4M8DA

Crystal structure of an isatin hydrolase bound to product analogue thioisatinate
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
262
structure length
262
Chain Sequence
MSAQSALSGLGAKLLSGEVEVVDCTGVLGPNTPILQLPPDFAKNTPKVEIHKISEYDSDGPFFAWNWMVLGEHSGTHFDAPHHWITGKDYSDGFTDTLDVQRLIAPVNVIDCSKESAADPDFLLTADLIKAWEAEHGEIGAGEWVVMRTDWDKRAGDEAAFLNADETGPHSPGPTPDAIEYLLSKKIVGWGSQCIGTDAGQAGGMEPPFPAHNLLHRDNCFGLASLANLDKLPAKGAILIAAPLKIERGTGSPIRALALVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A proton wire and water channel revealed in the crystal structure of isatin hydrolase.
pubmed doi rcsb
source organism Labrenzia aggregata
molecule tags Hydrolase
molecule keywords Putative uncharacterized protein
total genus 78
structure length 262
sequence length 262
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.5.2.20: Isatin hydrolase.
pdb deposition date 2013-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04199 Cyclase Putative cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.50 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Putative cyclase 4m8dA00
4M8DA 4COGA 3KRVA 4COBA 2B0AA 4CO9A 4J0NA 1R61A 4CZ1A
chains in the Genus database with same CATH superfamily
3TLEA 1CX8A 4C85A 1EZBA 3TYXA 1C30B 2XEGA 1T36B 3SJGA 4C86A 2FM4A 2JBJA 2XEJA 4W9YA 2AUNA 3GJZA 3D7DA 4NGNA 2CIJA 2PCNA 4P44A 5IB9A 1Y9ZA 3EZEA 4P4JA 3I6SA 4X3RA 5F5XA 1GGOA 2B0AA 4CO9A 4P4EA 2YJVA 4TJVA 1ZRSA 4YN3A 4P4FA 1JDBC 3K9TA 3RBUA 3TLGA 2HI6A 4MCSA 2PVWA 4MCQA 3D7GA 1ZYMA 4OC2A 1Q5XA 4P4DA 4C8TA 2XEIA 4C8PA 2OOTA 3FEEA 3EIFA 3IWWA 3G23A 2C5QA 4OC5A 3TLBA 2XEFA 5FD8A 3FEDA 3SJEA 1KEEB 1R61A 5F9MA 4MJXA 4C9EA 4C9UA 1J3LA 3K4IA 4NGSA 1WVMA 4H1HA 1XF1A 4OC3A 3TLZA 1C3OB 3BHXA 4IIYA 4IIXA 4C8FA 1CE8B 4JYWA 2JBKA 2D0OA 4INJA 4TJXA 2OLSA 2PVVA 1VI4A 4NGPA 3S9NA 1V6CA 4COGA 1DIKA 2X0SA 3BI0A 3SJXA 2EZCA 4C9RA 3NOJA 4CZ1A 4LQGA 4MI1A 4NGTA 2C6PA 4TWEA 4OC0A 2R82A 3BXMA 3KRVA 4OC4A 3TLCA 4C99A 1M6VB 4MCPA 5K99A 3T5MA 1ZL0A 2EZBA 4NGRA 3S9MA 5F1YA 3TLYA 1NBWA 3FF3A 4C8UA 1JDEA 2HROA 4C84A 2GP4A 3I74A 4CDJA 3SJFA 4C8AA 1VBHA 3T07A 4KNGE 4NGMA 4JVOA 1KC7A 3D7FA 4JZ0A 4P4IA 3FECA 2C6CA 4CDKA 1BXRB 3SR3A 2AUMA 4E5SA 5IR2A 2DIKA 2EK9A 4COBA 2EZAA 3BI1A 3C8OA 4J0NA 3TLGB 3KASA 4MCRA 1Z8LA 4OC1A 2HWGA 5ELYA 4NGQA 1A9XB 4C8CA 2C6GA 2OR4A 3D7HA 1DE4C 1EZAA 3IIBA 3TLAA 2MP0A 5JVLA 4P45A 3T0TA 2EK8A 4P4BA 4C9VA 1NXJA 3S9LA 3T05A 1KBLA 1VBGA 4E94A 4EYSA 3U1BA 2E28A 5D29A 3VTAA 4M8DA 1CS0B 3EZBA 3ICUA 4OMEA 5JYBA 4C9AA 5F09A 2YJTA 2D0PA 3EZAA
