4M8DA

Crystal structure of an isatin hydrolase bound to product analogue thioisatinate
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
262
structure length
262
Chain Sequence
MSAQSALSGLGAKLLSGEVEVVDCTGVLGPNTPILQLPPDFAKNTPKVEIHKISEYDSDGPFFAWNWMVLGEHSGTHFDAPHHWITGKDYSDGFTDTLDVQRLIAPVNVIDCSKESAADPDFLLTADLIKAWEAEHGEIGAGEWVVMRTDWDKRAGDEAAFLNADETGPHSPGPTPDAIEYLLSKKIVGWGSQCIGTDAGQAGGMEPPFPAHNLLHRDNCFGLASLANLDKLPAKGAILIAAPLKIERGTGSPIRALALVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title A proton wire and water channel revealed in the crystal structure of isatin hydrolase.
pubmed doi rcsb
source organism Labrenzia aggregata
molecule tags Hydrolase
total genus 78
structure length 262
sequence length 262
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.5.2.20: Isatin hydrolase.
pdb deposition date 2013-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04199 Cyclase Putative cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.50 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Putative cyclase 4m8dA00
4COGA 4J0NA 2B0AA 4CZ1A 4COBA 3KRVA 1R61A 4CO9A 4M8DA
chains in the Genus database with same CATH superfamily
2CIJA 4TJXA 3G23A 4X3RA 2EZBA 3BHXA 4OC0A 5IR2A 2PCNA 2PVWA 4NGQA 3T5MA 3T05A 4M8DA 1V6CA 3T07A 3EIFA 4MJXA 3FEDA 1JDEA 3TLGB 4P44A 4MI1A 3TLCA 2XEIA 2EK9A 4OC3A 4JYWA 3SJFA 2OLSA 4H1HA 3TLZA 4C9VA 3BI0A 3D7DA 1KC7A 4EYSA 1T36B 4OC2A 4C86A 2GP4A 2EZAA 5D29A 4OC5A 4NGSA 2HI6A 2C6GA 2XEFA 2JBJA 5FD8A 4C85A 4JZ0A 5F9MA 4P4EA 4C8TA 3S9LA 2HWGA 1VBHA 3I6SA 3U1BA 3FECA 4TJVA 4MCRA 4C9AA 4C8AA 1DE4C 4NGNA 5F5XA 1J3LA 5F1YA 3SJEA 3EZAA 4P4IA 1NXJA 1ZL0A 1JDBC 3GJZA 3FEEA 3S9NA 1ZRSA 1ZYMA 3D7GA 3FF3A 4OC4A 4J0NA 3K4IA 3TLYA 4C8FA 2XEJA 3IWWA 3BI1A 4YN3A 2OOTA 2AUMA 1KBLA 1Q5XA 1BXRB 2D0OA 2X0SA 4JVOA 4TWEA 5ELYA 2XEGA 2DIKA 3TLEA 1EZBA 1GGOA 4OC1A 3S9MA 2AUNA 5F09A 2FM4A 3EZBA 4INJA 3KASA 4C8CA 1CX8A 3D7FA 1KEEB 4MCSA 4C8PA 1CS0B 3TLAA 3KRVA 1C30B 4KNGE 1VI4A 4P45A 3TLGA 1M6VB 4CDJA 4CZ1A 2C6PA 3VTAA 4P4JA 1NBWA 2OR4A 2EK8A 5JVLA 5K99A 4MCQA 4C84A 4IIXA 4E5SA 4NGTA 3ICUA 2D0PA 5JYBA 2PVVA 1R61A 4C8UA 3K9TA 4NGRA 2MP0A 3SJGA 3T0TA 1DIKA 4NGMA 4P4FA 3SJXA 2C5QA 1EZAA 1CE8B 3RBUA 1XF1A 3NOJA 2EZCA 3SR3A 2B0AA 3IIBA 4LQGA 3C8OA 4MCPA 5IB9A 4C9EA 2HROA 1Z8LA 3D7HA 4P4DA 3TYXA 2C6CA 4C9UA 1WVMA 3BXMA 4OMEA 4COBA 4C99A 1Y9ZA 4CDKA 4P4BA 2JBKA 4W9YA 3TLBA 4E94A 3I74A 4COGA 4C9RA 2YJVA 2R82A 1VBGA 3EZEA 1C3OB 4IIYA 4NGPA 2YJTA 4CO9A 2E28A 1A9XB
