4CDJA

Structure of znrf3 ectodomain
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
153
structure length
153
Chain Sequence
KETAFVEVVLFESSPSGDYTTHTTGLTGRFSRAGAMLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
publication title Structures of Wnt-Antagonist Znrf3 and its Complex with R-Spondin 1 and Implications for Signaling.
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
total genus 40
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4cdjA00
1Y9ZA 3D7FA 3BXMA 2XEJA 4C85A 4P4IA 2OR4A 3SJFA 3D7GA 3FF3A 4LQGA 5F09A 4C8UA 3FECA 4C9VA 4TJVA 2PVWA 2CIJA 1Z8LA 3BI1A 4NGSA 4OC5A 4C8FA 4KNGE 4MCRA 4JYWA 4CDKA 1DE4C 4OC1A 4C9AA 1CX8A 4C8TA 2XEFA 2C6CA 3D7HA 2XEGA 4JZ0A 4NGNA 5D29A 4NGRA 4OC3A 3SJXA 3IIBA 2C6PA 4TJXA 4YN3A 3BI0A 4P44A 4NGMA 3SJEA 4TWEA 1V6CA 2C6GA 4OC2A 4P4JA 4C84A 4C9EA 1XF1A 4C8AA 4NGTA 4P45A 4NGQA 5ELYA 4OC0A 2XEIA 4MCSA 3RBUA 4C9UA 2JBKA 4X3RA 3S9MA 4MCQA 3D7DA 4C9RA 4C8PA 2EK9A 4W9YA 3I74A 3FEDA 4OC4A 4NGPA 2EK8A 4P4BA 4CDJA 3EIFA 3VTAA 4P4DA 3S9NA 3KASA 4P4FA 2PVVA 3FEEA 3SJGA 5IB9A 4P4EA 4C86A 1WVMA 4OMEA 3S9LA 3ICUA 3BHXA 4C99A 3I6SA 2JBJA 4C8CA 4MCPA 3IWWA 2OOTA
chains in the Genus database with same CATH superfamily
1Y9ZA 3D7FA 3BXMA 1A9XB 2XEJA 4C85A 4P4IA 2OR4A 2DIKA 4CZ1A 3SJFA 3D7GA 3TYXA 3FF3A 4MI1A 2YJTA 4LQGA 1KEEB 3K9TA 3G23A 3T05A 2HWGA 5K99A 5F09A 4C8UA 3FECA 4E5SA 4C9VA 2YJVA 1KBLA 4TJVA 2PVWA 1M6VB 3U1BA 2MP0A 2CIJA 4INJA 2EZCA 1EZAA 1ZL0A 1Z8LA 5F1YA 4E94A 3BI1A 3TLZA 4EYSA 3EZEA 3TLBA 5IR2A 2HROA 2E28A 4NGSA 4OC5A 1C30B 1CS0B 4C8FA 4CO9A 4KNGE 4MCRA 4JYWA 4CDKA 1DE4C 4OC1A 1JDBC 1NXJA 4C9AA 1CX8A 4C8TA 2XEFA 2C6CA 2R82A 2XEGA 3D7HA 4M8DA 4COBA 4JZ0A 4NGNA 5D29A 2AUMA 4H1HA 4NGRA 4OC3A 3SJXA 2HI6A 3IIBA 3TLYA 2PCNA 2C6PA 1VI4A 4TJXA 4YN3A 3BI0A 4P44A 1EZBA 1GGOA 4NGMA 4MJXA 3SJEA 3NOJA 4TWEA 3TLCA 2B0AA 1V6CA 1C3OB 2C6GA 4OC2A 4P4JA 4C84A 4C9EA 5JVLA 1R61A 1XF1A 3T0TA 4C8AA 4NGTA 3T07A 1ZRSA 3SR3A 2GP4A 3EZBA 3TLAA 4JVOA 4P45A 2FM4A 3K4IA 4NGQA 2X0SA 5ELYA 4OC0A 1NBWA 2XEIA 4MCSA 3RBUA 4C9UA 1CE8B 4X3RA 4MCPA 3S9MA 4COGA 4MCQA 3D7DA 4C9RA 4C8PA 2EK9A 1Q5XA 4W9YA 2OLSA 2D0PA 3I74A 2EZAA 3FEDA 4OC4A 2C5QA 4NGPA 2EK8A 4P4BA 1T36B 4CDJA 1DIKA 3EIFA 3VTAA 2D0OA 4P4DA 1J3LA 3S9NA 4IIXA 3TLEA 4IIYA 2AUNA 5JYBA 3KASA 3TLGB 4P4FA 2PVVA 3FEEA 3SJGA 5F9MA 5IB9A 4P4EA 4C86A 5F5XA 1ZYMA 4J0NA 1VBGA 1WVMA 1BXRB 4OMEA 3S9LA 3ICUA 3T5MA 1JDEA 3GJZA 3KRVA 1KC7A 3BHXA 4C99A 3TLGA 5FD8A 2EZBA 3I6SA 3EZAA 1VBHA 2JBJA 3C8OA 4C8CA 2JBKA 3IWWA 2OOTA
