4CDJA

Structure of znrf3 ectodomain
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
153
structure length
153
Chain Sequence
KETAFVEVVLFESSPSGDYTTHTTGLTGRFSRAGAMLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Wnt-Antagonist Znrf3 and its Complex with R-Spondin 1 and Implications for Signaling.
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
total genus 40
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4cdjA00
3D7HA 2C6PA 2XEGA 2XEJA 2PVVA 3SJXA 2JBJA 4MCQA 4NGTA 4P45A 4C9VA 3I6SA 4P4JA 3S9MA 4TWEA 4C8AA 2XEIA 4OC1A 4NGQA 4C8CA 1WVMA 4NGNA 4OC0A 1CX8A 3FF3A 4CDKA 4CDJA 4OMEA 2C6GA 4NGPA 4NGSA 4W9YA 3BXMA 5F09A 5ELYA 4MCRA 4OC3A 3S9LA 4OC5A 3FECA 3KASA 3BI1A 2XEFA 3EIFA 4C86A 2OOTA 3D7GA 1Z8LA 4LQGA 4C8PA 4TJXA 2EK9A 3D7FA 1DE4C 4P4DA 4MCPA 1XF1A 4C99A 3SJEA 5IB9A 3FEEA 5D29A 3ICUA 1Y9ZA 4YN3A 3SJGA 3D7DA 4C9RA 2EK8A 4OC4A 3VTAA 3SJFA 2CIJA 4JZ0A 4P4BA 2OR4A 4C9EA 4C8UA 3IWWA 4P4IA 2C6CA 4MCSA 4P44A 3RBUA 4C84A 3I74A 4OC2A 3S9NA 3BHXA 3BI0A 4NGMA 4JYWA 2JBKA 4C8TA 3IIBA 4C8FA 4C9UA 4C9AA 4KNGE 4P4FA 4NGRA 4TJVA 1V6CA 2PVWA 4C85A 4P4EA 3FEDA 4X3RA
chains in the Genus database with same CATH superfamily
4M8DA 1C3OB 1JDBC 3SR3A 3D7HA 3C8OA 2AUNA 5F5XA 1A9XB 3EZAA 2C6PA 2XEGA 2XEJA 2PVVA 3SJXA 2JBJA 4MCQA 4NGTA 4P45A 4C9VA 3I6SA 1Q5XA 4P4JA 3S9MA 4TWEA 4C8AA 2HI6A 2D0OA 1NXJA 4CZ1A 5F9MA 2XEIA 5JYBA 4OC1A 3K9TA 2DIKA 4NGQA 4C8CA 4CO9A 1WVMA 1J3LA 4NGNA 3TLYA 4JVOA 4OC0A 1JDEA 1CX8A 4MI1A 3FF3A 4CDKA 4CDJA 1EZAA 4OMEA 2C6GA 4NGPA 5F1YA 4NGSA 4W9YA 3BXMA 5K99A 1NBWA 1EZBA 3TLEA 5F09A 4EYSA 3G23A 5ELYA 2YJVA 4MCRA 2HROA 2OLSA 4OC3A 5IR2A 3S9LA 2EZCA 1M6VB 1R61A 4OC5A 3FECA 3KASA 3BI1A 2XEFA 3EIFA 3TLAA 4C86A 2OOTA 3D7GA 1ZRSA 1Z8LA 2MP0A 1KC7A 1BXRB 4LQGA 4J0NA 3T07A 4C8PA 4TJXA 2EK9A 3D7FA 4IIXA 1DE4C 2E28A 4P4DA 3TLCA 3TLGA 4MCPA 4COBA 3U1BA 1ZYMA 1XF1A 4H1HA 4C99A 3SJEA 5IB9A 2EZBA 2GP4A 3FEEA 1KEEB 5D29A 1T36B 3K4IA 5JVLA 3ICUA 2X0SA 1Y9ZA 2EZAA 4YN3A 1VI4A 3TYXA 3TLGB 3T05A 3SJGA 3D7DA 2C5QA 4C9RA 3NOJA 2EK8A 1GGOA 4OC4A 4E94A 3VTAA 2AUMA 2R82A 3EZEA 3SJFA 1CS0B 2CIJA 2D0PA 4JZ0A 4P4BA 2B0AA 2OR4A 1DIKA 4C9EA 3KRVA 3TLBA 3IWWA 4C8UA 2HWGA 3GJZA 2FM4A 1VBHA 2C6CA 4P4IA 4MCSA 5FD8A 4P44A 3T0TA 3TLZA 3RBUA 4C84A 3I74A 4OC2A 3S9NA 1ZL0A 3BHXA 3BI0A 4NGMA 4MJXA 4JYWA 2JBKA 3EZBA 4IIYA 4C8TA 3IIBA 4C8FA 4C9UA 3T5MA 4C9AA 4KNGE 4P4FA 1VBGA 2PCNA 4NGRA 4TJVA 1KBLA 1V6CA 2PVWA 4C85A 4E5SA 4INJA 2YJTA 4P4EA 1CE8B 1C30B 4COGA 3FEDA 4X3RA
