4M8DA

Crystal structure of an isatin hydrolase bound to product analogue thioisatinate
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
262
structure length
262
Chain Sequence
b'MSAQSALSGLGAKLLSGEVEVVDCTGVLGPNTPILQLPPDFAKNTPKVEIHKISEYDSDGPFFAWNWMVLGEHSGTHFDAPHHWITGKDYSDGFTDTLDVQRLIAPVNVIDCSKESAADPDFLLTADLIKAWEAEHGEIGAGEWVVMRTDWDKRAGDEAAFLNADETGPHSPGPTPDAIEYLLSKKIVGWGSQCIGTDAGQAGGMEPPFPAHNLLHRDNCFGLASLANLDKLPAKGAILIAAPLKIERGTGSPIRALALVPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title A proton wire and water channel revealed in the crystal structure of isatin hydrolase.
pubmed doi rcsb
source organism Labrenzia aggregata
molecule tags Hydrolase
total genus 78
structure length 262
sequence length 262
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.5.2.20: Isatin hydrolase.
pdb deposition date 2013-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04199 Cyclase Putative cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.50 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Putative cyclase 4m8dA00
4COGA 4CZ1A 4COBA 4CO9A 4M8DA 3KRVA 2B0AA 4J0NA 1R61A
chains in the Genus database with same CATH superfamily
4TWEA 4COBA 3EZBA 5D29A 2R82A 3K9TA 4MCRA 3T0TA 2X0SA 2GP4A 4M8DA 4CDJA 1A9XB 3VTAA 4MJXA 4MCPA 4P4BA 1NXJA 3BI1A 4C8CA 4CDKA 1XF1A 1KEEB 4OC0A 3EIFA 4YN3A 1R61A 2XEFA 4MCSA 1EZAA 4C9RA 4NGTA 4NGMA 1ZL0A 4C99A 1CS0B 4W9YA 3TLYA 3KRVA 1CX8A 4KNGE 3SJGA 2YJVA 3RBUA 2C5QA 1V6CA 3GJZA 3I74A 2OLSA 1CE8B 2XEJA 3FEEA 4IIXA 3BXMA 3S9MA 2XEGA 3D7FA 3TLAA 1T36B 5F09A 1DIKA 2YJTA 1JDEA 3G23A 4OC4A 3SJEA 3SJXA 3BI0A 4P4FA 4TJVA 4IIYA 3NOJA 3FECA 4NGSA 3FF3A 3ICUA 4C8TA 3SR3A 2C6GA 4C8FA 2FM4A 3S9LA 2MP0A 3BHXA 4P4IA 3K4IA 4OC2A 3IIBA 3EZEA 2D0OA 3D7DA 1GGOA 4LQGA 3TLGB 3T5MA 1J3LA 1KBLA 2EK9A 1C30B 4CO9A 4X3RA 4NGNA 3TLGA 2AUNA 3TLEA 5F1YA 1ZYMA 4NGRA 4OC5A 3IWWA 4INJA 2JBKA 3TLCA 3TYXA 4C9UA 1DE4C 3D7GA 2DIKA 2JBJA 4MI1A 3T07A 4OC3A 4C9VA 4JVOA 2E28A 4J0NA 2C6CA 4E5SA 3T05A 3KASA 4CZ1A 2HI6A 1BXRB 2OOTA 2XEIA 3SJFA 2AUMA 2EK8A 4C9EA 2CIJA 5K99A 1EZBA 4OC1A 4P4EA 4NGPA 4OMEA 5IR2A 4C9AA 5ELYA 4JYWA 3C8OA 1VBHA 2HROA 2PVWA 4MCQA 2EZBA 1M6VB 2HWGA 2C6PA 4COGA 4E94A 3TLBA 3D7HA 3FEDA 4C8AA 4C86A 1Q5XA 4C8PA 5IB9A 2D0PA 3S9NA 1JDBC 1WVMA 1KC7A 2PVVA 3U1BA 4C85A 2EZAA 2OR4A 4JZ0A 3EZAA 4EYSA 3I6SA 1NBWA 3TLZA 5JYBA 1VBGA 4TJXA 5F9MA 2PCNA 4H1HA 1C3OB 4P45A 1VI4A 5FD8A 5F5XA 5JVLA 4C84A 4P4DA 4P44A 1Z8LA 4P4JA 4NGQA 4C8UA 2B0AA 1ZRSA 2EZCA 1Y9ZA
