4CDJA

Structure of znrf3 ectodomain
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
153
structure length
153
Chain Sequence
KETAFVEVVLFESSPSGDYTTHTTGLTGRFSRAGAMLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
publication title Structures of Wnt-Antagonist Znrf3 and its Complex with R-Spondin 1 and Implications for Signaling.
pubmed doi rcsb
source organism Mus musculus
total genus 40
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4cdjA00
3IIBA 2OR4A 4OC3A 4YN3A 4MCPA 4TJXA 2XEJA 4C84A 2XEFA 4JYWA 4X3RA 4C9UA 2EK8A 4C9RA 3S9LA 5ELYA 3SJEA 3RBUA 2XEGA 4C8CA 3FF3A 2C6CA 4C85A 4NGMA 1DE4C 4LQGA 4OC5A 4C8AA 4C8PA 1V6CA 2XEIA 3KASA 4JZ0A 4NGSA 4CDKA 4CDJA 4KNGE 3S9NA 4OC2A 2JBKA 3FEDA 3BXMA 2CIJA 4MCSA 4MCQA 2EK9A 3BHXA 4P4BA 4OMEA 4P4FA 4NGQA 2C6PA 4P4DA 3ICUA 4TJVA 4C9VA 3EIFA 1XF1A 4OC4A 4NGTA 3SJGA 4C86A 1Y9ZA 4TWEA 3SJFA 2C6GA 3FECA 4C8UA 3VTAA 5F09A 3D7HA 4NGRA 4W9YA 4NGNA 4P4EA 3BI1A 2PVWA 4P45A 3D7GA 4P4IA 4C9EA 3FEEA 4C99A 3D7FA 4P44A 1CX8A 4MCRA 4C8TA 3BI0A 5IB9A 3S9MA 2JBJA 4C9AA 2PVVA 4OC0A 3I74A 4NGPA 1WVMA 4P4JA 5D29A 3IWWA 4OC1A 1Z8LA 2OOTA 3I6SA 3SJXA 3D7DA 4C8FA
chains in the Genus database with same CATH superfamily
1JDBC 3IIBA 3TLGB 3TLYA 2GP4A 1NXJA 5K99A 2OR4A 4OC3A 4YN3A 4MCPA 3TLCA 1GGOA 3K9TA 4TJXA 2XEJA 4IIXA 4C84A 1ZYMA 2XEFA 4JYWA 4X3RA 1M6VB 4C9UA 2DIKA 2EK8A 1A9XB 4C9RA 1DIKA 3S9LA 3GJZA 1BXRB 5ELYA 3EZBA 3SJEA 3RBUA 2XEGA 2D0OA 4C8CA 2OLSA 4MJXA 4E94A 2EZBA 3FF3A 3K4IA 2C6CA 3TLAA 1KC7A 4C85A 4NGMA 1DE4C 1T36B 2E28A 3NOJA 4LQGA 4OC5A 4C8PA 4C8AA 1V6CA 4COGA 2XEIA 3KASA 5JVLA 3T05A 2B0AA 4JZ0A 5JYBA 4COBA 2C5QA 1EZAA 4IIYA 2MP0A 4NGSA 1VBGA 1VI4A 4J0NA 4CZ1A 4CDKA 1CE8B 5F9MA 4KNGE 1ZL0A 4CDJA 3S9NA 2HWGA 4OC2A 2JBKA 5F1YA 3FEDA 2FM4A 3BXMA 2CIJA 4MCSA 4MCQA 3TYXA 2EK9A 3BHXA 3TLEA 4P4BA 4OMEA 4P4FA 4NGQA 2C6PA 1ZRSA 3EZEA 3ICUA 4P4DA 4TJVA 5F5XA 4C9VA 3EIFA 2EZAA 4INJA 1XF1A 4OC4A 2PCNA 3T0TA 1R61A 4NGTA 4H1HA 1C3OB 3T07A 3SJGA 4C86A 5IR2A 3U1BA 1Y9ZA 4TWEA 2X0SA 4EYSA 5FD8A 2YJVA 3SJFA 2C6GA 3FECA 4C8UA 3VTAA 5F09A 3D7HA 1KBLA 4NGRA 4W9YA 4NGNA 4P4EA 3BI1A 2PVWA 4M8DA 4P45A 3D7GA 3TLZA 3KRVA 2HROA 4P4IA 1J3LA 3G23A 4E5SA 1CS0B 4C9EA 2YJTA 3FEEA 4C99A 3C8OA 3D7FA 4MI1A 2EZCA 2AUMA 2R82A 4P44A 1CX8A 1EZBA 4MCRA 4C8TA 3BI0A 3TLGA 4CO9A 1C30B 2AUNA 5IB9A 1KEEB 4JVOA 3S9MA 2JBJA 3EZAA 1VBHA 4C9AA 2PVVA 4OC0A 1Q5XA 3I74A 1NBWA 1WVMA 4NGPA 4P4JA 5D29A 3SR3A 1JDEA 3TLBA 3IWWA 4OC1A 1Z8LA 2OOTA 3I6SA 2HI6A 3D7DA 3SJXA 2D0PA 4C8FA 3T5MA
