7A 4PEVA 4OI1A 3V4VB 4CV3A 1RZVA 3I2IA 1JJFA 4U2BA 3VHXB 1JJIA 1XCLA 3NHUA 1GFIA 4G86A 1DBQA 4BWGA 3ESXA 4PC7A 4UHJA 5IP5A 3MT9A 4FPXA 3T7IA 5EVJA 1U1FA 3VO1A 3HWX1 3IJRA 1KWKA 5ED4A 4Q47A 3OPYB 5BT9A 5BSMA 5LYJA 5L4LA 3PQFA 4F06A 3JY6A 4PZLA 1XCGB 3BTSA 3G0IA 3NBXX 1B8UA 3ZH2A 4W9MC 3PXEA 2GN1A 4RANA 3SNKA 3LA8A 5J4VA 1MJGM 3FOFC 2F43A 3N53A 2WP8J 2ECPA 4O2AF 1MB4A 1UDAA 4Z1MD 2XA1A 1OI4A 2IK8A 2PTGA 2Q99A 4AM8A 1T6YA 3K32A 4I19A 1SU7A 1C2YA 2OC4A 4KXMA 1I1QB 3R41A 5ALOA 4KE6A 3MWDA 2BW0A 2G17A 4E13A 3EE6A 3T5CA 4GO1A 4LTMA 3U60B 4IOKA 3S1AB 1KFJB 4YMWA 3HEMA 4KHPB 2HIGA 1R9GA 1OKKA 1AX9A 1RWWA 1Z5NA 2X8WA 3GXBA 3JASB 3M6IA 4H3SA 2FOXA 3AWDA 3HUFA 2GN6A 2H1FA 2V98A 3EFOB 4HDKB 1LTQA 3A9SA 5ALPA 4Q4AB 3L6UA 2V1XA 1AQIA 3PNVA 5T4EA 2B36A 2NVBA 1S1MA 2RGYA 5BW8A 4RHUA 5C7YA 5JNSA 1DARA 2FWBA 3RHTA 2C4WA 2ZSIA 1VL0A 2NO9A 2QG4A 5IASA 2X4IA 4WUVA 4ZCMA 1YVDA 2XEXA 6REQA 3JVDA 1UR5A 4ABYA 1Z6YA 4PX3A 4AY5A 4JV5B 3PC6A 4OC3A 2ALJA 2GJ4A 5I9MA 2OXFA 3S5JA 2IEIA 5A0VA 3HBAA 4IUDS 4DJTA 1SPBS 2PNJA 2R00A 4O5OA 1PNOA 4L8YA 2FSGA 2P3QA 3TW8A 3EEYA 3BWYA 1XTZA 1ZP6A 4RL6A 4EVRA 3I01A 4F2DA 4ZRDA 2JGJA 3CSDA 3C1AA 2PRYA 3K71B 1QLHA 3V8RA 4N9WA 3NOJA 4ZALA 5JAMA 1NPDA 5NLLA 3L6OO 3R4VA 2OLEA 4KFCA 2ZUWA 2P0YA 3ZNOA 4GP6A 5CFQA 2FMTA 1PJAA 1UEJA 4IDHA 1W49A 4BV8A 4C2AA 1UPXA 4XUGB 5DT9A 2DT8A 4TWEA 1LLDA 3IOEA 4DFDA 1J7KA 4PINA 1Q0UA 2H1IA 2PLAA 2I4TA 1NA5A 4EY3A 5MFZA 4CEHA 4BC1A 3ZNPA 3VH4A 4PO3X 3VH3A 1I5EA 1O5OA 1OZFA 4K9MA 4HDAA 4BYMA 2O8NA 4BCDA 4B33A 2IBSA 3D59A 2ZJBA 4OB6A 1RYFA 4IXWA 1N5RA 5AUOB 4ASUD 4E51A 3UMFA 2EW1A 5HTKA 1EU1A 1K8ZB 1OCEA 2I6XA 2J6HA 2A1UB 2Z8ZA 1GYQA 4GQIA 4TKLA 2NUTB 3LL7A 2PIDA 4AKIA 1Q7EA 2BI7A 4PYLA 4G1EB 3QIAA 4CIDA 3D8RA 2PT7A 2FK7A 1BEZA 1DXOA 5JW6A 3BI1A 1HE1C 4W6ZA 4ZZIA 1G64A 4R7GA 3UWPA 2P7HA 5KVAA 4MVJP 2HWKA 3MTJA 2WSSA 1GG8A 4ARCA 2FPIA 1ILWA 3DVSX 4QC2A 3WQBA 1IYZA 1C9EA 1WD5A 4HLQB 3WMWA 3UT0A 2GEUA 2VYVA 3OLCX 3T3PB 4P2GA 1C3EA 3GYBA 4NONA 3L02A 2VHTA 1TD1A 5EKTA 3X1WA 1NQAO 4YJ3F 5FYQA 3H2KA 4CQNA 1R8JA 1D4AA 1YGPA 1R4NA 2IEYA 3DAFA 1I2ZA 4FKBA 2QP9X 1SXQA 3I23A 5CFMA 2PMEA 3Q6IA 1CFJA 2GBIA 1N57A 1CLEA 4ROTA 1CP2A 1V2GA 4C2TA 2H4YA 2P91A 4OHVA 2QJRA 5DX8A 3FOEC 3WNQA 1N5KA 4AXBA 1FSPA 3RAPR 2ZYTX 2FPOA 2Y1DA 4DQDA 4IYJA 4DZRA 3PUKA 2OCXA 1Z5OA 3PQ7A 2V0NA 5D3QA 5C0OE 3WK9A 5A4MS 4RTQA 3HJCA 4GHWA 1R1DA 3TZBA 3ETHA 4UDOA 3BIJA 4A2WA 1X0XA 4F8YA 1LPBB 1XTQA 1S2NA 5HIMA 2N1MA 3V4FA 2NYUA 5DNYB 1DRUA 3U31A 3WLAA 2Q0SA 2R6DA 2JZCA 3JQAA 3ZU3A 3H16A 1N3YA 2C9ZA 3ZLUA 2XB9A 4XKJA 2WJGA 3NKLA 4N5LA 4O29A 1V26A 1G3MA 1NN1A 2WUGA 2DBQA 3GLIA 3EOAI 1ZM4A 2WNIA 2Y9PB 5ILOA 1VDZA 1AQJA 1E1RD 5K0CA 4Y9DA 3U7GA 1U0JA 2YIVX 2GPAA 1UXIA 1K6JA 2VG8A 4UVEA 1QV7A 3CKLA 4ACBA 1P18A 2OD2A 2QTBA 3GARA 4EQZA 3H5TA 3FMVA 2YHIB 4F3TA 2WHRA 3C48A 4HAVA 5EMMA 2C98A 4DRXA 2W9XA 5AI0A 2H63A 2Z3WA 3ASYA 1D1TA 2R25B 3JQDA 4XVRA 5IEJA 3IOBA 2R8ZA 4J0IA 3QEJA 4F21A 4H59A 4WOCA 5CEFA 5U9CA 4XSVA 1GAJA 3ZHVA 4ZC1A 1W75A 1NQOA 4YCDA 1H2EA 2RG1A 4Z7OB 3RBXA 4P4GA 1J2EA 1OMOA 4BFUA 4E1AA 4TS3A 1POXA 3G89A 3D6MA 4Y2RA 4QWWA 2O7RA 1GZVA 2BEJA 2FB9A 4FONA 2PLRA 1SUPA 1QK3A 1VG0B 1XLTC 4FW8A 5LA6F 4A73A 2DE0X 2X1MA 4TKZA 4KNWA 5KOHA 3RRFA 2J5RA 3FUUA 4MUAA 4JVOA 1L5OA 1E1RA 3G23A 2UUPA 3SC6A 2C2OA 