4CDJA

Structure of znrf3 ectodomain
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
153
structure length
153
Chain Sequence
KETAFVEVVLFESSPSGDYTTHTTGLTGRFSRAGAMLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Wnt-Antagonist Znrf3 and its Complex with R-Spondin 1 and Implications for Signaling.
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
total genus 40
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4cdjA00
4TJXA 2XEIA 4P45A 4C9RA 4P44A 5IB9A 3BHXA 3SJXA 2EK9A 4NGNA 4OC0A 4C8CA 4C9AA 3IIBA 3EIFA 4C9VA 4C8UA 4X3RA 4NGMA 3D7FA 1CX8A 4P4EA 4OC2A 4P4JA 4MCSA 3RBUA 4JYWA 4P4FA 4TJVA 1WVMA 2PVVA 1V6CA 2EK8A 5F09A 2XEGA 2JBKA 4KNGE 4CDKA 3SJFA 3S9MA 4NGTA 4C85A 4OC4A 4C8TA 4C9EA 4OC3A 2OR4A 2C6PA 4MCPA 3S9NA 3I6SA 3D7HA 4MCRA 2XEJA 3FEDA 3FEEA 4C99A 3I74A 3BI1A 4P4DA 3S9LA 4C86A 3D7DA 2CIJA 4P4IA 4C8PA 4NGSA 3KASA 2C6CA 3SJGA 4OC5A 4OMEA 3VTAA 5D29A 2OOTA 5ELYA 2C6GA 4YN3A 4C9UA 4C8AA 4W9YA 4NGPA 3FECA 3SJEA 4CDJA 2XEFA 4P4BA 4JZ0A 3IWWA 4MCQA 4OC1A 4NGRA 1DE4C 4TWEA 1XF1A 4LQGA 1Y9ZA 4NGQA 2PVWA 3BXMA 3ICUA 1Z8LA 4C8FA 4C84A 2JBJA 3FF3A 3D7GA 3BI0A
chains in the Genus database with same CATH superfamily
3G23A 4TJXA 2R82A 2PCNA 2XEIA 1M6VB 4P45A 1Q5XA 2C5QA 2YJVA 4P44A 4C9RA 5IB9A 1J3LA 3BHXA 3SJXA 1JDEA 4INJA 4CO9A 3K4IA 2EK9A 1T36B 1VBGA 4NGNA 4OC0A 4C8CA 4C9AA 3U1BA 1VBHA 4CZ1A 3IIBA 3EIFA 2B0AA 4C8UA 2AUMA 4X3RA 5F9MA 4IIYA 4NGMA 1NBWA 3D7FA 3TLGA 3TLYA 1CX8A 4P4EA 4OC2A 1KC7A 1EZAA 1GGOA 4P4JA 4MCSA 3RBUA 1JDBC 5FD8A 4JYWA 5JVLA 2OLSA 3EZBA 3KRVA 4P4FA 4TJVA 1WVMA 2D0PA 3TLGB 2YJTA 2PVVA 2X0SA 1R61A 5F1YA 3TYXA 1V6CA 2EK8A 1C30B 2EZCA 1DIKA 2E28A 5F09A 2XEGA 2JBKA 2HI6A 4KNGE 2HROA 4IIXA 4CDKA 3SJFA 3C8OA 4MI1A 4NGTA 3S9MA 4C85A 4OC4A 4C8TA 4C9EA 4OC3A 2AUNA 2OR4A 2C6PA 4MCPA 4E94A 3S9NA 3SR3A 3I6SA 5IR2A 1A9XB 3D7HA 4MCRA 2XEJA 3TLCA 2DIKA 3TLEA 3FEDA 3TLAA 3FEEA 4C99A 3TLBA 2D0OA 3I74A 3BI1A 4P4DA 1KBLA 3S9LA 4C86A 3T5MA 1C3OB 3D7DA 1ZYMA 2CIJA 1KEEB 5K99A 3T05A 4P4IA 4C8PA 4NGSA 3KASA 2C6CA 3SJGA 4MJXA 4OC5A 4COBA 2EZBA 4OMEA 3VTAA 5JYBA 5D29A 2OOTA 3K9TA 1ZL0A 2C6GA 5ELYA 2HWGA 2MP0A 4YN3A 4C9UA 4C8AA 4W9YA 4NGPA 4JVOA 3FECA 3SJEA 3GJZA 3T07A 3T0TA 2EZAA 4CDJA 1CS0B 2XEFA 3TLZA 4P4BA 1NXJA 5F5XA 4JZ0A 4M8DA 3IWWA 4MCQA 3EZEA 4OC1A 2FM4A 4NGRA 1DE4C 4TWEA 1ZRSA 1XF1A 4LQGA 1Y9ZA 4NGQA 4E5SA 2PVWA 4H1HA 2GP4A 4COGA 3BXMA 4EYSA 3ICUA 1Z8LA 4C8FA 3NOJA 4C84A 3EZAA 1BXRB 4J0NA 1EZBA 2JBJA 1CE8B 1VI4A 3FF3A 4C9VA 3D7GA 3BI0A