chains in the Genus database with same CATH topology
4M8DA 4COGA 3KRVA 4COBA 2B0AA 4CO9A 4J0NA 1R61A 4CZ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M8D A;  4COG A;  3KRV A;  4COB A;  2B0A A;  4CO9 A;  4J0N A;  1R61 A;  4CZ1 A; 
#chains in the Genus database with same CATH topology
 3TLE A;  1CX8 A;  4C85 A;  1EZB A;  3TYX A;  1C30 B;  2XEG A;  1T36 B;  3SJG A;  4C86 A;  2FM4 A;  2JBJ A;  2XEJ A;  4W9Y A;  2AUN A;  3GJZ A;  3D7D A;  4NGN A;  2CIJ A;  2PCN A;  4P44 A;  5IB9 A;  1Y9Z A;  3EZE A;  4P4J A;  3I6S A;  4X3R A;  5F5X A;  1GGO A;  2B0A A;  4CO9 A;  4P4E A;  2YJV A;  4TJV A;  1ZRS A;  4YN3 A;  4P4F A;  1JDB C;  3K9T A;  3RBU A;  3TLG A;  2HI6 A;  4MCS A;  2PVW A;  4MCQ A;  3D7G A;  1ZYM A;  4OC2 A;  1Q5X A;  4P4D A;  4C8T A;  2XEI A;  4C8P A;  2OOT A;  3FEE A;  3EIF A;  3IWW A;  3G23 A;  2C5Q A;  4OC5 A;  3TLB A;  2XEF A;  5FD8 A;  3FED A;  3SJE A;  1KEE B;  1R61 A;  5F9M A;  4MJX A;  4C9E A;  4C9U A;  1J3L A;  3K4I A;  4NGS A;  1WVM A;  4H1H A;  1XF1 A;  4OC3 A;  3TLZ A;  1C3O B;  3BHX A;  4IIY A;  4IIX A;  4C8F A;  1CE8 B;  4JYW A;  2JBK A;  2D0O A;  4INJ A;  4TJX A;  2OLS A;  2PVV A;  1VI4 A;  4NGP A;  3S9N A;  1V6C A;  4COG A;  1DIK A;  2X0S A;  3BI0 A;  3SJX A;  2EZC A;  4C9R A;  3NOJ A;  4CZ1 A;  4LQG A;  4MI1 A;  4NGT A;  2C6P A;  4TWE A;  4OC0 A;  2R82 A;  3BXM A;  3KRV A;  4OC4 A;  3TLC A;  4C99 A;  1M6V B;  4MCP A;  5K99 A;  3T5M A;  1ZL0 A;  2EZB A;  4NGR A;  3S9M A;  5F1Y A;  3TLY A;  1NBW A;  3FF3 A;  4C8U A;  1JDE A;  2HRO A;  4C84 A;  2GP4 A;  3I74 A;  4CDJ A;  3SJF A;  4C8A A;  1VBH A;  3T07 A;  4KNG E;  4NGM A;  4JVO A;  1KC7 A;  3D7F A;  4JZ0 A;  4P4I A;  3FEC A;  2C6C A;  4CDK A;  1BXR B;  3SR3 A;  2AUM A;  4E5S A;  5IR2 A;  2DIK A;  2EK9 A;  4COB A;  2EZA A;  3BI1 A;  3C8O A;  4J0N A;  3TLG B;  3KAS A;  4MCR A;  1Z8L A;  4OC1 A;  2HWG A;  5ELY A;  4NGQ A;  1A9X B;  4C8C A;  2C6G A;  2OR4 A;  3D7H A;  1DE4 C;  1EZA A;  3IIB A;  3TLA A;  2MP0 A;  5JVL A;  4P45 A;  3T0T A;  2EK8 A;  4P4B A;  4C9V A;  1NXJ A;  3S9L A;  3T05 A;  1KBL A;  1VBG A;  4E94 A;  4EYS A;  3U1B A;  2E28 A;  5D29 A;  3VTA A;  4M8D A;  1CS0 B;  3EZB A;  3ICU A;  4OME A;  5JYB A;  4C9A A;  5F09 A;  2YJT A;  2D0P A;  3EZA A; 
#chains in the Genus database with same CATH homology
 4M8D A;  4COG A;  3KRV A;  4COB A;  2B0A A;  4CO9 A;  4J0N A;  1R61 A;  4CZ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...