chains in the Genus database with same CATH topology
1Y9ZA 3D7FA 3BXMA 2XEJA 4C85A 4P4IA 2OR4A 3SJFA 3D7GA 3FF3A 4LQGA 3K9TA 5F09A 4C8UA 3FECA 4C9VA 4TJVA 2PVWA 2CIJA 1Z8LA 3BI1A 5IR2A 4NGSA 4OC5A 4C8FA 4KNGE 4MCRA 4JYWA 4CDKA 1DE4C 4OC1A 4C9AA 1CX8A 4C8TA 2XEFA 2C6CA 3D7HA 2XEGA 4JZ0A 4NGNA 5D29A 4NGRA 4OC3A 3SJXA 3IIBA 2C6PA 4TJXA 4YN3A 3BI0A 4P44A 4NGMA 3SJEA 4TWEA 1V6CA 2C6GA 4OC2A 4P4JA 4C84A 4C9EA 1XF1A 4C8AA 4NGTA 2GP4A 4P45A 4NGQA 5ELYA 4OC0A 2XEIA 4MCSA 3RBUA 4C9UA 2JBKA 4X3RA 3S9MA 4MCQA 3D7DA 4C9RA 4C8PA 2EK9A 4W9YA 3I74A 3FEDA 4OC4A 2C5QA 4NGPA 2EK8A 4P4BA 4CDJA 3EIFA 3VTAA 4P4DA 3S9NA 3KASA 4P4FA 2PVVA 3FEEA 3SJGA 5IB9A 4P4EA 4C86A 1WVMA 4OMEA 3S9LA 3ICUA 3BHXA 4C99A 3I6SA 2JBJA 4C8CA 4MCPA 3IWWA 2OOTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y9Z A;  3D7F A;  3BXM A;  2XEJ A;  4C85 A;  4P4I A;  2OR4 A;  3SJF A;  3D7G A;  3FF3 A;  4LQG A;  5F09 A;  4C8U A;  3FEC A;  4C9V A;  4TJV A;  2PVW A;  2CIJ A;  1Z8L A;  3BI1 A;  4NGS A;  4OC5 A;  4C8F A;  4KNG E;  4MCR A;  4JYW A;  4CDK A;  1DE4 C;  4OC1 A;  4C9A A;  1CX8 A;  4C8T A;  2XEF A;  2C6C A;  3D7H A;  2XEG A;  4JZ0 A;  4NGN A;  5D29 A;  4NGR A;  4OC3 A;  3SJX A;  3IIB A;  2C6P A;  4TJX A;  4YN3 A;  3BI0 A;  4P44 A;  4NGM A;  3SJE A;  4TWE A;  1V6C A;  2C6G A;  4OC2 A;  4P4J A;  4C84 A;  4C9E A;  1XF1 A;  4C8A A;  4NGT A;  4P45 A;  4NGQ A;  5ELY A;  4OC0 A;  2XEI A;  4MCS A;  3RBU A;  4C9U A;  2JBK A;  4X3R A;  3S9M A;  4MCQ A;  3D7D A;  4C9R A;  4C8P A;  2EK9 A;  4W9Y A;  3I74 A;  3FED A;  4OC4 A;  4NGP A;  2EK8 A;  4P4B A;  4CDJ A;  3EIF A;  3VTA A;  4P4D A;  3S9N A;  3KAS A;  4P4F A;  2PVV A;  3FEE A;  3SJG A;  5IB9 A;  4P4E A;  4C86 A;  1WVM A;  4OME A;  3S9L A;  3ICU A;  3BHX A;  4C99 A;  3I6S A;  2JBJ A;  4C8C A;  4MCP A;  3IWW A;  2OOT A; 
#chains in the Genus database with same CATH topology
 1Y9Z A;  3D7F A;  3BXM A;  1A9X B;  2XEJ A;  4C85 A;  4P4I A;  2OR4 A;  2DIK A;  4CZ1 A;  3SJF A;  3D7G A;  3TYX A;  3FF3 A;  4MI1 A;  2YJT A;  4LQG A;  1KEE B;  3K9T A;  3G23 A;  3T05 A;  2HWG A;  5K99 A;  5F09 A;  4C8U A;  3FEC A;  4E5S A;  4C9V A;  2YJV A;  1KBL A;  4TJV A;  2PVW A;  1M6V B;  3U1B A;  2MP0 A;  2CIJ A;  4INJ A;  2EZC A;  1EZA A;  1ZL0 A;  1Z8L A;  5F1Y A;  4E94 A;  3BI1 A;  3TLZ A;  4EYS A;  3EZE A;  3TLB A;  5IR2 A;  2HRO A;  2E28 A;  4NGS A;  4OC5 A;  1C30 B;  1CS0 B;  4C8F A;  4CO9 A;  4KNG E;  4MCR A;  4JYW A;  4CDK A;  1DE4 C;  4OC1 A;  1JDB C;  1NXJ A;  4C9A A;  1CX8 A;  4C8T A;  2XEF A;  2C6C A;  2R82 A;  2XEG A;  3D7H A;  4M8D A;  4COB A;  4JZ0 A;  4NGN A;  5D29 A;  2AUM A;  4H1H A;  4NGR A;  4OC3 A;  3SJX A;  2HI6 A;  3IIB A;  3TLY A;  2PCN A;  2C6P A;  1VI4 A;  4TJX A;  4YN3 A;  3BI0 A;  4P44 A;  1EZB A;  1GGO A;  4NGM A;  4MJX A;  3SJE A;  3NOJ A;  4TWE A;  3TLC A;  2B0A A;  1V6C A;  1C3O B;  2C6G A;  4OC2 A;  4P4J A;  4C84 A;  4C9E A;  5JVL A;  1R61 A;  1XF1 A;  3T0T A;  4C8A A;  4NGT A;  3T07 A;  1ZRS A;  3SR3 A;  2GP4 A;  3EZB A;  3TLA A;  4JVO A;  4P45 A;  2FM4 A;  3K4I A;  4NGQ A;  2X0S A;  5ELY A;  4OC0 A;  1NBW A;  2XEI A;  4MCS A;  3RBU A;  4C9U A;  1CE8 B;  4X3R A;  4MCP A;  3S9M A;  4COG A;  4MCQ A;  3D7D A;  4C9R A;  4C8P A;  2EK9 A;  1Q5X A;  4W9Y A;  2OLS A;  2D0P A;  3I74 A;  2EZA A;  3FED A;  4OC4 A;  2C5Q A;  4NGP A;  2EK8 A;  4P4B A;  1T36 B;  4CDJ A;  1DIK A;  3EIF A;  3VTA A;  2D0O A;  4P4D A;  1J3L A;  3S9N A;  4IIX A;  3TLE A;  4IIY A;  2AUN A;  5JYB A;  3KAS A;  3TLG B;  4P4F A;  2PVV A;  3FEE A;  3SJG A;  5F9M A;  5IB9 A;  4P4E A;  4C86 A;  5F5X A;  1ZYM A;  4J0N A;  1VBG A;  1WVM A;  1BXR B;  4OME A;  3S9L A;  3ICU A;  3T5M A;  1JDE A;  3GJZ A;  3KRV A;  1KC7 A;  3BHX A;  4C99 A;  3TLG A;  5FD8 A;  2EZB A;  3I6S A;  3EZA A;  1VBH A;  2JBJ A;  3C8O A;  4C8C A;  2JBK A;  3IWW A;  2OOT A; 
#chains in the Genus database with same CATH homology
 1Y9Z A;  3D7F A;  3BXM A;  2XEJ A;  4C85 A;  4P4I A;  2OR4 A;  3SJF A;  3D7G A;  3FF3 A;  4LQG A;  3K9T A;  5F09 A;  4C8U A;  3FEC A;  4C9V A;  4TJV A;  2PVW A;  2CIJ A;  1Z8L A;  3BI1 A;  5IR2 A;  4NGS A;  4OC5 A;  4C8F A;  4KNG E;  4MCR A;  4JYW A;  4CDK A;  1DE4 C;  4OC1 A;  4C9A A;  1CX8 A;  4C8T A;  2XEF A;  2C6C A;  3D7H A;  2XEG A;  4JZ0 A;  4NGN A;  5D29 A;  4NGR A;  4OC3 A;  3SJX A;  3IIB A;  2C6P A;  4TJX A;  4YN3 A;  3BI0 A;  4P44 A;  4NGM A;  3SJE A;  4TWE A;  1V6C A;  2C6G A;  4OC2 A;  4P4J A;  4C84 A;  4C9E A;  1XF1 A;  4C8A A;  4NGT A;  2GP4 A;  4P45 A;  4NGQ A;  5ELY A;  4OC0 A;  2XEI A;  4MCS A;  3RBU A;  4C9U A;  2JBK A;  4X3R A;  3S9M A;  4MCQ A;  3D7D A;  4C9R A;  4C8P A;  2EK9 A;  4W9Y A;  3I74 A;  3FED A;  4OC4 A;  2C5Q A;  4NGP A;  2EK8 A;  4P4B A;  4CDJ A;  3EIF A;  3VTA A;  4P4D A;  3S9N A;  3KAS A;  4P4F A;  2PVV A;  3FEE A;  3SJG A;  5IB9 A;  4P4E A;  4C86 A;  1WVM A;  4OME A;  3S9L A;  3ICU A;  3BHX A;  4C99 A;  3I6S A;  2JBJ A;  4C8C A;  4MCP A;  3IWW A;  2OOT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...