4C9UA

Xenopus znrf3 ectodomain in complex with xenopus rspo2 fu1-fu2 crystal form ii
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
161
structure length
161
Chain Sequence
ETGESLAKETAFVEVVLFESSPNGDYKTHTTELQGRFSRAGATISAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPEMDPKPCLTVLGKAKRAVQRGATAVIFDVSDNPDAVEQLNQGLEDPLKRPVVYMKGMDAIKLMNIVNKQKGARARIQHRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
publication title Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb
source organism Xenopus (silurana) tropicalis
molecule tags Ligase/signaling protein
total genus 39
structure length 161
sequence length 161
chains with identical sequence C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4c9uA00
4OMEA 3BHXA 3EIFA 4C8FA 1DE4C 4OC0A 3S9LA 4P4BA 2CIJA 4MCPA 5D29A 4X3RA 4LQGA 4C8CA 4P4DA 2C6GA 3FEEA 3I74A 5ELYA 2XEJA 3KASA 3ICUA 3SJEA 4OC3A 3S9NA 4OC1A 4C84A 4C8UA 3D7DA 4P4FA 2XEFA 3D7GA 4NGSA 4JYWA 4C9EA 3S9MA 2JBKA 2OR4A 4MCQA 4NGRA 1Z8LA 4P4IA 1V6CA 3BXMA 3IIBA 5F09A 4TJXA 4KNGE 3SJXA 2XEIA 4NGNA 4NGMA 4CDJA 3D7HA 4NGPA 3FECA 3BI1A 4C9RA 3RBUA 4C8AA 2XEGA 4OC5A 4C99A 2EK9A 4P4EA 4C9AA 5IB9A 4OC2A 2PVWA 3BI0A 4JZ0A 4P45A 4CDKA 3SJGA 2PVVA 4C86A 1WVMA 1Y9ZA 3I6SA 4C9UA 2EK8A 3D7FA 4OC4A 3IWWA 2C6CA 3FF3A 4YN3A 4C85A 4MCRA 4C9VA 2C6PA 4MCSA 4C8TA 4W9YA 4NGQA 2JBJA 4TJVA 4NGTA 1XF1A 4P44A 4TWEA 1CX8A 3FEDA 3SJFA 3VTAA 4P4JA 2OOTA 4C8PA
chains in the Genus database with same CATH superfamily
4OMEA 1JDEA 1JDBC 1VBGA 3BHXA 3C8OA 4IIXA 3EIFA 2D0OA 5F5XA 4C8FA 1DE4C 4OC0A 3S9LA 2E28A 4P4BA 5FD8A 3TLYA 3TLAA 4COBA 2CIJA 4MCPA 3T07A 5D29A 4X3RA 1Q5XA 3G23A 4LQGA 4E5SA 4C8CA 4P4DA 5F9MA 4E94A 2C6GA 3FEEA 3I74A 5ELYA 2XEJA 3KASA 3ICUA 3SJEA 4OC3A 3S9NA 4COGA 4OC1A 3U1BA 1C30B 4C84A 4EYSA 5JVLA 3TYXA 1R61A 4C8UA 3D7DA 1M6VB 4P4FA 2XEFA 3D7GA 4NGSA 4JYWA 4C9EA 2HWGA 3S9MA 1ZRSA 2JBKA 2OR4A 4MCQA 1KC7A 4NGRA 1Z8LA 4P4IA 1V6CA 3BXMA 3T5MA 3IIBA 5F09A 4TJXA 4KNGE 3SJXA 2DIKA 2XEIA 4NGNA 4NGMA 5JYBA 4J0NA 4CDJA 3T0TA 3D7HA 2B0AA 4NGPA 1NXJA 3FECA 3EZBA 3BI1A 4C9RA 3RBUA 4C8AA 3GJZA 2XEGA 4OC5A 2R82A 4C99A 3NOJA 3K9TA 2EK9A 4P4EA 1CS0B 4C9AA 1NBWA 3TLEA 5IB9A 2EZAA 4MI1A 4OC2A 2PVWA 3BI0A 1A9XB 1ZL0A 4JZ0A 4P45A 4CDKA 3TLGA 3TLGB 3SJGA 2PVVA 4M8DA 4C86A 1WVMA 1GGOA 3T05A 1Y9ZA 2GP4A 3I6SA 1ZYMA 3KRVA 2D0PA 5F1YA 4IIYA 3TLZA 2EK8A 3D7FA 4C9UA 4OC4A 3IWWA 2C6CA 5K99A 2HI6A 2X0SA 3FF3A 4MJXA 2EZBA 4YN3A 3TLBA 4C85A 4MCRA 3TLCA 4CO9A 2FM4A 4H1HA 1DIKA 4C9VA 2C6PA 4CZ1A 2PCNA 4MCSA 4C8TA 4W9YA 3K4IA 1KEEB 1CE8B 4INJA 1EZBA 4NGQA 2JBJA 1KBLA 5IR2A 4TJVA 3EZEA 2OLSA 4NGTA 1XF1A 2AUMA 2AUNA 4P44A 4TWEA 1EZAA 1CX8A 1VBHA 2C5QA 1C3OB 4JVOA 2MP0A 1J3LA 1BXRB 3FEDA 2EZCA 2HROA 1T36B 1VI4A 3SJFA 3VTAA 4P4JA 2YJTA 2YJVA 2OOTA 3SR3A 4C8PA 3EZAA