2DHRA 5BSGA 3L7YA 4C2BA 5ESWA 3C3MA 3TFWA 3TR5A 3JARB 2W93A 5ALMA 5BMOA 1SVNA 1CKEA 5JVLA 2QL6A 3AB3A 3EQ6A 4DCPA 4NNJA 3AOGA 3UBTA 3PDUA 1AQYA 2BJHA 3MAAC 3EH1A 3VPSA 4I4IA 1R6UA 1UINA 5SZJA 2RB5A 1BKDR 1HXHA 1YZNA 1QIJA 4R8KA 2OGZA 5E38A 4L76A 5HE9A 5IAEA 2BFBB 3EPPA 4TZKA 4D3SA 3BWCA 3SI7A 4DRYA 2WJWA 2DFDA 3C7TA 3PFNA 4YDRA 1AA6A 3Q72A 1DHRA 4NOLA 2R85A 1RBMA 3SBXA 1XVTA 2WU4A 3G2LA 1I3MA 4KXVA 3T5DA 3JAMA 1JLRA 2KX7A 2VJMB 2VHEA 3CLHA 3E9YA 4A6DA 4XD7A 2H4HA 4NOMA 3DQPA 1LQTA 1E4EA 4XUEA 1YA4A 3ZDQA 4EG7A 4ETMA 4OAPA 3M5CA 1FXWF 4OPMA 3OZSA 1VBKA 4MUEA 4AU1A 5JJBA 4G1FA 3WKDA 1G8HA 3ZWKA 4NTZA 2OO3A 3OT5A 2X42A 2BMWA 1FNNA 1Y3HA 4QVGA 4UM7A 4YJ2A 1UBGA 2DFNA 4YPFA 3MD0A 3QXXA 1KJYA 1L4MA 1UBKS 2IBMA 1WPXA 1CYDA 2AMLA 2OQRA 3FWYA 5JH7B 4IGEA 3R23A 1YVRA 2AQ8A 4OFZA 2WNSA 1SC3A 3QEMB 4U1RA 1M74A 3CKKA 5ETJA 4Z0HO 3C98A 2BCEA 2ECKA 3PR1A 1IATA 1R6BX 3RHZA 3TLBA 4YMIA 2ENUA 4TM7A 3B2QA 4C0KA 4EVIA 2J7PA 3ZWDA 5H83A 5K09A 4F2WA 1YFKA 2ZREA 4KAAA 3QWAA 2ZWIA 1ZRHA 5KTOA 3FOZA 3V80A 1TK3A 1P3Y1 3NTVA 2B20A 2A0YA 2GAFA 1U0LA 1WTCA 3N8HA 1GCOA 1YJXA 2JARA 3AHJA 2D1RA 2WSLA 4QXRA 4ALKA 1QZ3A 4AMYA 3KEFA 4WNIA 1MXFA 3JQAD 4Q39A 1MLDA 1F20A 1YB1A 2SKEA 3O6VA 4NBSA 4QFDA 2WTAA 4YONB 3SZGA 4FZ3A 1HSOA 2O7SA 1NI4B 1VJ1A 1VI2A 2GWRA 1L2TA 3KQYA 1ZUHA 3BGDA 1KHTA 2X76A 4JKYA 4Z9YA 4WCFB 2V7WA 3WKAA 1I7NA 2E82A 4I2VA 4JBXA 4OP3A 4QEKA 3HDJA 3H8WA 4R8VA 1AKEA 3P2MA 2C5AA 4GMGA 3CUSA 1UJCA 3OWHA 4KG7A 4ND7A 5B57C 4KQXA 3UWSA 4EKDA 2EZBA 2CJWB 5C46F 4HQRA 1DOAA 3KQKA 2FPWA 4UEKA 1Z6QA 2PLNA 3U0BA 1T24A 4A36A 2J6IA 2VEOA 3NV7A 4MWOA 2FZGA 2V6MA 2XRYA 2FN4A 1GN9A 3NANA 4F4DA 4A8JA 3QU7A 2GJKA 3HEAA 1PX0A 4ODIA 1XE3A 2JHAA 4PIPA 4R6XA 3A4IA 4BNHA 4CEIB 1VJCA 3GEEA 1D9ZA 1Y3DE 3AXSA 3SSOA 1EFKA 3FA2A 4G9BA 3NYRA 2N42A 4R1NA 3CF0A 1UBMS 2G5TA 2IY8A 2P4EA 2FZ5A 3E70C 2F1OA 3P2YA 2GN4A 2XYQA 3KJZA 3NEPX 1QAQA 4IGFA 3EWNA 4OMUA 2YYZA 5LZ9A 4AUKA 4MXDA 4NG5A 5B64A 5CVVA 3RVDA 3PVCA 2WZBA 1E3MA 2FVXA 1EBFA 2WAAA 5SY4A 3A06A 4IZ6A 3COSA 4F6RA 5DEOA 1RIIA 1P5JA 5HP4A 1HURA 2CVPA 3R6LA 1Y34E 2JBWA 1Q12A 3QFCA 4K2AA 3NMUF 4PR0A 2WIDA 2IIQA 3L40A 1Q83A 3A3OA 3IX7A 2PUAA 5LDDC 4E07A 1M6VA 2PT9A 1T6XA 2E1PA 4KN9S 4QRDA 1KR2A 5EQDA 1YS9A 4CKBB 2WYWA 2GCOA 4R31A 1I3CA 1OXVA 5DHTA 1U9ZA 1YU6A 4KQFA 3Q98A 3TINA 2VDUE 5LM3A 4FHZA 1E96A 1TZBA 5IG2A 3MCTA 1U6IA 1W5BA 1VHTA 2JL1A 3PQDA 3T7JA 3VDNB 4TXLA 3FHLA 1JT2A 2Q6LA 2ZDQA 4JWKA 2ACEA 3VI3B 3AUKA 3ZX5A 2HNBA 1MKYA 2AF4C 3R5KA 4KBGA 4EWLA 2QE6A 2MINB 4N7MA 1AG9A 5EJMA 2ISQA 3PFHA 4O0MA 1T0JB 2KS6A 3QV1A 1IQRA 1P1JA 3BEDA 2BFMA 1JRLA 3FHOA 4JMLA 3UAWA 4ZI2A 4C05A 2PMFA 4PZUA 1DFGA 3SDBA 5D85A 3UKJA 3NRBA 1FUIA 4DV2B 2XSZD 5LFAA 3R74A 1T3SA 1YDFA 2BKXA 3OQ6A 4QATA 1WXHA 2O9JA 3GX1A 2GK7A 2F3SA 2ZWOA 5D7BA 3NBFA 4MWZA 1PT9A 2C6GA 4MI9A 4MYRA 3HQ4O 3RKUA 1VE1A 3UWMA 4EGAA 2KM1A 4NGMA 4JGGA 3B13B 4KVFA 3PIRA 1RPTA 1Y6ZA 4OMDA 1VGQA 4F8EA 3BILA 2D59A 2A9JA 5HGJA 3Q0EA 1L7RA 4UM9D 521PA 4E1VA 1B6RA 5IC6A 1R8SA 5JG7A 4R2MA 1D8TA 4WKNA 4ZODA 2P6UA 1JPUA 1TF7A 4GOJA 1DEXA 1P2DA 1TTHA 4KFRA 1VRVA 5AI4A 4RPGA 3SFZA 3N6RA 1GGEA 3NJRA 1S8FA 4YV0A 5GZ1A 5KOJB 2IYLD 3HC7A 5KNDA 1E2BA 3PVSA 3U81A 2X7XA 4P4FA 2AI2A 5BXYA 1JEAA 1NPYA 5G1OA 3DAGA 1J49A 4CKWB 3TTVA 1PK7A 1XPOA 4ML3A 2F8SA 1E3WB 