4M8DA

Crystal structure of an isatin hydrolase bound to product analogue thioisatinate
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
262
structure length
262
Chain Sequence
MSAQSALSGLGAKLLSGEVEVVDCTGVLGPNTPILQLPPDFAKNTPKVEIHKISEYDSDGPFFAWNWMVLGEHSGTHFDAPHHWITGKDYSDGFTDTLDVQRLIAPVNVIDCSKESAADPDFLLTADLIKAWEAEHGEIGAGEWVVMRTDWDKRAGDEAAFLNADETGPHSPGPTPDAIEYLLSKKIVGWGSQCIGTDAGQAGGMEPPFPAHNLLHRDNCFGLASLANLDKLPAKGAILIAAPLKIERGTGSPIRALALVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Putative uncharacterized protein
publication title A proton wire and water channel revealed in the crystal structure of isatin hydrolase.
pubmed doi rcsb
source organism Labrenzia aggregata
total genus 78
structure length 262
sequence length 262
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.5.2.20: Isatin hydrolase.
pdb deposition date 2013-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04199 Cyclase Putative cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.50 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Putative cyclase 4m8dA00
4COBA 4CZ1A 4COGA 4M8DA 3KRVA 4J0NA 2B0AA 4CO9A 1R61A
chains in the Genus database with same CATH superfamily
4TWEA 2OLSA 1NXJA 4C9AA 1EZAA 2PVVA 4TJXA 3TLAA 1GGOA 4MCSA 2XEFA 4JVOA 2GP4A 2EZBA 4LQGA 1KBLA 1NBWA 1WVMA 2EZCA 1VI4A 3TLYA 3FF3A 3BI1A 4CDJA 1C30B 4P44A 4C9VA 3SR3A 2AUNA 4C84A 3T07A 1VBHA 4P4BA 5F5XA 2C6GA 2OOTA 1R61A 3K4IA 4P4JA 3TLGA 3RBUA 4IIYA 3U1BA 1C3OB 2HROA 2PCNA 4OC3A 3TYXA 1KEEB 5JYBA 2EK9A 3EZEA 4MCRA 2C6CA 2AUMA 1BXRB 5ELYA 2PVWA 4J0NA 3D7HA 5F1YA 4MCPA 4NGSA 3C8OA 4OMEA 3SJXA 1EZBA 4EYSA 3SJFA 5FD8A 3EZBA 1XF1A 4NGNA 3TLBA 4YN3A 4P45A 3K9TA 3S9MA 1ZYMA 1ZRSA 3BHXA 3FECA 2OR4A 4C85A 4COBA 2JBJA 2XEJA 1JDEA 1V6CA 3NOJA 2HI6A 2XEIA 3VTAA 2E28A 1DIKA 3IWWA 4MJXA 3D7FA 2X0SA 1DE4C 5IB9A 3KASA 3ICUA 2YJVA 4C99A 2EK8A 5D29A 3TLZA 4C8AA 2D0OA 1JDBC 4M8DA 4C8TA 3SJGA 4C9RA 2XEGA 2YJTA 4P4DA 4E94A 5K99A 3IIBA 1T36B 4OC1A 4P4EA 3G23A 3GJZA 3T0TA 4NGPA 5IR2A 4CDKA 4NGTA 4OC4A 3KRVA 1A9XB 2EZAA 3D7GA 3D7DA 4X3RA 4KNGE 2D0PA 4JZ0A 3FEEA 5JVLA 3S9LA 1CS0B 2HWGA 4INJA 4P4IA 4H1HA 4C9EA 4CO9A 4JYWA 3TLEA 3EZAA 5F9MA 3BI0A 1Z8LA 4C8CA 3T05A 4OC5A 1ZL0A 4W9YA 2DIKA 3I6SA 4IIXA 4C8UA 4C9UA 4CZ1A 3TLGB 1CE8B 5F09A 3BXMA 2CIJA 4NGQA 2MP0A 1J3LA 2JBKA 2B0AA 4C8PA 4NGMA 1M6VB 2FM4A 2C5QA 3T5MA 1VBGA 1CX8A 1Q5XA 4COGA 4E5SA 4C8FA 2C6PA 4TJVA 2R82A 4MCQA 3I74A 1Y9ZA 4C86A 3SJEA 3EIFA 4OC2A 4OC0A 3FEDA 4MI1A 4P4FA 3S9NA 3TLCA 4NGRA 1KC7A