chains in the Genus database with same CATH topology
4COGA 4J0NA 2B0AA 4CZ1A 4COBA 3KRVA 1R61A 4CO9A 4M8DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4COG A;  4J0N A;  2B0A A;  4CZ1 A;  4COB A;  3KRV A;  1R61 A;  4CO9 A;  4M8D A; 
#chains in the Genus database with same CATH topology
 2CIJ A;  4TJX A;  3G23 A;  4X3R A;  2EZB A;  3BHX A;  4OC0 A;  5IR2 A;  2PCN A;  2PVW A;  4NGQ A;  3T5M A;  3T05 A;  4M8D A;  1V6C A;  3T07 A;  3EIF A;  4MJX A;  3FED A;  1JDE A;  3TLG B;  4P44 A;  4MI1 A;  3TLC A;  2XEI A;  2EK9 A;  4OC3 A;  4JYW A;  3SJF A;  2OLS A;  4H1H A;  3TLZ A;  4C9V A;  3BI0 A;  3D7D A;  1KC7 A;  4EYS A;  1T36 B;  4OC2 A;  4C86 A;  2GP4 A;  2EZA A;  5D29 A;  4OC5 A;  4NGS A;  2HI6 A;  2C6G A;  2XEF A;  2JBJ A;  5FD8 A;  4C85 A;  4JZ0 A;  5F9M A;  4P4E A;  4C8T A;  3S9L A;  2HWG A;  1VBH A;  3I6S A;  3U1B A;  3FEC A;  4TJV A;  4MCR A;  4C9A A;  4C8A A;  1DE4 C;  4NGN A;  5F5X A;  1J3L A;  5F1Y A;  3SJE A;  3EZA A;  4P4I A;  1NXJ A;  1ZL0 A;  1JDB C;  3GJZ A;  3FEE A;  3S9N A;  1ZRS A;  1ZYM A;  3D7G A;  3FF3 A;  4OC4 A;  4J0N A;  3K4I A;  3TLY A;  4C8F A;  2XEJ A;  3IWW A;  3BI1 A;  4YN3 A;  2OOT A;  2AUM A;  1KBL A;  1Q5X A;  1BXR B;  2D0O A;  2X0S A;  4JVO A;  4TWE A;  5ELY A;  2XEG A;  2DIK A;  3TLE A;  1EZB A;  1GGO A;  4OC1 A;  3S9M A;  2AUN A;  5F09 A;  2FM4 A;  3EZB A;  4INJ A;  3KAS A;  4C8C A;  1CX8 A;  3D7F A;  1KEE B;  4MCS A;  4C8P A;  1CS0 B;  3TLA A;  3KRV A;  1C30 B;  4KNG E;  1VI4 A;  4P45 A;  3TLG A;  1M6V B;  4CDJ A;  4CZ1 A;  2C6P A;  3VTA A;  4P4J A;  1NBW A;  2OR4 A;  2EK8 A;  5JVL A;  5K99 A;  4MCQ A;  4C84 A;  4IIX A;  4E5S A;  4NGT A;  3ICU A;  2D0P A;  5JYB A;  2PVV A;  1R61 A;  4C8U A;  3K9T A;  4NGR A;  2MP0 A;  3SJG A;  3T0T A;  1DIK A;  4NGM A;  4P4F A;  3SJX A;  2C5Q A;  1EZA A;  1CE8 B;  3RBU A;  1XF1 A;  3NOJ A;  2EZC A;  3SR3 A;  2B0A A;  3IIB A;  4LQG A;  3C8O A;  4MCP A;  5IB9 A;  4C9E A;  2HRO A;  1Z8L A;  3D7H A;  4P4D A;  3TYX A;  2C6C A;  4C9U A;  1WVM A;  3BXM A;  4OME A;  4COB A;  4C99 A;  1Y9Z A;  4CDK A;  4P4B A;  2JBK A;  4W9Y A;  3TLB A;  4E94 A;  3I74 A;  4COG A;  4C9R A;  2YJV A;  2R82 A;  1VBG A;  3EZE A;  1C3O B;  4IIY A;  4NGP A;  2YJT A;  4CO9 A;  2E28 A;  1A9X B; 
#chains in the Genus database with same CATH homology
 4COG A;  4J0N A;  2B0A A;  4CZ1 A;  4COB A;  3KRV A;  1R61 A;  4CO9 A;  4M8D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...