4CDJA

Structure of znrf3 ectodomain
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
153
structure length
153
Chain Sequence
KETAFVEVVLFESSPSGDYTTHTTGLTGRFSRAGAMLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
publication title Structures of Wnt-Antagonist Znrf3 and its Complex with R-Spondin 1 and Implications for Signaling.
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
total genus 40
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4cdjA00
3BHXA 1CX8A 2XEGA 4MCSA 4C9RA 2JBJA 1Z8LA 4OMEA 1XF1A 3IIBA 4KNGE 3SJEA 4OC2A 4NGTA 1DE4C 3BI0A 5ELYA 4C8AA 4C8TA 3SJXA 3SJFA 4CDJA 4C8UA 3FEDA 2PVVA 4C86A 4NGNA 2OOTA 3BI1A 4P4DA 3KASA 4NGQA 4JZ0A 4OC1A 4X3RA 2EK9A 4CDKA 4TWEA 4C9UA 5IB9A 3SJGA 4C9VA 3FEEA 4NGRA 4C9EA 3S9MA 4P4FA 4LQGA 2C6GA 3D7HA 3D7GA 4OC4A 4OC3A 4C99A 3I74A 4P44A 2XEFA 4P4JA 4C8FA 4C85A 4P4IA 4OC5A 2EK8A 4TJVA 2JBKA 4NGSA 3BXMA 1Y9ZA 2CIJA 4MCPA 2OR4A 4YN3A 4MCRA 2C6PA 2PVWA 3S9NA 2XEIA 3EIFA 4P4BA 5D29A 3VTAA 4MCQA 4C8PA 4C9AA 1V6CA 4OC0A 3FECA 3RBUA 5F09A 3IWWA 2C6CA 2XEJA 4NGPA 3D7DA 3S9LA 3D7FA 1WVMA 3FF3A 4P45A 4W9YA 4NGMA 4JYWA 4P4EA 3ICUA 4TJXA 4C84A 3I6SA 4C8CA
chains in the Genus database with same CATH superfamily
3BHXA 2EZCA 1NBWA 2B0AA 1CX8A 1EZAA 2XEGA 2D0PA 4MCSA 1EZBA 4C9RA 1NXJA 2JBJA 1R61A 2HROA 4IIXA 1Z8LA 4OMEA 1KBLA 2D0OA 1XF1A 3IIBA 4KNGE 2EZAA 3SJEA 2E28A 1VI4A 1VBGA 2GP4A 4OC2A 3TLCA 4NGTA 2R82A 1DE4C 2HWGA 2PCNA 1KEEB 5FD8A 2MP0A 2YJVA 3BI0A 1ZYMA 5ELYA 5F5XA 4C8AA 1ZRSA 4C8TA 2OLSA 5K99A 3SJXA 3TLAA 3TLGB 3SJFA 4CDJA 4EYSA 4C8UA 3TLBA 1ZL0A 3FEDA 3GJZA 1JDBC 4H1HA 3NOJA 2PVVA 1M6VB 4C86A 4NGNA 2OOTA 3BI1A 4P4DA 3KASA 4COGA 4NGQA 4JZ0A 4IIYA 4OC1A 4X3RA 4INJA 2EK9A 1GGOA 4CDKA 1C3OB 4TWEA 4C9UA 5IB9A 2FM4A 1VBHA 3SJGA 1A9XB 4CZ1A 3T05A 4C9VA 3FEEA 3SR3A 3T07A 4NGRA 4C9EA 3S9MA 3U1BA 4P4FA 4LQGA 2C6GA 3D7HA 3EZBA 3D7GA 1BXRB 4OC4A 4OC3A 3TYXA 4C99A 3I74A 1J3LA 4JVOA 2AUMA 3KRVA 4P44A 4M8DA 2EZBA 2XEFA 3G23A 4P4JA 4C8FA 4C85A 4P4IA 4OC5A 4CO9A 2EK8A 4J0NA 4TJVA 2JBKA 4NGSA 3BXMA 3TLEA 1Q5XA 3C8OA 1Y9ZA 2CIJA 1CE8B 4MCPA 4COBA 2OR4A 5F1YA 4MCRA 2C6PA 2PVWA 4YN3A 3S9NA 2XEIA 3TLYA 3EIFA 3TLZA 3K4IA 4P4BA 5JYBA 5D29A 2C5QA 4MCQA 3VTAA 4C9AA 4C8PA 1V6CA 4OC0A 1CS0B 3FECA 5IR2A 3EZEA 3RBUA 3T0TA 3TLGA 2YJTA 1DIKA 5F09A 1C30B 1JDEA 3IWWA 2C6CA 2DIKA 4MI1A 5F9MA 4E5SA 2XEJA 2HI6A 4MJXA 3K9TA 4NGPA 5JVLA 3D7DA 3S9LA 3D7FA 1WVMA 3FF3A 3T5MA 1KC7A 4P45A 4W9YA 4NGMA 2X0SA 4JYWA 4P4EA 3ICUA 3EZAA 4TJXA 4C84A 3I6SA 4E94A 1T36B 2AUNA 4C8CA