2CDCA 3UHPA 3FZNA 4EHBA 3DSRA 3MJFA 4R1LA 5CPFA 2G71A 5TQ2B 3T94A 1JPJA 2XE7A 3GR6A 4Q7KA 4TTPA 2H9YA 1QAMA 3LCUA 4QA9A 1DC4A 1SG6A 4WX2B 4BO7A 5AESA 1ORTA 1O96A 5K01A 1EXDA 4OJYA 1HNXB 3OZUA 4LF4B 2ZT7A 5AIBA 4BX9A 9MHTA 1NF3A 1Z56C 4GZMA 4ITUA 4LJKA 4IXNA 5AM5A 2BGNA 3HPRA 6AT1A 3R0JA 1CT9A 4D56A 1DT3A 2D1FA 5ERXA 2BHSA 5DKFA 4CR6A 1UBSB 2O4UX 1N6KA 3KXLA 1QIIA 1Y8QA 3D81A 5K1ZA 4UQLA 4D25A 1NW9B 1XAGA 4DV7B 5F98A 5E2BA 1BMTA 2YHAA 2O23A 2BR5A 1PBNA 1XVIA 4IR7A 1RM3A 3DCYA 5DYIA 4LC9A 3UBMA 5E1OA 3G0HA 3SYLA 4MW0A 3LGAA 1HTWA 2JLQA 1A9SA 3P0RA 4PQEA 1G21B 3DDSA 3NO4A 2WABA 1QAOA 4MWGA 3WJ2A 3W5SA 2DWQA 1EQ2A 2FRXA 3MIIA 3MOIA 2YY6A 3QI7A 1PLKA 3SJBA 4EHLA 5BR7A 1NRWA 2ETXA 4FU0A 1XCOA 4RTMA 1MJNA 2VXBA 3CXUA 3L05A 3PNPA 2HQ1A 2Y6VA 3QKRA 4O02B 4B8WA 4HUTA 2FQ1A 1YBFA 2XT6A 4PZ9A 3EUWA 4G0NA 1W4ZA 2BPOA 2SNIE 3KJHA 4UDXX 4W1SA 3PI6A 1B4DA 3M70A 1VL8A 3AEXA 3GJ8A 3KOYA 4MKHA 1E98A 1G6OA 2EZ9A 2OCAA 5DK6A 4ZVLA 3HNRA 4BN4A 3LXMA 4DNXA 4QX6A 5A9SB 3E61A 3OQHA 3GRFA 4PS0A 3TR6A 3PVZA 4M6WB 4L4SA 1KJIA 1Y81A 3FOBA 2OV6A 4B3JA 2SCUA 1WCWA 2PQ6A 2C00A 4PW0A 3HVHA 1JA9A 4KIGA 1SCIA 2OQVA 3LOPA 2UZ0A 4I7EA 5EJFA 5K8JB 2F48A 1ZEJA 2IZ6A 5JCJA 4MVXA 4OUKX 2ZR8A 4IDCA 4MEBA 3CB4A 3M3HA 2Z9BA 4MPDA 3OCVA 1NVDA 2ASEA 4XQCA 3R3WA 1DAEA 3NTLA 4BMDA 2JAWA 2A58A 3A27A 4HPXB 2ICAA 4IDNA 2L18A 4H7FA 4CV0A 5LNK6 4E7PA 3PNMA 4IMIB 3PK0A 2CZCA 4LDQA 2I9KA 2FEOA 2CBGA 4Q34A 1C8KA 4PNZA 2N9UA 4L2IB 4C3VA 2EP8A 1AS0A 2P9JA 4Z99A 5IJXA 3EHEA 4L50A 3EPHA 3KWFA 4J1SA 3HV2A 1AZSC 3TQTA 1L3IA 2WWWA 2YYSA 2A6PA 2JF0A 2IJGX 3MZ0A 1O6FA 1YR6A 5EJ6A 3OX4A 4AZWA 1FTNA 2FR8C 4RBNA 4B3IA 3EMDA 1KVRA 3AVOA 3DLCA 2R7KA 2G8NA 1R37A 2CLLB 3FJYA 1W29A 1YB6A 3PD0A 1ZPDA 4IQ4A 1XMPA 3WWEA 3DDOA 4BFXA 2J7KA 5JLJA 2V4MA 4N9QA 3F6PA 1ONSA 2BMFA 3JARA 5BMVF 2ZRHA 1P7YA 2HYDA 1MHTA 1TAQA 5JIBA 3I6BA 1G17A 3S9MA 3E6AA 2I3GA 1EUDA 1LJ8A 2FTKE 1NMZA 2ZG6A 3KELA 2FSSA 3HRHA 3NYWA 2QMHA 5TEWA 2Q1YA 4V3BA 4BMVA 4ZOLA 2D1TA 2XEGA 3AJEA 3ELYA 4ZT7A 4IUBS 3ZI4A 2ZI9A 2E4ZA 3NBAA 3E1KA 3NEYA 3QTBA 4O4HF 2FPSA 3UHOA 4N6GA 1GGMA 2BLLA 2W48A 3FGOA 3JQAB 5F7ZA 3ZHQA 1EK5A 5ICSA 5KO2A 3PNKA 1ZD3A 5F12A 3E9RA 2VNAA 3U39A 3DVAA 4WK0B 3OFJA 4XGNA 4YAJA 5FPKA 2I9PA 1GZ4A 4IEFB 1DTWA 3DF7A 3RJ9A 3ZXUB 1QB7A 1I0ZA 2XCOA 3X1ZA 4IQFA 4I4TF 4MIKA 3A9RA 1SELA 4OQQA 4R2KA 1R18A 1CFZA 5K99A 3AERA 3VNUA 2WTNA 3QX3A 1MB9A 1CRLA 3RUCA 5L45A 3NIFB 3WNZA 2OZPA 3ADPA 2NO1A 4HDKA 3EA0A 2C5EA 2E87A 2B8JA 2FJ0A 4HWKA 3RUHA 1ZUWA 3GDHA 2O8BA 2A9RA 2QX4A 1GGFA 1QMPA 3MLAA 4S04A 1GZ3A 2JBHA 2ZS8A 2HA0A 3NC4A 1E9FA 3LGSA 1I2DA 4RHTA 4LIPD 3LRXA 4JLVA 4EW3A 4RD6A 2BFWA 4ZIRA 3WDKA 4DLLA 2X6RA 3IUPA 3F1LA 3JAKB 4JJ8A 3HCWA 4PRYA 4UUBA 3JXEA 3VV3A 4DLTA 1PWZA 2O2XA 3HZOA 3D6HA 5LVAA 1QQ5A 3QUAA 1CG6A 4WCFC 4H27A 4QIHA 1X9IA 2EIXA 3B70A 2E49A 2NO4A 3N2EA 1TMKA 2YRFA 3PF9A 2H4FA 4B0OA 3LC2O 1V48A 4BNGA 3ROZA 4ZO4A 4NH0A 2PCLA 2VQ3A 1QVAA 2R7LA 1X92A 5EJ9A 1V3QE 5AW2A 3T7DA 3DZBA 4P98A 4YP0A 1OBFO 3HUTA 1EE2A 1ADGA 1RCUA 1K27A 1NXWA 1ZMOA 4BTLA 4L0CA 5F5LA 1XLUA 1NX6A 5DNVA 4PFQA 3D8NA 3JYQA 2R5WA 4U39A 2WA1A 4TWRA 5JJLA 1E5QA 1PG5A 2JGLA 3N2IA 4Q1DA 3BGVA 3C39A 2WYVA 2Z4TA 3OZGA 1JJVA 2DH6A 4WBSA 1DBRA 5DIZA 3B6MA 1QHHA 5T57A 4D6PA 3G49A 3MXOA 1P3DA 4V1CA 3E9MA 3LLMA 4KK3A 2CMHA 5DM4A 