2EK9A

Aminopeptidase from aneurinibacillus sp. strain am-1 with bestatin
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
412
structure length
412
Chain Sequence
ADHQITKRTDAENMYNTIQFLSQAPRVAGSPEELKAVRYIEQQFKSYGYHVEVQPFQFEGYTAPSEVTLKIGTEKKEGEAFTYSPNSDVTAELVYVGLGTTADVAGKDLNGKIALIQRGNISFADKVRNAAKQGAKAVIIYNNTDGKLNGTLGGSDASFVAAVGITKQEGDALAANLRAGEKITATVKVAGAEVKTLTSHNVIATKKPDANKKNTNDIIIIGSHHDSVEKAPGANDDASGVAVTLELARVMSKLKTDTELRFITFGAEENGLIGSKKYAASLSEDEIKRTIGMFQLDMVGSKDAGDLIMYTIDGKKNRVTDLGAAASSRLSGVLPYGQEGRSDHESFHALGIPAALFIHAPVEPWYHTPNDTLDKISKEKLDNVADIVGSAVYQAARPGELVIEPIDYPRRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Aminopeptidase
publication title Structural characterization of a novel bacterial aminopeptidase with an apical domain from aneurinibacillus sp. strain AM-1
rcsb
source organism Aneurinibacillus sp.
total genus 138
structure length 412
sequence length 412
ec nomenclature
pdb deposition date 2007-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2ek9A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2ek9A02
4B6ZA 4MCSA 2WYRA 1YMEA 1YW6A 4FWUA 5K8PA 2ZEPA 2C6CA 4K3NA 2CF4A 2AFMA 3FECA 3L2NA 4O23A 2PIZA 2XEIA 5LYFA 2V77A 4P10A 1Z5RA 1LANA 4MRIA 4P4DA 4DYOA 2FVGA 3BXMA 3WC5A 1TKJA 3PB7X 2F7VA 2G9DA 2AFWA 4YWYA 4X2TA 4TJXA 2PJAA 1IGBA 3RZAA 2CTCA 2DEAA 3RBUA 4PXDA 1LCPA 3B3SA 3ICUA 4P44A 3KASA 3NH5A 4PQAA 4C8PA 4CDKA 5LRJA 4GM5A 4CDJA 1CBXA 1DE4C 1F57A 5ELYA 1ZLHA 2EK9A 4UEFA 1WVMA 2WZNA 3PRTA 1V6CA 3HUVA 1TKFA 4A38A 1XF1A 4OC0A 4ZX9A 1BLLE 3EIFA 5DS0A 4NGPA 5LRGA 1XFOA 2CIJA 3QNVA 2PJCA 4PXCA 3D68A 5THWA 3BI0A 4P4JA 5D29A 2ZEMA 4C85A 1VHEA 2ZEFA 3BI1A 4FAIA 2C6PA 1LAMA 4TNUA 2IMOA 3S9NA 2V8GA 2PJ9A 4TJVA 4C84A 3FEDA 1VGYA 4R8FA 2PJ7A 1XJOA 3D66A 1Y7EA 2PIYA 4NGSA 1ELLP 4OC1A 2GLJA 3PFEA 1CPSA 1ZG8A 5LRKA 3D7GA 3CPXA 1R3NA 4C9UA 3H8GA 4YU9A 1ELMP 2PJ3A 4MHYA 1CP7A 3ISZA 4JZ0A 1Q7LA 4NGMA 5K8NA 6CPAA 1H8LA 3KZWA 4DUKA 4P4EA 3WABA 5HVHA 2PJ2A 3B3CA 1TKHA 3PB6X 3NH8A 3FH4A 4ZY0A 3VATA 3KQZA 4R76A 4DJLA 2EWBA 3LMSA 3FJUA 4IHMA 1PCAA 2ZOGA 3JRUA 2EK8A 2C1CA 4FUUA 4C99A 2O53A 2HB6A 5HVFA 4MHZA 4X8IA 1GYTA 5LYLA 4F9UA 3B3WA 1F2PA 4NFRA 4LQGA 1F2OA 3KGQA 4OKOA 4IAVA 3D7FA 3SJGA 2ZOFA 1YSJA 1YW4A 2VL1A 3B35A 3MN8A 3VH9A 3DGVA 5JM6A 5K8OA 1VHOA 3IJ3A 1LFWA 1QQ9A 3KHXA 3SI0A 3SJXA 2QJ8A 2ZEEA 2F8HA 3ISXA 1AYEA 2Q43A 4C8TA 2Q4ZA 1BPNA 4C86A 1YLOA 4EMEA 3KHZA 1ARLA 3NH4A 1R43A 4P6YA 4PXEA 4AXVA 2PJBA 4FBEA 4X3RA 2PJ0A 3K9TA 1CX8A 5JH9A 2PJ1A 3D4UA 4MMOA 4NJRA 4A39A 1HDUA 4IK2A 4ZY1A 2JBJA 3B2YA 2JBKA 4UIBA 3IWWA 4F8ZA 1XBUA 3PEIA 1PYTB 4NGTA 4UEZA 1QMUA 2O4HA 2ZENA 4OIDA 1Y9ZA 3LWUA 3D7DA 3RAMA 4OMEA 3IFEA 3TX8A 3KR4A 1XMBA 5CPAA 2XEJA 2PJ8A 1LOKA 4JYWA 2ZEHA 1Z2LA 3S9MA 2AFZA 4A37A 3H8FA 3FVLA 3PB8X 3IEHA 4OC5A 4UEEA 4C8CA 3FX6A 2BOAA 4C8FA 5LYDA 5D8NA 1CPXA 2XEFA 4P4BA 4KNGE 5HXDA 3D7HA 4H2KA 2I3CA 1XRYA 3SI2A 3D67A 1OBRA 3KL9A 2RFHA 3KR5A 4UF4A 3WT4A 4YN3A 3FEEA 2IQ6A 2PE3A 1TF8A 4G1PA 2QYVA 4EFDA 2POKA 3DLJA 5LYIA 1LAPA 1NSAA 1Y0RA 4EWTA 2ZEGA 2GU2A 2NYQA 2OR4A 4MCPA 3T8WA 3PBEA 1DTDA 2C6GA 2BCOA 1HEEA 3VTAA 4OC3A 2HC9A 5CBMA 2V8HA 3KQXA 4PPZA 2NSMA 3NFZA 4A94A 5K8MA 3CDXA 2PVVA 4W9YA 4R7MA 3I6SA 1Y0YA 1ZG9A 4OC4A 5JGFA 2AFUA 4MXUA 3B3TA 3IO1A 2XEGA 5J1QA 4OC2A 3PFOA 4MHPA 2CTBA 2PJ6A 2AFOA 1EE3P 3B7IA 3GLJA 4NGRA 3K2KA 4MCQA 4ZX8A 4MHNA 3N5FA 4F9VA 4PXBA 3H8EA 5I4MA 4NGNA 3TC8A 3IIBA 3VARA 2JEWA 4ZI6A 2ANPA 3PB4X 1UWYA 1HDQA 1ZG7A 3HLPA 4P4FA 4CPAA 3V38A 3SJEA 3PBBA 4C8UA 2V8VA 2J9AA 1JQGA 4NGQA 1TF9A 3CPAA 4KSIA 3KI9A 3B3VA 2ZEOA 4Q7AA 1ARMA 2AFXA 2ZEDA 1RTQA 3S9LA 4P4IA 1M4LA 4BD9A 1CP6A 2RB7A 8CPAA 4OIWA 5F09A 3V7ZA 4ZYQA 1FNOA 1TXRA 4C9AA 3BHXA 1FT7A 2PVWA 2QVPA 4WJBA 4ZY2A 2GLFA 3GB0A 5HVGA 3FF3A 2PJ5A 2ZELA 3CT9A 4MCRA 3WC7A 4NJQA 3WC6A 4RUHA 1CG2A 7CPAA 4TWEA 3MRUA 2V8DA 3SI1A 3PB9X 2GREA 3IC1A 4C8AA 1BAVA 2Q51A 3FMCA 4P45A 4Z65A 4UIAA 3GUXA 1ZLIA 2PCUA 1Z8LA 1AMPA 4R6TA 2PRQA 3NA6A 4ONWA 4WWVA 1IY7A 2AFSA 3SJFA 2IJZA 4OP4A 1BPMA 5IB9A 2ABZA 1VIXA 2PJ4A 4C9EA 3I74A 3I1UA 2OOTA 2BO9A 1KWMA 4C9VA 4C9RA
chains in the Genus database with same CATH superfamily