chains in the Genus database with same CATH topology
3D7HA 2C6PA 2XEGA 2XEJA 2PVVA 3SJXA 2JBJA 4MCQA 4NGTA 4P45A 4C9VA 3I6SA 4P4JA 3S9MA 4TWEA 4C8AA 2XEIA 4OC1A 3K9TA 4NGQA 4C8CA 1WVMA 4NGNA 4OC0A 1CX8A 3FF3A 4CDKA 4CDJA 4OMEA 2C6GA 4NGPA 4NGSA 4W9YA 3BXMA 5F09A 5ELYA 4MCRA 4OC3A 5IR2A 3S9LA 4OC5A 3FECA 3KASA 3BI1A 2XEFA 3EIFA 4C86A 2OOTA 3D7GA 1Z8LA 4LQGA 4C8PA 4TJXA 2EK9A 3D7FA 1DE4C 4P4DA 4MCPA 1XF1A 4C99A 3SJEA 5IB9A 2GP4A 3FEEA 5D29A 3ICUA 1Y9ZA 4YN3A 3SJGA 3D7DA 2C5QA 4C9RA 2EK8A 4OC4A 3VTAA 3SJFA 2CIJA 4JZ0A 4P4BA 2OR4A 4C9EA 4C8UA 3IWWA 4P4IA 2C6CA 4MCSA 4P44A 3RBUA 4C84A 3I74A 4OC2A 3S9NA 3BHXA 3BI0A 4NGMA 4JYWA 2JBKA 4C8TA 3IIBA 4C8FA 4C9UA 4C9AA 4KNGE 4P4FA 4NGRA 4TJVA 1V6CA 2PVWA 4C85A 4P4EA 3FEDA 4X3RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D7H A;  2C6P A;  2XEG A;  2XEJ A;  2PVV A;  3SJX A;  2JBJ A;  4MCQ A;  4NGT A;  4P45 A;  4C9V A;  3I6S A;  4P4J A;  3S9M A;  4TWE A;  4C8A A;  2XEI A;  4OC1 A;  4NGQ A;  4C8C A;  1WVM A;  4NGN A;  4OC0 A;  1CX8 A;  3FF3 A;  4CDK A;  4CDJ A;  4OME A;  2C6G A;  4NGP A;  4NGS A;  4W9Y A;  3BXM A;  5F09 A;  5ELY A;  4MCR A;  4OC3 A;  3S9L A;  4OC5 A;  3FEC A;  3KAS A;  3BI1 A;  2XEF A;  3EIF A;  4C86 A;  2OOT A;  3D7G A;  1Z8L A;  4LQG A;  4C8P A;  4TJX A;  2EK9 A;  3D7F A;  1DE4 C;  4P4D A;  4MCP A;  1XF1 A;  4C99 A;  3SJE A;  5IB9 A;  3FEE A;  5D29 A;  3ICU A;  1Y9Z A;  4YN3 A;  3SJG A;  3D7D A;  4C9R A;  2EK8 A;  4OC4 A;  3VTA A;  3SJF A;  2CIJ A;  4JZ0 A;  4P4B A;  2OR4 A;  4C9E A;  4C8U A;  3IWW A;  4P4I A;  2C6C A;  4MCS A;  4P44 A;  3RBU A;  4C84 A;  3I74 A;  4OC2 A;  3S9N A;  3BHX A;  3BI0 A;  4NGM A;  4JYW A;  2JBK A;  4C8T A;  3IIB A;  4C8F A;  4C9U A;  4C9A A;  4KNG E;  4P4F A;  4NGR A;  4TJV A;  1V6C A;  2PVW A;  4C85 A;  4P4E A;  3FED A;  4X3R A; 
#chains in the Genus database with same CATH topology
 4M8D A;  1C3O B;  1JDB C;  3SR3 A;  3D7H A;  3C8O A;  2AUN A;  5F5X A;  1A9X B;  3EZA A;  2C6P A;  2XEG A;  2XEJ A;  2PVV A;  3SJX A;  2JBJ A;  4MCQ A;  4NGT A;  4P45 A;  4C9V A;  3I6S A;  1Q5X A;  4P4J A;  3S9M A;  4TWE A;  4C8A A;  2HI6 A;  2D0O A;  1NXJ A;  4CZ1 A;  5F9M A;  2XEI A;  5JYB A;  4OC1 A;  3K9T A;  2DIK A;  4NGQ A;  4C8C A;  4CO9 A;  1WVM A;  1J3L A;  4NGN A;  3TLY A;  4JVO A;  4OC0 A;  1JDE A;  1CX8 A;  4MI1 A;  3FF3 A;  4CDK A;  4CDJ A;  1EZA A;  4OME A;  2C6G A;  4NGP A;  5F1Y A;  4NGS A;  4W9Y A;  3BXM A;  5K99 A;  1NBW A;  1EZB A;  3TLE A;  5F09 A;  4EYS A;  3G23 A;  