2JGNA 2WD8A 4BJ5A 1NL3A 1VE3A 2XGOA 3K35A 2C7RA 4DBVO 3KXDA 4I36A 1DEAA 3WGHA 3M1AA 2OEPA 2RJNA 1S02A 5E0OA 2ZT5A 5ENDA 3V1UA 4BNJA 1QRDA 3QE4A 4BVEA 4TWIA 3P9PA 1ULUA 3O4RA 4BKPA 3FPFA 2JFVA 1NFRA 2HX1A 2MSNA 4C89A 2WC1A 1XX6A 3RE1A 1K7SN 2I54A 2IPNA 3JAKA 4OVKA 2Z1MA 4E32A 4ZTUB 3AUSA 2QN7A 2QB5A 3LI2A 5CW1A 5KINB 3SQNA 2VUHB 2BKEA 4OBXA 4WOPA 4NGPA 1ZAYA 5EZQA 1V7ZA 4L9SA 5CEEA 3FAKA 1IRIA 2DMRA 3WNBA 3O3NB 1TYEB 1ENZA 2NXNA 3ABZA 3V8NA 4QKQA 5BWMA 3BEOA 4LOJA 3WK6A 1IVSA 4K6GA 1SXJA 3EWIA 2F6RA 4B5KA 4EJMA 2HRZA 4FKMA 3BTOA 4R2XA 4BZXA 1Z6AA 2OOSA 2X5NA 2ZM5A 1UJNA 3A3PA 1Y8RB 4A8HA 1O8BA 4EW6A 1C80A 1Q7BA 3R7AA 3RGWS 2KHZA 3MJDA 5LN1A 1Y7PA 3CNLA 1KFCB 1CZKA 2ZIGA 1X6VA 2YVAA 2KLBA 4WT7A 2GNAA 1W0KA 2M1XA 4MI6A 1HZZC 3AERB 3LXRA 5HFJA 9ATCA 2PRZA 1PSWA 4BQEA 3GT0A 1UK8A 1UODA 4MV8A 4IH1A 3AEKA 2C0QA 4O8CA 5BQXA 3QMVA 1XDDA 3PPWA 3OEWA 1LQ2A 3V7NA 4RZHA 4EG8A 1G0OA 4HY3A 5DV9A 2YIJA 5FI0B 1H3FA 4Y2QA 2GFHA 2QV0A 4JB2A 1XU9A 3B7WA 5EJGA 4KFSA 3I53A 3TJRA 4JXXA 3SICE 5HE8A 5IW8A 1SRQA 1E1LA 3HM9A 1CIJA 3IMEA 3K0HA 3EVDA 4H4DA 5AQEA 5HF6A 3RV3A 4B3FX 3L0BA 1F0PA 2I3AA 4RK0A 1P2VA 1E7QA 1YKSA 3OOEA 4XR9A 3T5AA 4X71A 2WJJA 2EWVA 3WGKA 1KIFA 3I6SA 4F60A 1K4YA 1MJFA 4HYYA 4A2QA 5LXTB 4KTVE 4XTCS 3LLSA 4EG0A 1T2NA 4L5JA 5CT4A 3U3ZA 1LB1B 3F7NA 4N65A 1Q0RA 4R2JA 3V4RA 4K6CA 1MOQA 3KZVA 3K09A 5FXMA 1BWRA 3S8EA 4KIWA 1JALA 3AFOA 3CLTD 2C9CA 1WV0A 2D3TA 3QPUA 1NG9A 4TMZA 3ICUA 3SD7A 4MVJD 2XRZA 2F59A 2HD4A 5ALFA 2XXAB 1UMCA 4CJXA 4QGHA 4TLAA 4TLDA 4K86A 2FW1A 2HFKA 2YFHA 2HHLA 3NOQA 5K0JA 5TT1A 1OH7A 3ZY6A 4TUYF 2VK1A 4R8LA 5EOVA 4LOIA 4OQXA 3TKAA 4O2AB 4WLEA 3IOCA 5AJTA 1FS4A 1L7NA 2VPIA 3LUHA 4U7PB 4V0OA 1PAUA 3PD7A 1U7WA 1H2XA 1ID8A 1HA3A 4D26A 4XD2A 3ZLVA 3P9KA 1KO4A 1K3FA 1E9BA 2IEAA 1CE8B 2PSFA 1PJRA 3I04M 4N39A 4E5VA 4RD3A 5J2UF 4IMRA 3E03A 1NRJB 5F1OA 3CO0S 1AKQA 1TCCA 3AEYA 3BK1A 4LTNA 3JQ8B 3MTAA 1GQRA 2W2KB 3ZY2A 4MV4A 3F3KA 4B17A 2QU7A 3COJA 4LOHA 4U2EA 4M8IA 1ADBA 3FUVA 3LZDA 4DLPA 2PKQP 1M66A 1TM4E 3DL7A 1Y33E 1QNFA 5FR1A 5LQCA 4ESOA 4M1EA 1S96A 1DQRA 3CG4A 1EFRD 2GHRA 4JP3A 1PV4A 2ZJ0A 3PGLA 4I4TA 4M3NA 4C21A 3MMSA 5JFTA 4CNBA 2QMQA 1NKSA 5LUAA 4G0QA 4NCIA 4KPYA 1ZK4A 1AGNA 1FSFA 1XRQA 3OM0A 1C9DB 1MAVA 1K8RA 1Q7GA 2G28A 1SCNE 5JD5A 1TA4A 3MBKA 3TNYA 3UH1A 1ZIDA 3AOEC 2ZUBA 4BCBA 1F8UA 3E9NA 3LHSA 3VVCA 3ND9A 3VAAA 4CM6A 4L6AA 1ZGBA 4Q1AA 4FSXA 3VHLB 3RBZA 3K70D 4N41A 3CJRA 3EIWA 1FVOA 4YAKA 8AT1A 1HDXA 1RS0A 2I65A 4NCKA 4H1VA 1L4BA 3SJFA 1ABFA 2VOEA 3K1ZA 3VVBA 1QGED 4IVQA 5ADUS 1XMVA 3Q7EA 2PWYA 1PK9A 3SIWA 3H3JA 5ALNA 3QWIA 4ENQA 1CJTC 4KGZA 1KU6A 1KSFX 3QXCA 3SN6A 3BK2A 2LXNA 1Z18A 4INAA 2QS9A 5KHAA 4F9EA 1O0CA 3DBIA 1CY7A 3OO1A 2NT3A 5SYAA 1X9GA 3T4PA 5HJ2A 4Q3BA 3NASA 1UJ4A 2CXTA 3D8HA 4OBBA 5C5CA 3CX8A 1K97A 1RKBA 1WPGA 4D9KA 1L0BA 5BNTA 1JQLB 3JALA 4UNPA 5YASA 1Z6GA 4JLKA 1GV1A 3LUJA 5H4HA 2QEQA 3MYRA 4H7DA 4NF2A 3UG6A 3AFGA 4XDZA 2QRNA 2EFCB 1S2IA 4LCBA 5CA0B 1OJLA 4GRDA 3AFHA 3A05A 4DMGA 4UEJA 3MINB 5J9FA 1QIGA 4E2ZA 3HCRA 3I83A 3BB3A 5JHHB 1QYCA 3FGZA 4I1OA 1GHTA 1V7CA 3D9QX 3HSYA 3QEKA 4G0MA 2G5PA 2XVAA 4L5IA 4X6LA 3T3IA 1WD7A 3BWMA 1VZ2A 4I1RA 1PZEA 2O5EA 2C83A 4ZU1X 1SC6A 4MCJA 4MYSA 2KBEA 2N46A 4BQSA 2JGMA 1ZHOA 2Y6UA 1XHEA 2I7CA 1II9A 3OMLA 5CTAA 5DOZA 3DBLA 2FLKA 