4B6ZA 4MCSA 2WYRA 4KVME 3NE7A 4M85A 4QVTA 1YMEA 1YW6A 4FWUA 5K8PA 1BOBA 3T0TA 2ZEPA 5KTAA 1M6VB 2C6CA 4K3NA 4ZBGA 2CF4A 2AFMA 1S7LA 3FECA 3IWGA 2CNTA 3L2NA 2FIWA 4MFJA 4O23A 1YVKA 2PIZA 4I49A 1XOVA 4CAFA 5F46A 2XEIA 1XEBA 5LYFA 2ZPAA 2V77A 4P10A 1Z5RA 3CXQA 4CGNA 4MI1A 2BEIA 1LANA 4MRIA 4P4DA 2QECA 4DYOA 2FVGA 3T07A 1Z4RA 3TT2A 4IUSA 1PU9A 3PGPA 4CO9A 4UCMA 3BXMA 2REFA 4KLVA 3WC5A 1Y9KA 1TKJA 1YR0A 3PB7X 4MFKA 1IIDA 3LODA 3VWEA 2B4DB 2F7VA 2G9DA 4R3KA 2AFWA 2ODFA 4CZ1A 4PV6A 4YWYA 3TLBA 4C7IA 2X0SA 4X2TA 4KOSA 1OZPA 2Q04A 3EFAA 4TJXA 4B13A 2PJAA 1IGBA 3RZAA 2CTCA 4MFLA 4H89A 3W6SA 1KUXA 4C99A 4QC6A 1VHSA 2DEAA 3RBUA 4J0NA 4PXDA 4UA3A 1LCPA 3B3SA 2B4DA 5HH1A 4A33A 4AG9A 2Z3MA 1ON0A 4HNWB 3DR6A 3EO4A 4UFWA 3SXOA 3FXTA 2VXKA 4UFVA 2PC1A 3ICUA 4B5OA 4P44A 2YJTA 3KASA 4CGMA 3TE4A 3NH5A 4PQAA 5JVLA 4C8PA 1YLEA 2ZXVA 4MBUA 4CDKA 5LRJA 2Z3OA 4HNYB 4KSFA 4AVBA 4GM5A 4CYOA 5IB0A 4CDJA 1CBXA 2EUIA 1DE4C 1F57A 2R98A 5ELYA 1ZLHA 2EK9A 4UEFA 3TO7A 4GXHA 1WVMA 1YGHA 2WZNA 3EZBA 3JUWA 3EZEA 3PRTA 1PUAA 1V6CA 3HUVA 4YRHA 2FS5A 1TKFA 4A38A 1XF1A 4OC0A 4ZX9A 1J4JA 3LD2A 1BLLE 3GIUA 3S6GA 5DS0A 4CS0B 4C68A 3EIFA 2DPTA 4NGPA 5IV0A 2WUUA 3E0KA 4HNXB 5LRGA 3SHPA 3S6HA 1XFOA 2CIJA 5KTDA 1GGOA 2FM4A 1YX0A 2FXFA 3QNVA 2PJCA 4PXCA 4U9YA 5DWMA 4M3SA 3D68A 2FSRA 3LACA 5THWA 3BI0A 4P4JA 5D29A 2ZEMA 4C85A 1VHEA 1EZAA 1IICA 2ZEFA 3FNCA 3BI1A 3R9EA 2CY2A 4FAIA 5EBVA 1BXRB 4MJXA 1Z8XA 2C6PA 3G3SA 1LAMA 3H5ZA 5HMNA 4TNUA 2IMOA 3S9NA 2V8GA 2PR8A 2PJ9A 1XE4A 2FCKA 4TJVA 3SR3A 4PSWA 4XPDC 2EBJA 4C84A 3R95A 3R9GA 2OLSA 2DPSA 3FEDA 1VGYA 2B4BA 1IU8A 4R8FA 1XJOA 2PJ7A 2H5MA 1S7KA 3IWEA 3SXNA 3D66A 1Y7EA 2PIYA 4NGSA 1ELLP 4OC1A 1CM0A 2BL1A 4KVXA 3TO9A 2GLJA 4BINA 2CXAA 3PFEA 1VBHA 1CPSA 2Q7SA 1ZG8A 5LRKA 1ZO0A 4MFZA 3D7GA 4R87A 1JDBC 3RO0A 3CPXA 1T36B 4EYSA 3BJ8A 1R3NA 4C2YA 1LRZA 4CYQA 2B5GB 4LX9A 4B12A 4DNCA 4C9UA 2EZAA 1FY7A 1IOFA 4IIYA 3H8GA 4YU9A 1YVOA 1ELMP 2G3AA 2PJ3A 4MHYA 1ZL0A 1CP7A 4UBRA 3ISZA 4KOTA 3IU2A 4JZ0A 1M4GA 1Q7LA 1YREA 4NGMA 5K8NA 2E28A 3TLYA 2Z3NA 2R1IA 3DNSA 6CPAA 4H6ZA 1S60A 1H8LA 3GJZA 3KZWA 3G8WA 4F0YA 2HI6A 1EZBA 2KCWA 4DUKA 2J8MA 1RXTA 4P4EA 2A4NA 1XIXA 5H86A 2B5GA 3WABA 1ZRSA 1S7NA 3F5BA 4F6AA 5HVHA 2DIKA 2PJ2A 2X7BA 3B3CA 1S5KA 1TKHA 1Z9UA 1QSOA 3NH8A 3FH4A 3PB6X 4YFJA 4ZY0A 3VATA 4E8OA 2Y0MA 3KQZA 4R76A 4CAVA 2D4PA 2OU2A 5F47A 4DJLA 5GCNA 1M4DA 2EWBA 3LMSA 3FJUA 2YNDA 4HPSA 4IHMA 2JDDA 1PCAA 2VZZA 2ZOGA 2EK8A 3JRUA 1Q2YA 1KUVA 2C1CA 2FT0A 4FUUA 4JXRA 2O53A 2HB6A 2VQYA 5HVFA 4MHZA 4X8IA 3S6KA 2OB0A 1GYTA 1X10A 4MHDA 5G20A 2HUZA 3B3WA 4F9UA 5LYLA 4IIXA 5FD8A 2P6GA 3T5MA 2Q7BA 1F2PA 4NFRA 4LQGA 1F2OA 3KGQA 4OKOA 4IAVA 3D7FA 4A95A 2YNEA 5A27A 1BO4A 3SJGA 3D2MA 3FBUA 4UFXA 2ZOFA 1YSJA 1Q2CA 1YW4A 2VL1A 3NE8A 2G0BA 4JXQA 3B35A 2VEZA 3MN8A 3VH9A 3DGVA 3FRMA 3QAYA 4OAEA 2K5TA 1NSLA 1VHOA 3GKRA 5JM6A 3IJ3A 5K8OA 2EZCA 4E94A 1LFWA 1QQ9A 3KHXA 3SI0A 2JDCA 2ATRA 2HWGA 3TLAA 1X12A 3TLCA 3SJXA 2D4OA 2JLMA 1WK4A 1MJAA 1I12A 2QJ8A 2ZEEA 2F8HA 3P2FA 4UCNA 3ISXA 4KUBA 1AYEA 3DR8A 3G23A 2Q43A 1C30B 4M8DA 3TO6A 2DXQA 4C8TA 2Q4ZA 4QUSA 2D0OA 3T9YA 1BPNA 4C86A 1YLOA 4EMEA 3KHZA 2GIVA 4KS9A 1ARLA 3NH4A 4XNHC 5J8FA 1P4NA 1R43A 3RNZA 1VKCA 1IB1E 1KC7A 4KOVA 4P6YA 3N7ZA 4PXEA 1A9XB 2Q44A 3DDDA 2PJBA 4AXVA 4FBEA 2VI7A 5JPHA 4KOWA 5A28A 4X3RA 2PJ0A 1J3LA 4A32A 2BSWA 2GFQA 3K9TA 1Z8WA 1CX8A 4CAEA 1V0CA 5JH9A 2PJ1A 3A9LA 4E2AA 3DSBA 3MGDA 4JWPA 3D4UA 4MMOA 1U6MA 4NJRA 4QB9A 3V8IA 4A39A 1MJ9A 1HDUA 4IK2A 3UY5A 4ZY1A 2JBJA 3W91A 2AUMA 3B2YA 3EY5A 4F0XA 2JBKA 4UIBA 3D3SA 4KVOE 2P6FA 3IWWA 3I9SA 4F8ZA 2FIAA 1XBUA 3PEIA 5J8CA 1PYTB 4NGTA 4UEZA 4XPLA 1CE8B 1QMUA 1K4JA 1KUYA 2B3VA 2GP4A 2O4HA 3QAHA 2ZENA 4OIDA 1Y9ZA 1B6BA 1IYLA 2Q4YA 2AUNA 3LWUA 4FD4A 3D7DA 5JYBA 3RAMA 5IX3A 4OMEA 4A30A 3R96A 3IFEA 4EVYA 3TX8A 3KR4A 1XMBA 5CPAA 2XEJA 2PJ8A 2HQYA 2ARHA 2YGWA 4X5KA 4U5YA 4B10A 1LOKA 5KTCA 1SQHA 4COGA 4PSXA 1QSMA 3TLGB 4JYWA 1NXJA 1MK4A 2YNCC 2ZEHA 1Z2LA 4M6IA 3S9MA 2AFZA 4A37A 4XPDB 4C7HA 3H8FA 3FVLA 3PB8X 2FL4A 3IEHA 3IGRA 3K4IA 1UFHA 5F9MA 5AG4A 2OH1A 3BJ7A 3TOAA 2HV2A 2PDOA 4OC5A 4UEEA 4C8CA 5FVJA 5CNPA 1TIQA 2BOAA 3FX6A 4C8FA 1VBGA 3WR7A 3EC4A 4CAXA 3TLGA 2O28A 1XF8A 1P0HA 5LYDA 5D8NA 3KKWA 2Z10A 1CPXA 2XEFA 4P4BA 3I3GA 1Y7RA 1I21A 5HXDA 4KNGE 3TLEA 3D7HA 1YQEA 2EO8A 3PZJA 4H2KA 2I3CA 1B87A 1XRYA 3SI2A 3NOJA 3D67A 3TLZA 1OBRA 3KL9A 2RFHA 3KR5A 2BUEA 1YK3A 3KRVA 4NEXA 3CXSA 5F5XA 4UF4A 2NMTA 3WT4A 4YN3A 1MJBA 