4IIYA

Structure of mccf in complex with glutamyl sulfamoyl inosine
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
335
structure length
335
Chain Sequence
PLLAAPLAVGDTIGFFSSSAPATVTAKNRFFRGVEFLQRKGFKLVSGKLTGKTDFYRSGTIKERAQEFNELVYNPDITCIMSTIGGDNSNSLLPFLDYDAIIANPKIIIGYADTTALLAGIYAKTGLITFYGPALIPSFGEHPPLVDITYESFIKILTRKQSGIYTYTLPEKWSDESINWNENKILRPKKLYKNNCAFYGSGKVEGRVIGGNLNTLTGIWGSEWMPEIRNGDILFIEDSRKSIATVERLFSMLKLNRVFDKVSAIILGKHELFDCAGSKRRPYEVLTEVLDGKQIPVLDGFDCSHTHPMLTLPLGVKLAIDFDNKNISITEQYLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MccF
publication title Structure of MccF with substrate analogs
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 120
structure length 335
sequence length 335
chains with identical sequence B
ec nomenclature ec 3.4.-.-:
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02016 Peptidase_S66 LD-carboxypeptidase N-terminal domain
A PF17676 Peptidase_S66C LD-carboxypeptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Class I glutamine amidotransferase-like 4iiyA01
3.50.30.60 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 LD-carboxypeptidase A C-terminal domain-like 4iiyA02
4IIYA 3T5MA 4MJXA 5FD8A 3SR3A 4EYSA 5K99A 4INJA 4E5SA 3TLEA 5F5XA 4MI1A 3G23A 5F1YA 3TLBA 3TLCA 4IIXA 3U1BA 4JVOA 1ZRSA 3TLAA 3TLZA 3TLYA 1ZL0A 2AUMA 4H1HA 5F9MA 3TYXA 3TLGB 3TLGA 4E94A 5JYBA 2AUNA 3GJZA
chains in the Genus database with same CATH superfamily
1H3FA 1PZEA 1F5SA 2F3UA 3BS4A 5FLKA 4KK4A 5ESXA 4A27A 1YS7A 3VPBA 2FV8A 2XVMA 4YI3A 1RJEA 1A50B 2X9LA 4US0R 1B2LA 4NX2A 1EM6A 1QKKA 3GA0A 2JFBA 1VYVA 2UXCB 3L7JA 1EMDA 1JEEA 4MIOA 4U39A 1FP7A 3G85A 5DGTA 3UV3A 1GPJA 3B8EA 4KWHA 2G0TA 2R00C 5HA5A 2CLMB 4MVWA 3TFWA 3LCRA 1PFVA 4X92A 1N2CA 3BI0A 1D07A 1TK9A 1E4EB 1IY1A 1JAZA 4CM1A 4FDTA 1KKLA 1XVVA 5CW2A 1T36B 3CNBA 2DM6A 1DDIA 4EZIA 2OHVA 1BFKA 3IHLA 3ISJA 1SURA 1RDFA 1QB8A 1ZNZA 1ZSYA 1XP8A 3DVAA 4U7GA 2WTXA 5BVHB 3I74A 4A16A 2P8JA 3L1UA 3DZJA 3KLNA 4KPGA 5AVVA 4M8NE 4M0LA 3NC0C 2AFIE 1KSHA 1ORHA 1UJ4A 2DBRA 2H1CA 1J0DA 2Q6OA 1UEJA 2R7LA 3DTVA 5E6SA 2RI1A 1PWEA 1UOEA 4RPJA 8AT1A 1V9SA 1RRPA 2WT8A 3A7DA 3FFWA 3ORFA 4NMXB 4TTAA 4FEYA 3QY0A 1U8YA 3FGPA 4H4DA 2GYYA 2GJ8A 3E18A 3QE3A 5A02A 3FTFA 3FMIA 3T7SA 5FA6A 2BR5A 1C7EA 2IYNA 4BRSA 3LCUA 3LP6A 5IKEA 1VRCA 3JQCA 1QWSA 1NKTA 2UVPB 5A4AA 1KO7A 4MMXB 4AKTA 3HWSA 1WVMA 1U8TA 2V6JA 4B34A 1JFRA 3AW8A 1OX4B 5ALMA 4MJLA 4BX2A 1OWLA 4DQXA 5BUCA 1GAJA 3OEWA 3RSOA 3NHUA 2ACVA 2Q5EA 5B4UA 2VF5X 2XMZA 3K9WA 2F1JA 4CQJA 4XRRA 5BOSB 1TJYA 3KC2A 5KNCH 4C0LA 2VHWA 4DUPA 4MITA 4YCAA 4HDKB 2QTWB 1UIRA 4LXUA 5EP2A 1CUWA 3RRMA 3PJDA 1K7FB 4OQFA 5DN6A 4OHPA 1RRKA 1TK3A 1U0FA 4IDQA 1NZJA 3JD0A 4R9NA 4KDRA 3VDRA 4CLXA 5HS6A 5TEWA 3S70A 5GIOE 3PD0A 4E1AA 1X86B 2ATCA 1PGOA 2C9OA 1NTOA 1ISHA 1YB5A 2G5PA 1VBKA 3EHDA 3MJDA 3C15C 4JIGA 2XVAA 5HFAA 4CF5A 3U56A 1NXPA 4EUEA 3PDIB 5BN3A 1R74A 3RODA 3CNLA 2MT9A 3DLAA 1HLPA 1L7EA 1W0CA 3FSJX 2TMYA 3IEUA 3OTQA 1EE1A 4RSGA 4U6QA 5ANRB 5F2KA 1Y9JA 3I05A 2QMEA 1MTZA 3B3AA 4DQDA 5BWLA 2GK4A 3KKQA 1UMBA 1F8XA 5G2OA 1E1LA 3RYHB 1MJ5A 4P2BA 1R5BA 3KLBA 4O4HA 1RP1A 1SBIA 3AGQA 5JH7A 3VDXA 1LSJA 2IGBA 1VIYA 1ZGZA 2GSDA 3GDOA 5H3CA 5JTUA 3E7XA 4XGNA 1YK0A 1OY1A 3K05A 3MFQA 4YQEA 4IV0A 1YR1A 3FPHA 4BAZA 3TVYA 2H57A 2EZUA 1B41A 3O8RA 1AMOA 3GLHE 4C7MA 4F7DA 4WESA 4BB5A 5A4JA 3UFBA 4IEFB 2PK3A 1GXSB 3IOBA 2HRBA 3MGBA 5DTRA 4E1BA 4DCOA 3PVZA 2NQ2C 4E11A 5A04A 5E1OA 1NLYA 1QIGA 4ZIRA 2DFLA 2R1TA 1E2QA 3KK0A 5AUPB 1XCPA 4GX5A 3WWDA 4KR6A 3DMYA 1L9XA 2FB9A 2R6AA 3QFSA 4MUIA 4O33A 5HQJA 1CUDA 4KFCA 1EXNA 3G2KA 1CQIB 1NU6A 3I73A 4U3JB 2XUHA 3BZBA 1B0AA 2BW0A 5T57A 1NQAO 4C4RA 4F84A 2D62A 2I6XA 4N4AA 1C4OA 1JS1X 1J8DA 2CNWA 4H7PA 3KUDA 1HLFA 3I72A 4G4JA 4WNYA 3Q88A 4MYCA 4UXJA 2W2XA 8OHMA 4BY9E 1WG8A 3EZEA 4WMLA 4ZRMA 2GRUA 4BNMA 3IIBA 3UWMA 4MLDA 5FBWB 4ZAGA 3KWLA 4F3KA 5KWIA 1LQTA 2WWVD 5FWAA 5BYBA 1RYHA 2R2AA 5DV9A 1K89A 1RKBA 3P8ZA 4J43A 5IDQA 3HJFA 3RBUA 3GIWA 5G4LA 2HF2A 2PY6A 1S2LA 1UPAA 1XRNA 2QM3A 2QM8A 1V25A 4YCCA 3L0SA 3GEMA 3MT0A 4Q4JB 4EAAA 4PY2A 4W9NC 4DC1A 1I94B 2AFHA 2G6BA 2WM2A 5L9AA 3REOA 2A5GA 4DCCA 2W11A 4FS8A 4XB6B 3TSZA 1ONSA 4JC5A 4R8LA 4RMGA 4Y0AA 5D51S 3WAKA 4B7ZA 3PXDA 4C06A 3O8NA 1Z38A 5JW6A 1U9YA 1O9HA 4ZJYA 3RS4A 1P2DA 1JIUA 3MHTA 1ZM4A 2WIGA 1TYCA 2JLCA 2PA0A 2P7IA 5B57C 1KGSA 1O77A 3EODA 2ZWAA 2OA0A 1ZR4A 3CX6A 2Q07A 3RS7A 4B2PA 1RHKA 2BTQA 4TYNA 1T4BA 4XM1A 2M6SA 2WAYA 4IHJF 1ZJ5A 3ZU4A 1QDEA 2I7XA 2PZBA 4BX8A 2QF7A 3D02A 5H83A 3LFTA 4BBAA 4L28A 1FPMA 3GRKA 4C9UA 1P4AA 4AZ3A 3EX7C 1IXZA 3G0GA 2NUTB 1RQNA 1L6IA 3SHFA 3CWQA 1B93A 4KBYA 1ATIA 1F17A 1UT5A 2WJGA 1AKTA 4RGYA 2H2FA 1T4CA 2BONA 4I4NA 5IJAA 4CG3A 3Q3JB 3QTLA 3L6EA 1FZQA 4LQGA 3ZLJA 3WKDA 3D1JA 1C0KA 1F0NA 3K9GA 3TIGA 4QG7A 3VPCA 1C14A 1DDOA 4QUEA 4ZEMA 1GIAA 2FE4A 2XQKA 3FTQA 4HDCA 1BVUA 3BRWD 3LF1A 2Y0PA 3PFFA 1G9SA 3IVXA 5ALXA 3STUA 3FOFC 1V1RB 4WKBA 3D2LA 4AO8A 2O5RA 3OF2A 3LV8A 3SXUA 3Q9NA 1XC7A 1XN1A 2O3UA 3TQSA 2O07A 2O8VA 4HEQA 1K7SN 1L3CA 4JB0A 1WVGA 1YI0A 2M6RA 4N3AA 3N7UA 5K9ZA 4D79A 4WA8A 1VL5A 5FLXA 3VR5H 4IO1A 1FP1D 1GCAA 3UW3A 