chains in the Genus database with same CATH topology
4TJXA 2XEIA 4P45A 2C5QA 4C9RA 4P44A 5IB9A 3BHXA 3SJXA 2EK9A 4NGNA 4OC0A 4C8CA 4C9AA 3IIBA 3EIFA 4C9VA 4C8UA 4X3RA 4NGMA 3D7FA 1CX8A 4P4EA 4OC2A 4P4JA 4MCSA 3RBUA 4JYWA 4P4FA 4TJVA 1WVMA 2PVVA 1V6CA 2EK8A 5F09A 2XEGA 2JBKA 4KNGE 4CDKA 3SJFA 3S9MA 4NGTA 4C85A 4OC4A 4C8TA 4C9EA 4OC3A 2OR4A 2C6PA 4MCPA 3S9NA 3I6SA 5IR2A 3D7HA 4MCRA 2XEJA 3FEDA 3FEEA 4C99A 3I74A 3BI1A 4P4DA 3S9LA 4C86A 3D7DA 2CIJA 4P4IA 4C8PA 4NGSA 3KASA 2C6CA 3SJGA 4OC5A 4OMEA 3VTAA 5D29A 2OOTA 3K9TA 5ELYA 2C6GA 4YN3A 4C9UA 4C8AA 4W9YA 4NGPA 3FECA 3SJEA 4CDJA 2XEFA 4P4BA 4JZ0A 3IWWA 4MCQA 4OC1A 4NGRA 1DE4C 4TWEA 1XF1A 4LQGA 1Y9ZA 4NGQA 2PVWA 2GP4A 3BXMA 3ICUA 1Z8LA 4C8FA 4C84A 2JBJA 3FF3A 3D7GA 3BI0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TJX A;  2XEI A;  4P45 A;  4C9R A;  4P44 A;  5IB9 A;  3BHX A;  3SJX A;  2EK9 A;  4NGN A;  4OC0 A;  4C8C A;  4C9A A;  3IIB A;  3EIF A;  4C9V A;  4C8U A;  4X3R A;  4NGM A;  3D7F A;  1CX8 A;  4P4E A;  4OC2 A;  4P4J A;  4MCS A;  3RBU A;  4JYW A;  4P4F A;  4TJV A;  1WVM A;  2PVV A;  1V6C A;  2EK8 A;  5F09 A;  2XEG A;  2JBK A;  4KNG E;  4CDK A;  3SJF A;  3S9M A;  4NGT A;  4C85 A;  4OC4 A;  4C8T A;  4C9E A;  4OC3 A;  2OR4 A;  2C6P A;  4MCP A;  3S9N A;  3I6S A;  3D7H A;  4MCR A;  2XEJ A;  3FED A;  3FEE A;  4C99 A;  3I74 A;  3BI1 A;  4P4D A;  3S9L A;  4C86 A;  3D7D A;  2CIJ A;  4P4I A;  4C8P A;  4NGS A;  3KAS A;  2C6C A;  3SJG A;  4OC5 A;  4OME A;  3VTA A;  5D29 A;  2OOT A;  5ELY A;  2C6G A;  4YN3 A;  4C9U A;  4C8A A;  4W9Y A;  4NGP A;  3FEC A;  3SJE A;  4CDJ A;  2XEF A;  4P4B A;  4JZ0 A;  3IWW A;  4MCQ A;  4OC1 A;  4NGR A;  1DE4 C;  4TWE A;  1XF1 A;  4LQG A;  1Y9Z A;  4NGQ A;  2PVW A;  3BXM A;  3ICU A;  1Z8L A;  4C8F A;  4C84 A;  2JBJ A;  3FF3 A;  3D7G A;  3BI0 A; 
#chains in the Genus database with same CATH topology
 3G23 A;  4TJX A;  2R82 A;  2PCN A;  2XEI A;  1M6V B;  4P45 A;  1Q5X A;  2C5Q A;  2YJV A;  4P44 A;  4C9R A;  5IB9 A;  1J3L A;  3BHX A;  3SJX A;  1JDE A;  4INJ A;  4CO9 A;  3K4I A;  2EK9 A;  1T36 B;  1VBG A;  4NGN A;  4OC0 A;  4C8C A;  4C9A A;  3U1B A;  1VBH A;  4CZ1 A;  3IIB A;  3EIF A;  2B0A A;  4C8U A;  2AUM A;  4X3R A;  5F9M A;  4IIY A;  4NGM A;  1NBW A;  3D7F A;  3TLG A;  3TLY A;  1CX8 A;  4P4E A;  4OC2 A;  1KC7 A;  1EZA A;  1GGO A;  4P4J A;  4MCS A;  3RBU A;  1JDB C;  5FD8 A;  4JYW A;  5JVL A;  2OLS A;  3EZB A;  3KRV A;  4P4F A;  4TJV A;  1WVM A;  2D0P A;  3TLG B;  2YJT A;  2PVV A;  