chains in the Genus database with same CATH topology
3IIBA 2GP4A 2OR4A 4OC3A 4YN3A 4MCPA 3K9TA 4TJXA 2XEJA 4C84A 2XEFA 4JYWA 4X3RA 4C9UA 2EK8A 4C9RA 3S9LA 5ELYA 3SJEA 3RBUA 2XEGA 4C8CA 3FF3A 2C6CA 4C85A 4NGMA 1DE4C 4LQGA 4OC5A 4C8AA 4C8PA 1V6CA 2XEIA 3KASA 4JZ0A 2C5QA 4NGSA 4CDKA 4CDJA 4KNGE 3S9NA 4OC2A 2JBKA 3FEDA 3BXMA 2CIJA 4MCSA 4MCQA 2EK9A 3BHXA 4P4BA 4OMEA 4P4FA 4NGQA 2C6PA 4P4DA 3ICUA 4TJVA 4C9VA 3EIFA 1XF1A 4OC4A 4NGTA 3SJGA 4C86A 5IR2A 1Y9ZA 4TWEA 3SJFA 2C6GA 3FECA 4C8UA 3VTAA 5F09A 3D7HA 4NGRA 4W9YA 4NGNA 4P4EA 3BI1A 2PVWA 4P45A 3D7GA 4P4IA 4C9EA 3FEEA 4C99A 3D7FA 4P44A 1CX8A 4MCRA 4C8TA 3BI0A 5IB9A 3S9MA 2JBJA 4C9AA 2PVVA 4OC0A 3I74A 4NGPA 1WVMA 4P4JA 5D29A 3IWWA 4OC1A 1Z8LA 2OOTA 3I6SA 3SJXA 3D7DA 4C8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IIB A;  2OR4 A;  4OC3 A;  4YN3 A;  4MCP A;  4TJX A;  2XEJ A;  4C84 A;  2XEF A;  4JYW A;  4X3R A;  4C9U A;  2EK8 A;  4C9R A;  3S9L A;  5ELY A;  3SJE A;  3RBU A;  2XEG A;  4C8C A;  3FF3 A;  2C6C A;  4C85 A;  4NGM A;  1DE4 C;  4LQG A;  4OC5 A;  4C8A A;  4C8P A;  1V6C A;  2XEI A;  3KAS A;  4JZ0 A;  4NGS A;  4CDK A;  4CDJ A;  4KNG E;  3S9N A;  4OC2 A;  2JBK A;  3FED A;  3BXM A;  2CIJ A;  4MCS A;  4MCQ A;  2EK9 A;  3BHX A;  4P4B A;  4OME A;  4P4F A;  4NGQ A;  2C6P A;  4P4D A;  3ICU A;  4TJV A;  4C9V A;  3EIF A;  1XF1 A;  4OC4 A;  4NGT A;  3SJG A;  4C86 A;  1Y9Z A;  4TWE A;  3SJF A;  2C6G A;  3FEC A;  4C8U A;  3VTA A;  5F09 A;  3D7H A;  4NGR A;  4W9Y A;  4NGN A;  4P4E A;  3BI1 A;  2PVW A;  4P45 A;  3D7G A;  4P4I A;  4C9E A;  3FEE A;  4C99 A;  3D7F A;  4P44 A;  1CX8 A;  4MCR A;  4C8T A;  3BI0 A;  5IB9 A;  3S9M A;  2JBJ A;  4C9A A;  2PVV A;  4OC0 A;  3I74 A;  4NGP A;  1WVM A;  4P4J A;  5D29 A;  3IWW A;  4OC1 A;  1Z8L A;  2OOT A;  3I6S A;  3SJX A;  3D7D A;  4C8F A; 
#chains in the Genus database with same CATH topology
 1JDB C;  3IIB A;  3TLG B;  3TLY A;  2GP4 A;  1NXJ A;  5K99 A;  2OR4 A;  4OC3 A;  4YN3 A;  4MCP A;  3TLC A;  1GGO A;  3K9T A;  4TJX A;  2XEJ A;  4IIX A;  4C84 A;  1ZYM A;  2XEF A;  4JYW A;  4X3R A;  1M6V B;  4C9U A;  2DIK A;  2EK8 A;  1A9X B;  4C9R A;  1DIK A;  3S9L A;  3GJZ A;  1BXR B;  5ELY A;  3EZB A;  3SJE A;  3RBU A;  2XEG A;  2D0O A;  4C8C A;  2OLS A;  4MJX A;  4E94 A;  2EZB A;  3FF3 A;  3K4I A;  2C6C A;  3TLA A;  1KC7 A;  4C85 A;  4NGM A;  1DE4 C;  1T36 B;  2E28 A;  3NOJ A;  4LQG A;  4OC5 A;  4C8P A;  4C8A A;  1V6C A;  4COG A;  2XEI A;  3KAS A;  5JVL A;  3T05 A;  2B0A A;  