3R9FA 3FEEA 3F8KA 2IQ6A 2PE3A 1TF8A 2ZW7A 3VWDA 2P0WA 4KLWA 4G1PA 1KBLA 1IYKA 1GHEA 2QYVA 4NXYA 4EFDA 5C82A 5G1ZA 2POKA 1Y9WA 3DLJA 5ISVA 5LYIA 3TOBA 1LAPA 1NSAA 1Y0RA 2P6EA 4EWTA 1Q5XA 3QB8A 4R9MA 4Y49C 1R61A 2ZEGA 2GU2A 2NYQA 8CPAA 2OR4A 4LQ6A 4MCPA 5AG5A 3T8WA 4RS2A 3PBEA 1C3OB 1DTDA 2CNSA 4B11A 2C6GA 1A2ZA 2BCOA 5H84A 1JDEA 1XMTA 1HEEA 3CXPA 4C2ZA 3VTAA 4OC3A 2HC9A 2PSWA 1NE9A 4FD7A 3S6FA 4CRZB 5CBMA 1WWZA 2V8HA 2Z3PA 3KQXA 4GS4A 4PPZA 2DF5A 2NSMA 4MFPA 2R8VA 3NFZA 4A94A 5DWNA 2I00A 5K8MA 3CDXA 3FB3A 2PVVA 3BLNA 4W9YA 5K99A 4R7MA 3GYAA 4JJXA 3K9UA 2VBQA 2ZW4A 4KOYA 3B8GA 2WPWA 5EC4A 3I6SA 1Y0YA 5AG6A 1ZG9A 4OC4A 5C88A 5JGFA 2AFUA 1KEEB 4MXUA 4NSQA 4C2XA 3PP9A 1DIKA 3TFYA 2OZUA 3B3TA 1NBWA 3R1KA 3IO1A 2XEGA 1CJWA 4JD6A 4OC2A 5F49A 5F48A 5J1QA 4ORFA 4KOUA 4CGOA 1ZYMA 2Z11A 3PFOA 4MHPA 4Q38A 2ZW6A 2YJVA 2CTBA 4A31A 2PJ6A 2AFOA 1EE3P 3B7IA 3GLJA 3K2KA 4MCQA 4NGRA 3GY9A 4U9ZA 4ZX8A 4MHNA 4B14A 4H1HA 3U1BA 3N5FA 4F9VA 4PXBA 3H8EA 3JTKA 5I4MA 4Q36A 4XNHB 4NGNA 4RI1A 3TC8A 5EMIA 2AJ6A 5E96A 3IIBA 3VARA 2JEWA 4AVAA 4ZI6A 3H4QA 2F5IA 2RC4A 1IOIA 4UWJA 2ANPA 4MJ8A 2I79A 4PK3A 4JVOA 3PB4X 5IR2A 1UWYA 2CNMA 1HDQA 1ZG7A 4AG7A 1I1DA 4OADA 2IL4A 3HLPA 2GE3A 2Q4VA 4P4FA 2Q0YA 1M44A 4PK2A 4CPAA 1M4IA 3TCVA 4CGPA 4ONUA 3SJEA 3V38A 1AUGA 3EXNA 3PBBA 1S3ZA 3T05A 3TYXA 1QSNA 4LUAA 2FE7A 4C8UA 4MY3A 1QSRA 2V8VA 2J9AA 1JQGA 3IU1A 4NGQA 4BBHA 1TF9A 3CPAA 4HKFA 4KSIA 4MFQA 4OLLA 3KI9A 2R7HA 4QBJA 2VZYA 4FD6A 2AE6A 3B3VA 4IF5A 1N71A 2ZEOA 4Q7AA 1ARMA 3C26A 4B5PB 2AFXA 2B58A 2PR1A 2ZEDA 3RYOA 1R57A 1RTQA 3S9LA 4KSAA 5G22A 4P4IA 4E5SA 1M4LA 4CRYB 2PCNA 4BD9A 1CP6A 3D2PA 5BWAB 2RB7A 1KZFA 4H6UA 3JVNA 2PRBA 2JEVA 4OIWA 3CZXA 4JLYA 1QSTA 4L8AA 5AG7A 3V7ZA 5F09A 2PQ8A 3ZZIA 4ZYQA 4II9A 1FNOA 1TXRA 2D0PA 1Z8TA 4CGLA 4C9AA 4B5PA 3BHXA 2REEA 1FT7A 4INJA 2WPXA 2C5QA 4M6HA 2PVWA 2QVPA 4K30A 4WJBA 4ZY2A 2GLFA 3GB0A 5HVGA 3FF3A 3TTHA 2PJ5A 4R3LA 2ZELA 4M6GA 3ZJ0A 1Q2DA 3CT9A 4RN7A 2MP0A 3F0AA 4MI4A 4CYPA 4MCRA 2ZW5A 3WC7A 4KUAA 4NF1A 4NJQA 3WC6A 2Z3LA 4RUHA 2G3TA 4L89A 1CG2A 7CPAA 4TWEA 2B3UA 3D8PA 4A2ZA 4ZGYB 1Z4EA 3MRUA 5G21A 2YNCA 2V8DA 5F1YA 3SI1A 2GANA 3FYNA 1NMTA 3PB9X 2EVNA 2Z0ZA 2J8NA 2GREA 3IC1A 2HROA 2J8RA 1BAVA 2Q51A 1RO5A 4R57A 4C8AA 2OZHA 2OZGA 2QMLA 3FMCA 4P45A 5AGEA 4Z65A 4BMHA 4UIAA 5JQ4A 3GUXA 1ZLIA 2PCUA 2C27A 3FIXA 1M1DA 1Z8LA 4UWIA 2EZBA 1AMPA 2QIRA 4R6TA 2PRQA 3C8OA 2B0AA 4AB7A 2Z3KA 3NA6A 4ONWA 4KORA 3W6XA 5I0CA 4J3GA 4KOXA 4NCZA 4WWVA 1IY7A 4CYNA 1VI4A 2AFSA 3P2HA 4FD5A 4XPKA 3EZAA 3OWCA 4E0AA 3SJFA 2IJZA 4OP4A 4AVCA 1BPMA 1JWQA 4Y49B 5IB9A 2ABZA 1VIXA 2PJ4A 2WSAA 4C9EA 1S7FA 4CAWA 3I74A 1CS0B 3I1UA 4YGOA 3T90A 2R82A 4UCPA 4COBA 4MY0A 1L0CA 2OOTA 4KZTA 2BO9A 1KWMA 4C9VA 4C9RA
chains in the Genus database with same CATH topology
4B6ZA 4MCSA 2WYRA 1YMEA 1YW6A 4FWUA 5K8PA 2ZEPA 2C6CA 4K3NA 2CF4A 2AFMA 3FECA 3L2NA 4O23A 2PIZA 2XEIA 5LYFA 2V77A 4P10A 1Z5RA 1LANA 4MRIA 4P4DA 4DYOA 2FVGA 3BXMA 3WC5A 1TKJA 3PB7X 2F7VA 2G9DA 2AFWA 4YWYA 4X2TA 4TJXA 2PJAA 1IGBA 3RZAA 2CTCA 2DEAA 3RBUA 4PXDA 1LCPA 3B3SA 3ICUA 4P44A 3KASA 3NH5A 4PQAA 4C8PA 4CDKA 5LRJA 4GM5A 4CDJA 1CBXA 1DE4C 1F57A 5ELYA 1ZLHA 2EK9A 4UEFA 1WVMA 2WZNA 3PRTA 1V6CA 3HUVA 1TKFA 4A38A 1XF1A 4OC0A 4ZX9A 1BLLE 3EIFA 5DS0A 4NGPA 5LRGA 1XFOA 2CIJA 3QNVA 2PJCA 4PXCA 3D68A 5THWA 3BI0A 4P4JA 5D29A 2ZEMA 4C85A 1VHEA 2ZEFA 3BI1A 4FAIA 2C6PA 1LAMA 4TNUA 2IMOA 3S9NA 2V8GA 2PJ9A 4TJVA 4C84A 3FEDA 1VGYA 4R8FA 2PJ7A 1XJOA 3D66A 1Y7EA 2PIYA 4NGSA 1ELLP 4OC1A 2GLJA 3PFEA 1CPSA 1ZG8A 5LRKA 3D7GA 3CPXA 1R3NA 4C9UA 3H8GA 4YU9A 1ELMP 2PJ3A 4MHYA 1CP7A 3ISZA 4JZ0A 1Q7LA 4NGMA 5K8NA 6CPAA 1H8LA 3KZWA 4DUKA 4P4EA 3WABA 5HVHA 2PJ2A 3B3CA 1TKHA 3PB6X 3NH8A 3FH4A 4ZY0A 3VATA 3KQZA 4R76A 4DJLA 2EWBA 3LMSA 3FJUA 4IHMA 1PCAA 2ZOGA 3JRUA 2EK8A 2C1CA 4FUUA 4C99A 2O53A 2HB6A 5HVFA 4MHZA 4X8IA 1GYTA 5LYLA 4F9UA 3B3WA 1F2PA 4NFRA 4LQGA 1F2OA 3KGQA 4OKOA 4IAVA 3D7FA 3SJGA 2ZOFA 1YSJA 1YW4A 2VL1A 3B35A 3MN8A 3VH9A 3DGVA 5JM6A 5K8OA 1VHOA 3IJ3A 1LFWA 1QQ9A 3KHXA 3SI0A 3SJXA 2QJ8A 2ZEEA 2F8HA 3ISXA 1AYEA 2Q43A 4C8TA 2Q4ZA 1BPNA 4C86A 1YLOA 4EMEA 3KHZA 1ARLA 3NH4A 1R43A 4P6YA 4PXEA 4AXVA 2PJBA 4FBEA 4X3RA 2PJ0A 3K9TA 1CX8A 5JH9A 2PJ1A 3D4UA 4MMOA 4NJRA 4A39A 1HDUA 4IK2A 4ZY1A 2JBJA 3B2YA 2JBKA 4UIBA 3IWWA 4F8ZA 1XBUA 3PEIA 