1Z68A 1CB7A 2VHUA 3KX2A 4PC3A 4TKUA 2G83A 5IJXA 3ZWYA 1E3EA 4KUHA 1OLXB 2O0KA 3C14C 4FDMA 3VDNB 3IJRA 1XZNA 3AUAA 3AR9A 3D0QA 1UBCA 4OGWA 1BU8A 4PANA 2K7ZA 2VH2A 3A9UA 1OX5A 1XEWY 3N0RA 3U3ZA 8LDHA 3S2UA 3UG7A 1KI2A 1WO8A 3IDZA 3D8BA 4Q47A 4Y0NA 1Q7BA 4BCDA 4YRNA 2RGBA 1BG6A 2XGOA 4WXHA 2JAOA 1J9GA 1E9EA 2XPCA 3HUEA 4G23A 4V2IA 4HEA1 2DKNA 2WE8A 3MJCA 4D5GA 5FBZA 3NTOA 3CNHA 1M0TA 5GJVC 1C2YA 1XTQA 3EY4A 2R11A 1N2BA 1BDBA 4IS3A 1TQ4A 2IDZA 3AERB 1CPYA 2JGDB 2HJHA 4XLLA 5JMWA 3BHXA 4DMRA 2IC5A 2PMDA 4RY9A 4AY3A 4QAQA 4KR0A 4ZZ3A 3NIBA 2C5SA 3O5AA 3JVIA 4WK6A 5GV7A 4Q4DA 4P1ZA 2G71A 4RVOA 1T8YA 5JMOA 4OJNA 2DT5A 5AW3A 3QKIA 2WYUA 1I2AA 2OC4A 3EFOB 3UJNA 1FU4A 4TQGA 5EZYB 4EPRA 2CNBA 2N1MA 3LIPA 4EHLA 1W0JD 1UBUS 3GMDA 4I6JA 2CSXA 4LHSA 1YT5A 1XWWA 4DSZA 2EP7A 2COKA 4PTZA 4KE9A 3IUJA 3L8DA 4BOYA 5AO9A 3SVTA 2A3NA 2IEGA 4CV1A 5F1PA 2JIRA 3WB0A 5DYGA 1QIIA 4ID3A 1SC6A 4JLDA 1GTMA 4TTVA 1G3QA 4N7MA 3U49A 1I33A 1ODKA 2FGKA 2PGDA 2VA8A 3I30X 3L4BC 1EVIA 2X2PA 3QF7A 2OB2A 4JHLA 4ZQCB 1MPTA 1CNFA 3X0DA 3ICOA 3TTXA 5I8PA 2XE8A 1KRXA 4XUGB 1SC9A 3ZIAA 3EZ2A 4A5OA 3BICA 3D64A 2VZ9A 3NBAA 4QXQA 5LQJA 5C32A 8ADHA 1KEEB 3QLVA 3WKCA 5AH0A 1YFJA 1P9WA 2ZPTX 4PXAA 1SXJA 4EHFA 2Q4TA 3TPFA 1W4RA 3WBJA 4EA9A 4OHMA 4IX9A 4N6OA 2HL6A 4NCAA 2Z5VA 3P2OA 4GLJA 2YH2A 4WLOA 4XYBA 5AJVB 4WBNF 1BDIA 5BUQA 5CIQA 5IDYA 1J0BA 1UQUA 3FWNA 3H16A 1PT6A 1OXTA 2VNSA 4X45A 4DV1B 4JH0A 2DP4E 2O2JA 3UM9A 4IUBS 4EDHA 4NK4A 4OIMA 3ZKAA 2GTIA 3G1UA 3UHFA 4LWPA 5CEJA 4GZLA 2QG9A 4OLBA 2OCXA 2Q1SA 2JJQA 5K01A 3OTOB 2GCGA 4TMFA 5ALLA 3WAGA 1NOKA 4KVGA 3K1ZA 4Z2AA 1KJQA 1A9XB 1G9XA 1U9JA 4XVRA 3X44A 1XRMA 1XZBA 3L7MA 4HI0E 3PFHA 4C6TA 4M0KA 2ON6A 5L53A 4E12A 4MCHA 4PYQA 1YTLA 2NPFA 4C3ZA 1EGAA 1TW3A 2EZ9A 3LVBA 3FBGA 1WDTA 2IE8A 4RELA 3C5HA 1S2OA 4KLNA 4MO2A 4HH3C 4RHXA 5EEHA 4ZANA 4JI3B 3R23A 4NFSA 1OMOA 3ET4A 5KYGA 4REOA 3GRFA 4RXTA 3SHWA 4KAJA 4CM6A 3EGXB 5JASA 2AWNA 1WHTA 5EQDA 4D9NA 3V7FA 2ZZMA 5B12A 4QXRA 4Q7EA 2FA9A 1YZFA 4NYMR 4LRSB 1J2EA 2W98A 1RWQA 3A11A 2CGEA 3G2JA 1KJYA 4F91B 1YKGA 1EP3B 4FCTA 3ZC3A 4QAJA 4JI7B 1FYVA 1E6MA 4GI7A 5CNMA 1J1ZA 5INTA 4EFMA 4F60A 2ACWA 2IHKA 1R0LA 5K8JB 2AOTB 2BKAA 1J21A 3E7FA 4UEKA 1FW6A 5D1NA 4P4SA 1NVXQ 1JSXA 3FHOA 5DZSA 3SBEA 1ZCAA 3EC7A 1RPAA 2H1SA 1QGED 3D8TA 2WB4A 4ILEA 4V3CA 5HILA 5AD1A 2ID7A 3MAAC 1PO7A 1O4VA 2V4ZA 1E9RA 2KX7A 1N2GA 2YHSA 1NJSA 3KU4A 1PU2A 4PSVA 1E7RA 5HG0A 5JXWA 2J6IA 3EEQA 3U3DA 4ETMA 1JLLA 1C0PA 1IY2A 3UAZA 3UAGA 1J25A 4U2GA 2FPLA 2ISCA 4YCLA 2P6OA 1KERA 4P54A 2Q4EA 4Q1FA 5HIJA 5J2UB 1SZDA 4AK9A 1YKSA 4EKEA 3KVYA 3QV2A 4FE4A 4BVHA 4YJ3B 4B7XA 1WPXA 5BW5A 2C95A 3Q6IA 5AI5A 1S96A 3OI7A 1JDPA 1TCUA 2P2SA 4E5NA 1WBDA 1E94E 2FQ1A 1ADBA 1F5NA 1TK2A 1V6CA 2WZCA 1HDYA 3C6YA 3F2IA 2QUZA 1KJ9A 3IC5A 2YS7A 1YJ5A 3F46A 3A58B 3MWYW 4G97A 4WT7A 3NHRA 2LKDA 5BMVA 5JMTA 5JSHA 1KYZA 1RE1A 2QN6A 3ICCA 4LPSA 3OM8A 3ENVA 2YV4A 1MU0A 4LJ7A 5K6AC 4LCBA 1BW9A 1ULSA 2PR2A 3N5KA 1JYSA 3NJRA 4MYRA 2AZXA 4GRIA 1X7YB 3JTMA 5TPZA 5AIBA 4I5EA 2QQ0A 3DWIA 1CX8A 3JAWA 5C8VA 5EJFA 3EJWA 2C2MA 5EMJA 2G82A 3DBOB 2DUJA 3GA5A 5FHRA 3NHMA 4TWZA 5KOHA 2ZAIA 3WQRA 1DKUA 4NYJQ 1VKOA 3L7YA 2Y1DA 4MTCA 1RPNA 3U7EB 2AIRA 1HNWB 4S24A 1KSJA 3IAS6 3U7FB 1WD5A 1VJCA 1XCLA 2PLFA 4G8DA 1PJRA 3R7WA 1GPNA 3AFGA 3B6EA 4NEHB 4F0JA 1XIVA 4B45A 4BUJA 1CDEA 4KQ6A 2VDKB 2Z2XA 3DE1X 5EQTA 4L4YA 2F3SA 3T1NA 5JDIC 3IMGA 5EWMA 3LX4A 3TXAA 1RYFA 1T3LA 1TXGA 1Z75A 4FE7A 2F1RA 2R00A 4RFVA 3JAKB 4WOCA 5D1HA 3SIPA 4RPGA 1CK4A 3AFHA 1P9RA 1UBOS 5AYVA 4M1TA 2J4DA 4QRDA 4FHFA 4N3BA 5EHNA 3WTBA 4BE9A 4MQ5A 4AKHA 1KP9A 3IUMA 3SLRA 5BV0A 1W0KD 4IJVA 2GPAA 2WJVA 5FPSA 1GEEA 4R81A 1E89A 5JCJA 2IFTA 2FSVA 1K5DA 3P9SA 2QORA 3PXBA 4PBRA 1XDUA 1X7ZB 2J48A 3LDUA 2LRHA 3CLTD 2YDYA 4GM4A 1YSCA 5G0WA 4HAWA 4CEIA 1GPAA 1NR1A 1FRQA 4P86A 2CCJA 3SLKA 3WQSB 1TZJA 3JQ7B 2OESA 3GEBA 1DTWB 3UKOA 4M60A 2H7XA 4ZK6A 2Y76A 1R0KA 1WHSB 1QYXA 3NB0A 1MW8X 4P0QB 1M6WA 2JFWA 3K2QA 5BW6B 2AQ8A 1KC1A 4FR5A 3TTSA 3IKTA 5G1PA 1PV1A 2ZIZA 4QJ4A 3OC0A 3TPCA 4MMZB 2AQKA 3ZCUA 3ITDA 2IXBA 1KOLA 4HWRA 1HT3A 3OAAA 4WIAA 2I34A 5FA8A 1I7PA 5JJ5A 3LPLA 1B0ZA 2BFAA 3RVPA 2ESRA 4KGZA 4LTMA 4ESVA 1E62A 2Q8PA 4YEDA 4F5WA 2Y8EA 1WCWA 3SQDA 4ZEWA 1U7OA 3RIHA 3TQTA 4YY3B 1PS8A 4LY0A 3O1IC 4OYYA 4JDUA 1EFHA 4J0JA 5LD2C 3OFJA 5DOZA 1UKBA 3OPYB 1JR3E 1T3HA 4LHVA 1P31A 2R82A 1JYEA 2GF9A 4PC7A 5L7WA 3SBOA 2VPWA 3TOZA 2CYBA 1KI6A 4ZHQA 1ECLA 1T8WA 1FYWA 3LG2A 5EKDA 5HX7A 2CD7A 4WN9A 3A4MA 1CY0A 2JKZA 4ZJUA 3I3OA 3NVMB 5LMCA 3PWZA 4DV2B 1KF0A 1SKYB 4BYMA 3L6OO 1FIUA 1VBFA 4LZZA 3TW8B 3GAZA 3ZZ1A 4F6RB 4KN8A 5JD5A 4NRDA 3TRJA 4PTLA 2GHIA 3B3JA 3MOIA 4JVNA 4MVCA 4WTOA 3PPXA 5IBQA 1T2NA 3A4TA 4KIJA 3FYTA 5C4IA 1N6HA 3QA9A 3QI2A 4LZPA 4NBKA 3S2ZA 2W43A 3LLCA 1USVA 2Z6QA 1EINA 1HYEA 3PT5A 4B85A 4C4ZA 3MJSA 4EHBA 2L19A 2ZWPA 2W93A 3CISA 3L0BA 2D13A 2LCFA 4IF4A 4NU6A 3KVRA 4EFKA 1DEXA 4R6XA 1VL8A 3Q7IA 2TECE 4X6XA 4TLEA 2VBGA 2VJOA 2P91A 5FI3A 2HWWA 3UG6A 3ZYZA 3H11B 3HKDB 3VHRA 1RQ2A 3FCOA 3EMBA 4ZCTA 1CVIA 3N75A 4H31A 3AHCA 4HWTA 2OGZA 4CQLA 9MHTA 1MOPA 4HFMA 4TMKA 4PLGA 3MCWA 4O2AB 2JK0A 2QTMA 4NNOA 4DPLA 