4C9UA

Xenopus znrf3 ectodomain in complex with xenopus rspo2 fu1-fu2 crystal form ii
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
161
structure length
161
Chain Sequence
ETGESLAKETAFVEVVLFESSPNGDYKTHTTELQGRFSRAGATISAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPEMDPKPCLTVLGKAKRAVQRGATAVIFDVSDNPDAVEQLNQGLEDPLKRPVVYMKGMDAIKLMNIVNKQKGARARIQHRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb
source organism Xenopus (silurana) tropicalis
molecule tags Ligase/signaling protein
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
total genus 39
structure length 161
sequence length 161
chains with identical sequence C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4c9uA00
4JZ0A 4YN3A 3D7HA 3D7GA 1WVMA 4W9YA 4C8FA 1DE4C 4P45A 1V6CA 4NGMA 3D7FA 3I74A 2EK9A 2C6CA 2XEJA 5ELYA 4P4JA 3VTAA 4OC5A 4OC1A 4C86A 4P4EA 1Y9ZA 3FEDA 4OC4A 4NGQA 3S9LA 4NGTA 4LQGA 4MCQA 4MCPA 2PVVA 3S9MA 5F09A 4C9AA 2PVWA 4OMEA 3FEEA 4C9VA 4P4IA 4P4FA 3KASA 3RBUA 4P44A 4C9RA 4NGSA 4CDJA 1XF1A 4MCSA 2XEFA 5D29A 3IWWA 4C9EA 4MCRA 5IB9A 3BXMA 2XEGA 2EK8A 2OR4A 3IIBA 4KNGE 3SJXA 3D7DA 2XEIA 2CIJA 3FECA 3SJFA 1Z8LA 4TWEA 4P4DA 4C8TA 4C84A 4OC2A 4CDKA 4C8PA 1CX8A 4X3RA 2C6PA 4NGPA 4C8AA 3S9NA 3BI1A 4JYWA 2JBKA 2JBJA 3I6SA 4TJVA 4C8CA 4C9UA 3BHXA 3EIFA 4C85A 4NGRA 4OC0A 3ICUA 3SJGA 4C8UA 3FF3A 4C99A 4TJXA 2OOTA 4NGNA 2C6GA 4OC3A 3SJEA 3BI0A 4P4BA
chains in the Genus database with same CATH superfamily
1NBWA 4JZ0A 4YN3A 1JDBC 3D7HA 3D7GA 2EZCA 3TLEA 1VBGA 1WVMA 4W9YA 2YJTA 3KRVA 3NOJA 4C8FA 2YJVA 1A9XB 1DE4C 2GP4A 4COBA 4P45A 1V6CA 4NGMA 3D7FA 1R61A 3I74A 2MP0A 1KC7A 1EZAA 2AUMA 2EK9A 4J0NA 1ZRSA 2C6CA 2E28A 2XEJA 3K9TA 5ELYA 4P4JA 3VTAA 4MJXA 3G23A 4OC5A 4OC1A 2R82A 4C86A 2EZBA 4JVOA 2PCNA 4P4EA 1Y9ZA 3TLAA 1C30B 3FEDA 2FM4A 1BXRB 4OC4A 3T5MA 4NGQA 2D0OA 3TLCA 5F9MA 3EZBA 3S9LA 1KEEB 4NGTA 1DIKA 4LQGA 5F5XA 1EZBA 4MCQA 4MCPA 4MI1A 3T0TA 2PVVA 3S9MA 5F09A 4C9AA 4IIYA 1Q5XA 3T07A 2PVWA 5FD8A 4OMEA 3U1BA 3FEEA 4C9VA 4P4IA 4P4FA 4EYSA 2HI6A 1VBHA 3KASA 3RBUA 2HWGA 2B0AA 4P44A 4C9RA 4NGSA 2DIKA 3T05A 4CDJA 3TLYA 3TYXA 1XF1A 3TLZA 4MCSA 2X0SA 3SR3A 1M6VB 2XEFA 5D29A 3IWWA 4C9EA 3TLBA 4H1HA 4MCRA 5IB9A 3BXMA 1ZYMA 2XEGA 2EK8A 2OR4A 3IIBA 4KNGE 3SJXA 3D7DA 1C3OB 1GGOA 4E94A 1J3LA 2XEIA 3EZEA 2CIJA 3FECA 3SJFA 1Z8LA 3K4IA 4TWEA 4P4DA 4C8TA 4CO9A 3EZAA 4C84A 5JVLA 1T36B 3C8OA 4OC2A 4CDKA 4C8PA 1CX8A 3GJZA 1JDEA 4X3RA 2C6PA 4NGPA 4C8AA 3S9NA 1CE8B 1KBLA 3BI1A 4JYWA 2AUNA 4M8DA 2JBKA 2JBJA 5F1YA 3I6SA 4TJVA 5K99A 4C8CA 4C9UA 3BHXA 3EIFA 4C85A 2D0PA 4NGRA 4OC0A 2OLSA 3ICUA 2EZAA 2HROA 4CZ1A 3SJGA 4C8UA 1VI4A 3FF3A 1NXJA 3TLGA 4C99A 4TJXA 4IIXA 2OOTA 4INJA 4NGNA 4COGA 5JYBA 2C6GA 1CS0B 4OC3A 3TLGB 1ZL0A 5IR2A 3SJEA 4E5SA 2C5QA 3BI0A 4P4BA
