4C9AA

Mouse znrf3 ectodomain in complex with xenopus rspo2 fu1-fu2 (seleno met) crystal form i
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
153
structure length
153
Chain Sequence
KETAFVEVVLFESSPSGDYTTHTTGLTGRFSRAGAMLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
total genus 38
structure length 153
sequence length 153
chains with identical sequence C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4c9aA00
5ELYA 4OC0A 3SJFA 4NGNA 2C6CA 3S9LA 3FEEA 4C8PA 4NGMA 4P44A 2XEGA 4C9EA 3D7DA 2PVVA 3FECA 4P4JA 4OC1A 3KASA 1CX8A 3BHXA 3D7HA 4C99A 4X3RA 4TJXA 4C8FA 4NGQA 4JZ0A 2OOTA 2JBKA 4C9AA 1Z8LA 3I74A 4C9UA 3RBUA 3EIFA 3BI1A 3IIBA 3BI0A 1Y9ZA 4TJVA 3SJEA 4TWEA 5F09A 2PVWA 4C8CA 1WVMA 4CDJA 4LQGA 4C84A 4P4IA 5D29A 4C85A 2C6PA 3I6SA 4C9VA 4P45A 3D7GA 3IWWA 2EK8A 2OR4A 4C8TA 2C6GA 2XEFA 4P4FA 1V6CA 3VTAA 4CDKA 3ICUA 4OC5A 4MCQA 4C8UA 1DE4C 1XF1A 4MCRA 2JBJA 4NGRA 4W9YA 4OMEA 3S9MA 4YN3A 2XEIA 4C8AA 4KNGE 4P4BA 3FF3A 4MCPA 2CIJA 4JYWA 4NGPA 3FEDA 2XEJA 5IB9A 3SJGA 4MCSA 4OC3A 2EK9A 3BXMA 3SJXA 3S9NA 4P4DA 3D7FA 4C86A 4OC2A 4P4EA 4OC4A 4NGTA 4NGSA 4C9RA
chains in the Genus database with same CATH superfamily
5ELYA 4OC0A 3SJFA 4NGNA 2C6CA 2X0SA 2DIKA 3S9LA 3FEEA 4C8PA 4E5SA 2B0AA 1NXJA 4NGMA 4P44A 2XEGA 1JDEA 1VBGA 3T0TA 4C9EA 2D0PA 3D7DA 2PVVA 4CZ1A 3FECA 4INJA 5JYBA 4P4JA 4OC1A 3TLEA 3KASA 4E94A 2FM4A 1CX8A 3BHXA 1KC7A 3D7HA 4C99A 3T5MA 4J0NA 4X3RA 1BXRB 4TJXA 4C8FA 4NGQA 1KBLA 4H1HA 1ZL0A 4JZ0A 2OOTA 2JBKA 4C9AA 5JVLA 3TLYA 1Z8LA 1Q5XA 3I74A 3RBUA 4C9UA 3GJZA 3EIFA 2HWGA 4JVOA 5F5XA 3T05A 3BI1A 3IIBA 3BI0A 3T07A 4CO9A 2D0OA 1Y9ZA 2YJTA 4TJVA 3SJEA 2MP0A 4COBA 1NBWA 3EZAA 1KEEB 2PCNA 3K4IA 4TWEA 2PVWA 3C8OA 3SR3A 5F09A 4C8CA 1WVMA 4CDJA 4LQGA 4C84A 4P4IA 3G23A 3NOJA 2E28A 5D29A 2C6PA 3I6SA 4C85A 2C5QA 4C9VA 4IIXA 4P45A 3D7GA 2EZCA 1M6VB 3IWWA 2EK8A 2OR4A 4MI1A 4C8TA 2C6GA 2EZBA 2HI6A 2XEFA 4P4FA 1V6CA 3VTAA 2HROA 4CDKA 3ICUA 4OC5A 1C30B 1CS0B 4MCQA 3TLAA 4IIYA 4C8UA 3KRVA 1DE4C 5F9MA 1XF1A 1DIKA 1EZAA 4MCRA 3TYXA 2JBJA 4NGRA 5K99A 2EZAA 3TLGA 1A9XB 4W9YA 1VBHA 4OMEA 4COGA 3U1BA 3S9MA 1R61A 1T36B 4YN3A 3EZBA 3TLCA 1J3LA 1ZRSA 4EYSA 2AUNA 4MJXA 2XEIA 4C8AA 4KNGE 4P4BA 1EZBA 5FD8A 2GP4A 3FF3A 4MCPA 2CIJA 4JYWA 4NGPA 3FEDA 2XEJA 1CE8B 5IB9A 3SJGA 2OLSA 2R82A 4MCSA 1ZYMA 1C3OB 2YJVA 4OC3A 5IR2A 3K9TA 1JDBC 3TLGB 3TLBA 2EK9A 3EZEA 3BXMA 3SJXA 1VI4A 3S9NA 4P4DA 3D7FA 5F1YA 4C86A 4OC2A 4P4EA 4OC4A 4NGTA 4NGSA 3TLZA 4C9RA 2AUMA 4M8DA 1GGOA