4PQYA 4QHSA 1H66A 2FN8A 3PQ4A 5DGXA 5KJEA 2OCBA 4MR8A 3ADPA 4GMXA 4LNHA 1WUJS 3O3MB 3D8NA 2SCUB 4J0QA 1INLA 4JSYA 2GFIA 4QQKA 2IYUA 5FO0A 5T67A 3VH3A 3FDZB 2BEWA 3EEIA 2VDJA 3QH4A 4TPKA 4KLAA 2YWXA 3CLSD 2EBHX 2XMBA 4RSHA 3K1AB 3MW8A 3DKVA 4B71A 4RVGA 2OD2A 2LBPA 4X63A 1DUSA 2CJWA 4R69A 3GBSA 4BJ5A 3QRWA 5ICMA 1GPKA 5AT1A 2H29A 4HV4A 3TECE 4QUKA 4O08A 4QREA 5LP1A 4LOIA 3U3JA 5T7BA 1BOOA 4QUJA 4C0HA 1Z5ZA 5DO9A 3EGEA 3CE9A 3Q3EA 1N25A 5EJIA 5ARDA 1KAMA 5GZ6A 2WD9A 3K6SA 3PR1A 3SSOA 1HPLA 1QGZA 2Y27A 1EVLA 3QITA 4K03A 2XE7A 4RY8A 3HLYA 2GCOB 4TLLB 2BFDB 2OZKA 3WICA 3CUEF 1W5EA 3ZD6A 5DK6A 5COBA 4BP3A 4DR2B 3KTFA 3NG1A 4JV5B 1K0UA 2NUPB 4S1TA 1W52X 3VR3A 3UTCA 3OPVA 1YOVB 3DTTA 3IBTA 4KC0A 4W8OA 1T0PA 4YCJA 1KMHB 1DGQA 4B8ZA 4IQFA 1GKYA 2H54A 1Y9AA 2SKDA 1J70A 1G7TA 4JUCA 4M9CA 4QPNA 4W9NA 5DCUA 1IOWA 2Z98A 1J42A 3EDOA 2ZSDA 3GRZA 4ZEOA 5H70A 3SC4A 3WL3A 3HP4A 1YDFA 1QCZA 5EIBC 3KAJA 1FYEA 4FFVA 3NH9A 1ISGA 2WSMA 4RYLA 3HZOA 4YJFA 1OXSC 1V35A 2F7SA 3AKYA 3DZGA 3MC1A 3WSVA 1PR2A 2R66A 3MJRA 4Y2PA 4KYIB 3UJAA 3U4AA 4E1VA 4E5YA 4PZLA 3ZNNA 4D4HA 2CNLA 4E7OA 1PTJC 4QLBA 3NDIA 4Z5XA 1K4KA 1PYGA 3GLVA 3OQBA 1QMPA 4UVGA 1SXHA 3WNBA 5C1PA 2O52A 5IKOA 5TXGA 4TLAA 3G7SA 4TUYB 2GBIA 2NXCA 5AW2A 4AICA 1ZWLA 3V1NA 4NMHA 4URVR 4NS4A 1I6WA 1J6UA 2G04A 1JG1A 1Q1NA 2HRCA 3KSDO 2E7ZA 4ANFA 3HB5X 3H2YA 1H8ED 1W30A 4A36A 3EPPA 3WLOA 1U3GA 1WB5A 2HPAA 1ZINA 5DM2A 2LZ0A 4KNVA 1V1MA 3BMXA 3ZJTA 1CIJA 3EW9A 3GROA 3ZDEA 4UKDA 1E32A 2I7TA 2W2KB 1ZJ6A 5T4HA 1RAAA 2NU8A 4F56A 4YUZA 3K70B 2XZPA 3BRSA 3GEDA 1BX3A 5EHXA 3GHHA 4LXIA 3ZE8A 4F21A 4I55B 1R0CA 4EAQA 3AIIA 4F3CA 1YRYE 3DBHB 3ZD9A 1JEOA 1PGQA 2IW1A 2NO4A 3GDHA 3O84A 4NMLA 5E0OA 3COSA 5J23A 5IT9A 3FOEC 4GOLD 3T1VA 3SJZA 5A06A 2AD5A 3ESDA 1QNFA 3DZFA 4CETA 2Z08A 3QVMA 4WASA 4ZTUB 1J49A 3RTGA 1IBMB 3FZGA 3ROGA 4WOBA 4OI1A 3SBDA 3GFVA 2FSSA 3BHIA 3BMOB 1TEVA 3LXXA 1FE8A 3GLQA 1XRLA 1ZXLA 2XTZA 2B8JA 1VE3A 4ZARA 2ZJ8A 3ZZMA 3I1FA 1W94A 2Z1NA 4G2NA 4QUHA 4TT3A 1TIBA 4ZPJA 2IYLD 1NM5A 4PW0A 4B79A 4W7IA 3THXB 3JWIA 5I4BA 3L1HA 5I9LA 2WSSD 1IU9A 1JHXA 1V96A 3OIWA 4MCSA 1A9PA 5CA1F 1XT6A 5GY7A 4NBRA 3WWYA 1KJIA 3M33A 3BXEA 4G1BA 4XOUA 2D7JA 4MKFA 4EJSC 4ZYYA 1SJ9A 3BA1A 2HWYA 3BMCB 1T34A 5CVDA 5BQ3A 3CQ9A 5BT8A 5JZ9A 4JWKA 3DO8A 1P44A 2FRDC 2VRCD 1Q19A 5KOYA 3HVHA 1HL7A 2DPGA 4QATA 4UREA 5DLDA 1C80A 1BXGB 4U2FA 5EGNA 2G25A 1Y1RA 5LCXA 3PC3A 2CWDA 2D06A 4EGFA 2HBYA 3GXBA 2FMKA 4C0WA 2AMVA 1LW7A 4EFNA 4O2LA 3T9EA 4A3SA 4YUAA 2H1RA 5JANA 1JHUA 2R48A 3LPNA 1JH8A 1XA3A 1UOOA 3MRXA 1GZHB 3TRDA 2PX3A 2IZ7A 4P45A 4F4DA 3KSZO 1A8UA 2BGWA 1I6MA 1LLQA 2P5TB 3KOOA 3OX2A 5T4BA 1AKEA 1ORRA 3KUCA 3WG9A 3HM9A 5AW7A 4XWYA 1M1YA 5KTYA 1LVHA 1XMXA 2IOYA 4YGXB 3RABA 2WWIA 3AR5A 1POWA 3IHKA 1C3XA 1PR0A 4WDRA 4ZVRA 3B1ZA 3FTDA 3L7NA 3FLEA 3LY9A 3HDTA 4DRYA 4RD4A 1MO3A 1W6RA 6REQB 4NBLA 5DLYA 2JW5A 4Z4QA 3SFTA 4YCNA 3TOVA 4LF6B 1RM0A 1T8UA 1WCXA 5H81A 2Q1UA 3WKEA 2VDOB 3STYA 1KY2A 2ZSAA 1KTVA 3ILHA 4LF7B 4G0MA 2SKCA 3OCCA 3PL1A 2XV1A 3E5NA 1M1XB 3GGDA 4R3UC 4MP8A 2QD2A 1NPYA 1U7TA 3RSZA 3SDBA 3ZI7A 2P9YA 4GPIB 4RORA 1SIOA 5HW0A 3IS3A 4U6NA 1BS1A 4A6PA 2C1EA 1YZNA 4FKBA 4E2YA 3C41J 2WICA 5HGJA 4FFSA 4YMHA 5IM4A 1N78A 3TFOA 4YJHA 1OU4A 2P11A 1KZ9A 4NJEA 2V1UA 1RU3A 3ZU3A 4UZSA 5K3FB 3GLHA 3HCOA 1FU7A 1UL1X 4MWBA 3BB3A 4M1MA 3EUAA 5ESDA 2VYVD 4OFXA 2FKAA 3ANXA 1MJFA 4N0EA 1AMNA 4TZ6A 4WECA 1BCRA 2A0UA 5E4FA 2WTEA 3OZSA 1A9RA 1I5EA 4V2UA 4C04A 1MN6A 5HOQA 1I3CA 3J81A 2BHSA 2HIGA 3PHGA 1I7QB 2WTNA 4D9HA 3I9KA 5E38A 1M74A 1KFEB 1BE8A 2GJAA 2ISSD 3SHOA 1SBZA 1UBEA 1DVRA 2P6NA 3E05A 1B74A 1VJGA 3C7DB 3CNNA 3LDAA 1N0IA 3QU2A 4KGVA 1A71A 3EDRA 1NQXA 2PWBA 5KYWB 1IEXA 2ZUCA 2ODEA 2XX3A 2Z9CA 5FBKA 1HKUA 4BVKA 2PRZA 1SKAA 1TVKB 4QULA 4C4TA 1N92A 1YRBA 3IV9A 5J2TA 5T8KC 1RQ7A 3LC7O 1BJRE 2LW7A 3I1IA 3UJ3X 4HTAA 4BVFA 4C9RA 2Q4OA 1N57A 2ZRPA 2VRNA 1NW5A 2C42A 4W6QA 3PFNA 3QEMA 4LDJA 5G0UA 4DOMA 1CZUA 1JR6A 4BKUA 4CM7A 1G98A 1DBQA 2GLTA 3GELA 1D0IA 2IP1A 2Q5HA 1E2DA 5GONA 1U1FA 3R0XA 4K28A 4H6WA 3DOJA 3FUWA 3S28A 3CEMA 4L8GA 5KTMA 1JEAA 1E92A 3OUTA 2ZI9A 1CUYA 1KO8A 4HN2A 3U4CA 2PS9A 1CXZA 1L5OA 1X8JA 3B60A 1GN9A 4G0QA 1NWCA 4H0FA 4HZIA 1MAHA 3PJFA 4MIYA 4P6VF 1MKYA 1GARA 4RH1A 4TGLA 5TT1A 1VIAA 1T9AA 3SKXA 3DBLA 3MG9A 2YJZA 1MENA 3K20A 3JQQA 3C98A 1PQ4A 4RD6A 1IE3A 5P21A 5GZ1A 5AVTA 4NOJA 3W7BA 4J2TA 4G56A 1I2ZA 1SZPA 3BE4A 2VQ3A 4OLHA 1K3TA 2GLXA 2V5UA 3CG4A 3CZ9A 3AHGA 1MO5A 4RJIA 3DBRA 1CDOA 2GO1A 2V98A 1T2DA 3BA6A 4JQSA 3M5PA 4I5GA 3TXXA 1C30A 3ZLUA 4EWLA 4N18A 3BOSA 2WSIA 4NFHA 1C4WA 1ECGA 2WF9A 3VGJA 3C6BA 1JKMA 3M2TA 3WMEA 1L5RA 4N5NA 1XZLA 4N8EA 3NXSA 2ADOA 4RW0A 1E8NA 2BFPA 3A06A 3EOAI 3Q7RA 5JS7A 3J80A 1NOIA 1PVOA 2CLKB 2ERCA 3PYLA 1DJNA 2E3JA 2CLIB 1CY8A 1TM7E 2J67A 3ZWPA 3NWEA 2HRRA 1NG9A 2VZ8A 1QFYA 3CY6A 1ZICA 4CLDA 3W0LB 3F73A 2HF7A 2C5EA 2RGDA 5J5AA 3I12A 1Q44A 4LGCA 1D1PA 2NADA 3VHXA 4AO7A 5JCXA 4P4GA 2E0IA 2G6TA 4CZ2A 3T1YB 2UUCB 1NRIA 1Z74A 4CMIB 4QUDA 4EUSA 1YRHA 3A32A 2WOJA 2FK7A 1KEKA 1J20A 4H7DA 1O1YA 2BPOA 3BXZA 3EPRA 3I09A 1P2FA 1T35A 4TXHA 1JMYA 4ISBA 2ZI4A 1GL6A 3PR3A 2HU5A 3U4QB 4RK4A 2P9BA 