1QDEA 1G2PA 1OOEA 3KBBA 2Z8YM 2FWMX 1UOPA 2ZIXB 3I9JA 3L1KA 1CPYA 3H7AA 3ONDA 3H9BA 2V65A 4L6CA 1WVIA 4L95C 3R40A 3V1TC 5FPYA 2BM9A 4BNIA 4XFJA 4FWBA 1CUJA 1ZJZA 2Y1EA 1V11A 4CF3A 5L40A 1QH8A 4M1QA 2J9RA 4K88A 3S2SA 4HI0E 2PZLA 1MHPA 4NMXB 4OIFA 4R8SA 4DCSA 4WH0A 4ZT6A 5E95A 4D8UA 1H2ZA 5FUQA 4L1KA 3OI7A 5CM2Z 4LJLA 2AVNA 1JDTA 2DCMA 1WDMA 4BO6A 5EP3A 4FK8A 4PS1A 2XR1A 3TRJA 3SEFA 2RSLA 1IUPA 4L0MA 3WWPA 4QPCA 4DG8A 5MHTA 1E58A 4IQ0A 3ZUPA 4H7PA 2OG2A 4F1KA 4LF9B 2OKCA 5DLPA 3O8QA 3Q2OA 1JIUA 3PPYA 1YCDA 1OFTA 1A27A 1KNQA 2OHXA 2Y3IA 3COVA 3DYBA 1L7OA 2DTXA 4RF4A 3UTDA 1IWOA 4I55B 5AO9A 5HTOA 3BD6A 2VT7A 1Q1EA 2MHCA 3L04A 3PRKE 4DQVA 3IE2A 4Q4JA 3WJAA 4F2GA 2E7ZA 5BQFA 3H05A 1DAMA 3IQXA 4UTRA 4JJEA 1C0IA 1PCXA 4UDNA 3EAFA 2FMFA 3O31A 3QF4A 1UBLS 4WQMA 2HDOA 2W2XA 4ZOLF 2R5NA 3X3HA 3LY9A 4OQEA 1Z7WA 4L0DA 3ER9A 2Z83A 2ZUTA 2VNJA 1LVUA 3B3QA 2ZI6A 1W36D 2X5KO 5EIWA 2YZKA 2WKRA 3M1IA 3GUVA 1T25A 2R8BA 2AW3A 1M2OA 3G8DA 2QRUA 4KKXB 3UK2A 1PG2A 5DXAA 1VPWA 1A7JA 1R9JA 4GS5A 1JLSA 4MQFB 2VJAA 5KQRA 4MDFA 1GVHA 1UQTA 5AJWA 5CITA 1GU7A 3LDAA 4M1ZA 3QQPA 5C37A 2YXDA 4BV9A 1EESA 3DUFB 4HTAA 4KAFA 1MO5A 2GCPA 3U4AA 3VSDA 4X45A 4GQAA 3ER8A 2HSJA 1XRNA 4A0QA 5HUHA 2XTZA 2QUIA 1V3TA 1ST2A 3F67A 3A1NA 3O93A 1UDRA 4WCFA 3RTAA 2ATCA 4EA8A 2JPDA 4Z0NA 3KYCA 1O6CA 1ODCA 1KH3A 2ZK7A 4AXXA 4O59O 5JNTA 1MF7A 4CZ1A 1PFKA 4TROA 5M29A 3DO8A 1T4BA 2IP2A 3ML1A 4M88A 1R6XA 2CLKB 4OP1A 1FS5A 2Q5JA 1SKYE 1IQPA 1NVVQ 4D46A 4QT4A 1A77A 1NW4A 5I4BA 4DLSA 5JJCA 4BAUA 3QE9Y 1GPAA 1P45A 1XZ8A 3C5VA 3I9MA 4KZPA 1KAOA 4B7UA 3AL0C 3JPYA 5D8DA 3QVXA 3DZ8A 4NZZA 1AUPA 1UJ2A 1AKRA 1UKEA 2P2DA 1XB2A 1M8GA 3RJZA 4MULA 4D02A 1IZYA 1AC5A 3DEIA 4M0EA 1YR7A 4KRGA 1NUAA 4HFMA 2ECOA 3VKVA 3QTTA 5ARCA 2IW1A 5F4ZA 2FRVA 2PX6A 5FPQA 1L5ZA 3HBJA 4DA9A 1VDMA 1A4RA 3CIFA 1Q57A 4RK6A 3U49A 5J2UA 5EXDA 4CIXA 3ZV6A 3A6LA 2F3RA 2WUWE 4J16C 5F51A 1VSTA 1Z68A 1XXLA 3T5GA 1GPNA 3ZXIA 1E92A 1FLDA 1WXQA 4IY1A 3ESYA 5G4KB 1LFAA 1O97D 1T91A 4LQGA 4D4HA 4IKEA 2FNAA 3EOBI 3ZWYA 1JKMA 2WBLC 3DE2X 3F3SA 3ICCA 3CR7A 5C52B 3QW2A 4PVCA 4RSGA 2UUCB 2IIPA 3QNMA 1JKJB 5T3YA 4BMXA 4BXOB 5CXSA 1U9JA 2FX3A 2P75A 4Z8XA 3HBLA 1TIPA 1M5UA 3OF5A 1DO2A 2ZI4A 1C5KA 1EZZA 1SVWA 2IUYA 2EJTA 3HDQA 1KE1A 1UUFA 2CT8A 1J9GA 3WRYA 3X1DA 3KQQA 2ILTA 3TTTA 3W2TA 2J4DA 4HN9A 3LLCA 1NI5A 4C6HA 3E84A 3PSHA 4NZ9A 2PGXA 1A1SA 2G67A 3W8NA 5DU2A 1UP7A 1W94A 2P79A 1X7YA 3CT4A 3KZKA 4YASA 5E6UA 5KVVA 3I5AA 3CBGA 2BHRA 4D0SA 2HV8A 1REQA 2YRXA 2Q3EA 1FLAA 4JVLA 1HBJA 1W4CA 1WF6A 1OUMA 3ROGA 1OLOA 2XDQA 2FW7A 4D4IA 4NYJR 4D9HA 2FFAA 2EZUA 3CC8A 5HJ7A 2P35A 3QGMA 1A97A 4Q4HA 5JRJA 2PBRA 2GOYA 1KEEB 5KOJA 1YQQA 3IT2A 5BWNA 1VI4A 2EEPA 3V8MA 1OX6A 5HS6A 3KQLA 3IGFA 3DLAA 1II0A 1KDOA 3BA6A 4YIHA 3DXFA 4GX2A 3JYPA 4L5BA 4MVJM 2DLDA 4J0NA 5BV8A 1RZRD 4TYQA 5TNXA 2W8BA 1RWPA 4F5EA 4ZXFA 1MOSA 2B2NA 1XMXA 2OHIA 3KQWA 3VBEA 3E3AA 1UADA 3GLFA 2PS1A 2EQ5A 1T8YA 1O1YA 2HJVA 5CMLA 4JEMA 4KN5A 3PC8C 3THYB 5EPOA 1VC2A 4XRRA 5CRIA 3E05A 4HGZA 2DQKA 2VXCA 3ODGA 4B6GA 5JCOA 2EJBA 4CZ2A 1PRYA 4FEYA 4HS9A 1KGSA 2R6JA 3PQCA 2YQZA 4J90A 4N7BA 3M33A 3R5HA 1L5QA 5HVNA 1L5SA 5HBRA 2R1TA 3I6YA 2YVUA 5D86A 3T05A 3VOBA 5IABA 3EBPA 1B2RA 3EVAA 1A8QA 3CEAA 3H2BA 3OLQA 5C80A 3I9V6 4D8TA 5CB0A 1BDJA 1TL7C 2NLOA 2QTRA 2XWQA 3BWXA 