1PYTB 4NGTA 4UEZA 1QMUA 2GP4A 2O4HA 2ZENA 4OIDA 1Y9ZA 3LWUA 3D7DA 3RAMA 4OMEA 3IFEA 3TX8A 3KR4A 1XMBA 5CPAA 2XEJA 2PJ8A 1LOKA 4JYWA 2ZEHA 1Z2LA 3S9MA 2AFZA 4A37A 3H8FA 3FVLA 3PB8X 3IEHA 4OC5A 4UEEA 4C8CA 3FX6A 2BOAA 4C8FA 5LYDA 5D8NA 1CPXA 2XEFA 4P4BA 4KNGE 5HXDA 3D7HA 4H2KA 2I3CA 1XRYA 3SI2A 3D67A 1OBRA 3KL9A 2RFHA 3KR5A 4UF4A 3WT4A 4YN3A 3FEEA 2IQ6A 2PE3A 1TF8A 4G1PA 2QYVA 4EFDA 2POKA 3DLJA 5LYIA 1LAPA 1NSAA 1Y0RA 4EWTA 2ZEGA 2GU2A 2NYQA 2OR4A 4MCPA 3T8WA 3PBEA 1DTDA 2C6GA 2BCOA 1HEEA 3VTAA 4OC3A 2HC9A 5CBMA 2V8HA 3KQXA 4PPZA 2NSMA 3NFZA 4A94A 5K8MA 3CDXA 2PVVA 4W9YA 4R7MA 3I6SA 1Y0YA 1ZG9A 4OC4A 5JGFA 2AFUA 4MXUA 3B3TA 3IO1A 2XEGA 5J1QA 4OC2A 3PFOA 4MHPA 2CTBA 2PJ6A 2AFOA 1EE3P 3B7IA 3GLJA 4NGRA 3K2KA 4MCQA 4ZX8A 4MHNA 3N5FA 4F9VA 4PXBA 3H8EA 5I4MA 4NGNA 3TC8A 3IIBA 3VARA 2JEWA 4ZI6A 2ANPA 3PB4X 5IR2A 1UWYA 1HDQA 1ZG7A 3HLPA 4P4FA 4CPAA 3V38A 3SJEA 3PBBA 4C8UA 2V8VA 2J9AA 1JQGA 4NGQA 1TF9A 3CPAA 4KSIA 3KI9A 3B3VA 2ZEOA 4Q7AA 1ARMA 2AFXA 2ZEDA 1RTQA 3S9LA 4P4IA 1M4LA 4BD9A 1CP6A 2RB7A 8CPAA 4OIWA 5F09A 3V7ZA 4ZYQA 1FNOA 1TXRA 4C9AA 3BHXA 1FT7A 2C5QA 2PVWA 2QVPA 4WJBA 4ZY2A 2GLFA 3GB0A 5HVGA 3FF3A 2PJ5A 2ZELA 3CT9A 4MCRA 3WC7A 4NJQA 3WC6A 4RUHA 1CG2A 7CPAA 4TWEA 3MRUA 2V8DA 3SI1A 3PB9X 2GREA 3IC1A 4C8AA 1BAVA 2Q51A 3FMCA 4P45A 4Z65A 4UIAA 3GUXA 1ZLIA 2PCUA 1Z8LA 1AMPA 4R6TA 2PRQA 3NA6A 4ONWA 4WWVA 1IY7A 2AFSA 3SJFA 2IJZA 4OP4A 1BPMA 5IB9A 2ABZA 1VIXA 2PJ4A 4C9EA 3I74A 3I1UA 2OOTA 2BO9A 1KWMA 4C9VA 4C9RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B6Z A;  4MCS A;  2WYR A;  1YME A;  1YW6 A;  4FWU A;  5K8P A;  2ZEP A;  2C6C A;  4K3N A;  2CF4 A;  2AFM A;  3FEC A;  3L2N A;  4O23 A;  2PIZ A;  2XEI A;  5LYF A;  2V77 A;  4P10 A;  1Z5R A;  1LAN A;  4MRI A;  4P4D A;  4DYO A;  2FVG A;  3BXM A;  3WC5 A;  1TKJ A;  3PB7 X;  2F7V A;  2G9D A;  2AFW A;  4YWY A;  4X2T A;  4TJX A;  2PJA A;  1IGB A;  3RZA A;  2CTC A;  2DEA A;  3RBU A;  4PXD A;  1LCP A;  3B3S A;  3ICU A;  4P44 A;  3KAS A;  3NH5 A;  4PQA A;  4C8P A;  4CDK A;  5LRJ A;  4GM5 A;  4CDJ A;  1CBX A;  1DE4 C;  1F57 A;  5ELY A;  1ZLH A;  2EK9 A;  4UEF A;  1WVM A;  2WZN A;  3PRT A;  1V6C A;  3HUV A;  1TKF A;  4A38 A;  1XF1 A;  4OC0 A;  4ZX9 A;  1BLL E;  3EIF A;  5DS0 A;  4NGP A;  5LRG A;  1XFO A;  2CIJ A;  3QNV A;  2PJC A;  4PXC A;  3D68 A;  5THW A;  3BI0 A;  4P4J A;  5D29 A;  2ZEM A;  4C85 A;  1VHE A;  2ZEF A;  3BI1 A;  4FAI A;  2C6P A;  1LAM A;  4TNU A;  2IMO A;  3S9N A;  2V8G A;  2PJ9 A;  4TJV A;  4C84 A;  3FED A;  1VGY A;  4R8F A;  2PJ7 A;  1XJO A;  3D66 A;  1Y7E A;  2PIY A;  4NGS A;  1ELL P;  4OC1 A;  2GLJ A;  3PFE A;  1CPS A;  1ZG8 A;  5LRK A;  3D7G A;  3CPX A;  1R3N A;  4C9U A;  3H8G A;  4YU9 A;  1ELM P;  2PJ3 A;  4MHY A;  1CP7 A;  3ISZ A;  4JZ0 A;  1Q7L A;  4NGM A;  5K8N A;  6CPA A;  1H8L A;  3KZW A;  4DUK A;  4P4E A;  3WAB A;  5HVH A;  2PJ2 A;  3B3C A;  1TKH A;  3PB6 X;  3NH8 A;  3FH4 A;  4ZY0 A;  3VAT A;  3KQZ A;  4R76 A;  4DJL A;  2EWB A;  3LMS A;  3FJU A;  4IHM A;  1PCA A;  2ZOG A;  3JRU A;  2EK8 A;  2C1C A;  4FUU A;  4C99 A;  2O53 A;  2HB6 A;  5HVF A;  4MHZ A;  4X8I A;  1GYT A;  5LYL A;  4F9U A;  3B3W A;  1F2P A;  4NFR A;  4LQG A;  1F2O A;  3KGQ A;  4OKO A;  4IAV A;  3D7F A;  3SJG A;  2ZOF A;  1YSJ A;  1YW4 A;  2VL1 A;  3B35 A;  3MN8 A;  3VH9 A;  3DGV A;  5JM6 A;  5K8O A;  1VHO A;  3IJ3 A;  1LFW A;  1QQ9 A;  3KHX A;  3SI0 A;  3SJX A;  2QJ8 A;  2ZEE A;  2F8H A;  3ISX A;  1AYE A;  2Q43 A;  4C8T A;  2Q4Z A;  1BPN A;  4C86 A;  1YLO A;  4EME A;  3KHZ A;  1ARL A;  3NH4 A;  1R43 A;  4P6Y A;  4PXE A;  4AXV A;  2PJB A;  4FBE A;  4X3R A;  2PJ0 A;  3K9T A;  1CX8 A;  5JH9 A;  2PJ1 A;  3D4U A;  4MMO A;  4NJR A;  4A39 A;  1HDU A;  4IK2 A;  4ZY1 A;  2JBJ A;  3B2Y A;  2JBK A;  4UIB A;  3IWW A;  4F8Z A;  1XBU A;  3PEI A;  1PYT B;  4NGT A;  4UEZ A;  1QMU A;  2O4H A;  2ZEN A;  4OID A;  1Y9Z A;  3LWU A;  3D7D A;  3RAM A;  4OME A;  3IFE A;  3TX8 A;  3KR4 A;  1XMB A;  5CPA A;  2XEJ A;  2PJ8 A;  1LOK A;  4JYW A;  2ZEH A;  1Z2L A;  3S9M A;  2AFZ A;  4A37 A;  3H8F A;  3FVL A;  3PB8 X;  3IEH A;  4OC5 A;  4UEE A;  4C8C A;  3FX6 A;  2BOA A;  4C8F A;  5LYD A;  5D8N A;  1CPX A;  2XEF A;  4P4B A;  4KNG E;  5HXD A;  3D7H A;  4H2K A;  2I3C A;  1XRY A;  3SI2 A;  3D67 A;  1OBR A;  3KL9 A;  2RFH