5CLQA 1JSRA 4DMUB 3C16C 1JIIA 2A9KA 1VI2A 1VPDA 3D3JA 5LC1A 1VQ1A 4MDEA 1B16A 2RGAA 5IH7A 1QRDA 3NXKA 2OHGA 4JSTA 1IAVA 3LQRA 4O1IA 1JJBA 4UFOA 3IPAA 4JVMA 1N2OA 3ZCRA 1Y37A 1L5LA 1E1DA 4IQ8A 1P4SA 2GYUA 1A88A 4AG6A 1JL3A 2WSYB 4AWXA 1YVEI 2CBXA 1YZGA 2QRKA 4M99A 3RNLA 5CFLA 4WV3A 2H4FA 1AXEA 3PXEA 4IVQA 3NCTA 4CN9A 3RAGA 4EQ6B 2VXBA 2YMQA 1GO2A 4HLUA 4QFDA 1XVLA 3B36A 4NJMA 2QRZA 4NATA 1J2TA 2NXWA 4H1WA 2E89A 4JT4A 1U8FO 4LE2A 3R7SA 5LL6P 3HP7A 3K35A 1N32B 4K1XA 1HE1C 3ELUA 1J0CA 4C88A 4WGFA 3I4CA 1LX6A 3MTEA 4LSMA 5CBPA 4LA4A 5AMXA 1TQ2A 1BVHA 2H07A 1M7GA 4W8GA 4WFJA 2YJ3A 4OQYA 4OBWA 4XAQA 4C2UA 3IEVA 3KOZA 1R1DA 5G4KB 4Z6KA 4C5BA 4M53A 1ZNYA 5CB0A 4MCPA 2PD3A 1U3WA 4B7AA 3DNPA 2IIBA 3V1YA 4CMEC 3WBBA 4LUCA 1P9OA 5IXSA 1ISPA 2FX5A 3OZVA 1T2AA 2I7CA 2INGX 2DR0A 2HFJA 2CMFA 4X8MA 3QGMA 3UB4A 3LRXA 3QPBA 4JCOA 3S1AA 1RLTA 2IU3A 2YWHA 3TKLA 4DQVA 5KNDA 1Y9EA 3RFCA 5CH3A 1JKJA 3MBOA 2P40A 3DW1X 2G9UA 4M86A 2GFQA 3TLMA 5KNBA 4KPEC 3PNQA 1US8A 2V7UA 3LHFA 2E48A 3Q15C 2D2XA 4QEZA 5CXSA 1ML4A 4IVPA 4MAFA 3U60B 4HWPA 3RBVA 5FNVB 4KWIA 5KBYA 3SG0A 4YIHA 3CG0A 1SCIA 3V42A 2A8YA 4NV0A 3AEZA 3BGIA 3F1KA 1NHWA 2UAGA 3TD6A 5SZIA 1DNPA 1JKFA 3BJRA 3ON5A 5FUYA 2WJWA 1V48A 2AMJA 1IQUA 3NTLA 4FSXA 4IR7A 4YXWA 4RTKA 1P33A 2XRFA 3UHPA 3NDBB 1G2QA 3O75A 4QTXA 2PHZA 3GRAA 4JJAA 3T9AA 3MBIA 2HO5A 3WLKX 2NTVA 3FMFA 4GGOA 4WOPA 1JLKA 4TS4A 5CYFA 3F49S 1FNSA 2J9ZB 3P2IA 1CLEA 1ULBA 5EIWA 3EGCA 1N34B 2OCLA 2Y1XA 1IQRA 4O02B 5K8LA 3OLYA 4GYWA 3JD3A 4N5MA 2DQ4A 4F5ZA 3I9JA 4N5IX 4MYDA 3VVCA 3M6AA 5FPHA 1I3MA 1NXOA 5DBOA 3VSBA 2MINB 4YJGA 2EKQA 4ZPXA 1T5IA 1FBTA 2PVPA 1MO6A 3DCIA 4M9XA 1O5TA 4P4EA 3ELDA 3DXYA 4W6ZA 4JUDX 2JLRA 3ESAA 4J2HA 1BH2A 5ARCA 2R7KA 2Y0BA 1ZAKA 1AQIA 3H42B 5TDHA 2IXEA 4QVKA 4F1WA 1Y9DA 2OCKA 2FEOA 3QF4A 3RBZA 2GLUA 4CV3A 3SJXA 4PV7A 2IEIA 1YFKA 4NPHA 4XTRA 3SJFA 1C4XA 2OLSA 1ESCA 1U2RA 4YRAA 1DARA 4J1NA 3BERA 1X1QA 4MS3A 3R24A 1Z6QA 2QTAA 1DBVO 1TIPA 5F7JA 2QAGA 2EKZA 5CRIA 521PA 1FYFA 1J0XO 3BK7A 3G9UA 5KTNA 2A92A 3U1TA 3IT2A 3ETLA 4DT1A 3R7AA 5CK4A 3AF3A 1C41A 1F9AA 4Q9HA 2JGAA 1QU2A 4P3NA 2X5NA 1S02A 2XQIA 3CBGA 2XKBA 1AKWA 1P2SA 3EGDB 1KZHA 1LPPA 2HD4A 3PXAA 4QBFA 4FFLA 1WKCA 1IG3A 1NF2A 1QHHB 3DEHA 4K40A 4Z9BA 4DM3A 4ZEVA 1H65A 2YNMA 4LMPA 3EPJA 1A7UA 3EVDA 3TK1A 4D97A 1P4HA 2JGKA 1D7OA 2BFWA 1KJZA 1X7WB 4WDQA 3FEEA 4H1HA 1Z39A 3EZ7A 1ONNA 3SS8A 1IULA 1PJZA 5L40A 4EFDA 2REOA 3BEOA 3NKVA 3Q72A 4JBYA 2PZKA 4OUDB 4MSUA 5IUKC 1PJQA 1TZ2A 2PMFA 3DA8A 4Q7LA 5F2EA 4LK3A 3HRHA 2ENWA 3DNMA 4D9KA 2BI4A 1CZHA 1NQUA 1FUYB 1MZVA 4KR7A 2BLNA 1ZGBA 1ZAYA 1DIBA 1F2UA 1SH7A 1XXHE 1DTSA 2RB5A 4BKMA 1LB1B 4HN4B 1K6IA 4I8IA 3TH5A 5D5HA 4DR3B 1N6KA 3VTFA 2AXQA 1SBCA 3T12A 4MVJG 3ZCSA 1KO4A 5EHGA 1Q1BA 5CGQB 1WUIS 1Z83A 2BVNA 5JAZA 5JS6A 1P7WA 4F3NA 4BWGA 3UAYA 2FPPB 2NZYA 3DDSA 3HKBA 1ISRA 4AN4A 1PTJA 2OOTA 1VSQA 2Q9BA 1LPAB 4WEOA 5D6NA 4HVAA 4D96A 2OV8A 3KM0A 3GEIA 4FXPA 4Z8XA 1ZDMA 2WJYA 5KTSA 5KX5A 1B42A 1PJ2A 4B3MB 4MAMA 2C04A 4BRUA 5KQPA 1R3DA 3NYRA 3Q8KA 2X7HA 1WPGA 2FUNB 2FX3A 4X97A 2DPYA 2Q3CA 4LJLA 2Z9DA 4Q93A 1GA1A 3ROMA 1X42A 2WUEA 1RJ9A 5AKXA 1WW8A 3VR2A 4H3HB 1KZ1A 4BMYA 2XJ4A 4EECA 2OK8A 3CCCA 1GUFA 3KOWA 4CMAA 2NT4A 3GB9A 1YJBA 4PX9A 3T4EA 4DUGA 3ZNPA 3HTXA 5AFSA 1V37A 1GQOA 1GNLA 4FLFA 4X1IA 4WRRA 4BRZA 5CVVA 3M7IA 3F6CA 2OV4A 3EZLA 1UJCA 4A0HA 5KYXB 3HL0A 3OLVA 3PGKA 3BMQA 4KMRA 4NULA 5BPFA 2H1HA 1DINA 1G18A 1H2HA 2ZJYA 1GD1O 1GLNA 1KEVA 2P4UA 4XARA 1KVSA 1P7ZA 1T0JB 3SN6A 1D04A 5A9RA 2IE0A 3A0RB 3H13A 4YMLA 1J3LA 2WG1A 2YJVA 2BMFA 3FI9A 4RVFA 3UTDA 3THOA 3UJPA 3ZWWA 4BAUA 2FWMX 1IRIA 2I6GA 2PSDA 1XZPA 4ER7A 1Q5XA 3MFYA 4MHOA 4Z0PA 2A1UB 1K5HA 3FGNA 2RH9B 2V7GA 3T5BA 5BNZA 2JRLA 5LDGA 3QJGA 3ZE6A 1ZNXA 3MTAA 1NLFA 3GU3A 3QLJA 2BGNA 1HH4A 2R0QC 2CHFA 2X8AA 4LXHA 2V58A 5JYDA 2IYRA 4X65B 1ZUD1 1HMYA 3KO8A 4R8KA 1G66A 2VL7A 4FOOA 4EL0A 2BTOA 2QX8A 1Q83A 4R83A 1DJQA 2V74B 1ZIOA 1AD2A 5F73A 5JT1A 2J9XB 4YAJA 1MJNA 4FLMA 3AF0A 1GGMA 5JAQA 2O8BA 2K5UA 1G5IA 3KHTA 2X4DA 3PT9A 4XA8A 1YDGA 2WE7A 3IBFA 4D0GA 1YU9A 3CZPA 1JE1A 3CUUA 3TFQA 3RK1A 2VT3A 1AT1A 1NP3A 4I9NA 2AR9A 3RGGA 2O48X 4S35A 2OKGA 4D6PA 2Q3HA 2R68A 3VDMA 2QZSA 1OAOA 4YV0A 3C1UA 5HQ3B 2ZCJA 4W1SA 3OLQA 1J5PA 2VJLA 2WDZA 4OSEA 1K9SA 3SVZA 3V8RA 1COZA 1ENYA 1FUEA 4N0QA 5CW1A 4DQUA 3G5MA 2A9OA 5CNJA 5H80A 3DOCA 1SVOA 4PEVA 3RYCB 1T0HB 2YDXA 1CC1S 5DGCA 2NXNA 3AJAA 1UBHS 1L5SA 1JR3A 4PZEA 4KN5A 4S1NA 4J0IA 3SPXA 1VGRA 1W75A 3OQ1A 4A03A 5FHQA 2C94A 4B3IA 2A9QA 3OLXA 4FM9A 1OC2A 3DB1A 4Y6OA 2Y1FA 4OOEA 2ZVDA 3PIDA 4P34A 4R1NA 2W2LD 1GYRA 1UM8A 4W5WA 5AW6A 5KOJA 3CGGA 1WXEA 2D7DA 4C8TA 4ENQA 3WL4A 4RSRA 3ER8A 2FUEA 1IYZA 1OFGA 4M1ZA 5FOTA 1SPXA 4M98A 2B83A 3ZDXB 1XMPA 5AVYA 3FMPB 4DIDA 1PI3A 1QYDA 1RMYA 2APJA 2EP5A 4RMHA 1OBHA 3SZMA 3PPVA 1BDMA 1UT8A 3P94A 3QG1A 1XHFA 5C7LO 1AZLA 2CVPA 5AW1A 2ZANA 3L84A 1UFQA 1FS5A 3SJCA 3B70A 3QFCA 3MINA 1BE6A 3V9PA 3FSEA 1RJGA 4DZTA 1EUQA 2GJKA 2YWDA 4KDFA 4LC0A 1VPWA 1KS2A 1CE8B 3ZQ6A 1XVUA 4Y2QA 3EY9A 1SCDA 3K9QO 3WGYA 3CZQA 4G81A 4FD2A 3K2BA 4CFYA 1C7QA 2A9VA 2ZSUA 3A25A 3LBAA 4DR6B 4KPFC 3KHKA 2ID4A 1TM5E 1QQAA 