4M8DA

Crystal structure of an isatin hydrolase bound to product analogue thioisatinate
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
262
structure length
262
Chain Sequence
MSAQSALSGLGAKLLSGEVEVVDCTGVLGPNTPILQLPPDFAKNTPKVEIHKISEYDSDGPFFAWNWMVLGEHSGTHFDAPHHWITGKDYSDGFTDTLDVQRLIAPVNVIDCSKESAADPDFLLTADLIKAWEAEHGEIGAGEWVVMRTDWDKRAGDEAAFLNADETGPHSPGPTPDAIEYLLSKKIVGWGSQCIGTDAGQAGGMEPPFPAHNLLHRDNCFGLASLANLDKLPAKGAILIAAPLKIERGTGSPIRALALVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A proton wire and water channel revealed in the crystal structure of isatin hydrolase.
pubmed doi rcsb
source organism Labrenzia aggregata
molecule tags Hydrolase
molecule keywords Putative uncharacterized protein
total genus 78
structure length 262
sequence length 262
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.5.2.20: Isatin hydrolase.
pdb deposition date 2013-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04199 Cyclase Putative cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.50 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Putative cyclase 4m8dA00
4CO9A 4M8DA 4J0NA 2B0AA 4CZ1A 4COBA 3KRVA 4COGA 1R61A
chains in the Genus database with same CATH superfamily
3ICUA 4C99A 2XEFA 3IWWA 4JYWA 3BI1A 5JVLA 1T36B 2E28A 4MCRA 4TJXA 1VBHA 1JDBC 3TLCA 3SJFA 3KASA 3TLAA 3S9MA 3EIFA 1Y9ZA 1JDEA 3GJZA 4NGQA 3T07A 5F09A 5IR2A 3TYXA 1XF1A 3VTAA 3K4IA 1Z8LA 4OC2A 4COGA 2JBKA 1KBLA 5D29A 1CX8A 4OC3A 2EK8A 3S9LA 2JBJA 4NGPA 4M8DA 1KC7A 2OR4A 4C9VA 3C8OA 4INJA 2C6GA 1KEEB 4P44A 4C9AA 4C84A 2OOTA 4MCSA 3SR3A 4CDKA 4C9EA 3FEDA 4E5SA 1ZYMA 3TLGB 4C9RA 3TLZA 2PCNA 4C9UA 4P4JA 3T5MA 4IIXA 4TWEA 2XEIA 4OC5A 3D7GA 2EK9A 4YN3A 4P4BA 3TLEA 4C8TA 4P4EA 2R82A 4NGTA 3FEEA 4NGRA 1DE4C 5F9MA 3IIBA 1ZL0A 4H1HA 2C6CA 3U1BA 3EZBA 4C8PA 2B0AA 2EZBA 4MCPA 4C8AA 2C5QA 1V6CA 4P45A 2YJTA 2C6PA 4P4FA 4W9YA 4LQGA 4CZ1A 4MCQA 4KNGE 5IB9A 5K99A 3NOJA 3S9NA 4JVOA 3SJXA 2PVWA 4X3RA 2XEGA 4OMEA 4CDJA 5JYBA 5ELYA 1ZRSA 3G23A 3FECA 3D7DA 4MJXA 1WVMA 1BXRB 1NBWA 4CO9A 2HROA 5F1YA 1Q5XA 4C8FA 4C85A 5FD8A 3I74A 1J3LA 4P4DA 2HI6A 2D0OA 3EZEA 4JZ0A 4C8CA 2FM4A 1CE8B 4P4IA 4C8UA 2OLSA 3I6SA 3TLYA 4COBA 3SJGA 1VI4A 4NGNA 3D7HA 1EZBA 1DIKA 3RBUA 4NGSA 1C30B 2YJVA 1VBGA 2PVVA 3T05A 3T0TA 3TLBA 1C3OB 2XEJA 3EZAA 3D7FA 3K9TA 5F5XA 1A9XB 1M6VB 2D0PA 2DIKA 3KRVA 3TLGA 2AUNA 4EYSA 3BI0A 1EZAA 1GGOA 2GP4A 1R61A 2HWGA 2MP0A 4E94A 4OC4A 1NXJA 2EZCA 1CS0B 2X0SA 3BXMA 4J0NA 2AUMA 2EZAA 4NGMA 4OC1A 2CIJA 3SJEA 3FF3A 4MI1A 4C86A 4IIYA 4TJVA 3BHXA 4OC0A