5ELY A;  2YJV A;  4MCR A;  2HRO A;  2OLS A;  4OC3 A;  5IR2 A;  3S9L A;  2EZC A;  1M6V B;  1R61 A;  4OC5 A;  3FEC A;  3KAS A;  3BI1 A;  2XEF A;  3EIF A;  3TLA A;  4C86 A;  2OOT A;  3D7G A;  1ZRS A;  1Z8L A;  2MP0 A;  1KC7 A;  1BXR B;  4LQG A;  4J0N A;  3T07 A;  4C8P A;  4TJX A;  2EK9 A;  3D7F A;  4IIX A;  1DE4 C;  2E28 A;  4P4D A;  3TLC A;  3TLG A;  4MCP A;  4COB A;  3U1B A;  1ZYM A;  1XF1 A;  4H1H A;  4C99 A;  3SJE A;  5IB9 A;  2EZB A;  2GP4 A;  3FEE A;  1KEE B;  5D29 A;  1T36 B;  3K4I A;  5JVL A;  3ICU A;  2X0S A;  1Y9Z A;  2EZA A;  4YN3 A;  1VI4 A;  3TYX A;  3TLG B;  3T05 A;  3SJG A;  3D7D A;  2C5Q A;  4C9R A;  3NOJ A;  2EK8 A;  1GGO A;  4OC4 A;  4E94 A;  3VTA A;  2AUM A;  2R82 A;  3EZE A;  3SJF A;  1CS0 B;  2CIJ A;  2D0P A;  4JZ0 A;  4P4B A;  2B0A A;  2OR4 A;  1DIK A;  4C9E A;  3KRV A;  3TLB A;  3IWW A;  4C8U A;  2HWG A;  3GJZ A;  2FM4 A;  1VBH A;  2C6C A;  4P4I A;  4MCS A;  5FD8 A;  4P44 A;  3T0T A;  3TLZ A;  3RBU A;  4C84 A;  3I74 A;  4OC2 A;  3S9N A;  1ZL0 A;  3BHX A;  3BI0 A;  4NGM A;  4MJX A;  4JYW A;  2JBK A;  3EZB A;  4IIY A;  4C8T A;  3IIB A;  4C8F A;  4C9U A;  3T5M A;  4C9A A;  4KNG E;  4P4F A;  1VBG A;  2PCN A;  4NGR A;  4TJV A;  1KBL A;  1V6C A;  2PVW A;  4C85 A;  4E5S A;  4INJ A;  2YJT A;  4P4E A;  1CE8 B;  1C30 B;  4COG A;  3FED A;  4X3R A; 
#chains in the Genus database with same CATH homology
 3D7H A;  2C6P A;  2XEG A;  2XEJ A;  2PVV A;  3SJX A;  2JBJ A;  4MCQ A;  4NGT A;  4P45 A;  4C9V A;  3I6S A;  4P4J A;  3S9M A;  4TWE A;  4C8A A;  2XEI A;  4OC1 A;  3K9T A;  4NGQ A;  4C8C A;  1WVM A;  4NGN A;  4OC0 A;  1CX8 A;  3FF3 A;  4CDK A;  4CDJ A;  4OME A;  2C6G A;  4NGP A;  4NGS A;  4W9Y A;  3BXM A;  5F09 A;  5ELY A;  4MCR A;  4OC3 A;  5IR2 A;  3S9L A;  4OC5 A;  3FEC A;  3KAS A;  3BI1 A;  2XEF A;  3EIF A;  4C86 A;  2OOT A;  3D7G A;  1Z8L A;  4LQG A;  4C8P A;  4TJX A;  2EK9 A;  3D7F A;  1DE4 C;  4P4D A;  4MCP A;  1XF1 A;  4C99 A;  3SJE A;  5IB9 A;  2GP4 A;  3FEE A;  5D29 A;  3ICU A;  1Y9Z A;  4YN3 A;  3SJG A;  3D7D A;  2C5Q A;  4C9R A;  2EK8 A;  4OC4 A;  3VTA A;  3SJF A;  2CIJ A;  4JZ0 A;  4P4B A;  2OR4 A;  4C9E A;  4C8U A;  3IWW A;  4P4I A;  2C6C A;  4MCS A;  4P44 A;  3RBU A;  4C84 A;  3I74 A;  4OC2 A;  3S9N A;  3BHX A;  3BI0 A;  4NGM A;  4JYW A;  2JBK A;  4C8T A;  3IIB A;  4C8F A;  4C9U A;  4C9A A;  4KNG E;  4P4F A;  4NGR A;  4TJV A;  1V6C A;  2PVW A;  4C85 A;  4P4E A;  3FED A;  4X3R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...