2B8WA 2KBEA 3CLRD 4EHDA 4ND8A 1QTNA 5CCDA 1MG0A 3RUIA 2C8LA 2G1AA 3V2GA 1X94A 5IUNC 2NO9A 5KYUB 3LLMA 5ALTA 5CG2A 3UJ6A 4N1AA 5A9SA 1NNSA 2YW9A 3I37X 4BYGA 1HDCA 1F2TA 3N53A 4H27A 3TCXB 5F52A 3CKLA 3OCZA 3U16A 1JE0A 5F76A 1BDJA 3QVLA 1SRRA 5I51A 3EH2A 2PRSA 4PF1A 2FZGA 1U8EA 4RVCA 4HN9A 5EHQA 3CVOA 3WRXA 2J30A 2NGRA 1I13A 2W6MA 1GZ5A 2PT9A 1R8XA 3UC5A 5ITVA 3R7LA 1GV1A 3FAKA 4LCEA 5A71A 3RW9A 2X5KO 3UGTA 3V3TA 3GMTA 1J09A 3JASB 6PFKA 4LY3A 5DSTA 5A1JA 5CVEA 4OGKA 1ZEJA 3C8ZA 3EXFA 1F60A 4MQFA 1ZHOA 5KTRA 2H4JA 3C85A 3EIHA 5JALA 2OPHA 1SCJA 3MNFA 1GKKA 2WJPA 1AS0A 2AUNA 4YV2A 2JCBA 1A8SA 3CH7A 1WW2A 1H8HA 2IPNA 2K6GA 3I6ZA 3MQFA 2YV3A 3OFNA 4FU0A 4H6VA 1F3LA 4LI3X 2XVZA 2HW8A 1JXQA 2FETA 2M1ZA 2VPPA 4LV8B 5I7WA 3BM5A 4M7RA 2XKAA 3EVAA 3GDWA 3L4SO 4EVSA 1X80B 2BJHA 4TLDA 4ZCPA 3UAWA 5TGTA 1L7QA 2HXYA 3GFQA 5HZGA 2VO1A 4OQPA 4PQGA 5DTMA 1C0IA 3DQPA 3EOBI 2B36A 4MPRA 2O2GA 3C3CA 4WWHA 3VYSB 5AICA 5FTKA 4HX9A 3I92A 4ALNA 3QQ5A 3ZZTA 3AFOA 4KX3A 4MA0A 2VAWA 4RGVA 2F59A 3OY2A 3DMFA 2P5SA 2QRQA 4PCAA 3DKIA 1PEKE 4EB6A 4Q3LA 5C8YF 1ZMRA 9ABPA 2PSHA 3DDCA 5D8DA 1QU3A 4CCYB 1Z5WA 1QQ6A 3TTUA 1ZQ9A 2QRJA 4LTNA 3TD2A 5ILOA 1NXSA 2ZSFA 3B6KA 3G2OA 2HO4A 4PGGA 4DJAA 4Y9SA 4EKIA 4NGNA 1Z0KA 1T29A 4J75A 1DC3A 1Z0DA 4JYZA 2H17A 1MVOA 4BFSA 3SMVA 1KH3A 3O47A 4HDMA 4R54A 1RRMA 4V1CB 1T9GS 2HHLA 4ITUA 1Y1TA 3MUOA 1P77A 3P45A 2OVFA 3EDQA 1BC5A 2ZEJA 2WM9B 4RKYA 3OEYA 4RE6A 2XXAB 3NNDA 4GDMA 4MW6A 3OQMA 4P33A 3ZNOA 1W46A 4Y2VA 3LTNC 4B33A 1XU7A 5D5QA 1FFCA 2HH9A 3AQIA 4AF7A 4GHWA 4NPAA 3WX0A 2GNAA 3WYCA 4RIIA 4Z4EA 3ZVLA 1S2IA 2DWPA 2HROA 1GJRA 4Y1FA 2EQ5A 2WWGA 1EZ4A 4TL9A 5CVCA 3S1LA 1UM9B 5FR2A 3WYGA 1U99A 2X7JA 3WADA 4MWTA 3NBUA 10MHA 3BHMA 3AP2A 1P4GA 2H4YA 2QXYA 1VKHA 1BYUA 2OEPA 3KKZA 2Y9PB 1CETA 4JJ4A 2WHRA 4GO1A 5CM8B 1OLOA 2PNJA 3RVSA 1RE0A 4ETIA 1IHDA 2Q6TA 5CVUA 1PV2A 5CA0B 5JO9A 3G0HA 2GF0A 1SVWA 2FLVA 2C7OA 5EMHA 3ENQA 1PG0A 3EXEB 1MO2A 5IBPA 1GEGA 3P2JA 4G41A 4BO0A 7ADHA 3O0DA 1BKDR 3R20A 4KU4A 1BD4A 3D7NA 4KQCA 2BV3A 2I3DA 3NBYC 3UAXA 1OX6A 1W4CA 2X3UA 5D7NA 4LXXA 5F33A 3QUCA 2G88A 2FN4A 5ECWA 1JG2A 2LXNA 2B82A 3L93A 5JDCC 1VGQA 2G9VA 1QP0A 1N6IA 3CONA 3NONA 4F4UA 1EDDA 2IUYA 1KYYA 4O3MA 3KAKA 5E3IA 3W2IA 1E69A 4MV8A 2FK8A 3DT9A 4Y2HA 5JSUA 1CZLA 4P83A 4L4XA 1TZCA 1DP4A 1XO1A 3GQBA 3WHPA 5LNK6 1H5UA 2ZJBA 2C0PA 4KDCA 1RPJA 3GK3A 4GXTA 4LNUB 3DKPA 4RY2A 2NO7A 3B1FA 3QVKA 1MORA 3IEXA 2XKJE 4WNAB 3D6VA 3G0DA 4DBLC 1H3NA 2I8CA 3CX4A 5KYYA 1TA0A 2V3VA 4ZCMA 1RWWA 1K8RA 1ZXBA 4U00A 3CPHA 4ZVKA 4RJJA 4BTEA 1Y4SA 2ATEA 3HCFA 4G07A 1ST2A 1D1SA 1EGVB 1MT0A 2GRJA 3TRIA 3SE7A 5B4VA 2IYZA 2B5WA 3FTEA 2JIBA 4OAQA 4BNIA 1V3QE 1G5HA 2QUBA 4GYKA 4FQ7A 5JBQA 1MX5A 4PGAA 4BCCA 3QEBZ 1O9BA 4HDNB 1BRTA 2BFNA 2A94A 4JR2A 2YXPX 1HEYA 3EF0A 3IDFA 4RK0A 4CN8A 2XXJA 4KV7A 1B8UA 4M21A 4WNCA 1BNCA 2IV7A 2JB9A 1W2WB 3ANMA 2PIAA 4UTXA 1L6RA 4II7A 5EVJA 3RYFB 1DUVG 3ZDCA 3G59A 3O8CA 4NZ9A 1Z25A 2GNOA 2RHCA 1EJ2A 3KEGA 1IZYA 3C3JA 5JNWA 4Y7CA 1Z7EA 5DP2A 1NNLA 3PD7A 4E30A 1RBMA 1J90A 3DAYA 1MEEA 2I1LA 3I1YA 5EINA 1FVXA 3AVVA 3DJYA 2PFKA 3HDQA 1F8FA 2EARA 3SYNA 4RLSA 4OHOA 5ER6A 2V45A 1KMNA 3O83A 2QOEA 3SIWA 1W88A 3ZKWB 4A9AA 1G8YA 1Y98A 4M38A 2OUKA 4B74A 4BNDA 2REXB 3EXHA 1GFIA 2R4QA 4ROSA 1DO2A 2DOKA 4ZREA 4EY8A 5BQ5A 1NSFA 4E2ZA 5A5EA 2ZT6A 3MJEA 4DM4A 2CW5A 4M9QA 4U0JA 4OX9B 4RQBA 1GN8A 1PYDA 3HDVA 3T52A 3IJEB 3TZ6A 1E6EA 4IG4A 5A4KA 3BIJA 2ETXA 4HR7A 5BSGA 4AY6A 2IIVA 2XEXA 1XR3A 1UPCA 3SYTA 5FAKA 3DFIA 2BFMA 5E3HA 1ZD1A 2SNIE 3WGOA 3ITNA 4C29A 4Q9KA 1M6NA 4OJQA 3S6JA 1GZ7A 1FDIA 1ZI6A 1JI3A 5ERXA 4E5SA 3OQJA 2YZKA 2Q9UA 4JXKA 3ZWOA 5JCJD 4TJVA 3RQSA 2IEYA 4P3KA 2BFFA 3KQLA 1RLOA 4KUGA 3T7JA 3WGTA 3MGGA 1D1QA 1KYIA 1TJ4A 3H87A 2YQ4A 5EIHA 1ZU5A 3ZTWA 4CKCA 5B3KA 1WJGA 3G8AA 1RWPA 5KQRA 1AO0A 1SVNA 1DBWA 3SHVA 5AIAA 3AOGA 4RFSA 3FNHA 2GO7A 1RKXA 4YUVA 3I53A 1U5CA 2QRNA 2PLRA 3RASA 4WOJA 3TRHA 1X19A 2HSEA 2DWQA 3AKDA 5JAPA 1XELA 2QE6A 2WAAA 3MCZA 2GPTA 4OHCA 5DW0A 3WO1A 2ES4A 1IUOA 4U7PB 2O23A 1NN1A 4A7PA 4EKNB 4Q1EA 4AVYA 1HO3A 4G89A 2C03A 4TXNA 3O1HB 4KOEC 1R5JA 3IIEA 2MSEB 3HY4A 4OLJA 1PL0A 1S2GA 4JJGA 1EE2A 3PGXA 5DGHA 5AKZA 3TCNA 2VTBB 1CRZA 1XTBA 4QYXA 5B1EA 4EW2A 1FXWF 3GFTA 4OATA 5DHUA 3IOYA 3G0BA 1DV2A 2R1VB 1DAKA 2JF0A 1SC3A 3EGOA 2H0QA 3S3TA 1K8ZB 1YC2A 2FFRA 4D3FA 1QQTA 2ZJ2A 1IMOA 2I87A 2PMBA 1JFLA 2HREA 2AVNA 3MT9A 4MOWA 4LSGA 4QBKA 4RGBA 3VUEA 5BXYA 2ZUUA 3NP7A 1YCHA 1HBJA 2LCIA 2VATA 3HB1A 1IK4A 1P0CA 1XF9A 3HJGA 3IIMA 4W9MC 3I0NA 4B3RB 3H8JA 1KDVA 5JLAA 1I2MA 3ZVRA 3VPXA 4FBMA 2DKFA 3MVEA 3CXRA 3C6XA 4B35A 3KKPA 2FEXA 3T5GA 1K63A 3ZS8A 4EA7A 1T5SA 1G4HA 4YAEA 3NX4A 4HMOA 3S7ZA 4HXEB 4GEGA 1FW8A 4DZZA 2A67A 3Q85A 4IGFA 3ZWKA 4ZZ0A 2PDAA 3KHUA 4Z7OB 3O8OA 5KSWB 1E2HA 1Z22A 1YR3A 3NEPX 2O1EA 3E5MA 4AKGA 3KG2A 2FP4B 2X2FA 2C7GA 3K5WA 1IY8A 1W5AA 2CDBA 2CNKA 4UDNA 5SZJA 4BV9A 4RLFA 3EK2A 3GGPA 3MILA 2PX0A 5ADVA 2O6HA 3TM5A 2XUDA 4HQFA 2LDBA 2YYZA 2E55A 4CCSA 4PO8A 2ZLBA 4KNGE 4H08A 5BR4A 3OQ6A 2ZSHA 1IZ8A 3G49A 1M73E 3GYBA 2O7NA 4FLEA 4MW9A 1DRKA 1ESDA 1KIAA 1Q1GA 1YDEA 4UAVA 2ACEA 4X7MA 3SK0A 3TTTA 4AP6A 3ZH2A 4WZBE 3TTYA 