4C9UA

Xenopus znrf3 ectodomain in complex with xenopus rspo2 fu1-fu2 crystal form ii
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
161
structure length
161
Chain Sequence
ETGESLAKETAFVEVVLFESSPNGDYKTHTTELQGRFSRAGATISAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPEMDPKPCLTVLGKAKRAVQRGATAVIFDVSDNPDAVEQLNQGLEDPLKRPVVYMKGMDAIKLMNIVNKQKGARARIQHRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/signaling protein
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
publication title Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb
source organism Xenopus (silurana) tropicalis
total genus 39
structure length 161
sequence length 161
chains with identical sequence C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4c9uA00
4YN3A 2JBKA 3IIBA 3I6SA 3FECA 2XEGA 3S9NA 2XEFA 4MCQA 3D7GA 3SJGA 3S9LA 4TJXA 4C85A 2C6CA 3SJFA 4P4DA 4C9RA 4OC3A 3SJXA 4TJVA 4NGNA 2PVVA 5IB9A 3S9MA 4OC2A 4OC1A 5D29A 4NGSA 2JBJA 1XF1A 4LQGA 3D7HA 4NGQA 3FEDA 3EIFA 3I74A 4C8FA 1Y9ZA 2C6PA 4TWEA 4C9AA 2EK9A 3BXMA 4C8PA 4OC4A 1DE4C 1WVMA 2XEJA 3KASA 4C9VA 4CDJA 3D7DA 2C6GA 2PVWA 4JYWA 5ELYA 4C9EA 2EK8A 2CIJA 4NGTA 4P4IA 4P44A 4CDKA 2XEIA 4P4FA 4MCSA 4C8AA 4C84A 3VTAA 2OR4A 1CX8A 3IWWA 4P4JA 4NGMA 4P4EA 4X3RA 4C99A 4C8UA 5F09A 4NGRA 4C8CA 3FF3A 1Z8LA 3FEEA 4C9UA 4C86A 4JZ0A 3BI0A 4P45A 4P4BA 3ICUA 4KNGE 4MCPA 3BHXA 3D7FA 4NGPA 2OOTA 4OMEA 3BI1A 4OC5A 4C8TA 3RBUA 1V6CA 4MCRA 4OC0A 4W9YA 3SJEA
chains in the Genus database with same CATH superfamily
4YN3A 1J3LA 5F9MA 2JBKA 3K9TA 3IIBA 3KRVA 4JVOA 3I6SA 2R82A 3FECA 1R61A 2XEGA 3GJZA 2D0PA 3S9NA 1GGOA 2B0AA 5FD8A 2XEFA 4COGA 1NBWA 4MCQA 4COBA 2MP0A 3D7GA 4MI1A 3TLBA 2YJVA 3SJGA 2HROA 2EZCA 3S9LA 1VBHA 4TJXA 1Q5XA 4C85A 1T36B 2C6CA 5K99A 3SJFA 1JDEA 4IIYA 4P4DA 3C8OA 1EZAA 3T5MA 1NXJA 4C9RA 4OC3A 3SJXA 4TJVA 2EZBA 3EZBA 5JYBA 1CS0B 4NGNA 2PVVA 5IB9A 3S9MA 4OC2A 4OC1A 5D29A 4NGSA 3TYXA 2JBJA 1XF1A 4LQGA 3D7HA 4NGQA 2HWGA 1ZL0A 3FEDA 3EIFA 1M6VB 3T0TA 4H1HA 3I74A 4C8FA 1Y9ZA 2HI6A 2OLSA 2C6PA 1KEEB 1BXRB 4TWEA 4C9AA 2EK9A 3BXMA 4C8PA 4OC4A 4IIXA 3T07A 1DE4C 2AUNA 1WVMA 2XEJA 3KASA 4C9VA 4CDJA 1ZRSA 3D7DA 2DIKA 2C6GA 2PVWA 3EZEA 4JYWA 1JDBC 4CZ1A 5ELYA 4C9EA 3TLZA 1A9XB 2EK8A 3T05A 2CIJA 4NGTA 4J0NA 4P4IA 4E94A 1ZYMA 4P44A 4CDKA 5IR2A 2EZAA 2XEIA 2D0OA 4CO9A 3NOJA 4P4FA 3U1BA 4MCSA 1KC7A 4C8AA 1KBLA 4INJA 1EZBA 1C30B 2GP4A 4EYSA 3SR3A 5JVLA 3TLEA 4C84A 3VTAA 2OR4A 3TLGA 2X0SA 2C5QA 4M8DA 2YJTA 1CX8A 3IWWA 4P4JA 4NGMA 4P4EA 2AUMA 4X3RA 4C99A 4MJXA 4C8UA 2PCNA 5F09A 4NGRA 4C8CA 1VI4A 1CE8B 3K4IA 1VBGA 1Z8LA 3FF3A 3FEEA 4E5SA 4C9UA 3TLAA 4C86A 3TLYA 4JZ0A 3BI0A 4P45A 4P4BA 3EZAA 3TLGB 3ICUA 4KNGE 4MCPA 3TLCA 3BHXA 3D7FA 4NGPA 2OOTA 4OMEA 3BI1A 2FM4A 5F5XA 4OC5A 4C8TA 3RBUA 1V6CA 4MCRA 4OC0A 2E28A 3G23A 4W9YA 1C3OB 3SJEA 5F1YA 1DIKA