chains in the Genus database with same CATH topology
4JZ0A 4YN3A 3D7HA 3D7GA 1WVMA 4W9YA 4C8FA 1DE4C 2GP4A 4P45A 1V6CA 4NGMA 3D7FA 3I74A 2EK9A 2C6CA 2XEJA 3K9TA 5ELYA 4P4JA 3VTAA 4OC5A 4OC1A 4C86A 4P4EA 1Y9ZA 3FEDA 4OC4A 4NGQA 3S9LA 4NGTA 4LQGA 4MCQA 4MCPA 2PVVA 3S9MA 5F09A 4C9AA 2PVWA 4OMEA 3FEEA 4C9VA 4P4IA 4P4FA 3KASA 3RBUA 4P44A 4C9RA 4NGSA 4CDJA 1XF1A 4MCSA 2XEFA 5D29A 3IWWA 4C9EA 4MCRA 5IB9A 3BXMA 2XEGA 2EK8A 2OR4A 3IIBA 4KNGE 3SJXA 3D7DA 2XEIA 2CIJA 3FECA 3SJFA 1Z8LA 4TWEA 4P4DA 4C8TA 4C84A 4OC2A 4CDKA 4C8PA 1CX8A 4X3RA 2C6PA 4NGPA 4C8AA 3S9NA 3BI1A 4JYWA 2JBKA 2JBJA 3I6SA 4TJVA 4C8CA 4C9UA 3BHXA 3EIFA 4C85A 4NGRA 4OC0A 3ICUA 3SJGA 4C8UA 3FF3A 4C99A 4TJXA 2OOTA 4NGNA 2C6GA 4OC3A 5IR2A 3SJEA 2C5QA 3BI0A 4P4BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JZ0 A;  4YN3 A;  3D7H A;  3D7G A;  1WVM A;  4W9Y A;  4C8F A;  1DE4 C;  4P45 A;  1V6C A;  4NGM A;  3D7F A;  3I74 A;  2EK9 A;  2C6C A;  2XEJ A;  5ELY A;  4P4J A;  3VTA A;  4OC5 A;  4OC1 A;  4C86 A;  4P4E A;  1Y9Z A;  3FED A;  4OC4 A;  4NGQ A;  3S9L A;  4NGT A;  4LQG A;  4MCQ A;  4MCP A;  2PVV A;  3S9M A;  5F09 A;  4C9A A;  2PVW A;  4OME A;  3FEE A;  4C9V A;  4P4I A;  4P4F A;  3KAS A;  3RBU A;  4P44 A;  4C9R A;  4NGS A;  4CDJ A;  1XF1 A;  4MCS A;  2XEF A;  5D29 A;  3IWW A;  4C9E A;  4MCR A;  5IB9 A;  3BXM A;  2XEG A;  2EK8 A;  2OR4 A;  3IIB A;  4KNG E;  3SJX A;  3D7D A;  2XEI A;  2CIJ A;  3FEC A;  3SJF A;  1Z8L A;  4TWE A;  4P4D A;  4C8T A;  4C84 A;  4OC2 A;  4CDK A;  4C8P A;  1CX8 A;  4X3R A;  2C6P A;  4NGP A;  4C8A A;  3S9N A;  3BI1 A;  4JYW A;  2JBK A;  2JBJ A;  3I6S A;  4TJV A;  4C8C A;  4C9U A;  3BHX A;  3EIF A;  4C85 A;  4NGR A;  4OC0 A;  3ICU A;  3SJG A;  4C8U A;  3FF3 A;  4C99 A;  4TJX A;  2OOT A;  4NGN A;  2C6G A;  4OC3 A;  3SJE A;  3BI0 A;  4P4B A; 
#chains in the Genus database with same CATH topology
 1NBW A;  4JZ0 A;  4YN3 A;  1JDB C;  3D7H A;  3D7G A;  2EZC A;  3TLE A;  1VBG A;  1WVM A;  4W9Y A;  2YJT A;  3KRV A;  3NOJ A;  4C8F A;  2YJV A;  1A9X B;  1DE4 C;  2GP4 A;  4COB A;  4P45 A;  1V6C A;  4NGM A;  3D7F A;  1R61 A;  3I74 A;  2MP0 A;  1KC7 A;  1EZA A;  2AUM A;  2EK9 A;  4J0N A;  1ZRS A;  2C6C A;  2E28 A;  2XEJ A;  3K9T A;  5ELY A;  4P4J A;  3VTA A;  4MJX A;  3G23 A;  4OC5 A;  4OC1 A;  2R82 A;  4C86 A;  2EZB A;  4JVO A;  2PCN A;  4P4E A;  1Y9Z A;  3TLA A;  1C30 B;  3FED A;  2FM4 A;  1BXR B;  