chains in the Genus database with same CATH topology
3BHXA 1CX8A 2XEGA 4MCSA 4C9RA 2JBJA 1Z8LA 4OMEA 1XF1A 3IIBA 4KNGE 3SJEA 4OC2A 2GP4A 4NGTA 1DE4C 3BI0A 5ELYA 4C8AA 4C8TA 3SJXA 3SJFA 4CDJA 4C8UA 3FEDA 2PVVA 4C86A 4NGNA 2OOTA 3BI1A 4P4DA 3KASA 4NGQA 4JZ0A 4OC1A 4X3RA 2EK9A 4CDKA 4TWEA 4C9UA 5IB9A 3SJGA 4C9VA 3FEEA 4NGRA 4C9EA 3S9MA 4P4FA 4LQGA 2C6GA 3D7HA 3D7GA 4OC4A 4OC3A 4C99A 3I74A 4P44A 2XEFA 4P4JA 4C8FA 4C85A 4P4IA 4OC5A 2EK8A 4TJVA 2JBKA 4NGSA 3BXMA 1Y9ZA 2CIJA 4MCPA 2OR4A 4YN3A 4MCRA 2C6PA 2PVWA 3S9NA 2XEIA 3EIFA 4P4BA 5D29A 2C5QA 4MCQA 3VTAA 4C9AA 4C8PA 1V6CA 4OC0A 3FECA 5IR2A 3RBUA 5F09A 3IWWA 2C6CA 2XEJA 3K9TA 4NGPA 3D7DA 3S9LA 3D7FA 1WVMA 3FF3A 4P45A 4W9YA 4NGMA 4JYWA 4P4EA 3ICUA 4TJXA 4C84A 3I6SA 4C8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BHX A;  1CX8 A;  2XEG A;  4MCS A;  4C9R A;  2JBJ A;  1Z8L A;  4OME A;  1XF1 A;  3IIB A;  4KNG E;  3SJE A;  4OC2 A;  4NGT A;  1DE4 C;  3BI0 A;  5ELY A;  4C8A A;  4C8T A;  3SJX A;  3SJF A;  4CDJ A;  4C8U A;  3FED A;  2PVV A;  4C86 A;  4NGN A;  2OOT A;  3BI1 A;  4P4D A;  3KAS A;  4NGQ A;  4JZ0 A;  4OC1 A;  4X3R A;  2EK9 A;  4CDK A;  4TWE A;  4C9U A;  5IB9 A;  3SJG A;  4C9V A;  3FEE A;  4NGR A;  4C9E A;  3S9M A;  4P4F A;  4LQG A;  2C6G A;  3D7H A;  3D7G A;  4OC4 A;  4OC3 A;  4C99 A;  3I74 A;  4P44 A;  2XEF A;  4P4J A;  4C8F A;  4C85 A;  4P4I A;  4OC5 A;  2EK8 A;  4TJV A;  2JBK A;  4NGS A;  3BXM A;  1Y9Z A;  2CIJ A;  4MCP A;  2OR4 A;  4YN3 A;  4MCR A;  2C6P A;  2PVW A;  3S9N A;  2XEI A;  3EIF A;  4P4B A;  5D29 A;  3VTA A;  4MCQ A;  4C8P A;  4C9A A;  1V6C A;  4OC0 A;  3FEC A;  3RBU A;  5F09 A;  3IWW A;  2C6C A;  2XEJ A;  4NGP A;  3D7D A;  3S9L A;  3D7F A;  1WVM A;  3FF3 A;  4P45 A;  4W9Y A;  4NGM A;  4JYW A;  4P4E A;  3ICU A;  4TJX A;  4C84 A;  3I6S A;  4C8C A; 
#chains in the Genus database with same CATH topology
 3BHX A;  2EZC A;  1NBW A;  2B0A A;  1CX8 A;  1EZA A;  2XEG A;  2D0P A;  4MCS A;  1EZB A;  4C9R A;  1NXJ A;  2JBJ A;  1R61 A;  2HRO A;  4IIX A;  1Z8L A;  4OME A;  1KBL A;  2D0O A;  1XF1 A;  3IIB A;  4KNG E;  2EZA A;  3SJE A;  2E28 A;  1VI4 A;  1VBG A;  2GP4 A;  4OC2 A;  3TLC A;  4NGT A;  2R82 A;  1DE4 C;  2HWG A;  2PCN A;  1KEE B;  5FD8 A;  2MP0 A;  2YJV A;  3BI0 A;  1ZYM A;  5ELY A;  5F5X A;  4C8A A;  1ZRS A;  4C8T A;  2OLS A;  5K99 A;  3SJX A;  3TLA A;  3TLG B;  3SJF A;  4CDJ A;  4EYS A;  4C8U A;  3TLB A;  1ZL0 A;  3FED A;  3GJZ A;  1JDB C;  4H1H A;  3NOJ A;  2PVV A;  1M6V