A;  3KR5 A;  4UF4 A;  3WT4 A;  4YN3 A;  3FEE A;  2IQ6 A;  2PE3 A;  1TF8 A;  4G1P A;  2QYV A;  4EFD A;  2POK A;  3DLJ A;  5LYI A;  1LAP A;  1NSA A;  1Y0R A;  4EWT A;  2ZEG A;  2GU2 A;  2NYQ A;  2OR4 A;  4MCP A;  3T8W A;  3PBE A;  1DTD A;  2C6G A;  2BCO A;  1HEE A;  3VTA A;  4OC3 A;  2HC9 A;  5CBM A;  2V8H A;  3KQX A;  4PPZ A;  2NSM A;  3NFZ A;  4A94 A;  5K8M A;  3CDX A;  2PVV A;  4W9Y A;  4R7M A;  3I6S A;  1Y0Y A;  1ZG9 A;  4OC4 A;  5JGF A;  2AFU A;  4MXU A;  3B3T A;  3IO1 A;  2XEG A;  5J1Q A;  4OC2 A;  3PFO A;  4MHP A;  2CTB A;  2PJ6 A;  2AFO A;  1EE3 P;  3B7I A;  3GLJ A;  4NGR A;  3K2K A;  4MCQ A;  4ZX8 A;  4MHN A;  3N5F A;  4F9V A;  4PXB A;  3H8E A;  5I4M A;  4NGN A;  3TC8 A;  3IIB A;  3VAR A;  2JEW A;  4ZI6 A;  2ANP A;  3PB4 X;  1UWY A;  1HDQ A;  1ZG7 A;  3HLP A;  4P4F A;  4CPA A;  3V38 A;  3SJE A;  3PBB A;  4C8U A;  2V8V A;  2J9A A;  1JQG A;  4NGQ A;  1TF9 A;  3CPA A;  4KSI A;  3KI9 A;  3B3V A;  2ZEO A;  4Q7A A;  1ARM A;  2AFX A;  2ZED A;  1RTQ A;  3S9L A;  4P4I A;  1M4L A;  4BD9 A;  1CP6 A;  2RB7 A;  8CPA A;  4OIW A;  5F09 A;  3V7Z A;  4ZYQ A;  1FNO A;  1TXR A;  4C9A A;  3BHX A;  1FT7 A;  2PVW A;  2QVP A;  4WJB A;  4ZY2 A;  2GLF A;  3GB0 A;  5HVG A;  3FF3 A;  2PJ5 A;  2ZEL A;  3CT9 A;  4MCR A;  3WC7 A;  4NJQ A;  3WC6 A;  4RUH A;  1CG2 A;  7CPA A;  4TWE A;  3MRU A;  2V8D A;  3SI1 A;  3PB9 X;  2GRE A;  3IC1 A;  4C8A A;  1BAV A;  2Q51 A;  3FMC A;  4P45 A;  4Z65 A;  4UIA A;  3GUX A;  1ZLI A;  2PCU A;  1Z8L A;  1AMP A;  4R6T A;  2PRQ A;  3NA6 A;  4ONW A;  4WWV A;  1IY7 A;  2AFS A;  3SJF A;  2IJZ A;  4OP4 A;  1BPM A;  5IB9 A;  2ABZ A;  1VIX A;  2PJ4 A;  4C9E A;  3I74 A;  3I1U A;  2OOT A;  2BO9 A;  1KWM A;  4C9V A;  4C9R A; 
#chains in the Genus database with same CATH topology
 4B6Z A;  4MCS A;  2WYR A;  4KVM E;  3NE7 A;  4M85 A;  4QVT A;  1YME A;  1YW6 A;  4FWU A;  5K8P A;  1BOB A;  3T0T A;  2ZEP A;  5KTA A;  1M6V B;  2C6C A;  4K3N A;  4ZBG A;  2CF4 A;  2AFM A;  1S7L A;  3FEC A;  3IWG A;  2CNT A;  3L2N A;  2FIW A;  4MFJ A;  4O23 A;  1YVK A;  2PIZ A;  4I49 A;  1XOV A;  4CAF A;  5F46 A;  2XEI A;  1XEB A;  5LYF A;  2ZPA A;  2V77 A;  4P10 A;  1Z5R A;  3CXQ A;  4CGN A;  4MI1 A;  2BEI A;  1LAN A;  4MRI A;  4P4D A;  2QEC A;  4DYO A;  2FVG A;  3T07 A;  1Z4R A;  3TT2 A;  4IUS A;  1PU9 A;  3PGP A;  4CO9 A;  4UCM A;  3BXM A;  2REF A;  4KLV A;  3WC5 A;  1Y9K A;  1TKJ A;  1YR0 A;  3PB7 X;  4MFK A;  1IID A;  3LOD A;  3VWE A;  2B4D B;  2F7V A;  2G9D A;  4R3K A;  2AFW A;  2ODF A;  4CZ1 A;  4PV6 A;  4YWY A;  3TLB A;  4C7I A;  2X0S A;  4X2T A;  4KOS A;  1OZP A;  2Q04 A;  3EFA A;  4TJX A;  4B13 A;  2PJA A;  1IGB A;  3RZA A;  2CTC A;  4MFL A;  4H89 A;  3W6S A;  1KUX A;  4C99 A;  4QC6 A;  1VHS A;  2DEA A;  3RBU A;  4J0N A;  4PXD A;  4UA3 A;  1LCP A;  3B3S A;  2B4D A;  5HH1 A;  4A33 A;  4AG9 A;  2Z3M A;  1ON0 A;  4HNW B;  3DR6 A;  3EO4 A;  4UFW A;  3SXO A;  3FXT A;  2VXK A;  4UFV A;  2PC1 A;  3ICU A;  4B5O A;  4P44 A;  2YJT A;  3KAS A;  4CGM A;  3TE4 A;  3NH5 A;  4PQA A;  5JVL A;  4C8P A;  1YLE A;  2ZXV A;  4MBU A;  4CDK A;  5LRJ A;  2Z3O A;  4HNY B;  4KSF A;  4AVB A;  4GM5 A;  4CYO A;  5IB0 A;  4CDJ A;  1CBX A;  2EUI A;  1DE4 C;  1F57 A;  2R98 A;  5ELY A;  1ZLH A;  2EK9 A;  4UEF A;  3TO7 A;  4GXH A;  1WVM A;  1YGH A;  2WZN A;  3EZB A;  3JUW A;  3EZE A;  3PRT A;  1PUA A;  1V6C A;  3HUV A;  4YRH A;  2FS5 A;  1TKF A;  4A38 A;  1XF1 A;  4OC0 A;  4ZX9 A;  1J4J A;  3LD2 A;  1BLL E;  3GIU A;  3S6G A;  5DS0 A;  4CS0 B;  4C68 A;  3EIF A;  2DPT A;  4NGP A;  5IV0 A;  2WUU A;  3E0K A;  4HNX B;  5LRG A;  3SHP A;  3S6H A;  1XFO A;  2CIJ A;  5KTD A;  1GGO A;  2FM4 A;  1YX0 A;  2FXF A;  3QNV A;  2PJC A;  4PXC A;  4U9Y A;  5DWM A;  4M3S A;  3D68 A;  2FSR A;  3LAC A;  5THW A;  3BI0 A;  4P4J A;  5D29 A;  2ZEM A;  4C85 A;  1VHE A;  1EZA A;  1IIC A;  2ZEF A;  3FNC A;  3BI1 A;  3R9E A;  2CY2 A;  4FAI A;  5EBV A;  1BXR B;  4MJX A;  1Z8X A;  2C6P A;  3G3S A;  1LAM A;  3H5Z A;  5HMN A;  4TNU A;  2IMO A;  3S9N A;  2V8G A;  2PR8 A;  2PJ9 A;  1XE4 A;  2FCK A;  4TJV A;  3SR3 A;  4PSW A;  4XPD C;  2EBJ A;  4C84 A;  3R95 A;  3R9G A;  2OLS A;  2DPS A;  3FED A;  1VGY A;  2B4B A;  1IU8 A;  4R8F A;  1XJO A;  2PJ7 A;  2H5M A;  1S7K A;  3IWE A;  3SXN A;  3D66 A;  1Y7E A;  2PIY