chains in the Genus database with same CATH topology
4COBA 4CZ1A 4COGA 4M8DA 3KRVA 4J0NA 2B0AA 4CO9A 1R61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4COB A;  4CZ1 A;  4COG A;  4M8D A;  3KRV A;  4J0N A;  2B0A A;  4CO9 A;  1R61 A; 
#chains in the Genus database with same CATH topology
 4TWE A;  2OLS A;  1NXJ A;  4C9A A;  1EZA A;  2PVV A;  4TJX A;  3TLA A;  1GGO A;  4MCS A;  2XEF A;  4JVO A;  2GP4 A;  2EZB A;  4LQG A;  1KBL A;  1NBW A;  1WVM A;  2EZC A;  1VI4 A;  3TLY A;  3FF3 A;  3BI1 A;  4CDJ A;  1C30 B;  4P44 A;  4C9V A;  3SR3 A;  2AUN A;  4C84 A;  3T07 A;  1VBH A;  4P4B A;  5F5X A;  2C6G A;  2OOT A;  1R61 A;  3K4I A;  4P4J A;  3TLG A;  3RBU A;  4IIY A;  3U1B A;  1C3O B;  2HRO A;  2PCN A;  4OC3 A;  3TYX A;  1KEE B;  5JYB A;  2EK9 A;  3EZE A;  4MCR A;  2C6C A;  2AUM A;  1BXR B;  5ELY A;  2PVW A;  4J0N A;  3D7H A;  5F1Y A;  4MCP A;  4NGS A;  3C8O A;  4OME A;  3SJX A;  1EZB A;  4EYS A;  3SJF A;  5FD8 A;  3EZB A;  1XF1 A;  4NGN A;  3TLB A;  4YN3 A;  4P45 A;  3K9T A;  3S9M A;  1ZYM A;  1ZRS A;  3BHX A;  3FEC A;  2OR4 A;  4C85 A;  4COB A;  2JBJ A;  2XEJ A;  1JDE A;  1V6C A;  3NOJ A;  2HI6 A;  2XEI A;  3VTA A;  2E28 A;  1DIK A;  3IWW A;  4MJX A;  3D7F A;  2X0S A;  1DE4 C;  5IB9 A;  3KAS A;  3ICU A;  2YJV A;  4C99 A;  2EK8 A;  5D29 A;  3TLZ A;  4C8A A;  2D0O A;  1JDB C;  4M8D A;  4C8T A;  3SJG A;  4C9R A;  2XEG A;  2YJT A;  4P4D A;  4E94 A;  5K99 A;  3IIB A;  1T36 B;  4OC1 A;  4P4E A;  3G23 A;  3GJZ A;  3T0T A;  4NGP A;  5IR2 A;  4CDK A;  4NGT A;  4OC4 A;  3KRV A;  1A9X B;  2EZA A;  3D7G A;  3D7D A;  4X3R A;  4KNG E;  2D0P A;  4JZ0 A;  3FEE A;  5JVL A;  3S9L A;  1CS0 B;  2HWG A;  4INJ A;  4P4I A;  4H1H A;  4C9E A;  4CO9 A;  4JYW A;  3TLE A;  3EZA A;  5F9M A;  3BI0 A;  1Z8L A;  4C8C A;  3T05 A;  4OC5 A;  1ZL0 A;  4W9Y A;  2DIK A;  3I6S A;  4IIX A;  4C8U A;  4C9U A;  4CZ1 A;  3TLG B;  1CE8 B;  5F09 A;  3BXM A;  2CIJ A;  4NGQ A;  2MP0 A;  1J3L A;  2JBK A;  2B0A A;  4C8P A;  4NGM A;  1M6V B;  2FM4 A;  2C5Q A;  3T5M A;  1VBG A;  1CX8 A;  1Q5X A;  4COG A;  4E5S A;  4C8F A;  2C6P A;  4TJV A;  2R82 A;  4MCQ A;  3I74 A;  1Y9Z A;  4C86 A;  3SJE A;  3EIF A;  4OC2 A;  4OC0 A;  3FED A;  4MI1 A;  4P4F A;  3S9N A;  3TLC A;  4NGR A;  1KC7 A; 
#chains in the Genus database with same CATH homology
 4COB A;  4CZ1 A;  4COG A;  4M8D A;  3KRV A;  4J0N A;  2B0A A;  4CO9 A;  1R61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...