2X0S A;  1R61 A;  5F1Y A;  3TYX A;  1V6C A;  2EK8 A;  1C30 B;  2EZC A;  1DIK A;  2E28 A;  5F09 A;  2XEG A;  2JBK A;  2HI6 A;  4KNG E;  2HRO A;  4IIX A;  4CDK A;  3SJF A;  3C8O A;  4MI1 A;  4NGT A;  3S9M A;  4C85 A;  4OC4 A;  4C8T A;  4C9E A;  4OC3 A;  2AUN A;  2OR4 A;  2C6P A;  4MCP A;  4E94 A;  3S9N A;  3SR3 A;  3I6S A;  5IR2 A;  1A9X B;  3D7H A;  4MCR A;  2XEJ A;  3TLC A;  2DIK A;  3TLE A;  3FED A;  3TLA A;  3FEE A;  4C99 A;  3TLB A;  2D0O A;  3I74 A;  3BI1 A;  4P4D A;  1KBL A;  3S9L A;  4C86 A;  3T5M A;  1C3O B;  3D7D A;  1ZYM A;  2CIJ A;  1KEE B;  5K99 A;  3T05 A;  4P4I A;  4C8P A;  4NGS A;  3KAS A;  2C6C A;  3SJG A;  4MJX A;  4OC5 A;  4COB A;  2EZB A;  4OME A;  3VTA A;  5JYB A;  5D29 A;  2OOT A;  3K9T A;  1ZL0 A;  2C6G A;  5ELY A;  2HWG A;  2MP0 A;  4YN3 A;  4C9U A;  4C8A A;  4W9Y A;  4NGP A;  4JVO A;  3FEC A;  3SJE A;  3GJZ A;  3T07 A;  3T0T A;  2EZA A;  4CDJ A;  1CS0 B;  2XEF A;  3TLZ A;  4P4B A;  1NXJ A;  5F5X A;  4JZ0 A;  4M8D A;  3IWW A;  4MCQ A;  3EZE A;  4OC1 A;  2FM4 A;  4NGR A;  1DE4 C;  4TWE A;  1ZRS A;  1XF1 A;  4LQG A;  1Y9Z A;  4NGQ A;  4E5S A;  2PVW A;  4H1H A;  2GP4 A;  4COG A;  3BXM A;  4EYS A;  3ICU A;  1Z8L A;  4C8F A;  3NOJ A;  4C84 A;  3EZA A;  1BXR B;  4J0N A;  1EZB A;  2JBJ A;  1CE8 B;  1VI4 A;  3FF3 A;  4C9V A;  3D7G A;  3BI0 A; 
#chains in the Genus database with same CATH homology
 4TJX A;  2XEI A;  4P45 A;  2C5Q A;  4C9R A;  4P44 A;  5IB9 A;  3BHX A;  3SJX A;  2EK9 A;  4NGN A;  4OC0 A;  4C8C A;  4C9A A;  3IIB A;  3EIF A;  4C9V A;  4C8U A;  4X3R A;  4NGM A;  3D7F A;  1CX8 A;  4P4E A;  4OC2 A;  4P4J A;  4MCS A;  3RBU A;  4JYW A;  4P4F A;  4TJV A;  1WVM A;  2PVV A;  1V6C A;  2EK8 A;  5F09 A;  2XEG A;  2JBK A;  4KNG E;  4CDK A;  3SJF A;  3S9M A;  4NGT A;  4C85 A;  4OC4 A;  4C8T A;  4C9E A;  4OC3 A;  2OR4 A;  2C6P A;  4MCP A;  3S9N A;  3I6S A;  5IR2 A;  3D7H A;  4MCR A;  2XEJ A;  3FED A;  3FEE A;  4C99 A;  3I74 A;  3BI1 A;  4P4D A;  3S9L A;  4C86 A;  3D7D A;  2CIJ A;  4P4I A;  4C8P A;  4NGS A;  3KAS A;  2C6C A;  3SJG A;  4OC5 A;  4OME A;  3VTA A;  5D29 A;  2OOT A;  3K9T A;  5ELY A;  2C6G A;  4YN3 A;  4C9U A;  4C8A A;  4W9Y A;  4NGP A;  3FEC A;  3SJE A;  4CDJ A;  2XEF A;  4P4B A;  4JZ0 A;  3IWW A;  4MCQ A;  4OC1 A;  4NGR A;  1DE4 C;  4TWE A;  1XF1 A;  4LQG A;  1Y9Z A;  4NGQ A;  2PVW A;  2GP4 A;  3BXM A;  3ICU A;  1Z8L A;  4C8F A;  4C84 A;  2JBJ A;  3FF3 A;  3D7G A;  3BI0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...