B;  4C86 A;  4NGN A;  2OOT A;  3BI1 A;  4P4D A;  3KAS A;  4COG A;  4NGQ A;  4JZ0 A;  4IIY A;  4OC1 A;  4X3R A;  4INJ A;  2EK9 A;  1GGO A;  4CDK A;  1C3O B;  4TWE A;  4C9U A;  5IB9 A;  2FM4 A;  1VBH A;  3SJG A;  1A9X B;  4CZ1 A;  3T05 A;  4C9V A;  3FEE A;  3SR3 A;  3T07 A;  4NGR A;  4C9E A;  3S9M A;  3U1B A;  4P4F A;  4LQG A;  2C6G A;  3D7H A;  3EZB A;  3D7G A;  1BXR B;  4OC4 A;  4OC3 A;  3TYX A;  4C99 A;  3I74 A;  1J3L A;  4JVO A;  2AUM A;  3KRV A;  4P44 A;  4M8D A;  2EZB A;  2XEF A;  3G23 A;  4P4J A;  4C8F A;  4C85 A;  4P4I A;  4OC5 A;  4CO9 A;  2EK8 A;  4J0N A;  4TJV A;  2JBK A;  4NGS A;  3BXM A;  3TLE A;  1Q5X A;  3C8O A;  1Y9Z A;  2CIJ A;  1CE8 B;  4MCP A;  4COB A;  2OR4 A;  5F1Y A;  4MCR A;  2C6P A;  2PVW A;  4YN3 A;  3S9N A;  2XEI A;  3TLY A;  3EIF A;  3TLZ A;  3K4I A;  4P4B A;  5JYB A;  5D29 A;  2C5Q A;  4MCQ A;  3VTA A;  4C9A A;  4C8P A;  1V6C A;  4OC0 A;  1CS0 B;  3FEC A;  5IR2 A;  3EZE A;  3RBU A;  3T0T A;  3TLG A;  2YJT A;  1DIK A;  5F09 A;  1C30 B;  1JDE A;  3IWW A;  2C6C A;  2DIK A;  4MI1 A;  5F9M A;  4E5S A;  2XEJ A;  2HI6 A;  4MJX A;  3K9T A;  4NGP A;  5JVL A;  3D7D A;  3S9L A;  3D7F A;  1WVM A;  3FF3 A;  3T5M A;  1KC7 A;  4P45 A;  4W9Y A;  4NGM A;  2X0S A;  4JYW A;  4P4E A;  3ICU A;  3EZA A;  4TJX A;  4C84 A;  3I6S A;  4E94 A;  1T36 B;  2AUN A;  4C8C A; 
#chains in the Genus database with same CATH homology
 3BHX A;  1CX8 A;  2XEG A;  4MCS A;  4C9R A;  2JBJ A;  1Z8L A;  4OME A;  1XF1 A;  3IIB A;  4KNG E;  3SJE A;  4OC2 A;  2GP4 A;  4NGT A;  1DE4 C;  3BI0 A;  5ELY A;  4C8A A;  4C8T A;  3SJX A;  3SJF A;  4CDJ A;  4C8U A;  3FED A;  2PVV A;  4C86 A;  4NGN A;  2OOT A;  3BI1 A;  4P4D A;  3KAS A;  4NGQ A;  4JZ0 A;  4OC1 A;  4X3R A;  2EK9 A;  4CDK A;  4TWE A;  4C9U A;  5IB9 A;  3SJG A;  4C9V A;  3FEE A;  4NGR A;  4C9E A;  3S9M A;  4P4F A;  4LQG A;  2C6G A;  3D7H A;  3D7G A;  4OC4 A;  4OC3 A;  4C99 A;  3I74 A;  4P44 A;  2XEF A;  4P4J A;  4C8F A;  4C85 A;  4P4I A;  4OC5 A;  2EK8 A;  4TJV A;  2JBK A;  4NGS A;  3BXM A;  1Y9Z A;  2CIJ A;  4MCP A;  2OR4 A;  4YN3 A;  4MCR A;  2C6P A;  2PVW A;  3S9N A;  2XEI A;  3EIF A;  4P4B A;  5D29 A;  2C5Q A;  4MCQ A;  3VTA A;  4C9A A;  4C8P A;  1V6C A;  4OC0 A;  3FEC A;  5IR2 A;  3RBU A;  5F09 A;  3IWW A;  2C6C A;  2XEJ A;  3K9T A;  4NGP A;  3D7D A;  3S9L A;  3D7F A;  1WVM A;  3FF3 A;  4P45 A;  4W9Y A;  4NGM A;  4JYW A;  4P4E A;  3ICU A;  4TJX A;  4C84 A;  3I6S A;  4C8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...