3C6BA 3HWRA 3OX1A 4OA5A 3WZMA 1LPSA 4J8PA 3GMIA 3SR3A 3ZQ4A 2NADA 2CD9A 4KIUA 4WL0A 1JSXA 5CLLA 4II2A 2ODWA 3GOHA 4CN9A 5CB6A 3SSNA 4DHWA 1JH9A 2Y0BA 1LZLA 1P1IA 3CLVA 3OHPA 4KRYA 3S27A 2JIRA 1Q1GA 3MGGA 3KS9A 6GPBA 1BDBA 4L8VA 3VR3A 3F2VA 2JIQA 3KJXA 3TZHA 4LGMA 2JFQA 1N2OA 2OV8A 4W99A 1B8NA 4WERA 3WDLA 5IHPA 2B83A 2G1JA 5H80A 3TLAA 3GELA 3UMVA 3W5VA 5AM4A 4EK9A 4TVKA 1F17A 1NBMA 3A6PC 1Y3FE 5LQDA 1YZLA 1A9QA 3PHBE 1XZLA 2WHXA 4GOLD 5BR8B 3ZBUA 1VTKA 3V34A 1YRWA 2CDRA 1Z47A 2ZBGA 1WJGA 2IPLA 4K03A 5DF1A 4U3JB 2ZWAA 4GYYA 4TLMB 2ACWA 1TO6A 2J3LA 3B53X 3B52X 4BVKA 4C9UA 4CLXA 3BXGA 3PWZA 2C0PA 3D3NA 4W5JA 2QVGA 2YV3A 4DLBA 2ORYA 2C78A 2IUTA 1ODSA 4RX1A 5CM9C 1TM5E 2GD0A 1NQXA 1U3DA 3QMMA 5K3FB 1TZCA 3OU2A 1IWBB 1FFXA 2VP3A 3EZ9A 2AJDA 4KODA 1WP4A 1XMSA 2NU6A 1S3FA 4MRPA 1OZAA 3TZ6A 4AY2A 1IG3A 1K4KA 5LB2A 2GZ1A 3Q15C 4HDNA 4P4SA 1RLMA 1G20B 4YRJA 3VR3D 3HWWA 3OZRA 5AMXA 1I94B 3CUWA 3TUJC 1C4KA 1ZZEA 4WN9B 4YRLA 5A7FA 1I6WA 1XUOA 1JB1A 2J4FA 2WYIA 3FDIA 2QPOA 4KTTE 2W6ID 4C4PA 3C3EA 3DTVD 3DBRA 4S1NA 3AEZA 1EGQA 5AVSA 1C8BA 4B7ZA 1FXSA 4LHXA 4XLLA 1RPAA 3IAFA 4MLZA 2BI4A 3BL5A 4WBNB 3I05A 3Q8WA 3BF7A 3MXTA 3AHIA 3V1NA 5KHOC 3G2NA 2X7JA 2YWGA 4XDYA 4WZAB 4YAFA 3SJGA 1MABB 1AUVA 1ESNA 2CKMA 2W70A 3ZIAA 3DOOA 5JFGA 5CVJA 4DCMA 1U2SA 2DPHA 3EGDA 4ES6A 2QBYB 2ZIWB 4Q0MA 1XYVA 3LM8A 5FEMA 1AK2A 5AKIA 2TMYA 4XQGA 1I4WA 5HF9A 3UHFA 1X7HA 1QIFA 3GP5A 2R6FA 2FXVA 3GGDA 3IQIX 1EJ0A 3LC7O 3ORSA 1U5BA 2QVZX 4QEZA 4S0ZA 3ZIDA 1GNTA 2HF2A 4I9UA 1CY1A 1USVA 4NFLA 1KMHA 4N3BA 5JVDF 2PV7A 4Q4HB 1YE3A 5LZ4A 4OH7A 1KZGB 1RZRA 3OKPA 3B60A 2ZLBA 3BTVA 5B3LA 3ELWA 1EFAA 1PKXA 4Z3OA 2OZLA 5HUQA 1ULBA 3GIWA 2YJZA 1I4LD 4LSZA 2VJDA 2CV1A 2JH3A 4UUPA 4MUMA 4QBKA 2J0QA 4FFBB 1JHXA 1QHFA 1TVCA 2X9VA 4CMIA 3V3TA 7ABPA 2M98A 2YXNA 1NM5A 1XTRA 2VPWA 4C3OB 5K8TA 4F6CA 4F93B 1WMEA 4F84A 5IJWA 2RI0A 3UA4A 2ZTSA 1MNQA 1OF1A 1PFYA 2IXEA 2QUZA 3K9CA 1O87A 2A14A 2HI0A 1V11B 1E7RA 3AETB 2GCOB 3RTBA 5EUCA 1VRCA 3U4HA 4YCCA 2DY1A 2R6GA 5CK5A 1Y5RA 1YB7A 5B53A 3TQCA 2IHBA 2DU8A 3FPAA 4ZEWA 3D2AA 3HDGA 1DQSA 1E66A 1DKQA 3LRTA 3TW4A 4EKGA 1ACJA 5F2KA 2V5UA 1KJJA 3JZIA 4MYUA 2NUTA 1YU9A 2W6JD 3G0CA 3M89A 3B48A 3NTRA 4GZ5A 4FR2A 3JYOA 2IV2X 2AMVA 2H92A 2GZRA 2O1EA 3PXAA 2DFVA 1N7GA 2AWNA 4B09A 1ND6A 5IKXA 3IKLA 4O3MA 2X77A 5AHRA 3LPAA 5JPIA 4NY1A 1RAIA 1GTL1 2WD7A 5E4TA 1RT9A 1QIHA 2DLNA 4TTQA 1UXKA 1WP9A 4BNMA 4GI2A 1YJBA 4LSWA 3CA8A 4M0PA 1KC1A 3KUUA 3QFFA 2YY7A 3UJ6A 2PJRA 1K8YB 1E5LA 4N12A 3UZUA 1BGVA 1L5YA 5TQ0B 4LYAA 2X8JB 4BGDA 3EGDB 1AN0A 1YZKA 2XA9A 4C43A 2QBYA 3QY9A 3IHTA 3GAFA 4U7TB 2X0FA 3OIVA 5DVZA 4JWTA 3WLMA 1Y4UA 2AE1A 2V7TA 3EZLA 3K8ZA 4BS9A 1HYGA 1CVIA 2WFAA 2ZJZA 4MVCA 4DZZA 1XA3A 4WZ6A 3OEHD 4BJ6A 2P9TA 5BR1A 5L9AA 1QYXA 1DDOA 1MX9A 1CNFA 1J9ZA 2LW7A 2GBFA 4A6EA 4RJ2A 3ZLJA 1U63A 2B5WA 3DMNA 4NICA 1XTUA 4D96A 3H4MA 1L7EA 2OGWA 4L4RA 4GR9A 1C3LA 4JYMA 1KPHA 2DCUA 2SICE 4C20A 5LU8A 4JFAA 4TMVA 2R5FA 4BNYA 4C0QC 4AG3A 4EYSA 3RADC 1JUDA 4C4ZA 2XGJA 3F5MA 1TDJA 5HZGA 3NIWA 2B8NA 2Z0MA 1W85B 3WSVA 4XVUA 2E9SA 5SV2A 4XXHA 4KDCA 2NXWA 1C4WA 3DHWC 5T8KC 4CMAA 4EB8A 4ZYLA 4R01A 2V3CC 4NCJA 2R4QA 1H8EA 3RRBA 4E1BA 4QZVA 3FNRA 4XRGA 2CB0A 2WVHA 3CRVA 4OAQA 1O97C 3ETEA 2F1RA 1FUYB 2ZATA 5CLGA 1QH8B 3DEFA 2L2QA 5F3DA 4EL0A 3GBSA 