chains in the Genus database with same CATH topology
4YN3A 2JBKA 3K9TA 3IIBA 3I6SA 3FECA 2XEGA 3S9NA 2XEFA 4MCQA 3D7GA 3SJGA 3S9LA 4TJXA 4C85A 2C6CA 3SJFA 4P4DA 4C9RA 4OC3A 3SJXA 4TJVA 4NGNA 2PVVA 5IB9A 3S9MA 4OC2A 4OC1A 5D29A 4NGSA 2JBJA 1XF1A 4LQGA 3D7HA 4NGQA 3FEDA 3EIFA 3I74A 4C8FA 1Y9ZA 2C6PA 4TWEA 4C9AA 2EK9A 3BXMA 4C8PA 4OC4A 1DE4C 1WVMA 2XEJA 3KASA 4C9VA 4CDJA 3D7DA 2C6GA 2PVWA 4JYWA 5ELYA 4C9EA 2EK8A 2CIJA 4NGTA 4P4IA 4P44A 4CDKA 5IR2A 2XEIA 4P4FA 4MCSA 4C8AA 2GP4A 4C84A 3VTAA 2OR4A 2C5QA 1CX8A 3IWWA 4P4JA 4NGMA 4P4EA 4X3RA 4C99A 4C8UA 5F09A 4NGRA 4C8CA 3FF3A 1Z8LA 3FEEA 4C9UA 4C86A 4JZ0A 3BI0A 4P45A 4P4BA 3ICUA 4KNGE 4MCPA 3BHXA 3D7FA 4NGPA 2OOTA 4OMEA 3BI1A 4OC5A 4C8TA 3RBUA 1V6CA 4MCRA 4OC0A 4W9YA 3SJEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YN3 A;  2JBK A;  3IIB A;  3I6S A;  3FEC A;  2XEG A;  3S9N A;  2XEF A;  4MCQ A;  3D7G A;  3SJG A;  3S9L A;  4TJX A;  4C85 A;  2C6C A;  3SJF A;  4P4D A;  4C9R A;  4OC3 A;  3SJX A;  4TJV A;  4NGN A;  2PVV A;  5IB9 A;  3S9M A;  4OC2 A;  4OC1 A;  5D29 A;  4NGS A;  2JBJ A;  1XF1 A;  4LQG A;  3D7H A;  4NGQ A;  3FED A;  3EIF A;  3I74 A;  4C8F A;  1Y9Z A;  2C6P A;  4TWE A;  4C9A A;  2EK9 A;  3BXM A;  4C8P A;  4OC4 A;  1DE4 C;  1WVM A;  2XEJ A;  3KAS A;  4C9V A;  4CDJ A;  3D7D A;  2C6G A;  2PVW A;  4JYW A;  5ELY A;  4C9E A;  2EK8 A;  2CIJ A;  4NGT A;  4P4I A;  4P44 A;  4CDK A;  2XEI A;  4P4F A;  4MCS A;  4C8A A;  4C84 A;  3VTA A;  2OR4 A;  1CX8 A;  3IWW A;  4P4J A;  4NGM A;  4P4E A;  4X3R A;  4C99 A;  4C8U A;  5F09 A;  4NGR A;  4C8C A;  3FF3 A;  1Z8L A;  3FEE A;  4C9U A;  4C86 A;  4JZ0 A;  3BI0 A;  4P45 A;  4P4B A;  3ICU A;  4KNG E;  4MCP A;  3BHX A;  3D7F A;  4NGP A;  2OOT A;  4OME A;  3BI1 A;  4OC5 A;  4C8T A;  3RBU A;  1V6C A;  4MCR A;  4OC0 A;  4W9Y A;  3SJE A; 
#chains in the Genus database with same CATH topology
 4YN3 A;  1J3L A;  5F9M A;  2JBK A;  3K9T A;  3IIB A;  3KRV A;  4JVO A;  3I6S A;  2R82 A;  3FEC A;  1R61 A;  2XEG A;  3GJZ A;  2D0P A;  3S9N A;  1GGO A;  2B0A A;  5FD8 A;  2XEF A;  4COG A;  1NBW A;  4MCQ A;  4COB A;  2MP0 A;  3D7G A;  4MI1 A;  3TLB A;  2YJV A;  3SJG A;  2HRO A;  2EZC A;  3S9L A;  1VBH A;  4TJX A;  1Q5X A;  4C85 A;  1T36 B;  2C6C A;  5K99 A;  3SJF A;  1JDE A;  4IIY A;  4P4D A;  3C8O A;  1EZA A;  3T5M A;  1NXJ A;  4C9R A;  4OC3 A;  3SJX A;  4TJV A;  2EZB A;  3EZB A;  5JYB