4JZ0 A;  5JYB A;  4COB A;  2C5Q A;  1EZA A;  4IIY A;  2MP0 A;  4NGS A;  1VBG A;  1VI4 A;  4J0N A;  4CZ1 A;  4CDK A;  1CE8 B;  5F9M A;  4KNG E;  1ZL0 A;  4CDJ A;  3S9N A;  2HWG A;  4OC2 A;  2JBK A;  5F1Y A;  3FED A;  2FM4 A;  3BXM A;  2CIJ A;  4MCS A;  4MCQ A;  3TYX A;  2EK9 A;  3BHX A;  3TLE A;  4P4B A;  4OME A;  4P4F A;  4NGQ A;  2C6P A;  1ZRS A;  3EZE A;  3ICU A;  4P4D A;  4TJV A;  5F5X A;  4C9V A;  3EIF A;  2EZA A;  4INJ A;  1XF1 A;  4OC4 A;  2PCN A;  3T0T A;  1R61 A;  4NGT A;  4H1H A;  1C3O B;  3T07 A;  3SJG A;  4C86 A;  5IR2 A;  3U1B A;  1Y9Z A;  4TWE A;  2X0S A;  4EYS A;  5FD8 A;  2YJV A;  3SJF A;  2C6G A;  3FEC A;  4C8U A;  3VTA A;  5F09 A;  3D7H A;  1KBL A;  4NGR A;  4W9Y A;  4NGN A;  4P4E A;  3BI1 A;  2PVW A;  4M8D A;  4P45 A;  3D7G A;  3TLZ A;  3KRV A;  2HRO A;  4P4I A;  1J3L A;  3G23 A;  4E5S A;  1CS0 B;  4C9E A;  2YJT A;  3FEE A;  4C99 A;  3C8O A;  3D7F A;  4MI1 A;  2EZC A;  2AUM A;  2R82 A;  4P44 A;  1CX8 A;  1EZB A;  4MCR A;  4C8T A;  3BI0 A;  3TLG A;  4CO9 A;  1C30 B;  2AUN A;  5IB9 A;  1KEE B;  4JVO A;  3S9M A;  2JBJ A;  3EZA A;  1VBH A;  4C9A A;  2PVV A;  4OC0 A;  1Q5X A;  3I74 A;  1NBW A;  1WVM A;  4NGP A;  4P4J A;  5D29 A;  3SR3 A;  1JDE A;  3TLB A;  3IWW A;  4OC1 A;  1Z8L A;  2OOT A;  3I6S A;  2HI6 A;  3D7D A;  3SJX A;  2D0P A;  4C8F A;  3T5M A; 
#chains in the Genus database with same CATH homology
 3IIB A;  2GP4 A;  2OR4 A;  4OC3 A;  4YN3 A;  4MCP A;  3K9T A;  4TJX A;  2XEJ A;  4C84 A;  2XEF A;  4JYW A;  4X3R A;  4C9U A;  2EK8 A;  4C9R A;  3S9L A;  5ELY A;  3SJE A;  3RBU A;  2XEG A;  4C8C A;  3FF3 A;  2C6C A;  4C85 A;  4NGM A;  1DE4 C;  4LQG A;  4OC5 A;  4C8A A;  4C8P A;  1V6C A;  2XEI A;  3KAS A;  4JZ0 A;  2C5Q A;  4NGS A;  4CDK A;  4CDJ A;  4KNG E;  3S9N A;  4OC2 A;  2JBK A;  3FED A;  3BXM A;  2CIJ A;  4MCS A;  4MCQ A;  2EK9 A;  3BHX A;  4P4B A;  4OME A;  4P4F A;  4NGQ A;  2C6P A;  4P4D A;  3ICU A;  4TJV A;  4C9V A;  3EIF A;  1XF1 A;  4OC4 A;  4NGT A;  3SJG A;  4C86 A;  5IR2 A;  1Y9Z A;  4TWE A;  3SJF A;  2C6G A;  3FEC A;  4C8U A;  3VTA A;  5F09 A;  3D7H A;  4NGR A;  4W9Y A;  4NGN A;  4P4E A;  3BI1 A;  2PVW A;  4P45 A;  3D7G A;  4P4I A;  4C9E A;  3FEE A;  4C99 A;  3D7F A;  4P44 A;  1CX8 A;  4MCR A;  4C8T A;  3BI0 A;  5IB9 A;  3S9M A;  2JBJ A;  4C9A A;  2PVV A;  4OC0 A;  3I74 A;  4NGP A;  1WVM A;  4P4J A;  5D29 A;  3IWW A;  4OC1 A;  1Z8L A;  2OOT A;  3I6S A;  3SJX A;  3D7D A;  4C8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...