A;  4NGS A;  1ELL P;  4OC1 A;  1CM0 A;  2BL1 A;  4KVX A;  3TO9 A;  2GLJ A;  4BIN A;  2CXA A;  3PFE A;  1VBH A;  1CPS A;  2Q7S A;  1ZG8 A;  5LRK A;  1ZO0 A;  4MFZ A;  3D7G A;  4R87 A;  1JDB C;  3RO0 A;  3CPX A;  1T36 B;  4EYS A;  3BJ8 A;  1R3N A;  4C2Y A;  1LRZ A;  4CYQ A;  2B5G B;  4LX9 A;  4B12 A;  4DNC A;  4C9U A;  2EZA A;  1FY7 A;  1IOF A;  4IIY A;  3H8G A;  4YU9 A;  1YVO A;  1ELM P;  2G3A A;  2PJ3 A;  4MHY A;  1ZL0 A;  1CP7 A;  4UBR A;  3ISZ A;  4KOT A;  3IU2 A;  4JZ0 A;  1M4G A;  1Q7L A;  1YRE A;  4NGM A;  5K8N A;  2E28 A;  3TLY A;  2Z3N A;  2R1I A;  3DNS A;  6CPA A;  4H6Z A;  1S60 A;  1H8L A;  3GJZ A;  3KZW A;  3G8W A;  4F0Y A;  2HI6 A;  1EZB A;  2KCW A;  4DUK A;  2J8M A;  1RXT A;  4P4E A;  2A4N A;  1XIX A;  5H86 A;  2B5G A;  3WAB A;  1ZRS A;  1S7N A;  3F5B A;  4F6A A;  5HVH A;  2DIK A;  2PJ2 A;  2X7B A;  3B3C A;  1S5K A;  1TKH A;  1Z9U A;  1QSO A;  3NH8 A;  3FH4 A;  3PB6 X;  4YFJ A;  4ZY0 A;  3VAT A;  4E8O A;  2Y0M A;  3KQZ A;  4R76 A;  4CAV A;  2D4P A;  2OU2 A;  5F47 A;  4DJL A;  5GCN A;  1M4D A;  2EWB A;  3LMS A;  3FJU A;  2YND A;  4HPS A;  4IHM A;  2JDD A;  1PCA A;  2VZZ A;  2ZOG A;  2EK8 A;  3JRU A;  1Q2Y A;  1KUV A;  2C1C A;  2FT0 A;  4FUU A;  4JXR A;  2O53 A;  2HB6 A;  2VQY A;  5HVF A;  4MHZ A;  4X8I A;  3S6K A;  2OB0 A;  1GYT A;  1X10 A;  4MHD A;  5G20 A;  2HUZ A;  3B3W A;  4F9U A;  5LYL A;  4IIX A;  5FD8 A;  2P6G A;  3T5M A;  2Q7B A;  1F2P A;  4NFR A;  4LQG A;  1F2O A;  3KGQ A;  4OKO A;  4IAV A;  3D7F A;  4A95 A;  2YNE A;  5A27 A;  1BO4 A;  3SJG A;  3D2M A;  3FBU A;  4UFX A;  2ZOF A;  1YSJ A;  1Q2C A;  1YW4 A;  2VL1 A;  3NE8 A;  2G0B A;  4JXQ A;  3B35 A;  2VEZ A;  3MN8 A;  3VH9 A;  3DGV A;  3FRM A;  3QAY A;  4OAE A;  2K5T A;  1NSL A;  1VHO A;  3GKR A;  5JM6 A;  3IJ3 A;  5K8O A;  2EZC A;  4E94 A;  1LFW A;  1QQ9 A;  3KHX A;  3SI0 A;  2JDC A;  2ATR A;  2HWG A;  3TLA A;  1X12 A;  3TLC A;  3SJX A;  2D4O A;  2JLM A;  1WK4 A;  1MJA A;  1I12 A;  2QJ8 A;  2ZEE A;  2F8H A;  3P2F A;  4UCN A;  3ISX A;  4KUB A;  1AYE A;  3DR8 A;  3G23 A;  2Q43 A;  1C30 B;  4M8D A;  3TO6 A;  2DXQ A;  4C8T A;  2Q4Z A;  4QUS A;  2D0O A;  3T9Y A;  1BPN A;  4C86 A;  1YLO A;  4EME A;  3KHZ A;  2GIV A;  4KS9 A;  1ARL A;  3NH4 A;  4XNH C;  5J8F A;  1P4N A;  1R43 A;  3RNZ A;  1VKC A;  1IB1 E;  1KC7 A;  4KOV A;  4P6Y A;  3N7Z A;  4PXE A;  1A9X B;  2Q44 A;  3DDD A;  2PJB A;  4AXV A;  4FBE A;  2VI7 A;  5JPH A;  4KOW A;  5A28 A;  4X3R A;  2PJ0 A;  1J3L A;  4A32 A;  2BSW A;  2GFQ A;  3K9T A;  1Z8W A;  1CX8 A;  4CAE A;  1V0C A;  5JH9 A;  2PJ1 A;  3A9L A;  4E2A A;  3DSB A;  3MGD A;  4JWP A;  3D4U A;  4MMO A;  1U6M A;  4NJR A;  4QB9 A;  3V8I A;  4A39 A;  1MJ9 A;  1HDU A;  4IK2 A;  3UY5 A;  4ZY1 A;  2JBJ A;  3W91 A;  2AUM A;  3B2Y A;  3EY5 A;  4F0X A;  2JBK A;  4UIB A;  3D3S A;  4KVO E;  2P6F A;  3IWW A;  3I9S A;  4F8Z A;  2FIA A;  1XBU A;  3PEI A;  5J8C A;  1PYT B;  4NGT A;  4UEZ A;  4XPL A;  1CE8 B;  1QMU A;  1K4J A;  1KUY A;  2B3V A;  2GP4 A;  2O4H A;  3QAH A;  2ZEN A;  4OID A;  1Y9Z A;  1B6B A;  1IYL A;  2Q4Y A;  2AUN A;  3LWU A;  4FD4 A;  3D7D A;  5JYB A;  3RAM A;  5IX3 A;  4OME A;  4A30 A;  3R96 A;  3IFE A;  4EVY A;  3TX8 A;  3KR4 A;  1XMB A;  5CPA A;  2XEJ A;  2PJ8 A;  2HQY A;  2ARH A;  2YGW A;  4X5K A;  4U5Y A;  4B10 A;  1LOK A;  5KTC A;  1SQH A;  4COG A;  4PSX A;  1QSM A;  3TLG B;  4JYW A;  1NXJ A;  1MK4 A;  2YNC C;  2ZEH A;  1Z2L A;  4M6I A;  3S9M A;  2AFZ A;  4A37 A;  4XPD B;  4C7H A;  3H8F A;  3FVL A;  3PB8 X;  2FL4 A;  3IEH A;  3IGR A;  3K4I A;  1UFH A;  5F9M A;  5AG4 A;  2OH1 A;  3BJ7 A;  3TOA A;  2HV2 A;  2PDO A;  4OC5 A;  4UEE A;  4C8C A;  5FVJ A;  5CNP A;  1TIQ A;  2BOA A;  3FX6 A;  4C8F A;  1VBG A;  3WR7 A;  3EC4 A;  4CAX A;  3TLG A;  2O28 A;  1XF8 A;  1P0H A;  5LYD A;  5D8N A;  3KKW A;  2Z10 A;  1CPX A;  2XEF A;  4P4B A;  3I3G A;  1Y7R A;  1I21 A;  5HXD A;  4KNG E;  3TLE A;  3D7H A;  1YQE A;  2EO8 A;  3PZJ A;  4H2K A;  2I3C A;  1B87 A;  1XRY A;  3SI2 A;  3NOJ A;  3D67 A;  3TLZ A;  1OBR A;  3KL9 A;  2RFH A;  3KR5 A;  2BUE A;  1YK3 A;  3KRV A;  4NEX A;  3CXS A;  5F5X A;  4UF4 A;  2NMT A;  3WT4 A;  4YN3 A;  1MJB A;  3R9F A;  3FEE A;  3F8K A;  2IQ6 A;  2PE3 A;  1TF8 A;  2ZW7 A;  3VWD A;  2P0W A;  4KLW A;  4G1P A;  1KBL A;  1IYK A;  1GHE