A;  1CS0 B;  4NGN A;  2PVV A;  5IB9 A;  3S9M A;  4OC2 A;  4OC1 A;  5D29 A;  4NGS A;  3TYX A;  2JBJ A;  1XF1 A;  4LQG A;  3D7H A;  4NGQ A;  2HWG A;  1ZL0 A;  3FED A;  3EIF A;  1M6V B;  3T0T A;  4H1H A;  3I74 A;  4C8F A;  1Y9Z A;  2HI6 A;  2OLS A;  2C6P A;  1KEE B;  1BXR B;  4TWE A;  4C9A A;  2EK9 A;  3BXM A;  4C8P A;  4OC4 A;  4IIX A;  3T07 A;  1DE4 C;  2AUN A;  1WVM A;  2XEJ A;  3KAS A;  4C9V A;  4CDJ A;  1ZRS A;  3D7D A;  2DIK A;  2C6G A;  2PVW A;  3EZE A;  4JYW A;  1JDB C;  4CZ1 A;  5ELY A;  4C9E A;  3TLZ A;  1A9X B;  2EK8 A;  3T05 A;  2CIJ A;  4NGT A;  4J0N A;  4P4I A;  4E94 A;  1ZYM A;  4P44 A;  4CDK A;  5IR2 A;  2EZA A;  2XEI A;  2D0O A;  4CO9 A;  3NOJ A;  4P4F A;  3U1B A;  4MCS A;  1KC7 A;  4C8A A;  1KBL A;  4INJ A;  1EZB A;  1C30 B;  2GP4 A;  4EYS A;  3SR3 A;  5JVL A;  3TLE A;  4C84 A;  3VTA A;  2OR4 A;  3TLG A;  2X0S A;  2C5Q A;  4M8D A;  2YJT A;  1CX8 A;  3IWW A;  4P4J A;  4NGM A;  4P4E A;  2AUM A;  4X3R A;  4C99 A;  4MJX A;  4C8U A;  2PCN A;  5F09 A;  4NGR A;  4C8C A;  1VI4 A;  1CE8 B;  3K4I A;  1VBG A;  1Z8L A;  3FF3 A;  3FEE A;  4E5S A;  4C9U A;  3TLA A;  4C86 A;  3TLY A;  4JZ0 A;  3BI0 A;  4P45 A;  4P4B A;  3EZA A;  3TLG B;  3ICU A;  4KNG E;  4MCP A;  3TLC A;  3BHX A;  3D7F A;  4NGP A;  2OOT A;  4OME A;  3BI1 A;  2FM4 A;  5F5X A;  4OC5 A;  4C8T A;  3RBU A;  1V6C A;  4MCR A;  4OC0 A;  2E28 A;  3G23 A;  4W9Y A;  1C3O B;  3SJE A;  5F1Y A;  1DIK A; 
#chains in the Genus database with same CATH homology
 4YN3 A;  2JBK A;  3K9T A;  3IIB A;  3I6S A;  3FEC A;  2XEG A;  3S9N A;  2XEF A;  4MCQ A;  3D7G A;  3SJG A;  3S9L A;  4TJX A;  4C85 A;  2C6C A;  3SJF A;  4P4D A;  4C9R A;  4OC3 A;  3SJX A;  4TJV A;  4NGN A;  2PVV A;  5IB9 A;  3S9M A;  4OC2 A;  4OC1 A;  5D29 A;  4NGS A;  2JBJ A;  1XF1 A;  4LQG A;  3D7H A;  4NGQ A;  3FED A;  3EIF A;  3I74 A;  4C8F A;  1Y9Z A;  2C6P A;  4TWE A;  4C9A A;  2EK9 A;  3BXM A;  4C8P A;  4OC4 A;  1DE4 C;  1WVM A;  2XEJ A;  3KAS A;  4C9V A;  4CDJ A;  3D7D A;  2C6G A;  2PVW A;  4JYW A;  5ELY A;  4C9E A;  2EK8 A;  2CIJ A;  4NGT A;  4P4I A;  4P44 A;  4CDK A;  5IR2 A;  2XEI A;  4P4F A;  4MCS A;  4C8A A;  2GP4 A;  4C84 A;  3VTA A;  2OR4 A;  2C5Q A;  1CX8 A;  3IWW A;  4P4J A;  4NGM A;  4P4E A;  4X3R A;  4C99 A;  4C8U A;  5F09 A;  4NGR A;  4C8C A;  3FF3 A;  1Z8L A;  3FEE A;  4C9U A;  4C86 A;  4JZ0 A;  3BI0 A;  4P45 A;  4P4B A;  3ICU A;  4KNG E;  4MCP A;  3BHX A;  3D7F A;  4NGP A;  2OOT A;  4OME A;  3BI1 A;  4OC5 A;  4C8T A;  3RBU A;  1V6C A;  4MCR A;  4OC0 A;  4W9Y A;  3SJE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...