1JL3A 3KSDO 4JSTA 1A7UA 1TGYA 5HEKA 2QKYA 3AETA 3NALA 4J49A 1GUFA 2RKBA 4Q15A 4CM8A 4GM0A 3R7NA 2AN1A 3PV0A 5ALKA 1JECA 3AHFA 3T9EA 1LI5A 4RCVA 3WWZA 2A0KA 1RKQA 1ZK3A 2OCYC 3E3OA 1E9DA 2YKGA 4OBWA 4XCVA 1BYUA 5JXIA 1T3TA 1FNDA 1A2BA 2LIPA 1UFRA 2R8PA 2QMZA 4LZZA 4IM7A 2JVKA 4WZBA 2PGIA 2JZNA 5CJJA 3W04A 1JLMA 4L85A 3U3JA 5LJLA 1HE4A 4FFBA 4W7HA 1P39A 4LC1A 2PUFA 2J85A 3I8XA 3MELA 5DLEA 4C4OA 5KC8A 3OH8A 4UQPA 2B35A 1TI7A 2QRQA 3GRYA 5CVEA 1UAAA 1B3BA 3PUXA 4G4GA 4GLOA 5B3JA 3VSBA 2PEYA 5ELYA 2FCAA 3L4SO 3NHPA 4A5OA 5GGXA 4MR7A 4FFPA 3IPCA 3WGQA 1Q0TA 2RHHA 3HY6A 3OX3A 3SYTA 1RSZA 2FEXA 4JY7A 6LDHA 2H2AA 2QLLA 3SEQA 1W6RA 3GFOA 3KJNA 3S1SA 1YJAA 1C0PA 2QJWA 3VHRA 3DMTC 2OM6A 3OURA 4O08A 1KVUA 4OHOA 4CM9D 5EERA 2GHIA 2HJWA 2JBAB 2NO5A 5JDIC 4BUZA 1QUEA 4EJSA 1QE3A 4ZEVA 1MH1A 3HM2A 1QQ7A 3N28A 4RMIA 3ZD8A 3WFZA 1UXOA 2BFDB 5GJCA 3DDCA 4AKGA 1EDBA 1RYEA 3K5PA 3E4CA 3TG2A 1XXHE 1ZGCA 2EEZA 3AQIA 3OC6A 3UC9A 2RHRA 3HJNA 3VTZA 4RNCA 1ADYA 2NO7A 3IQZA 3H5WA 3BB1A 1AKVA 3KYDB 4FZRA 4JEIA 4TRRA 2FPUA 4LBYA 1MEOA 5DN9A 1T0HB 3TLKA 4S05A 4N5HX 1GL9B 3MJHA 3IVAA 4EA6A 5KNBH 2AV6A 1FXWA 2GAIA 4NYIQ 1R4MA 4PXYA 5CB4A 4JC0A 4OQZA 2F3PA 4AUEA 2Q50A 3SY8A 4L6IA 2C2KA 1NMYA 2I4LA 2C57A 3MFQA 3R24A 3MUOA 2W42A 1WZEA 3KTFA 3DVAB 2XNDD 3HXOA 1A8IA 3HXMA 4RZUA 4FDTA 4DMFA 1BGXT 1R0KA 3N2YA 3TEJA 3BXMA 1S2GA 1V41E 1Q0HA 2VH2A 1M7GA 1A04A 2ZRMA 5CXXA 5ED0A 4D41A 3OZEA 5BSFA 4W6QA 4NMHA 5D5QA 2OY0A 5LP6F 4PFKA 3DKRA 1YL7A 1RLTA 3O94A 3PXCX 4FTWA 4IV0A 3QUBA 1XROA 4HAOA 1K75A 4R9UC 1FP1D 1N6IA 2HJGA 1HTTA 3D02A 3I2KA 4L57A 3T3MB 1KQGA 3GMTA 2COKA 2QW1A 1G21A 2P4SA 2FWIA 3QX9A 2Y66A 2V7GA 4M0MA 3WHPA 2W6OA 4DR7B 5AK6A 3O3MB 4I9FA 3EZAA 1IJKA 2PX8A 1LPPA 1SNYA 2QGNA 3ZV4A 4D5GA 4I66A 4QDOA 3AVUA 2NPFA 3VR2A 1EQAA 1P4GA 3OD1A 4MTLA 4DLXA 1QPGA 1Y80A 4HWSA 4U2FA 5AK4A 2CHEA 4DJFC 5FL3A 4IJQA 2EX1A 2BGWA 3VDQA 1OFHA 1Q0SA 4R1SA 4BO8A 2KLHA 3U0VA 5EHGA 2GN8A 5ALLA 2VUUA 1CTQA 3K0FA 3KHKA 3WYAA 3F6BX 1RCFA 3AVQA 3L8MA 4JOSA 1YH3A 3DLPX 3UENA 2V7VA 5E2AA 1AHIA 3W77A 2A35A 2QN8A 2H31A 1H3EA 3U9LA 5JS7A 2EFEB 4K9SA 1X77A 1SO8A 2OWDA 3PC2A 4L08A 2ZB8A 2G07A 3D4NA 1YE8A 1ECFA 1RLIA 2OV1A 1EGHA 1C9KA 1PX2A 2AR0A 3BA1A 3ON5A 3AI1A 4WSOA 3FBWA 2CFSA 1A8SA 1FBTA 3O4HA 3OEED 3L7LA 3OG9A 4MUNA 1FYXA 4G0VA 4QDXA 1ZLYA 1X7YB 1BMQA 4IIVA 4ZO6A 5DYGA 2ZTMA 5DM0A 5E6UB 1W9MA 2ZSEA 1YMVA 2GQ0A 3H0EA 3JQEA 1QC5A 2J9FB 3U7FB 3K8YA 1KZ9A 1NVEA 3OD5A 4ANFA 1GTJ1 5JEEA 2O8FA 4ZV9A 5EIEA 2QAGB 2A4MA 4AUMA 1R0XA 4J4HA 3E4DA 4ZWNA 4NJEA 3ZLTA 3LCVB 4CFYA 3OZVA 1HRDA 2GYYA 4Q7JB 1QO0A 5C1DA 1CX8A 1EZ4A 4QQFA 3WK5A 1MQSA 3A11A 3BL6A 4B3BA 4FUTA 3ZGLA 1J8DA 1K6XA 1QBKC 2SECE 2EL9A 3SJEA 4EJFA 2IUEA 4OYYA 4MQUA 5I9BA 2Y76A 4YDSA 1ZO8A 3NNNA 1QH9A 2FA9A 1E1YA 3FETA 4GQBA 5H68A 2LGJA 1ZNZA 3SYNA 2B2CA 3AW9A 3H8SA 3HS3A 4X93A 2SBTA 4BNUA 4KPFC 4FYWA 3W90A 3KE8A 4X1YA 3EEFA 3OMWA 4XIIA 1U4OA 4YCNA 4OMCA 4COGA 2ETVA 1XV5A 2VNSA 4L4YA 2YJVA 4MUHA 5C53B 3PHJA 1QH1A 2CEKA 2CWDA 3KC2A 4V0QA 4ZANA 5CCBA 4KREA 2PL9A 4AWBA 4IXTA 2G1KA 5EMHA 3SDZA 1YVPA 3PQ4A 4BGIA 1QQ6A 2BFPA 4K5QA 3FD8A 2I7XA 1AY0A 3LY7A 4J1NA 5ALUA 3NHAA 4OGLA 3VC1A 4EVQA 2BFDA 1PS9A 4IEEA 2ZB2A 3INGA 4DAOA 3PKIA 1ZIYA 1I7PA 1UH5A 4DANA 3AG5A 3L0PA 3T61A 4WIAA 1NE2A 3AF4A 4AS1A 1GAQA 1IIRA 