chains in the Genus database with same CATH topology
5ELYA 4OC0A 3SJFA 4NGNA 2C6CA 3S9LA 3FEEA 4C8PA 4NGMA 4P44A 2XEGA 4C9EA 3D7DA 2PVVA 3FECA 4P4JA 4OC1A 3KASA 1CX8A 3BHXA 3D7HA 4C99A 4X3RA 4TJXA 4C8FA 4NGQA 4JZ0A 2OOTA 2JBKA 4C9AA 1Z8LA 3I74A 4C9UA 3RBUA 3EIFA 3BI1A 3IIBA 3BI0A 1Y9ZA 4TJVA 3SJEA 4TWEA 5F09A 2PVWA 4C8CA 1WVMA 4CDJA 4LQGA 4C84A 4P4IA 5D29A 4C85A 2C6PA 3I6SA 2C5QA 4C9VA 4P45A 3D7GA 3IWWA 2EK8A 2OR4A 4C8TA 2C6GA 2XEFA 4P4FA 1V6CA 3VTAA 4CDKA 3ICUA 4OC5A 4MCQA 4C8UA 1DE4C 1XF1A 4MCRA 2JBJA 4NGRA 4W9YA 4OMEA 3S9MA 4YN3A 2XEIA 4C8AA 4KNGE 4P4BA 2GP4A 3FF3A 4MCPA 2CIJA 4JYWA 4NGPA 3FEDA 2XEJA 5IB9A 3SJGA 4MCSA 4OC3A 5IR2A 3K9TA 2EK9A 3BXMA 3SJXA 3S9NA 4P4DA 3D7FA 4C86A 4OC2A 4P4EA 4OC4A 4NGTA 4NGSA 4C9RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ELY A;  4OC0 A;  3SJF A;  4NGN A;  2C6C A;  3S9L A;  3FEE A;  4C8P A;  4NGM A;  4P44 A;  2XEG A;  4C9E A;  3D7D A;  2PVV A;  3FEC A;  4P4J A;  4OC1 A;  3KAS A;  1CX8 A;  3BHX A;  3D7H A;  4C99 A;  4X3R A;  4TJX A;  4C8F A;  4NGQ A;  4JZ0 A;  2OOT A;  2JBK A;  4C9A A;  1Z8L A;  3I74 A;  4C9U A;  3RBU A;  3EIF A;  3BI1 A;  3IIB A;  3BI0 A;  1Y9Z A;  4TJV A;  3SJE A;  4TWE A;  5F09 A;  2PVW A;  4C8C A;  1WVM A;  4CDJ A;  4LQG A;  4C84 A;  4P4I A;  5D29 A;  4C85 A;  2C6P A;  3I6S A;  4C9V A;  4P45 A;  3D7G A;  3IWW A;  2EK8 A;  2OR4 A;  4C8T A;  2C6G A;  2XEF A;  4P4F A;  1V6C A;  3VTA A;  4CDK A;  3ICU A;  4OC5 A;  4MCQ A;  4C8U A;  1DE4 C;  1XF1 A;  4MCR A;  2JBJ A;  4NGR A;  4W9Y A;  4OME A;  3S9M A;  4YN3 A;  2XEI A;  4C8A A;  4KNG E;  4P4B A;  3FF3 A;  4MCP A;  2CIJ A;  4JYW A;  4NGP A;  3FED A;  2XEJ A;  5IB9 A;  3SJG A;  4MCS A;  4OC3 A;  2EK9 A;  3BXM A;  3SJX A;  3S9N A;  4P4D A;  3D7F A;  4C86 A;  4OC2 A;  4P4E A;  4OC4 A;  4NGT A;  4NGS A;  4C9R A; 
#chains in the Genus database with same CATH topology
 5ELY A;  4OC0 A;  3SJF A;  4NGN A;  2C6C A;  2X0S A;  2DIK A;  3S9L A;  3FEE A;  4C8P A;  4E5S A;  2B0A A;  1NXJ A;  4NGM A;  4P44 A;  2XEG A;  1JDE A;  1VBG A;  3T0T A;  4C9E A;  2D0P A;  3D7D A;  2PVV A;  4CZ1 A;  3FEC A;  4INJ A;  5JYB A;  4P4J A;  4OC1 A;  3TLE A;  3KAS A;  4E94 A;  2FM4 A;  1CX8 A;  3BHX A;  1KC7 A;  3D7H A;  4C99 A;  3T5M A;  4J0N A;  4X3R A;  1BXR B;  4TJX A;  4C8F A;  4NGQ A;  1KBL A;  4H1H A;  1ZL0 A;  4JZ0 A;  2OOT A;  2JBK A;  4C9A A;  5JVL A;  3TLY A;  1Z8L A;  1Q5X A;  3I74 A;  3RBU A;  4C9U A;  3GJZ A;  3EIF A;  2HWG A;  4JVO A;  5F5X A;  3T05 A;  3BI1 A;  