chains in the Genus database with same CATH topology
4OMEA 3BHXA 3EIFA 4C8FA 1DE4C 4OC0A 3S9LA 4P4BA 2CIJA 4MCPA 5D29A 4X3RA 4LQGA 4C8CA 4P4DA 2C6GA 3FEEA 3I74A 5ELYA 2XEJA 3KASA 3ICUA 3SJEA 4OC3A 3S9NA 4OC1A 4C84A 4C8UA 3D7DA 4P4FA 2XEFA 3D7GA 4NGSA 4JYWA 4C9EA 3S9MA 2JBKA 2OR4A 4MCQA 4NGRA 1Z8LA 4P4IA 1V6CA 3BXMA 3IIBA 5F09A 4TJXA 4KNGE 3SJXA 2XEIA 4NGNA 4NGMA 4CDJA 3D7HA 4NGPA 3FECA 3BI1A 4C9RA 3RBUA 4C8AA 2XEGA 4OC5A 4C99A 3K9TA 2EK9A 4P4EA 4C9AA 5IB9A 4OC2A 2PVWA 3BI0A 4JZ0A 4P45A 4CDKA 3SJGA 2PVVA 4C86A 1WVMA 1Y9ZA 2GP4A 3I6SA 4C9UA 2EK8A 3D7FA 4OC4A 3IWWA 2C6CA 3FF3A 4YN3A 4C85A 4MCRA 4C9VA 2C6PA 4MCSA 4C8TA 4W9YA 4NGQA 2JBJA 5IR2A 4TJVA 4NGTA 1XF1A 4P44A 4TWEA 1CX8A 2C5QA 3FEDA 3SJFA 3VTAA 4P4JA 2OOTA 4C8PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OME A;  3BHX A;  3EIF A;  4C8F A;  1DE4 C;  4OC0 A;  3S9L A;  4P4B A;  2CIJ A;  4MCP A;  5D29 A;  4X3R A;  4LQG A;  4C8C A;  4P4D A;  2C6G A;  3FEE A;  3I74 A;  5ELY A;  2XEJ A;  3KAS A;  3ICU A;  3SJE A;  4OC3 A;  3S9N A;  4OC1 A;  4C84 A;  4C8U A;  3D7D A;  4P4F A;  2XEF A;  3D7G A;  4NGS A;  4JYW A;  4C9E A;  3S9M A;  2JBK A;  2OR4 A;  4MCQ A;  4NGR A;  1Z8L A;  4P4I A;  1V6C A;  3BXM A;  3IIB A;  5F09 A;  4TJX A;  4KNG E;  3SJX A;  2XEI A;  4NGN A;  4NGM A;  4CDJ A;  3D7H A;  4NGP A;  3FEC A;  3BI1 A;  4C9R A;  3RBU A;  4C8A A;  2XEG A;  4OC5 A;  4C99 A;  2EK9 A;  4P4E A;  4C9A A;  5IB9 A;  4OC2 A;  2PVW A;  3BI0 A;  4JZ0 A;  4P45 A;  4CDK A;  3SJG A;  2PVV A;  4C86 A;  1WVM A;  1Y9Z A;  3I6S A;  4C9U A;  2EK8 A;  3D7F A;  4OC4 A;  3IWW A;  2C6C A;  3FF3 A;  4YN3 A;  4C85 A;  4MCR A;  4C9V A;  2C6P A;  4MCS A;  4C8T A;  4W9Y A;  4NGQ A;  2JBJ A;  4TJV A;  4NGT A;  1XF1 A;  4P44 A;  4TWE A;  1CX8 A;  3FED A;  3SJF A;  3VTA A;  4P4J A;  2OOT A;  4C8P A; 
#chains in the Genus database with same CATH topology
 4OME A;  1JDE A;  1JDB C;  1VBG A;  3BHX A;  3C8O A;  4IIX A;  3EIF A;  2D0O A;  5F5X A;  4C8F A;  1DE4 C;  4OC0 A;  3S9L A;  2E28 A;  4P4B A;  5FD8 A;  3TLY A;  3TLA A;  4COB A;  2CIJ A;  4MCP A;  3T07 A;  5D29 A;  4X3R A;  1Q5X A;  3G23 A;  4LQG A;  4E5S A;  4C8C A;  4P4D A;  5F9M A;  4E94 A;  2C6G A;  3FEE A;  3I74 A;  5ELY A;  2XEJ A;  3KAS A;  3ICU A;  3SJE A;  4OC3 A;  3S9N A;  4COG A;  4OC1 A;  3U1B A;  1C30 B;  4C84 A;  4EYS A;  5JVL A;  3TYX A;  1R61 A;  4C8U A;  3D7D A;  1M6V B;  4P4F