4C9AA

Mouse znrf3 ectodomain in complex with xenopus rspo2 fu1-fu2 (seleno met) crystal form i
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
153
structure length
153
Chain Sequence
KETAFVEVVLFESSPSGDYTTHTTGLTGRFSRAGAMLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
publication title Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb
source organism Mus musculus
total genus 38
structure length 153
sequence length 153
chains with identical sequence C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4c9aA00
3BXMA 3SJXA 4C9AA 4NGPA 2PVVA 2EK9A 4P4BA 1DE4C 3FF3A 2OOTA 4MCPA 4C9UA 4OC3A 3I6SA 4NGQA 3KASA 3IWWA 3SJEA 2XEIA 4OC0A 4OC1A 4KNGE 2XEJA 1V6CA 4P4DA 3BI0A 4C8TA 4NGNA 3FEEA 4JYWA 2C6PA 3SJFA 5D29A 2PVWA 4NGMA 2C6CA 3IIBA 3EIFA 4LQGA 5F09A 4C9VA 4X3RA 4OC5A 4C85A 4TJXA 4C8PA 4C84A 1Y9ZA 3S9MA 4OMEA 1XF1A 4C8FA 3BHXA 2C6GA 3I74A 4P4FA 3D7FA 4NGRA 4MCSA 3S9NA 4NGSA 1Z8LA 3D7HA 3FEDA 3D7DA 4C86A 4MCRA 4C8CA 2JBKA 4TJVA 2JBJA 4YN3A 3FECA 4W9YA 3SJGA 4NGTA 2XEGA 2CIJA 3S9LA 3ICUA 4P4IA 4C8AA 5IB9A 1CX8A 4CDKA 3RBUA 4C9EA 4OC4A 4C9RA 4P45A 5ELYA 4OC2A 4P44A 2XEFA 4JZ0A 4C99A 3D7GA 4P4JA 1WVMA 4CDJA 2OR4A 4TWEA 3VTAA 3BI1A 2EK8A 4P4EA 4MCQA 4C8UA
chains in the Genus database with same CATH superfamily
1EZAA 3BXMA 1J3LA 3SJXA 4C9AA 4MJXA 4NGPA 2PVVA 1T36B 2EK9A 4P4BA 1DE4C 3FF3A 1Q5XA 3TYXA 2E28A 2OOTA 4CZ1A 4MCPA 4INJA 1ZRSA 4C9UA 4OC3A 4CO9A 2X0SA 1A9XB 3TLBA 3I6SA 2B0AA 3KASA 4NGQA 1KBLA 3IWWA 3SJEA 2XEIA 2C5QA 2D0PA 2PCNA 2HWGA 2GP4A 1JDBC 4OC0A 4OC1A 4KNGE 2YJTA 3GJZA 5F9MA 2XEJA 1R61A 1C3OB 1JDEA 1V6CA 4P4DA 3T07A 3K4IA 3BI0A 1NBWA 4C8TA 4COGA 4NGNA 3FEEA 4JYWA 2C6PA 3SJFA 5JYBA 5D29A 2PVWA 2MP0A 2R82A 4NGMA 2C6CA 3IIBA 3TLAA 3EIFA 4MI1A 3T5MA 5K99A 4LQGA 3KRVA 1VBGA 5F09A 3TLYA 4X3RA 2YJVA 4OC5A 4C9VA 4C85A 4EYSA 4TJXA 3TLZA 2OLSA 2FM4A 4C8PA 3EZAA 4C84A 4J0NA 1Y9ZA 2AUMA 4IIYA 4OMEA 3S9MA 3G23A 2HI6A 3T05A 1KC7A 2D0OA 1XF1A 2AUNA 4C8FA 3BHXA 3T0TA 1NXJA 1ZL0A 2C6GA 3I74A 4P4FA 3D7FA 2EZAA 3EZBA 1VBHA 4NGRA 4MCSA 3S9NA 2EZBA 4COBA 4NGSA 1Z8LA 1KEEB 2EZCA 1M6VB 3D7HA 3FEDA 3D7DA 4C86A 4MCRA 2HROA 2JBKA 4C8CA 4TJVA 4E94A 3U1BA 2JBJA 4YN3A 3FECA 4W9YA 3SJGA 1DIKA 4NGTA 5F5XA 3EZEA 2XEGA 2CIJA 3S9LA 1VI4A 3ICUA 4P4IA 4C8AA 5IB9A 1CX8A 1GGOA 4CDKA 3RBUA 4C9EA 4OC4A 4C9RA 4P45A 3C8OA 4M8DA 3SR3A 5ELYA 4OC2A 3TLGB 4P44A 2XEFA 5F1YA 3K9TA 4JZ0A 4H1HA 1BXRB 5JVLA 1ZYMA 1CS0B 4C99A 3D7GA 5FD8A 4P4JA 1C30B 1WVMA 4JVOA 4CDJA 5IR2A 3TLEA 1EZBA 4E5SA 2OR4A 4IIXA 1CE8B 4TWEA 3TLCA 3NOJA 2DIKA 3VTAA 3TLGA 3BI1A 2EK8A 4P4EA 4MCQA 4C8UA