3EULA 5DULA 4ZJZA 1I51A 4R5MA 4WKNA 1V2GA 1F2VA 3L7LA 1M72A 4KOAA 3IDSA 1Z28A 4PHCA 4D8VA 4BQEA 3AL0C 2GWHA 3AB3A 2A5YB 2I62A 4U7WA 4U7FA 5EZ6B 3A9WA 1E7QA 4A1FA 1TU0A 4FNGA 3V2HA 1DEKA 1G291 3TL2A 2WPDD 2E4UA 4PLPA 1GY8A 1RW4A 3PCTA 4RHCA 4PRZA 4D3DA 5JZBA 1DKNA 1JHAA 4ZO6A 2ORED 4PNPA 3TZKA 2OYSA 4BVBA 1NW9B 2DCMA 5I4IA 5L8VA 3M49A 2OGWA 3AFNA 3K5HA 4M9SA 3H75A 2ZK7A 1ZVQA 5KAMA 2GA9A 4M0FA 3PEFA 3ICUA 1K9VF 3T94A 4Y8VA 3GGOA 4LHZA 4OEHA 2CV1A 4R3NA 2BUBA 3QXHA 4OQEA 4K9DA 5KMGB 4CDMA 2IYXA 4P22A 4YQFA 1W25A 1JG3A 3PYMA 4XM2A 2CL7X 3E7DA 3IP6A 3KOUA 4R2KA 4DQ0A 3C8OA 4XYGA 2MMCA 4OJTA 3WJ1A 2O8NA 4EB0A 5LIPA 1FSFA 5AI8A 2BRUC 3DE4X 4ZCSA 1L7VC 4K9OA 4JI1B 2HHHB 1Y8RB 1R6UA 1FS6A 2J6HA 1JF8A 1MB0A 2WFZA 3IR5A 1J5XA 4PSAA 3RYTC 4CTNA 3BK1A 3TMYA 4WXEA 2RKBA 4GC9A 1AG9A 2QLMA 4DCMA 1JQEA 1AZTA 1F4VA 2V4UA 1C3JA 4JMPA 3VU9B 2ZE8A 4CNBA 3MCUA 5K3DA 4EDFA 4RA9B 4K0KB 1JIXA 2OFXA 1DKOA 1GGVA 2G4CA 2NVUB 5EZYF 5ESRA 2EFEB 5HDBB 1R9JA 4DJTA 3CX8A 2LPMA 4DDHA 1NW7A 3OPQA 2FQYA 3F3KA 4CJXA 2VJBA 1CZRA 3NYWA 1T24A 3D5TA 2PQMA 2E4ZA 3OM0A 2TS1A 3AUYA 5NULA 4CM4A 3AYZB 2VP3A 3EGIA 3BKXA 1CJUC 3ACBA 3VSDA 2HMYB 2Z4RA 4HJXA 3UH0A 1R50A 1AUOA 2E87A 3IMKA 1E64A 1ULZA 1P75A 1AIPA 3C3YA 4LS3A 5EWLB 1DMRA 4WK2B 1Y8QB 2EJWA 2JJ1D 4IGEA 4JSRA 3Q2IA 2RAUA 4UNIA 4C03A 4ZAZA 4XRGA 4L4ZA 2VSQA 4Y2SA 4C0BA 2PA3A 2OLEA 3AESA 5BQPA 2X2EA 1XVAA 5DEIA 1HEUA 2B4YA 3IHTA 4GP9A 4RCYA 1CF9A 1J9EA 3S2IA 2B2NA 2WYHA 4GPEA 1S6YA 3JWPA 4YV7A 2QLJA 2QG4A 2GNPA 2CLFB 3R44A 1K3UB 4O4IB 1PLLA 5IAEA 5CBKA 2M32A 5E4TA 4MUEA 4DRXA 1BSVA 5G0SA 3AUXA 3G8YA 4QDJA 2IYFA 1FMLA 3DL4A 3L04A 4GLOA 4WQMA 4F85A 3WFIA 5ITWA 3QWFA 2QWXA 3OZCA 5JZMA 2PG3A 4IJKA 2GN8A 4J0EA 4EHIA 4UU8A 3QIAA 4QDXA 3TSWA 1YUNA 2PWAA 3NHSA 4H0CA 4GH5A 3E1KA 5IC6A 1L4NA 3A10A 2BF4A 1RJDA 2AFRA 2B0JA 4TT3D 1RTKA 3L6CA 1KNQA 4IHAA 1DTEA 1JU3A 4MCAA 4DNOA 4E4RA 1QONA 2IHNA 2YFQA 3VHLB 5CFOA 2IP4A 3QX8A 4KITB 3BJIC 4AUEA 2PKYX 5EWJA 2ZB8A 4Y2JA 3ENKA 4MNTA 1AS2A 2JIOA 3P9KA 3VO9A 3H2IA 1EB9A 4ZODA 2BGJA 1U4OA 3T0IA 4C1BA 1XZIA 5JXJA 1XMQB 1XLTC 3DYBA 3M6IA 3L5KA 4UHCA 2W5UA 5JI2E 2GZ3A 1SOWA 3WLSA 2OBFA 4KXXA 3H2SA 1MT3A 4QGBA 4UHBA 1KDZA 3WZLA 2F90A 4Y67A 1TT5B 4OM7A 1EXMA 3A6ZA 4X7PA 4Z7NB 1LLDA 2X9NA 3KVNA 4GWGA 2QY9A 2WSLA 3ACDA 4UU0A 4JLJA 3D6AA 2X4IA 4I1RA 2HU8A 1NN0A 4L8LA 4UXIA 1URPA 2FW1A 1EDZA 4ARIA 3KKNA 4X90A 2O5EA 4JEHA 1W1UA 3HNOA 1TLFA 1P61B 1E7YA 3HYNA 3OM1A 1BCSA 2OWEA 4X60A 5KSPA 2JD2A 3THYB 3RVDA 2BFOA 1F9EA 2C29D 2GDJA 2GX6A 2C4MA 3CU5A 2FMTA 3QUSA 1U9ZA 1MD9A 5LQUA 1JIQA 3QKRA 3UPUA 3KFVA 3HDHA 5EJ6A 2PUGA 3BL6A 2HIMA 1L5QA 1SC4A 3EIFA 1XEXA 1Q0SA 3FYSA 3OCJA 1N5LA 2FWPA 2DMRA 4RO0A 5DRYA 2BSXA 3SZOA 3CZMA 1OYYA 4HAXA 4WUVA 3MUFA 4IOKA 5J2UF 2ZBPA 1SUAA 4KL8S 3QUAA 1Z5UA 4YJ3F 3SZRA 3ZTTA 4Z4CA 1ZCBA 3IMFA 3DMHA 4Q4AA 3IGFA 4FMDB 3R09A 4MIKA 2FMFA 4G63A 5EUQB 3OOEA 5REQA 5IWAB 2WB2A 3IWWA 2XB4A 5K0FA 4RFLA 1UJNA 1M6VB 2RGNC 3ESXA 4PN7A 3DMGA 4MH0R 1LI4A 2BEUA 1O96A 4Q9NA 1WULS 2Z83A 3PV0A 2W8ZA 2JGJA 3NDJA 2FFJA 4KIFA 4QEKA 4S2UA 2FPGA 3NFYA 4B32A 4F2WA 1NYRA 2CJFA 1JNYA 2CF6A 2HBQA 1ZI9A 2XCRB 1U7XA 3KJQA 2NZWA 3QXSA 3INNA 2YHUA 1P18A 3M4NA 5KC9A 2R8PA 1M8GA 3AG5A 2W6JA 3EAFA 4HQOA 4L9AA 4E3ZA 3E0XA 1I7DA 4U7TB 4UE2A 1U7WA 3VBCA 2J46A 3C3MA 3GUYA 4A0RA 2Q2VA 5EIFA 2OQVA 3DUFB 3H5VA 4BN4A 3IAS1 2HNAA 4YDHB 2J0UA 4ZOBA 7REQB 5K99A 1U0EA 2UDPA 2EV9A 4KQMA 1MAVA 4YDRA 3R8CA 5F5NA 4J0NA 3U6KA 2X0JA 3PUXA 3RD5A 2X0FA 4JX9A 3T3EA 2JLVA 1N2ZA 2IIPA 2GBPA 3N8DA 1XCMA 5ELLA 1B73A 1DKMA 1GZUA 3Q5DA 2JFPA 2HRDA 5DF1A 4IDGA 1J5EB 4AJJA 2H7VA 2XLCA 4MVJF 1Q57A 5FO1A 3RLIA 13PKA 2W6CX 2ZZKA 4Z0HO 2L42A 3RWBA 5HUHA 4S1WA 3GN2A 4B3XA 4QNMA 1QIHA 3B2NA 4RVHA 4EGQA 1QLWA 1XLUA 3ADDA 1OI7A 1JW9B 1QUFA 3U3OA 3G02A 4OB8A 2J3IA 4RL6A 3DMTA 2QDXA 4U0KA 4GEKA 1E1NA 2G67A 5D85A 2DH5A 1T9GR 4BV3A 2IH2A 2JBJA 1N0WA 3IT3A 5GP1A 3B5IA 5B55A 1NBME 4DW8A 2Y9MB 4DMHA 4KBGA 3IPLA 4URWR 2I80A 4FUTA 1FXSA 5AOCA 1I7NA 2G5TA 3TXYA 3T0TA 4C8AA 1N6PA 1V41E 2ZRHA 2Q2WA 2YV1A 3AWIA 3MWEA 4GQIA 5AK5A 4IDEA 2IPAB 4ZAFA 2Y2VA 3CH6A 4H6XA 3HUTA 5JDCA 4JP5A 1ZGGA 1ZRMA 4JLSA 1OF1A 1E66A 2ZCVA 3C43A 3W2TA 4JL5A 5EXXA 3TDNA 5IJ0B 3BXXA 3K53A 1S89A 4TYMA 1X8XA 1N1EA 2H92A 3A7EA 4B47A 4LMRA 4BLRA 4BQOA 4AY5A 3IVMA 3RS3A 1EESA 3LQ2A 2FOXA 2XADA 1N9GA 2VSOA 2XYRA 3IRUA 4INOA 5BPHA 5JCZA 3W77A 4ZYUA 3R0ZA 3HSKA 2BEJA 1LDYA 2ZYGA 3DBIA 3ORQA 2XRMA 4NABA 2WVAA 3BHJA 3HVJA 3I6MA 4ZYWA 4OI0A 2CVHA 3K72B 3RC3A 4UOZA 3JQAA 1BWQA 2LWIA 3U4MA 3PQCA 1G1MA 3KZOA 3RVOA 5CDHA 5BVGB 1L7MA 3QFHA 1E60A 4OMEA 1GHTA 1ZL0A 2XTAA 2VAXA 1PK8A 4OG2A 4RZSA 5L3QA 2UZ0A 2YRWA 1O97C 4WK4B 3RWOA 1L7PA 3L0PA 3IUSA 2YXLA 3MWFA 3QXGA 1WB9A 4S0ZA 2YN2A 1TMKA 2EWWA 2PU5A 3GT7A 3IP1A 2FWIA 1N0UA 2IEAA 1YJQA 1YZKA 1W5BA 2QXUA 3KXPA 4I4TB 1U3VA 2W6NA 1YHNA 4ZCIA 2E6KA 1DE4C 2C2KA 3LXUX 4PAQA 1H5QA 4S3MA 4MUYA 2GCPA 4F2GA 3DQQA 3F4KA 3DBVO 4LKOA 1UJMA 3BULA 4M1WA 2EG5A 2PJZA 7MDHA 1C1XA 1QIMA 1Z4NA 5FBVB 4A8PA 3P0RA 5DHRA 1UK7A 1HC7A 3LOQA 4IBOA 4RZ2A 4HATA 1PWZA 4E6PA 1AX9A 1NC3A 2HK6A 2HWGA 4DYVA 1SU6A 4HLDA 2PUDA 1M2VA 3HKCB 4JJKA 1WV0A 2UUAB 