A;  2XEF A;  3D7G A;  4NGS A;  4JYW A;  4C9E A;  2HWG A;  3S9M A;  1ZRS A;  2JBK A;  2OR4 A;  4MCQ A;  1KC7 A;  4NGR A;  1Z8L A;  4P4I A;  1V6C A;  3BXM A;  3T5M A;  3IIB A;  5F09 A;  4TJX A;  4KNG E;  3SJX A;  2DIK A;  2XEI A;  4NGN A;  4NGM A;  5JYB A;  4J0N A;  4CDJ A;  3T0T A;  3D7H A;  2B0A A;  4NGP A;  1NXJ A;  3FEC A;  3EZB A;  3BI1 A;  4C9R A;  3RBU A;  4C8A A;  3GJZ A;  2XEG A;  4OC5 A;  2R82 A;  4C99 A;  3NOJ A;  3K9T A;  2EK9 A;  4P4E A;  1CS0 B;  4C9A A;  1NBW A;  3TLE A;  5IB9 A;  2EZA A;  4MI1 A;  4OC2 A;  2PVW A;  3BI0 A;  1A9X B;  1ZL0 A;  4JZ0 A;  4P45 A;  4CDK A;  3TLG A;  3TLG B;  3SJG A;  2PVV A;  4M8D A;  4C86 A;  1WVM A;  1GGO A;  3T05 A;  1Y9Z A;  2GP4 A;  3I6S A;  1ZYM A;  3KRV A;  2D0P A;  5F1Y A;  4IIY A;  3TLZ A;  2EK8 A;  3D7F A;  4C9U A;  4OC4 A;  3IWW A;  2C6C A;  5K99 A;  2HI6 A;  2X0S A;  3FF3 A;  4MJX A;  2EZB A;  4YN3 A;  3TLB A;  4C85 A;  4MCR A;  3TLC A;  4CO9 A;  2FM4 A;  4H1H A;  1DIK A;  4C9V A;  2C6P A;  4CZ1 A;  2PCN A;  4MCS A;  4C8T A;  4W9Y A;  3K4I A;  1KEE B;  1CE8 B;  4INJ A;  1EZB A;  4NGQ A;  2JBJ A;  1KBL A;  5IR2 A;  4TJV A;  3EZE A;  2OLS A;  4NGT A;  1XF1 A;  2AUM A;  2AUN A;  4P44 A;  4TWE A;  1EZA A;  1CX8 A;  1VBH A;  2C5Q A;  1C3O B;  4JVO A;  2MP0 A;  1J3L A;  1BXR B;  3FED A;  2EZC A;  2HRO A;  1T36 B;  1VI4 A;  3SJF A;  3VTA A;  4P4J A;  2YJT A;  2YJV A;  2OOT A;  3SR3 A;  4C8P A;  3EZA A; 
#chains in the Genus database with same CATH homology
 4OME A;  3BHX A;  3EIF A;  4C8F A;  1DE4 C;  4OC0 A;  3S9L A;  4P4B A;  2CIJ A;  4MCP A;  5D29 A;  4X3R A;  4LQG A;  4C8C A;  4P4D A;  2C6G A;  3FEE A;  3I74 A;  5ELY A;  2XEJ A;  3KAS A;  3ICU A;  3SJE A;  4OC3 A;  3S9N A;  4OC1 A;  4C84 A;  4C8U A;  3D7D A;  4P4F A;  2XEF A;  3D7G A;  4NGS A;  4JYW A;  4C9E A;  3S9M A;  2JBK A;  2OR4 A;  4MCQ A;  4NGR A;  1Z8L A;  4P4I A;  1V6C A;  3BXM A;  3IIB A;  5F09 A;  4TJX A;  4KNG E;  3SJX A;  2XEI A;  4NGN A;  4NGM A;  4CDJ A;  3D7H A;  4NGP A;  3FEC A;  3BI1 A;  4C9R A;  3RBU A;  4C8A A;  2XEG A;  4OC5 A;  4C99 A;  3K9T A;  2EK9 A;  4P4E A;  4C9A A;  5IB9 A;  4OC2 A;  2PVW A;  3BI0 A;  4JZ0 A;  4P45 A;  4CDK A;  3SJG A;  2PVV A;  4C86 A;  1WVM A;  1Y9Z A;  2GP4 A;  3I6S A;  4C9U A;  2EK8 A;  3D7F A;  4OC4 A;  3IWW A;  2C6C A;  3FF3 A;  4YN3 A;  4C85 A;  4MCR A;  4C9V A;  2C6P A;  4MCS A;  4C8T A;  4W9Y A;  4NGQ A;  2JBJ A;  5IR2 A;  4TJV A;  4NGT A;  1XF1 A;  4P44 A;  4TWE A;  1CX8 A;  2C5Q A;  3FED A;  3SJF A;  3VTA A;  4P4J A;  2OOT A;  4C8P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...