A;  2QYV A;  4NXY A;  4EFD A;  5C82 A;  5G1Z A;  2POK A;  1Y9W A;  3DLJ A;  5ISV A;  5LYI A;  3TOB A;  1LAP A;  1NSA A;  1Y0R A;  2P6E A;  4EWT A;  1Q5X A;  3QB8 A;  4R9M A;  4Y49 C;  1R61 A;  2ZEG A;  2GU2 A;  2NYQ A;  8CPA A;  2OR4 A;  4LQ6 A;  4MCP A;  5AG5 A;  3T8W A;  4RS2 A;  3PBE A;  1C3O B;  1DTD A;  2CNS A;  4B11 A;  2C6G A;  1A2Z A;  2BCO A;  5H84 A;  1JDE A;  1XMT A;  1HEE A;  3CXP A;  4C2Z A;  3VTA A;  4OC3 A;  2HC9 A;  2PSW A;  1NE9 A;  4FD7 A;  3S6F A;  4CRZ B;  5CBM A;  1WWZ A;  2V8H A;  2Z3P A;  3KQX A;  4GS4 A;  4PPZ A;  2DF5 A;  2NSM A;  4MFP A;  2R8V A;  3NFZ A;  4A94 A;  5DWN A;  2I00 A;  5K8M A;  3CDX A;  3FB3 A;  2PVV A;  3BLN A;  4W9Y A;  5K99 A;  4R7M A;  3GYA A;  4JJX A;  3K9U A;  2VBQ A;  2ZW4 A;  4KOY A;  3B8G A;  2WPW A;  5EC4 A;  3I6S A;  1Y0Y A;  5AG6 A;  1ZG9 A;  4OC4 A;  5C88 A;  5JGF A;  2AFU A;  1KEE B;  4MXU A;  4NSQ A;  4C2X A;  3PP9 A;  1DIK A;  3TFY A;  2OZU A;  3B3T A;  1NBW A;  3R1K A;  3IO1 A;  2XEG A;  1CJW A;  4JD6 A;  4OC2 A;  5F49 A;  5F48 A;  5J1Q A;  4ORF A;  4KOU A;  4CGO A;  1ZYM A;  2Z11 A;  3PFO A;  4MHP A;  4Q38 A;  2ZW6 A;  2YJV A;  2CTB A;  4A31 A;  2PJ6 A;  2AFO A;  1EE3 P;  3B7I A;  3GLJ A;  3K2K A;  4MCQ A;  4NGR A;  3GY9 A;  4U9Z A;  4ZX8 A;  4MHN A;  4B14 A;  4H1H A;  3U1B A;  3N5F A;  4F9V A;  4PXB A;  3H8E A;  3JTK A;  5I4M A;  4Q36 A;  4XNH B;  4NGN A;  4RI1 A;  3TC8 A;  5EMI A;  2AJ6 A;  5E96 A;  3IIB A;  3VAR A;  2JEW A;  4AVA A;  4ZI6 A;  3H4Q A;  2F5I A;  2RC4 A;  1IOI A;  4UWJ A;  2ANP A;  4MJ8 A;  2I79 A;  4PK3 A;  4JVO A;  3PB4 X;  5IR2 A;  1UWY A;  2CNM A;  1HDQ A;  1ZG7 A;  4AG7 A;  1I1D A;  4OAD A;  2IL4 A;  3HLP A;  2GE3 A;  2Q4V A;  4P4F A;  2Q0Y A;  1M44 A;  4PK2 A;  4CPA A;  1M4I A;  3TCV A;  4CGP A;  4ONU A;  3SJE A;  3V38 A;  1AUG A;  3EXN A;  3PBB A;  1S3Z A;  3T05 A;  3TYX A;  1QSN A;  4LUA A;  2FE7 A;  4C8U A;  4MY3 A;  1QSR A;  2V8V A;  2J9A A;  1JQG A;  3IU1 A;  4NGQ A;  4BBH A;  1TF9 A;  3CPA A;  4HKF A;  4KSI A;  4MFQ A;  4OLL A;  3KI9 A;  2R7H A;  4QBJ A;  2VZY A;  4FD6 A;  2AE6 A;  3B3V A;  4IF5 A;  1N71 A;  2ZEO A;  4Q7A A;  1ARM A;  3C26 A;  4B5P B;  2AFX A;  2B58 A;  2PR1 A;  2ZED A;  3RYO A;  1R57 A;  1RTQ A;  3S9L A;  4KSA A;  5G22 A;  4P4I A;  4E5S A;  1M4L A;  4CRY B;  2PCN A;  4BD9 A;  1CP6 A;  3D2P A;  5BWA B;  2RB7 A;  1KZF A;  4H6U A;  3JVN A;  2PRB A;  2JEV A;  4OIW A;  3CZX A;  4JLY A;  1QST A;  4L8A A;  5AG7 A;  3V7Z A;  5F09 A;  2PQ8 A;  3ZZI A;  4ZYQ A;  4II9 A;  1FNO A;  1TXR A;  2D0P A;  1Z8T A;  4CGL A;  4C9A A;  4B5P A;  3BHX A;  2REE A;  1FT7 A;  4INJ A;  2WPX A;  2C5Q A;  4M6H A;  2PVW A;  2QVP A;  4K30 A;  4WJB A;  4ZY2 A;  2GLF A;  3GB0 A;  5HVG A;  3FF3 A;  3TTH A;  2PJ5 A;  4R3L A;  2ZEL A;  4M6G A;  3ZJ0 A;  1Q2D A;  3CT9 A;  4RN7 A;  2MP0 A;  3F0A A;  4MI4 A;  4CYP A;  4MCR A;  2ZW5 A;  3WC7 A;  4KUA A;  4NF1 A;  4NJQ A;  3WC6 A;  2Z3L A;  4RUH A;  2G3T A;  4L89 A;  1CG2 A;  7CPA A;  4TWE A;  2B3U A;  3D8P A;  4A2Z A;  4ZGY B;  1Z4E A;  3MRU A;  5G21 A;  2YNC A;  2V8D A;  5F1Y A;  3SI1 A;  2GAN A;  3FYN A;  1NMT A;  3PB9 X;  2EVN A;  2Z0Z A;  2J8N A;  2GRE A;  3IC1 A;  2HRO A;  2J8R A;  1BAV A;  2Q51 A;  1RO5 A;  4R57 A;  4C8A A;  2OZH A;  2OZG A;  2QML A;  3FMC A;  4P45 A;  5AGE A;  4Z65 A;  4BMH A;  4UIA A;  5JQ4 A;  3GUX A;  1ZLI A;  2PCU A;  2C27 A;  3FIX A;  1M1D A;  1Z8L A;  4UWI A;  2EZB A;  1AMP A;  2QIR A;  4R6T A;  2PRQ A;  3C8O A;  2B0A A;  4AB7 A;  2Z3K A;  3NA6 A;  4ONW A;  4KOR A;  3W6X A;  5I0C A;  4J3G A;  4KOX A;  4NCZ A;  4WWV A;  1IY7 A;  4CYN A;  1VI4 A;  2AFS A;  3P2H A;  4FD5 A;  4XPK A;  3EZA A;  3OWC A;  4E0A A;  3SJF A;  2IJZ A;  4OP4 A;  4AVC A;  1BPM A;  1JWQ A;  4Y49 B;  5IB9 A;  2ABZ A;  1VIX A;  2PJ4 A;  2WSA A;  4C9E A;  1S7F A;  4CAW A;  3I74 A;  1CS0 B;  3I1U A;  4YGO A;  3T90 A;  2R82 A;  4UCP A;  4COB A;  4MY0 A;  1L0C A;  2OOT A;  4KZT A;  2BO9 A;  1KWM A;  4C9V A;  4C9R A; 
#chains in the Genus database with same CATH homology