2V5AA 3Q3CA 2X1VA 1SO8A 4UE6A 3WIUA 2KLBA 1W7AA 4O2AF 5ITSA 2Q99A 5J9FA 1T3SA 4PSKA 2A59A 1M9NA 2WUDA 2RAPA 4H59A 2ZJ0A 3T34A 2VTKA 3FMVA 4JJ8A 5A0FA 4EG6A 3TD9A 4QPDA 3P5BA 1NQTA 4GXNA 2ZCUA 3X2SA 5ENVA 4PLZA 3WV4A 4G0NA 4BFVA 3WV5A 3D7HA 2RK6A 2Q6KA 3MQ2A 2JASA 2BFCB 4E31A 5A6VA 4OC5A 2O0JA 3N39C 3ZDBA 1OUMA 1AUVA 1FY2A 1VKJA 2PSJA 2XMCA 4KJZA 4RA6B 3UMSA 3RADC 3HO6A 3ZJ4A 1E3WA 5IARA 4C43A 1I1NA 1SCUA 4M1YA 3GOHA 4CMKA 5JYCA 3CMCO 4J4HA 2GZ1A 2CBGA 3KZMA 4ON9A 4ZI5A 5I8ZA 3RT1A 4EI7A 2VS1A 2BL4A 4UQOA 1TJ3A 3TVDA 1Y1LA 5IXYA 3C5EA 3UT6A 1WSAA 2DX7A 2GVZC 3B48A 3MTIA 1KU6A 1N1MA 3GJYA 4HKTA 2AK2A 3W3AA 1UKAA 4JZKA 3V4PB 3ND9A 4JEUA 5DXJA 1N5OX 2QX4A 4G86A 2LIVA 3CZAA 5KTOA 2A9RA 3ZUGA 3LBHA 3GGJA 4B46A 1YIOA 1B00A 3H17A 1T9BA 1CRLA 2WINI 3ER6A 2B1JA 1JA0A 3AYXB 1TM1E 4R2WA 2CHQA 4XPIB 4DCPA 4Q4CA 3BXGA 3H19A 4ALKA 4CQMA 2BGIA 1OFHA 3HYTA 1RZVA 4UMFA 2WAMA 1DIKA 2VDMB 1S1MA 4DABA 4F2PA 1N77A 2CNNA 3HFSA 3M9XA 1DFIA 5TVKA 2B1QA 4XQ9A 3FF1A 1P0FA 2UYQA 3N8IA 2BZ0A 4OQMA 2ZE6A 4TMXA 3RHFA 1ITZA 4XJSA 5I7FA 3D8RA 4FMBB 1XMJA 4LV6A 2WMNB 1F8YA 3VTZA 2GZRA 3PLAE 3D3WA 1ADJA 2X42A 4LMAA 3ZTYA 2GCIA 1EP1B 4E4YA 5IABA 2FUKA 2VOJA 4PAOA 3W4KA 3PRYA 4ACAA 4PZPA 3MGKA 4WI1A 4AJ9A 4EJMA 1EK6A 2D2EA 4PX3A 4LMBA 1G20B 4ZVLA 2J85A 3EWSA 2AZDA 4F1KA 1A1VA 4TUYF 4BJ3A 4R5HA 4FYHA 2C5BA 3WXMA 2ZSKA 1XZGA 1PK7A 4QXAA 1GQYA 4GUAA 5AVWA 1P7YA 4UEWA 5J4LA 3DVLA 5FV7A 3KETA 4BXOB 1TYDE 1IMJA 1GRRA 2PQ2A 2RMKA 2Z4TA 1JQDA 1TEHA 3K92A 1SUWA 4X0EA 5DN9A 5ILQA 4CG1A 1ZOIA 3N86A 5DNYB 3IE2A 2DEUA 3FUXA 4RKQA 1CF2O 3DDNA 5H02A 2HEGA 2P0AA 4R1OA 3VVBA 4B4WA 4MDFA 2PCNA 1YZHA 2KS6A 2QPTA 1ZISA 2FFAA 3EISA 2QMYA 2ZIAA 4UAGA 1A5SB 4Q05A 3O8QA 1KO1A 2ZZNA 3M3PA 1FSGA 2EQAA 2PKXA 3K09C 5BW8A 3TW0A 4NZYA 3LQKA 3LC2O 2UUPA 3WJAA 4PVCA 3ZPXA 2PSSA 3BIFA 4I55F 3AKZA 1Y6FA 3LDHA 2NU9A 4DLNA 2OWDA 4X3PA 1KNXA 3CKMA 4Z0TA 3F7NA 3AVQA 1K5PA 2VAPA 2UU9B 1N6OA 1OFUA 1M2FA 4HPWA 3IPCA 1XYYA 2GM3A 1KK1A 2P67A 3P9QA 4FN4A 4RZUA 2JJ2D 1ODTC 2GYWA 5JSFA 3DD1A 4YIKA 2B25A 1EZ1A 1HOXA 5AM1A 1D4FA 5J4YA 4EHNA 5B7GA 3IILA 2WC1A 4QRHA 2UZAA 1SG6A 1EUCA 4TS3A 2GD2A 4WAUA 1QFMA 1NG1A 3BE5A 5FYDA 4AZVA 4XSGA 4I81A 3ZDRA 1BQEA 2FSHA 1IBKB 3IOCA 4NIMA 1PJCA 5KNDH 3V4RA 1HG1A 1Z29A 3O90A 3SYKA 1FFDA 4E3WA 3KV1A 1UWVA 1R4ZA 4J94A 4LGVA 5KNBH 1F48A 4OQNA 4E09A 1XFAA 4YCMA 1O9GA 3T06B 1HLDA 1H05A 3E5RA 1WCV1 1XZEA 3LP8A 4OD0A 4OM8A 5EXTA 5KYVA 4PRKA 2NTYC 4V0ME 2ODBA 1AQ6A 2FW0A 5J58A 4ZYXA 1LDEA 3KASA 3EW7A 2EGHA 1DO8A 2AJCA 4KN9S 1WMEA 3PFKA 3MCVA 2UYOA 2V7WA 2M2IA 2A5DA 2DAPA 1FNDA 4RDCA 5CJJA 1EBFA 1H0RA 4UMVA 3OJCA 3REGA 1NE7A 2HA3A 1KBOA 4HDRB 4EMSA 2HSWA 4Q01A 2XOXA 4ND3A 4DADA 1KL7A 3FROA 4V0KA 5H16A 2Q0HA 4HGRA 1T9HA 2OCGA 3HA7A 3V1MA 2QV7A 4TKVA 1G8AA 1U0OC 2J7KA 4WE3A 1GFWA 5TEVA 4WKCA 2H65A 3EBLA 1WUTA 1XZQA 5HEKA 1JHDA 4I19A 4XUCA 3O03A 4P7KA 4QXMA 5LDDC 4FYJA 1JQBA 4H7FA 3HO1A 2GZ2A 4RXUA 3F6BX 1C8VB 2EVWX 3W34A 1RWXA 4ZTZB 1RRFA 2RC6A 1PGJA 5SY6A 3TNYA 4KQJA 4KVAA 3KSAC 4C7XA 5DBGA 1AGNA 3WB9A 3EMKA 4DXAA 2WBLC 1I14A 3D2BA 1SXIA 4OK3A 1MDFA 5JCOC 1ZVVA 3NQ41 2XDQB 4PGHA 3VR2D 4EVIA 2C54A 4UUPA 1E98A 5TX7A 3X3HA 4BMPB 4G37A 4MJ7A 1QIJA 2F8MA 2QQFA 1LGYA 1NJ1A 2N1BA 3JQPA 3LDFA 3ADKA 2YN4A 4OGFA 4AZSA 1GTSA 3T07A 4MWDA 4N9QA 1E1MA 3PU6A 4ZAVA 4DG8A 5BNTA 4HADA 3RSQA 4XZ3A 4XX0A 1NHGA 4FGKA 2VDQB 2EX1A 1Z2DA 2JKYA 1ZO8A 3H5TA 4RBNA 1TRHA 4B3HA 4DF3A 1LBTA 3GZNB 1GGNA 4GBMA 2J87A 5JS1A 1JHOA 4MVJE 2VHYA 4L0DA 2IXDA 4C4AA 1UDXA 3HKEA 1LCIA 4JU8A 2WU0A 2NYAA 5DI3B 4DM7A 5E2BA 1DC8A 1G1AA 1RM3A 2C98A 4FDLA 3WLFA 5IFLA 4U2CA 3R0QA 4MYHA 4KPUA 5A9TA 3I2HA 4OQZA 2PNFA 3NATA 3AEUA 2G63A 4UE3S 3E84A 4IMJB 1S8OA 1GTZA 2BMJA 3A4VA 3ZDDA 1W5SA 2JLQA 3AETA 3PYXA 1JBQA 4REQB 1LUAA 1ZH6A 3LO5A 1XZCA 2CYCA 4QYIA 4XWKA 4HH1A 2IYSA 2AG0A 4FJ0A 3R5HA 1L5ZA 1KMIY 2FQXA 2OXRA 1FDOA 3I64A 3IP9A 4BNZA 1GPWB 1QBKC 3JWJA 1XTUA 2VP9A 1KHHA 1E9DA 2RH8A 2PSEA 1Z07A 4G9EA 3M1LA 4MWZA 4FPXA 2QL5A 2WKPA 3ND8A 5BYKA 2AJTA 2CXNA 1GKLA 2DTXA 4TV9B 5BYAA 3TLAA 1UPTA 2UV8A 3R3VA 2OP1A 5AKKA 2XSZA 4LRQA 3OT1A 5LKAA 1Y33E 4F2DA 1UBRS 4OBXA 4DNFA 4W5RA 5JQGB 2C2HA 3B1JA 3VR6A 4EFLA 3BDIA 2C92A 2QYTA 2FSGA 3T1QA 3T7EA 4HUJA 2QNIA 1Y7TA 2QTNA 4IIYA 5T41A 4MDYA 4A5SA 1A5ZA 1VG1A 3C3DA 2Q2NA 4M8SA 3A6HA 3D4NA 1JR3D 3N76A 5K3AA 1N5DA 2XD9A 4MI1A 2O0MA 5IDVA 3FF4A 5LYJB 1XZKA 3SF8A 2KBFA 3SOZA 2VHXA 4FN5A 4AAYA 2IYYA 4YP7A 1GUDA 2PZFA 3RUAA 3E2IA 4KQGA 2XT0A 2HZBA 4TSRA 3JQGA 5AKYA 2Z8XA 3KJZA 2N9UA 3T9DA 1J06A 2ZIUB 3G5UA 3KQTA 5FOXA 3IEIA 3PFCA 2PCJA 1R4AA 5JRJA 4GM0A 2PYDA 1AK9A 4QIHA 5GTDA 1SXGA 1WNFA 2Y0EA 3COYA 3IQXA 4FFMA 1QG6A 1EUZA 2CDNA 3L8MA 3O2QB 3P1JA 4O1MA 3W5UA 4B3FX 4CMCA 3T05A 3EGWA 4RV5A 3EG9B 1YD7A 2WJZB 1W29A 3GVIA 3LC0A 3OY7A 4MS4A 3ZV6A 1Z0JA 4RD2A 2EZTA 1OB5A 1CF4A 4KSBA 4YLGA 3V8BA 1LV8A 2RI6A 4IP0A 5CMLA 2WLSA 1KQOA 1OCEA 5M7EA 2LUOA 1BKSB 1GUAA 4PSCA 3WC4A 5LQDA 1NVMB 1YL6A 2HMUA 5KI6A 4YBZA 2OBYA 3W6PA 5A3SA 5CFQA 4YMUA 4KO8A 1QAOA 2C9CA 3C3EA 3GCWA 2QD5A 2GKGA 4PPNA 1PFGA 2FR0A 1SOMA 4QTUB 4DA8A 4E2XA 4EO9A 2X0KA 4GF5A 1CFJA 4C4PA 1T25A 2HGSA 3QE4A 4GGPA 4YMSA 3TEFA 