chains in the Genus database with same CATH topology
3BXMA 3SJXA 4C9AA 4NGPA 2PVVA 2EK9A 4P4BA 1DE4C 3FF3A 2OOTA 4MCPA 4C9UA 4OC3A 3I6SA 4NGQA 3KASA 3IWWA 3SJEA 2XEIA 2C5QA 2GP4A 4OC0A 4OC1A 4KNGE 2XEJA 1V6CA 4P4DA 3BI0A 4C8TA 4NGNA 3FEEA 4JYWA 2C6PA 3SJFA 5D29A 2PVWA 4NGMA 2C6CA 3IIBA 3EIFA 4LQGA 5F09A 4C9VA 4X3RA 4OC5A 4C85A 4TJXA 4C8PA 4C84A 1Y9ZA 3S9MA 4OMEA 1XF1A 4C8FA 3BHXA 2C6GA 3I74A 4P4FA 3D7FA 4NGRA 4MCSA 3S9NA 4NGSA 1Z8LA 3D7HA 3FEDA 3D7DA 4C86A 4MCRA 4C8CA 2JBKA 4TJVA 2JBJA 4YN3A 3FECA 4W9YA 3SJGA 4NGTA 2XEGA 2CIJA 3S9LA 3ICUA 4P4IA 4C8AA 5IB9A 1CX8A 4CDKA 3RBUA 4C9EA 4OC4A 4C9RA 4P45A 5ELYA 4OC2A 4P44A 2XEFA 3K9TA 4JZ0A 4C99A 3D7GA 4P4JA 1WVMA 4CDJA 5IR2A 2OR4A 4TWEA 3VTAA 3BI1A 2EK8A 4P4EA 4MCQA 4C8UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BXM A;  3SJX A;  4C9A A;  4NGP A;  2PVV A;  2EK9 A;  4P4B A;  1DE4 C;  3FF3 A;  2OOT A;  4MCP A;  4C9U A;  4OC3 A;  3I6S A;  4NGQ A;  3KAS A;  3IWW A;  3SJE A;  2XEI A;  4OC0 A;  4OC1 A;  4KNG E;  2XEJ A;  1V6C A;  4P4D A;  3BI0 A;  4C8T A;  4NGN A;  3FEE A;  4JYW A;  2C6P A;  3SJF A;  5D29 A;  2PVW A;  4NGM A;  2C6C A;  3IIB A;  3EIF A;  4LQG A;  5F09 A;  4C9V A;  4X3R A;  4OC5 A;  4C85 A;  4TJX A;  4C8P A;  4C84 A;  1Y9Z A;  3S9M A;  4OME A;  1XF1 A;  4C8F A;  3BHX A;  2C6G A;  3I74 A;  4P4F A;  3D7F A;  4NGR A;  4MCS A;  3S9N A;  4NGS A;  1Z8L A;  3D7H A;  3FED A;  3D7D A;  4C86 A;  4MCR A;  4C8C A;  2JBK A;  4TJV A;  2JBJ A;  4YN3 A;  3FEC A;  4W9Y A;  3SJG A;  4NGT A;  2XEG A;  2CIJ A;  3S9L A;  3ICU A;  4P4I A;  4C8A A;  5IB9 A;  1CX8 A;  4CDK A;  3RBU A;  4C9E A;  4OC4 A;  4C9R A;  4P45 A;  5ELY A;  4OC2 A;  4P44 A;  2XEF A;  4JZ0 A;  4C99 A;  3D7G A;  4P4J A;  1WVM A;  4CDJ A;  2OR4 A;  4TWE A;  3VTA A;  3BI1 A;  2EK8 A;  4P4E A;  4MCQ A;  4C8U A; 
#chains in the Genus database with same CATH topology
 1EZA A;  3BXM A;  1J3L A;  3SJX A;  4C9A A;  4MJX A;  4NGP A;  2PVV A;  1T36 B;  2EK9 A;  4P4B A;  1DE4 C;  3FF3 A;  1Q5X A;  3TYX A;  2E28 A;  2OOT A;  4CZ1 A;  4MCP A;  4INJ A;  1ZRS A;  4C9U A;  4OC3 A;  4CO9 A;  2X0S A;  1A9X B;  3TLB A;  3I6S A;  2B0A A;  3KAS A;  4NGQ A;  1KBL A;  3IWW A;  3SJE A;  2XEI A;  2C5Q A;  2D0P A;  2PCN A;  2HWG A;  2GP4 A;  1JDB C;  4OC0 A;  4OC1 A;  4KNG E;  2YJT A;  3GJZ A;  5F9M A;  2XEJ A;  1R61 A;  1C3O B;  1JDE A;  1V6C A;  4P4D A;  3T07 A;  3K4I A;  3BI0 A;  1NBW A;  4C8T A;  4COG A;  4NGN A;  3FEE A;  4JYW A;  2C6P