 4B6Z A;  4MCS A;  2WYR A;  1YME A;  1YW6 A;  4FWU A;  5K8P A;  2ZEP A;  2C6C A;  4K3N A;  2CF4 A;  2AFM A;  3FEC A;  3L2N A;  4O23 A;  2PIZ A;  2XEI A;  5LYF A;  2V77 A;  4P10 A;  1Z5R A;  1LAN A;  4MRI A;  4P4D A;  4DYO A;  2FVG A;  3BXM A;  3WC5 A;  1TKJ A;  3PB7 X;  2F7V A;  2G9D A;  2AFW A;  4YWY A;  4X2T A;  4TJX A;  2PJA A;  1IGB A;  3RZA A;  2CTC A;  2DEA A;  3RBU A;  4PXD A;  1LCP A;  3B3S A;  3ICU A;  4P44 A;  3KAS A;  3NH5 A;  4PQA A;  4C8P A;  4CDK A;  5LRJ A;  4GM5 A;  4CDJ A;  1CBX A;  1DE4 C;  1F57 A;  5ELY A;  1ZLH A;  2EK9 A;  4UEF A;  1WVM A;  2WZN A;  3PRT A;  1V6C A;  3HUV A;  1TKF A;  4A38 A;  1XF1 A;  4OC0 A;  4ZX9 A;  1BLL E;  3EIF A;  5DS0 A;  4NGP A;  5LRG A;  1XFO A;  2CIJ A;  3QNV A;  2PJC A;  4PXC A;  3D68 A;  5THW A;  3BI0 A;  4P4J A;  5D29 A;  2ZEM A;  4C85 A;  1VHE A;  2ZEF A;  3BI1 A;  4FAI A;  2C6P A;  1LAM A;  4TNU A;  2IMO A;  3S9N A;  2V8G A;  2PJ9 A;  4TJV A;  4C84 A;  3FED A;  1VGY A;  4R8F A;  2PJ7 A;  1XJO A;  3D66 A;  1Y7E A;  2PIY A;  4NGS A;  1ELL P;  4OC1 A;  2GLJ A;  3PFE A;  1CPS A;  1ZG8 A;  5LRK A;  3D7G A;  3CPX A;  1R3N A;  4C9U A;  3H8G A;  4YU9 A;  1ELM P;  2PJ3 A;  4MHY A;  1CP7 A;  3ISZ A;  4JZ0 A;  1Q7L A;  4NGM A;  5K8N A;  6CPA A;  1H8L A;  3KZW A;  4DUK A;  4P4E A;  3WAB A;  5HVH A;  2PJ2 A;  3B3C A;  1TKH A;  3PB6 X;  3NH8 A;  3FH4 A;  4ZY0 A;  3VAT A;  3KQZ A;  4R76 A;  4DJL A;  2EWB A;  3LMS A;  3FJU A;  4IHM A;  1PCA A;  2ZOG A;  3JRU A;  2EK8 A;  2C1C A;  4FUU A;  4C99 A;  2O53 A;  2HB6 A;  5HVF A;  4MHZ A;  4X8I A;  1GYT A;  5LYL A;  4F9U A;  3B3W A;  1F2P A;  4NFR A;  4LQG A;  1F2O A;  3KGQ A;  4OKO A;  4IAV A;  3D7F A;  3SJG A;  2ZOF A;  1YSJ A;  1YW4 A;  2VL1 A;  3B35 A;  3MN8 A;  3VH9 A;  3DGV A;  5JM6 A;  5K8O A;  1VHO A;  3IJ3 A;  1LFW A;  1QQ9 A;  3KHX A;  3SI0 A;  3SJX A;  2QJ8 A;  2ZEE A;  2F8H A;  3ISX A;  1AYE A;  2Q43 A;  4C8T A;  2Q4Z A;  1BPN A;  4C86 A;  1YLO A;  4EME A;  3KHZ A;  1ARL A;  3NH4 A;  1R43 A;  4P6Y A;  4PXE A;  4AXV A;  2PJB A;  4FBE A;  4X3R A;  2PJ0 A;  3K9T A;  1CX8 A;  5JH9 A;  2PJ1 A;  3D4U A;  4MMO A;  4NJR A;  4A39 A;  1HDU A;  4IK2 A;  4ZY1 A;  2JBJ A;  3B2Y A;  2JBK A;  4UIB A;  3IWW A;  4F8Z A;  1XBU A;  3PEI A;  1PYT B;  4NGT A;  4UEZ A;  1QMU A;  2GP4 A;  2O4H A;  2ZEN A;  4OID A;  1Y9Z A;  3LWU A;  3D7D A;  3RAM A;  4OME A;  3IFE A;  3TX8 A;  3KR4 A;  1XMB A;  5CPA A;  2XEJ A;  2PJ8 A;  1LOK A;  4JYW A;  2ZEH A;  1Z2L A;  3S9M A;  2AFZ A;  4A37 A;  3H8F A;  3FVL A;  3PB8 X;  3IEH A;  4OC5 A;  4UEE A;  4C8C A;  3FX6 A;  2BOA A;  4C8F A;  5LYD A;  5D8N A;  1CPX A;  2XEF A;  4P4B A;  4KNG E;  5HXD A;  3D7H A;  4H2K A;  2I3C A;  1XRY A;  3SI2 A;  3D67 A;  1OBR A;  3KL9 A;  2RFH A;  3KR5 A;  4UF4 A;  3WT4 A;  4YN3 A;  3FEE A;  2IQ6 A;  2PE3 A;  1TF8 A;  4G1P A;  2QYV A;  4EFD A;  2POK A;  3DLJ A;  5LYI A;  1LAP A;  1NSA A;  1Y0R A;  4EWT A;  2ZEG A;  2GU2 A;  2NYQ A;  2OR4 A;  4MCP A;  3T8W A;  3PBE A;  1DTD A;  2C6G A;  2BCO A;  1HEE A;  3VTA A;  4OC3 A;  2HC9 A;  5CBM A;  2V8H A;  3KQX A;  4PPZ A;  2NSM A;  3NFZ A;  4A94 A;  5K8M A;  3CDX A;  2PVV A;  4W9Y A;  4R7M A;  3I6S A;  1Y0Y A;  1ZG9 A;  4OC4 A;  5JGF A;  2AFU A;  4MXU A;  3B3T A;  3IO1 A;  2XEG A;  5J1Q A;  4OC2 A;  3PFO A;  4MHP A;  2CTB A;  2PJ6 A;  2AFO A;  1EE3 P;  3B7I A;  3GLJ A;  4NGR A;  3K2K A;  4MCQ A;  4ZX8 A;  4MHN A;  3N5F A;  4F9V A;  4PXB A;  3H8E A;  5I4M A;  4NGN A;  3TC8 A;  3IIB A;  3VAR A;  2JEW A;  4ZI6 A;  2ANP A;  3PB4 X;  5IR2 A;  1UWY A;  1HDQ A;  1ZG7 A;  3HLP A;  4P4F A;  4CPA A;  3V38 A;  3SJE A;  3PBB A;  4C8U A;  2V8V A;  2J9A A;  1JQG A;  4NGQ A;  1TF9 A;  3CPA A;  4KSI A;  3KI9 A;  3B3V A;  2ZEO A;  4Q7A A;  1ARM A;  2AFX A;  2ZED A;  1RTQ A;  3S9L A;  4P4I A;  1M4L A;  4BD9 A;  1CP6 A;  2RB7 A;  8CPA A;  4OIW A;  5F09 A;  3V7Z A;  4ZYQ A;  1FNO A;  1TXR A;  4C9A A;  3BHX A;  1FT7 A;  2C5Q A;  2PVW A;  2QVP A;  4WJB A;  4ZY2 A;  2GLF A;  3GB0 A;  5HVG A;  3FF3 A;  2PJ5 A;  2ZEL A;  3CT9 A;  4MCR A;  3WC7 A;  4NJQ A;  3WC6 A;  4RUH A;  1CG2 A;  7CPA A;  4TWE A;  3MRU A;  2V8D A;  3SI1 A;  3PB9 X;  2GRE A;  3IC1 A;  4C8A A;  1BAV A;  2Q51 A;  3FMC A;  4P45 A;  4Z65 A;  4UIA A;  3GUX A;  1ZLI A;  2PCU A;  1Z8L A;  1AMP A;  4R6T A;  2PRQ A;  3NA6 A;  4ONW A;  4WWV A;  1IY7 A;  2AFS A;  3SJF A;  2IJZ A;  4OP4 A;  1BPM A;  5IB9 A;  2ABZ A;  1VIX A;  2PJ4 A;  4C9E A;  3I74 A;  3I1U A;  2OOT A;  2BO9 A;  1KWM A;  4C9V A;  4C9R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...