4OC4 A;  3T5M A;  4NGQ A;  2D0O A;  3TLC A;  5F9M A;  3EZB A;  3S9L A;  1KEE B;  4NGT A;  1DIK A;  4LQG A;  5F5X A;  1EZB A;  4MCQ A;  4MCP A;  4MI1 A;  3T0T A;  2PVV A;  3S9M A;  5F09 A;  4C9A A;  4IIY A;  1Q5X A;  3T07 A;  2PVW A;  5FD8 A;  4OME A;  3U1B A;  3FEE A;  4C9V A;  4P4I A;  4P4F A;  4EYS A;  2HI6 A;  1VBH A;  3KAS A;  3RBU A;  2HWG A;  2B0A A;  4P44 A;  4C9R A;  4NGS A;  2DIK A;  3T05 A;  4CDJ A;  3TLY A;  3TYX A;  1XF1 A;  3TLZ A;  4MCS A;  2X0S A;  3SR3 A;  1M6V B;  2XEF A;  5D29 A;  3IWW A;  4C9E A;  3TLB A;  4H1H A;  4MCR A;  5IB9 A;  3BXM A;  1ZYM A;  2XEG A;  2EK8 A;  2OR4 A;  3IIB A;  4KNG E;  3SJX A;  3D7D A;  1C3O B;  1GGO A;  4E94 A;  1J3L A;  2XEI A;  3EZE A;  2CIJ A;  3FEC A;  3SJF A;  1Z8L A;  3K4I A;  4TWE A;  4P4D A;  4C8T A;  4CO9 A;  3EZA A;  4C84 A;  5JVL A;  1T36 B;  3C8O A;  4OC2 A;  4CDK A;  4C8P A;  1CX8 A;  3GJZ A;  1JDE A;  4X3R A;  2C6P A;  4NGP A;  4C8A A;  3S9N A;  1CE8 B;  1KBL A;  3BI1 A;  4JYW A;  2AUN A;  4M8D A;  2JBK A;  2JBJ A;  5F1Y A;  3I6S A;  4TJV A;  5K99 A;  4C8C A;  4C9U A;  3BHX A;  3EIF A;  4C85 A;  2D0P A;  4NGR A;  4OC0 A;  2OLS A;  3ICU A;  2EZA A;  2HRO A;  4CZ1 A;  3SJG A;  4C8U A;  1VI4 A;  3FF3 A;  1NXJ A;  3TLG A;  4C99 A;  4TJX A;  4IIX A;  2OOT A;  4INJ A;  4NGN A;  4COG A;  5JYB A;  2C6G A;  1CS0 B;  4OC3 A;  3TLG B;  1ZL0 A;  5IR2 A;  3SJE A;  4E5S A;  2C5Q A;  3BI0 A;  4P4B A; 
#chains in the Genus database with same CATH homology
 4JZ0 A;  4YN3 A;  3D7H A;  3D7G A;  1WVM A;  4W9Y A;  4C8F A;  1DE4 C;  2GP4 A;  4P45 A;  1V6C A;  4NGM A;  3D7F A;  3I74 A;  2EK9 A;  2C6C A;  2XEJ A;  3K9T A;  5ELY A;  4P4J A;  3VTA A;  4OC5 A;  4OC1 A;  4C86 A;  4P4E A;  1Y9Z A;  3FED A;  4OC4 A;  4NGQ A;  3S9L A;  4NGT A;  4LQG A;  4MCQ A;  4MCP A;  2PVV A;  3S9M A;  5F09 A;  4C9A A;  2PVW A;  4OME A;  3FEE A;  4C9V A;  4P4I A;  4P4F A;  3KAS A;  3RBU A;  4P44 A;  4C9R A;  4NGS A;  4CDJ A;  1XF1 A;  4MCS A;  2XEF A;  5D29 A;  3IWW A;  4C9E A;  4MCR A;  5IB9 A;  3BXM A;  2XEG A;  2EK8 A;  2OR4 A;  3IIB A;  4KNG E;  3SJX A;  3D7D A;  2XEI A;  2CIJ A;  3FEC A;  3SJF A;  1Z8L A;  4TWE A;  4P4D A;  4C8T A;  4C84 A;  4OC2 A;  4CDK A;  4C8P A;  1CX8 A;  4X3R A;  2C6P A;  4NGP A;  4C8A A;  3S9N A;  3BI1 A;  4JYW A;  2JBK A;  2JBJ A;  3I6S A;  4TJV A;  4C8C A;  4C9U A;  3BHX A;  3EIF A;  4C85 A;  4NGR A;  4OC0 A;  3ICU A;  3SJG A;  4C8U A;  3FF3 A;  4C99 A;  4TJX A;  2OOT A;  4NGN A;  2C6G A;  4OC3 A;  5IR2 A;  3SJE A;  2C5Q A;  3BI0 A;  4P4B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...