chains in the Genus database with same CATH topology
4CO9A 4M8DA 4J0NA 2B0AA 4CZ1A 4COBA 3KRVA 4COGA 1R61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CO9 A;  4M8D A;  4J0N A;  2B0A A;  4CZ1 A;  4COB A;  3KRV A;  4COG A;  1R61 A; 
#chains in the Genus database with same CATH topology
 3ICU A;  4C99 A;  2XEF A;  3IWW A;  4JYW A;  3BI1 A;  5JVL A;  1T36 B;  2E28 A;  4MCR A;  4TJX A;  1VBH A;  1JDB C;  3TLC A;  3SJF A;  3KAS A;  3TLA A;  3S9M A;  3EIF A;  1Y9Z A;  1JDE A;  3GJZ A;  4NGQ A;  3T07 A;  5F09 A;  5IR2 A;  3TYX A;  1XF1 A;  3VTA A;  3K4I A;  1Z8L A;  4OC2 A;  4COG A;  2JBK A;  1KBL A;  5D29 A;  1CX8 A;  4OC3 A;  2EK8 A;  3S9L A;  2JBJ A;  4NGP A;  4M8D A;  1KC7 A;  2OR4 A;  4C9V A;  3C8O A;  4INJ A;  2C6G A;  1KEE B;  4P44 A;  4C9A A;  4C84 A;  2OOT A;  4MCS A;  3SR3 A;  4CDK A;  4C9E A;  3FED A;  4E5S A;  1ZYM A;  3TLG B;  4C9R A;  3TLZ A;  2PCN A;  4C9U A;  4P4J A;  3T5M A;  4IIX A;  4TWE A;  2XEI A;  4OC5 A;  3D7G A;  2EK9 A;  4YN3 A;  4P4B A;  3TLE A;  4C8T A;  4P4E A;  2R82 A;  4NGT A;  3FEE A;  4NGR A;  1DE4 C;  5F9M A;  3IIB A;  1ZL0 A;  4H1H A;  2C6C A;  3U1B A;  3EZB A;  4C8P A;  2B0A A;  2EZB A;  4MCP A;  4C8A A;  2C5Q A;  1V6C A;  4P45 A;  2YJT A;  2C6P A;  4P4F A;  4W9Y A;  4LQG A;  4CZ1 A;  4MCQ A;  4KNG E;  5IB9 A;  5K99 A;  3NOJ A;  3S9N A;  4JVO A;  3SJX A;  2PVW A;  4X3R A;  2XEG A;  4OME A;  4CDJ A;  5JYB A;  5ELY A;  1ZRS A;  3G23 A;  3FEC A;  3D7D A;  4MJX A;  1WVM A;  1BXR B;  1NBW A;  4CO9 A;  2HRO A;  5F1Y A;  1Q5X A;  4C8F A;  4C85 A;  5FD8 A;  3I74 A;  1J3L A;  4P4D A;  2HI6 A;  2D0O A;  3EZE A;  4JZ0 A;  4C8C A;  2FM4 A;  1CE8 B;  4P4I A;  4C8U A;  2OLS A;  3I6S A;  3TLY A;  4COB A;  3SJG A;  1VI4 A;  4NGN A;  3D7H A;  1EZB A;  1DIK A;  3RBU A;  4NGS A;  1C30 B;  2YJV A;  1VBG A;  2PVV A;  3T05 A;  3T0T A;  3TLB A;  1C3O B;  2XEJ A;  3EZA A;  3D7F A;  3K9T A;  5F5X A;  1A9X B;  1M6V B;  2D0P A;  2DIK A;  3KRV A;  3TLG A;  2AUN A;  4EYS A;  3BI0 A;  1EZA A;  1GGO A;  2GP4 A;  1R61 A;  2HWG A;  2MP0 A;  4E94 A;  4OC4 A;  1NXJ A;  2EZC A;  1CS0 B;  2X0S A;  3BXM A;  4J0N A;  2AUM A;  2EZA A;  4NGM A;  4OC1 A;  2CIJ A;  3SJE A;  3FF3 A;  4MI1 A;  4C86 A;  4IIY A;  4TJV A;  3BHX A;  4OC0 A; 
#chains in the Genus database with same CATH homology
 4CO9 A;  4M8D A;  4J0N A;  2B0A A;  4CZ1 A;  4COB A;  3KRV A;  4COG A;  1R61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...