chains in the Genus database with same CATH topology
4COGA 4CZ1A 4COBA 4CO9A 4M8DA 3KRVA 2B0AA 4J0NA 1R61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4COG A;  4CZ1 A;  4COB A;  4CO9 A;  4M8D A;  3KRV A;  2B0A A;  4J0N A;  1R61 A; 
#chains in the Genus database with same CATH topology
 4TWE A;  4COB A;  3EZB A;  5D29 A;  2R82 A;  3K9T A;  4MCR A;  3T0T A;  2X0S A;  2GP4 A;  4M8D A;  4CDJ A;  1A9X B;  3VTA A;  4MJX A;  4MCP A;  4P4B A;  1NXJ A;  3BI1 A;  4C8C A;  4CDK A;  1XF1 A;  1KEE B;  4OC0 A;  3EIF A;  4YN3 A;  1R61 A;  2XEF A;  4MCS A;  1EZA A;  4C9R A;  4NGT A;  4NGM A;  1ZL0 A;  4C99 A;  1CS0 B;  4W9Y A;  3TLY A;  3KRV A;  1CX8 A;  4KNG E;  3SJG A;  2YJV A;  3RBU A;  2C5Q A;  1V6C A;  3GJZ A;  3I74 A;  2OLS A;  1CE8 B;  2XEJ A;  3FEE A;  4IIX A;  3BXM A;  3S9M A;  2XEG A;  3D7F A;  3TLA A;  1T36 B;  5F09 A;  1DIK A;  2YJT A;  1JDE A;  3G23 A;  4OC4 A;  3SJE A;  3SJX A;  3BI0 A;  4P4F A;  4TJV A;  4IIY A;  3NOJ A;  3FEC A;  4NGS A;  3FF3 A;  3ICU A;  4C8T A;  3SR3 A;  2C6G A;  4C8F A;  2FM4 A;  3S9L A;  2MP0 A;  3BHX A;  4P4I A;  3K4I A;  4OC2 A;  3IIB A;  3EZE A;  2D0O A;  3D7D A;  1GGO A;  4LQG A;  3TLG B;  3T5M A;  1J3L A;  1KBL A;  2EK9 A;  1C30 B;  4CO9 A;  4X3R A;  4NGN A;  3TLG A;  2AUN A;  3TLE A;  5F1Y A;  1ZYM A;  4NGR A;  4OC5 A;  3IWW A;  4INJ A;  2JBK A;  3TLC A;  3TYX A;  4C9U A;  1DE4 C;  3D7G A;  2DIK A;  2JBJ A;  4MI1 A;  3T07 A;  4OC3 A;  4C9V A;  4JVO A;  2E28 A;  4J0N A;  2C6C A;  4E5S A;  3T05 A;  3KAS A;  4CZ1 A;  2HI6 A;  1BXR B;  2OOT A;  2XEI A;  3SJF A;  2AUM A;  2EK8 A;  4C9E A;  2CIJ A;  5K99 A;  1EZB A;  4OC1 A;  4P4E A;  4NGP A;  4OME A;  5IR2 A;  4C9A A;  5ELY A;  4JYW A;  3C8O A;  1VBH A;  2HRO A;  2PVW A;  4MCQ A;  2EZB A;  1M6V B;  2HWG A;  2C6P A;  4COG A;  4E94 A;  3TLB A;  3D7H A;  3FED A;  4C8A A;  4C86 A;  1Q5X A;  4C8P A;  5IB9 A;  2D0P A;  3S9N A;  1JDB C;  1WVM A;  1KC7 A;  2PVV A;  3U1B A;  4C85 A;  2EZA A;  2OR4 A;  4JZ0 A;  3EZA A;  4EYS A;  3I6S A;  1NBW A;  3TLZ A;  5JYB A;  1VBG A;  4TJX A;  5F9M A;  2PCN A;  4H1H A;  1C3O B;  4P45 A;  1VI4 A;  5FD8 A;  5F5X A;  5JVL A;  4C84 A;  4P4D A;  4P44 A;  1Z8L A;  4P4J A;  4NGQ A;  4C8U A;  2B0A A;  1ZRS A;  2EZC A;  1Y9Z A; 
#chains in the Genus database with same CATH homology
 4COG A;  4CZ1 A;  4COB A;  4CO9 A;  4M8D A;  3KRV A;  2B0A A;  4J0N A;  1R61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...