3ECSA 4J0JA 4CN8A 5F9MA 3CLSC 4GM4A 3CJQA 5KTPA 3R1IA 4GDMA 3TCNA 2WYUA 1Q1AA 4G0XA 3IDOA 2E21A 3F90A 3UMCA 4LJRA 4K81B 1O96B 5C31A 1ZEMA 3EDOA 4LY3A 4DCGA 1XI2A 5FTJA 4ALIA 4GSKA 4YHBA 4RAOA 3GEHA 1R5OA 2I3BA 3H3XA 3NFRA 3BE4A 5DGXA 1WXFA 2HSGA 1W46A 1WEKA 5KAMA 2OCGA 2VPPA 1IXRC 3K0KA 3U4QA 2QLJA 1XQVA 3B1KA 3GXOA 2VT3A 1CJBA 2BFOA 3IEIA 1EG7A 3LUCA 4TV9F 2IYUA 4BWFB 4EO9A 2WJHA 3EIUA 3PUIA 5KKCA 3HBMA 2CXQA 1I13A 2QMUA 3SS7X 1CC1S 1PL7A 4BBZA 2WT9A 1RVDA 2WWIA 3EVTA 5I7WA 2Q6OA 4IMJB 4YRGA 1XP5A 2NUAB 5HKBA 3GZTB 4OHBA 1T3GA 3F6SA 3S3TA 1K6IA 4BNDA 2UUAB 3AVVA 3HABA 2HSWA 5EJ2A 4F56A 1W581 1OFVA 5I7HA 3KKZA 5FOQA 3T7CA 1KYZA 1MC1A 3NBKA 3CZ4A 3UCEA 5G4KA 1N6HA 4QSMA 1GTMA 2X13A 5EN4A 1GDTA 2AOUB 4DIFA 5AW0A 1SXJD 2GETA 2YJ4A 4PXSA 2Y0CA 2JLUA 3UXHA 3UEOA 1NF9A 2PK3A 3IE0A 3FCAA 4QNRA 4FGJA 3CTPA 4CCAA 1P74A 4PWZA 4GX5A 1CUEA 1KMHB 3B1VA 4KWCA 5J1TB 2Y05A 3GRUA 4ZJZA 3I0ZA 4JUBA 4ACAA 1YBAA 2X14A 3L7OA 1FYEA 4Z1MA 1N1GA 3BMNB 1MRNA 1ESEA 5FYDA 2XGSA 4KXWA 5ALTA 1YFZA 3T5TA 2FWPA 2AZTA 1JEQB 2PBFA 3BX1A 3Q85A 1TB4A 1XZMA 4QJBA 1E3SA 4LK3A 1H65A 1PQUA 1T6NA 4Z3DA 1ZSNA 4CWAA 1KTIA 1ORRA 4XGIA 2JHCA 4EF5A 5HWSA 4TJXA 4WLUA 3JQGA 4QBIA 3ZHYA 2VN8A 3TMYA 2R6CA 2FMUA 4E33A 3KE9A 1JA0A 2IKQA 3I32A 4MCIA 8ABPA 1XTBA 4O1HA 3HBNA 1KS9A 3PUWA 3LT0A 2H0RA 3UV6A 1EBUA 5C4IA 3ERCA 2K87A 4QPDA 3OLZA 5DOVA 3SK0A 1QIKA 3V7YA 3ZK9A 1J24A 2BAGA 5HHTA 3PYXA 3Q8KA 3DH0A 1Y89A 5AW5A 1F2DA 3VKFA 1A82A 1E4EB 2V3WA 3I37X 3BZWA 2AW5A 1PQWA 3IYLW 3L9XA 4JOCA 2DHEA 2QG9A 4R9NA 1O95D 3SFVA 1WETA 3PLAE 1AQLA 4RH0A 2OL4A 1C1XA 4P5EA 2VDMB 3JRWA 2MSWA 3J81A 2PQ2A 4X8HA 3LUGA 3AI2A 4R16A 3HXKA 3V8QA 5JNWA 1DPGA 1FTYA 1HFJA 3EVCA 4TQUS 1WBJB 3HJTA 3L1JA 5FEUA 1Y82A 2J87A 2YS7A 3T3EA 3TLZA 2OENG 2GPJA 1ID1A 5EYPB 2EU8A 3SZUA 5DBHX 4MA5A 3ZBPA 1U7TA 3JQBA 1A71A 5JRDS 4ZA2A 3N9IA 3B7PA 4ZZ3A 5AM2A 3EQ7A 4YWJA 3RTCA 4P92A 1USKA 2E85A 1M6EX 3E35A 4HFRA 4Q9DA 4QOIA 2HQSA 3TIIA 4BN0A 4NS4A 4P3YA 2QIOA 1K98A 1AGYA 2HZBA 1EP9A 1URPA 4CM4A 5DLDA 1CJUC 4WZAE 1N0VC 1YI1A 2VBGA 4YWHA 2GF9A 5T4BA 1G38A 1RQ2A 1NAHA 1W4AA 2BL4A 3U4GA 1Y98A 4LTDA 3G9TA 2FAXA 4NOJA 1LBIA 3ORFA 3NGXA 5JJKA 4BECA 4JL6A 1H0HA 2XCTB 2FLVA 2WPNA 3SXJA 2B78A 2OB1A 4L5CA 3ZJ4A 4GVXA 1CF4A 4M9CA 4HEJA 5CVDA 2VJMA 3VYUB 4BFYA 3VU1A 3IPXA 4BEBA 2H2WA 3HJGA 2O2IA 3LX5A 4U2CA 4W9NA 4N7RA 4I0WB 5IUJC 2W7TA 1MJGA 4N0PA 1R0CA 2PA3A 5HQJA 3JRNA 2HSEA 1TECE 3I61A 3KYJB 1KEEA 1VSQA 4HADA 5KYTA 1HDOA 1HT3A 1DAGA 3VM6A 4KR3A 1J2RA 3PGVA 1PJQA 4TT3A 2YVKA 5I7SA 4OXIA 3D7LA 4AI6A 1P6QA 4D81A 2PFKA 2Y2UA 4E5KA 1M6WA 1NUPA 3F47A 1G3QA 1MC5A 2PHZA 3A70A 1QDUA 2CLCX 3I04A 2I7DA 1Y3IA 2GEJA 2SKCA 3WLSA 4AF6A 4IGKA 5A9SA 2OESA 5EYPA 4B2IA 5GADl 3R2JA 4KZKA 5J5AA 5CB4F 2CXOA 2D2VA 4O2BF 2PL3A 1H2RS 4WTOA 3BXHA 4B6OA 4LQLA 3DDUA 4U02A 4RKFA 4Q9AA 2BE9A 1P1CA 5DXJA 5D5PA 1OVGA 4XARA 3NV9A 1KRHA 2QP3A 5H8WA 1O03A 1RJ9B 1N9ZA 1U3GA 1ND5A 5JMTA 5JYCA 4IV8A 1H2WA 1B2LA 5CBKA 3IV7A 7GPBA 3AFMA 3O26A 3W78A 1XLTA 1DUSA 2FKAA 2YMPA 2HLPA 3L01A 3NWBA 4KITB 2IVFA 4V0KA 3ADKA 4JROA 4BWYA 4JGIA 2WZDA 4YHHB 4C07A 1TJYA 3I2JA 1S89A 1QCDA 1X3SA 3W05A 1V5WA 3AUAA 2EERA 1EFPA 1G42A 4L8WB 4LHWA 1FMLA 2ECFA 1NZFA 2W37A 1GGVA 4D9NA 1PJ4A 1R74A 5DHUA 1LS6A 1I4DD 2K6GA 4NBTA 4Z6KA 1GFWA 3LPDA 4MKFA 2VA8A 1JBKA