4COBA 2HBRA 1W4LA 4G5FA 1IJEA 1QV6A 1GG8A 3HBJA 3U4DA 4F12A 2YC4C 4NCHA 5KQSA 3WYAA 2F8LA 3LFUA 1E5TA 1GTJ1 1C9DB 2B94A 4LRTB 1YFLA 3OMLA 3PCRB 4YUXA 2J3QA 2CDCA 2CLCX 4WCFB 5THQA 2DERA 4KQKA 1HRKA 3DT6A 3HN7A 3O7WA 4NV3A 1GFSA 3MCTA 1JGTA 4DV5B 3RFXA 3RARA 4UBMA 2I0FA 1LFDB 1XXLA 2OD7A 4K7JA 2CXRA 4BNYA 4TRRA 5JNVA 4Y6GB 2VT2A 1LZLA 2DJ5A 3K6RA 3WWCA 4MQMA 4MKHA 3TYXA 2F9FA 3MJVA 1I10A 1NIJA 3IJ5A 4LC9A 1UMDA 1B76A 1XLWA 2V7QD 2PMEA 2ECQA 4BUCA 3QVXA 4YMTA 2W9XA 1P2VA 2VWQA 3M4ZA 3PIRA 4KFSA 2H1WA 2JFUA 1B0UA 1PT9A 3WZMA 3GWGA 1UOPA 3Q3IA 3PUKA 4J29A 1E3JA 1NBIA 4NV1A 4KMMA 5K0NA 3ZV7A 3DHEA 3IALA 1WXDA 3KYDB 3KQNA 3ROKA 1I9GA 1EFVB 2XB8A 3A1CA 2NZUG 4QDZA 4OIFA 4U6SA 1VHJA 4MRMB 4C7BA 4JI8B 2R9VA 3CSUA 3WNDA 1Y5IA 2R751 4ASUD 3QSGA 2Q27A 4Z2YA 1VIDA 1DAPA 3E2PA 1H2XA 2COUA 2BGKA 3N2EA 3GLGB 2HLHA 4PVDA 3SQLA 2HMSA 1L7OA 1GUYA 2XQGA 1JLHA 1P60A 3FPLA 3NYIA 3FMGA 4Z4IA 3U1VA 5G02A 4O2BB 1RVV1 2DU8A 4DLYA 4QTYA 4MCRA 3RSLA 2VXCA 3HFGA 4WOKA 2IX3A 1T3ZA 2BEVA 5EIXA 5F1KA 3WGGA 3AIOA 2FMUA 3GD5A 4A23A 2WWXA 2DY1A 3E53A 2ZM6B 4XWAA 3SR3A 3UHAA 2O6LA 5FNVF 1TCBA 3CRQA 2JBAB 2FSUA 3IAM1 3E3AA 1Y42X 1LKZA 4WZAE 3E8SA 1RZRA 3B5JA 4A2QA 2Z5FA 4HWSA 1WF6A 1N2CB 4JLOA 2NACA 3O1LA 2PRIA 5DTQA 3SEQA 3V7NA 3DMDA 4JUIA 3M6WA 2XUZA 4I4CA 1F4LA 1W59A 3CEAA 3GCXA 2ZSBA 2W7TA 3P9CA 1P74A 3GDGA 4JYCA 3DVAB 3KT0A 5BP7A 3CT4A 5HJ2A 4MIEA 5TS2A 1P6QA 4DAOA 1BOFA 3FCXA 1ZA2A 2Q3LA 2H2DA 3R6TA 1FP4A 2FWAA 5FBLB 4UZFA 1ZC3A 1KDPA 1NSYA 2QL9A 3BGSA 1DG1G 5KWJA 2P6MA 4EX7A 1VBGA 5CX4A 2GF2A 2JVKA 3DTVB 3PD1A 5E6SB 1KY3A 2ZJ7A 2O57A 3HB9A 2EWVA 4KI7A 5B3LA 5HE8A 5ALFA 5AI9A 2CLEB 1TF7A 4FB4A 3IO3A 5FOWA 4QQRA 4AY2A 1FFSA 3H9BA 3MMZA 5EGSA 4UMEA 4TMTA 2PVWA 5EIAA 1A76A 1U0LA 3N2IA 4GR9A 4HYYA 4XASA 4FWTA 2JIQA 4Y6RA 4YRRA 3NV7A 3OCXA 1WXGA 5J5CA 1LK0A 5C53B 3NKFA 3EFHA 1Q1AA 5FUXA 4B3TB 3U3XA 5BW4A 3KL4A 3TR0A 2PH7A 4C78A 4ZYVA 3CURA 3R6WA 1YAJA 3K8ZA 1CLUA 5BVHA 5E95A 2IPOA 5HPYB 2B9VA 4F4IA 2WEKA 4KN6A 4AQYB 1U0NA 4K2AA 3LTEA 5CVTA 1YBAA 4IGIA 4V02A 1EDEA 2CIJA 4AXBA 4IRMA 4J0DA 4JP3A 4MTLA 1AE1A 3K9HA 3V1TC 5GM1A 3M5DA 1QGOA 3PR2B 2GH1A 4LX0A 4KQIA 2KI5A 4M0EA 1ADYA 2ZROA 1VPTA 1TVEA 4P58A 3O3NB 4PZUA 3QG5A 5A4FS 2WZQA 1JFFA 1UAYA 1Z2AA 1V5FA 3DXFA 1XMIA 3GF4A 3WOVA 1YL5A 3DMNA 4UCWA 3DYIA 2UVPA 4LY9A 4UHFA 2VNKA 1W76A 2ZUFA 1ESNA 1IOZA 1E20A 4NARA 2QJTA 3Q12A 3A8TA 3BAFA 4JVLA 2C1XA 1Z62A 2JNWA 3Q10A 4L85A 5ALRA 4B6JA 2WQ7A 5ELXA 3C8MA 3PX3A 1N75A 1G6Q1 4J0FA 1UMBB 4QICA 2DIKA 5BOSA 2VJKA 1J97A 1YR2A 4EMTA 1M2OB 4ZQHA 1R16A 2Q2OA 3JQBC 3KXKA 4K05A 4O4HB 2VTDA 1B3RA 1YONA 5JH7B 1Z12A 1V9CA 2R6ZA 1RAEA 2C9ZA 3U9SA 3NBKA 4H1VA 4DSAA 1ZVKA 3AFMA 3UWSA 5IJWA 4ZYLA 2R6CA 3U1BA 2HT6A 1CRPA 3H2BA 2JCSA 4CR8A 3IA2A 5C34B 5BR1A 3X1YA 1ZZEA 3QLEA 4L4SA 3E6AA 1H2EA 3PTZA 5FWDA 4BBJA 2R1TB 4ZIRB 5FUBA 4DR5B 5COQA 3G2LA 1Q7GA 1TE2A 1I4DD 3D59A 4GOJA 2EK9A 5JR3A 1L8XA 1XMVA 4GXQA 3Q8XB 3PIIA 2J7PD 3DDOA 1U0TA 4MI6A 3U7HB 4NBWA 4TWAA 3HBLA 1SOAA 4J1SA 4ZVUA 5JAHA 2H5LA 1A69A 1UZLA 1G55A 3ECAA 2GT1A 5HIMA 1GTRA 1KI8A 2BHRA 3HI6A 2F3TA 3SR0A 3UJHA 4QDOA 2AI2A 2JDIA 2WFAA 4W1RA 3RVKA 1MJGA 4EKGA 1YUBA 2CLLB 2P77A 3HA3A 3BFPA 4BNGA 1B14A 3ACCA 1GXSA 4DMLA 2HU2A 2R8RA 1RSZA 2HC9A 2G36A 5TARA 3T4PA 4MK4A 3LI2A 3UCFA 2ZUTA 3WNVA 1PZFA 4D9IA 5F9HA 3BQMB 1N7GA 1SVLA 2VP0A 2H9AA 3L7IA 1Z4KA 2MYNA 1JQJC 4J16C 5DT9A 5A4DA 4MLCA 1MEJA 4P3PA 2KM1A 4O63O 2AFHB 3HDGA 3E1GA 1Z35A 1LBQA 2P8SA 4PLTA 4KNYA 2VPXA 3I6QA 1CQIA 4YAIA 4KX5A 4EEKA 3IESA 1Q0UA 1VCNA 4ITRC 1FFAA 2CUKA 1VCMA 3R0JA 1I9CA 2P9ZA 4YN3A 2ZU6A 1E3DA 5CU7A 4E5MA 4Z0NA 5B36A 4OMDA 4F72A 1ST3A 1L4YA 3KEFA 4XIYA 1ZX1A 2P2ZA 2V9PA 1EGHA 3NU1A 2Q46A 3O0TA 1ODFA 3F7OA 4QE3A 4U2EA 2G70A 2VK1A 3NW9A 1RXVA 2BKXA 3LO8A 1MQAA 5B64A 3IUYA 2B2CA 1SB8A 4OB6A 4P7JA 1O7JA 2IUEA 4M49A 1GNSA 2HHJA 3I0MA 1XHLA 2V7BA 4AZ3B 1EBBA 3LHIA 1CS0B 2PWZA 1Z4LA 4TM7A 1ZM3A 2Z5GA 5EZ5A 1GADO 1KU0A 1TFUA 2AE1A 4EUFA 2BE7A 2QYSA 1DXOA 3D5QA 4OYLA 4UMDA 4CF6A 5GJBA 5AM2A 4MQEA 1T4CB 3TUIC 2C7PA 2EEZA 2RHRA 4HAOA 3RH0A 2X6QA 3T7AA 3KPWA 3A26A 1RRGA 1NFRA 3TE7A 4MKZA 1IN7A 3U3RA 4DJFC 1EZAA 1VPVA 3BGWA 1PHRA 3CUVA 4JBNA 3IDOA 1QYRA 5AQEA 5GV8A 2XD4A 4HAVA 4QO7A 2UYHA 3A3OA 4JI2B 2AKAB 1KQ3A 1JQKA 2ZP1A 4FC7A 5CUQA 4BGUA 4L9RA 4DIEA 3ASUA 1NYTA 3NNNA 1T2CA 2MSDB 3OQHA 3PITA 4BFUA 3SXUB 5LZ4A 4J0KA 1N4DA 4YREA 1LVGA 3GUZA 3WL5A 4MGIR 3RLFA 1UZUA 4HL6A 5EJGA 1OILA 2YJTA 3N9IA 1ZRNA 2BISA 2OG2A 4D4KA 4V38A 1MP0A 3FNEA 2C5FA 1GFZA 3HR7A 4JLNA 4WZ6A 4KEAA 2WJ6A 4G65A 2NUTA 4CIDA 5B7NA 2VYCA 1YTUA 3UO8B 5E7IA 3FD8A 5CNKA 2JIZA 4D6YA 5JNTA 4LHWA 2OXTA 2I9KA 3FPJA 4NG5A 4TKUB 1UXJA 3HBMA 4HBZA 721PA 4NZOA 3UAVA 3K70C 1ZIYA 3GUCA 3FR8A 3VZQA 4L5JA 5BXQC 2XTMA 2BP7B 2EJVA 4U8GA 1T8PA 2X13A 2F4NA 5C0OE 4O8ZA 4UHDA 5BWCA 1JX6A 2GEBA 1V1RA 4CU5A 3HBNA 4M8IA 1YCGA 1BMDA 4CU2A 1Z0UA 3DHYA 1EJ6A 1X2BA 4KKVA 4IO0A 4ESEA 4KIUA 2YXEA 1SQGA 2DBYA 3U4HA 3ZE1B 2BR4A 4L8YA 1D2MA 1N3LA 5F9FA 3JTEA 1LY1A 4QFCA 2O2YA 2R60A 1EWTA 2JLBA 1C4KA 3RRXA 3T6KA 3AM1A 3M4JA 1VLHA 1I0ZA 2QSUA 1H93A 4P3OA 1SGWA 1XE3A 3V8PA 2R8ZA 1JIKA 1TC1A 2A0WA 4IDBA 4OQLA 4R