3IIB A;  3BI0 A;  3T07 A;  4CO9 A;  2D0O A;  1Y9Z A;  2YJT A;  4TJV A;  3SJE A;  2MP0 A;  4COB A;  1NBW A;  3EZA A;  1KEE B;  2PCN A;  3K4I A;  4TWE A;  2PVW A;  3C8O A;  3SR3 A;  5F09 A;  4C8C A;  1WVM A;  4CDJ A;  4LQG A;  4C84 A;  4P4I A;  3G23 A;  3NOJ A;  2E28 A;  5D29 A;  2C6P A;  3I6S A;  4C85 A;  2C5Q A;  4C9V A;  4IIX A;  4P45 A;  3D7G A;  2EZC A;  1M6V B;  3IWW A;  2EK8 A;  2OR4 A;  4MI1 A;  4C8T A;  2C6G A;  2EZB A;  2HI6 A;  2XEF A;  4P4F A;  1V6C A;  3VTA A;  2HRO A;  4CDK A;  3ICU A;  4OC5 A;  1C30 B;  1CS0 B;  4MCQ A;  3TLA A;  4IIY A;  4C8U A;  3KRV A;  1DE4 C;  5F9M A;  1XF1 A;  1DIK A;  1EZA A;  4MCR A;  3TYX A;  2JBJ A;  4NGR A;  5K99 A;  2EZA A;  3TLG A;  1A9X B;  4W9Y A;  1VBH A;  4OME A;  4COG A;  3U1B A;  3S9M A;  1R61 A;  1T36 B;  4YN3 A;  3EZB A;  3TLC A;  1J3L A;  1ZRS A;  4EYS A;  2AUN A;  4MJX A;  2XEI A;  4C8A A;  4KNG E;  4P4B A;  1EZB A;  5FD8 A;  2GP4 A;  3FF3 A;  4MCP A;  2CIJ A;  4JYW A;  4NGP A;  3FED A;  2XEJ A;  1CE8 B;  5IB9 A;  3SJG A;  2OLS A;  2R82 A;  4MCS A;  1ZYM A;  1C3O B;  2YJV A;  4OC3 A;  5IR2 A;  3K9T A;  1JDB C;  3TLG B;  3TLB A;  2EK9 A;  3EZE A;  3BXM A;  3SJX A;  1VI4 A;  3S9N A;  4P4D A;  3D7F A;  5F1Y A;  4C86 A;  4OC2 A;  4P4E A;  4OC4 A;  4NGT A;  4NGS A;  3TLZ A;  4C9R A;  2AUM A;  4M8D A;  1GGO A; 
#chains in the Genus database with same CATH homology
 5ELY A;  4OC0 A;  3SJF A;  4NGN A;  2C6C A;  3S9L A;  3FEE A;  4C8P A;  4NGM A;  4P44 A;  2XEG A;  4C9E A;  3D7D A;  2PVV A;  3FEC A;  4P4J A;  4OC1 A;  3KAS A;  1CX8 A;  3BHX A;  3D7H A;  4C99 A;  4X3R A;  4TJX A;  4C8F A;  4NGQ A;  4JZ0 A;  2OOT A;  2JBK A;  4C9A A;  1Z8L A;  3I74 A;  4C9U A;  3RBU A;  3EIF A;  3BI1 A;  3IIB A;  3BI0 A;  1Y9Z A;  4TJV A;  3SJE A;  4TWE A;  5F09 A;  2PVW A;  4C8C A;  1WVM A;  4CDJ A;  4LQG A;  4C84 A;  4P4I A;  5D29 A;  4C85 A;  2C6P A;  3I6S A;  2C5Q A;  4C9V A;  4P45 A;  3D7G A;  3IWW A;  2EK8 A;  2OR4 A;  4C8T A;  2C6G A;  2XEF A;  4P4F A;  1V6C A;  3VTA A;  4CDK A;  3ICU A;  4OC5 A;  4MCQ A;  4C8U A;  1DE4 C;  1XF1 A;  4MCR A;  2JBJ A;  4NGR A;  4W9Y A;  4OME A;  3S9M A;  4YN3 A;  2XEI A;  4C8A A;  4KNG E;  4P4B A;  2GP4 A;  3FF3 A;  4MCP A;  2CIJ A;  4JYW A;  4NGP A;  3FED A;  2XEJ A;  5IB9 A;  3SJG A;  4MCS A;  4OC3 A;  5IR2 A;  3K9T A;  2EK9 A;  3BXM A;  3SJX A;  3S9N A;  4P4D A;  3D7F A;  4C86 A;  4OC2 A;  4P4E A;  4OC4 A;  4NGT A;  4NGS A;  4C9R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...