A;  3SJF A;  5JYB A;  5D29 A;  2PVW A;  2MP0 A;  2R82 A;  4NGM A;  2C6C A;  3IIB A;  3TLA A;  3EIF A;  4MI1 A;  3T5M A;  5K99 A;  4LQG A;  3KRV A;  1VBG A;  5F09 A;  3TLY A;  4X3R A;  2YJV A;  4OC5 A;  4C9V A;  4C85 A;  4EYS A;  4TJX A;  3TLZ A;  2OLS A;  2FM4 A;  4C8P A;  3EZA A;  4C84 A;  4J0N A;  1Y9Z A;  2AUM A;  4IIY A;  4OME A;  3S9M A;  3G23 A;  2HI6 A;  3T05 A;  1KC7 A;  2D0O A;  1XF1 A;  2AUN A;  4C8F A;  3BHX A;  3T0T A;  1NXJ A;  1ZL0 A;  2C6G A;  3I74 A;  4P4F A;  3D7F A;  2EZA A;  3EZB A;  1VBH A;  4NGR A;  4MCS A;  3S9N A;  2EZB A;  4COB A;  4NGS A;  1Z8L A;  1KEE B;  2EZC A;  1M6V B;  3D7H A;  3FED A;  3D7D A;  4C86 A;  4MCR A;  2HRO A;  2JBK A;  4C8C A;  4TJV A;  4E94 A;  3U1B A;  2JBJ A;  4YN3 A;  3FEC A;  4W9Y A;  3SJG A;  1DIK A;  4NGT A;  5F5X A;  3EZE A;  2XEG A;  2CIJ A;  3S9L A;  1VI4 A;  3ICU A;  4P4I A;  4C8A A;  5IB9 A;  1CX8 A;  1GGO A;  4CDK A;  3RBU A;  4C9E A;  4OC4 A;  4C9R A;  4P45 A;  3C8O A;  4M8D A;  3SR3 A;  5ELY A;  4OC2 A;  3TLG B;  4P44 A;  2XEF A;  5F1Y A;  3K9T A;  4JZ0 A;  4H1H A;  1BXR B;  5JVL A;  1ZYM A;  1CS0 B;  4C99 A;  3D7G A;  5FD8 A;  4P4J A;  1C30 B;  1WVM A;  4JVO A;  4CDJ A;  5IR2 A;  3TLE A;  1EZB A;  4E5S A;  2OR4 A;  4IIX A;  1CE8 B;  4TWE A;  3TLC A;  3NOJ A;  2DIK A;  3VTA A;  3TLG A;  3BI1 A;  2EK8 A;  4P4E A;  4MCQ A;  4C8U A; 
#chains in the Genus database with same CATH homology
 3BXM A;  3SJX A;  4C9A A;  4NGP A;  2PVV A;  2EK9 A;  4P4B A;  1DE4 C;  3FF3 A;  2OOT A;  4MCP A;  4C9U A;  4OC3 A;  3I6S A;  4NGQ A;  3KAS A;  3IWW A;  3SJE A;  2XEI A;  2C5Q A;  2GP4 A;  4OC0 A;  4OC1 A;  4KNG E;  2XEJ A;  1V6C A;  4P4D A;  3BI0 A;  4C8T A;  4NGN A;  3FEE A;  4JYW A;  2C6P A;  3SJF A;  5D29 A;  2PVW A;  4NGM A;  2C6C A;  3IIB A;  3EIF A;  4LQG A;  5F09 A;  4C9V A;  4X3R A;  4OC5 A;  4C85 A;  4TJX A;  4C8P A;  4C84 A;  1Y9Z A;  3S9M A;  4OME A;  1XF1 A;  4C8F A;  3BHX A;  2C6G A;  3I74 A;  4P4F A;  3D7F A;  4NGR A;  4MCS A;  3S9N A;  4NGS A;  1Z8L A;  3D7H A;  3FED A;  3D7D A;  4C86 A;  4MCR A;  4C8C A;  2JBK A;  4TJV A;  2JBJ A;  4YN3 A;  3FEC A;  4W9Y A;  3SJG A;  4NGT A;  2XEG A;  2CIJ A;  3S9L A;  3ICU A;  4P4I A;  4C8A A;  5IB9 A;  1CX8 A;  4CDK A;  3RBU A;  4C9E A;  4OC4 A;  4C9R A;  4P45 A;  5ELY A;  4OC2 A;  4P44 A;  2XEF A;  3K9T A;  4JZ0 A;  4C99 A;  3D7G A;  4P4J A;  1WVM A;  4CDJ A;  5IR2 A;  2OR4 A;  4TWE A;  3VTA A;  3BI1 A;  2EK8 A;  4P4E A;  4MCQ A;  4C8U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...