4C9AA

Mouse znrf3 ectodomain in complex with xenopus rspo2 fu1-fu2 (seleno met) crystal form i
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
153
structure length
153
Chain Sequence
KETAFVEVVLFESSPSGDYTTHTTGLTGRFSRAGAMLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
publication title Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
total genus 38
structure length 153
sequence length 153
chains with identical sequence C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4c9aA00
5D29A 4C9VA 3D7GA 4P4EA 4C8CA 4NGQA 4OC2A 3D7FA 4C9EA 3SJXA 1WVMA 4MCRA 2PVWA 3ICUA 4TWEA 4P4DA 4C8UA 4P4IA 2EK9A 4NGSA 4OMEA 1CX8A 4TJXA 2XEFA 1XF1A 3FECA 4C8TA 4P4BA 3S9NA 2CIJA 4P4FA 4C86A 4OC3A 3FEDA 2C6GA 3IIBA 4JYWA 3D7DA 4OC5A 4OC0A 4C9AA 3S9MA 3RBUA 4JZ0A 3SJFA 4MCQA 4TJVA 3BI1A 2XEGA 4C8PA 4NGRA 4C9RA 5ELYA 1V6CA 4NGTA 2C6PA 3VTAA 4CDKA 2EK8A 4LQGA 4OC1A 4YN3A 1Z8LA 2PVVA 4P4JA 3KASA 4C8FA 3SJGA 2OOTA 1DE4C 4KNGE 4C99A 4W9YA 2XEIA 3BI0A 4OC4A 2C6CA 2XEJA 4P44A 4MCPA 4NGNA 3SJEA 3I6SA 3D7HA 4C85A 5F09A 4MCSA 4CDJA 2OR4A 3BXMA 1Y9ZA 2JBKA 3FEEA 3S9LA 4X3RA 3FF3A 4C84A 5IB9A 4C9UA 3BHXA 3I74A 4NGPA 4C8AA 2JBJA 4NGMA 4P45A 3EIFA 3IWWA
chains in the Genus database with same CATH superfamily
2GP4A 5D29A 4C9VA 4CZ1A 3D7GA 4IIYA 4P4EA 4C8CA 1EZBA 2AUMA 4NGQA 4OC2A 3KRVA 4EYSA 3K4IA 3D7FA 4C9EA 3SJXA 2YJTA 5F5XA 1WVMA 4MCRA 5IR2A 5JYBA 2PVWA 3ICUA 4TWEA 4P4DA 2AUNA 4C8UA 4J0NA 4P4IA 1M6VB 2EK9A 4NGSA 1KBLA 1JDEA 2YJVA 4OMEA 2OLSA 1CX8A 1C3OB 4TJXA 2XEFA 3SR3A 2EZAA 1A9XB 1XF1A 2D0OA 4E5SA 5JVLA 1J3LA 3EZAA 2DIKA 3FECA 4INJA 4P4BA 4C8TA 3S9NA 2CIJA 2EZBA 1T36B 4P4FA 1JDBC 3T05A 3TLEA 1VBGA 3NOJA 4C86A 4OC3A 3FEDA 2C6GA 3TLYA 1CS0B 3IIBA 5FD8A 1ZL0A 4JYWA 3D7DA 4OC5A 4OC0A 4C9AA 3EZBA 3S9MA 1DIKA 3TYXA 3EZEA 1BXRB 2B0AA 3RBUA 2EZCA 4JZ0A 3SJFA 1NBWA 2C5QA 3TLZA 3TLGA 4MCQA 1VI4A 4MI1A 4TJVA 3T07A 3BI1A 2HWGA 2XEGA 4C8PA 4NGRA 4C9RA 5ELYA 1V6CA 2PCNA 4NGTA 2C6PA 3VTAA 4CDKA 2EK8A 1KEEB 4LQGA 5F9MA 4IIXA 3T0TA 4OC1A 2MP0A 5F1YA 4YN3A 1Z8LA 1EZAA 3GJZA 2PVVA 3KASA 2E28A 4P4JA 4C8FA 3SJGA 3K9TA 2OOTA 1R61A 1DE4C 2HROA 4KNGE 4E94A 4C99A 4W9YA 4MJXA 2XEIA 2D0PA 3BI0A 3TLBA 3U1BA 1Q5XA 3TLCA 2C6CA 4OC4A 2XEJA 1ZYMA 1VBHA 4P44A 2FM4A 4MCPA 4M8DA 4NGNA 3SJEA 4H1HA 3TLGB 2HI6A 3D7HA 3I6SA 3C8OA 2R82A 1NXJA 4C85A 5F09A 4MCSA 2X0SA 3G23A 1KC7A 4CO9A 4CDJA 2OR4A 1CE8B 3BXMA 5K99A 4JVOA 3TLAA 1Y9ZA 1C30B 2JBKA 3FEEA 1ZRSA 3S9LA 4X3RA 3FF3A 4C84A 5IB9A 4C9UA 3BHXA 3I74A 4NGPA 4COGA 4C8AA 4COBA 2JBJA 4NGMA 1GGOA 4P45A 3EIFA 3T5MA 3IWWA
chains in the Genus database with same CATH topology
2GP4A 5D29A 4C9VA 3D7GA 4P4EA 4C8CA 4NGQA 4OC2A 3D7FA 4C9EA 3SJXA 1WVMA 4MCRA 5IR2A 2PVWA 3ICUA 4TWEA 4P4DA 4C8UA 4P4IA 2EK9A 4NGSA 4OMEA 1CX8A 4TJXA 2XEFA 1XF1A 3FECA 4C8TA 4P4BA 3S9NA 2CIJA 4P4FA 4C86A 4OC3A 3FEDA 2C6GA 3IIBA 4JYWA 3D7DA 4OC5A 4OC0A 4C9AA 3S9MA 3RBUA 4JZ0A 3SJFA 2C5QA 4MCQA 4TJVA 3BI1A 2XEGA 4C8PA 4NGRA 4C9RA 5ELYA 1V6CA 4NGTA 2C6PA 3VTAA 4CDKA 2EK8A 4LQGA 4OC1A 4YN3A 1Z8LA 2PVVA 4P4JA 3KASA 4C8FA 3SJGA 3K9TA 2OOTA 1DE4C 4KNGE 4C99A 4W9YA 2XEIA 3BI0A 4OC4A 2C6CA 2XEJA 4P44A 4MCPA 4NGNA 3SJEA 3I6SA 3D7HA 4C85A 5F09A 4MCSA 4CDJA 2OR4A 3BXMA 1Y9ZA 2JBKA 3FEEA 3S9LA 4X3RA 3FF3A 4C84A 5IB9A 4C9UA 3BHXA 3I74A 4NGPA 4C8AA 2JBJA 4NGMA 4P45A 3EIFA 3IWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D29 A;  4C9V A;  3D7G A;  4P4E A;  4C8C A;  4NGQ A;  4OC2 A;  3D7F A;  4C9E A;  3SJX A;  1WVM A;  4MCR A;  2PVW A;  3ICU A;  4TWE A;  4P4D A;  4C8U A;  4P4I A;  2EK9 A;  4NGS A;  4OME A;  1CX8 A;  4TJX A;  2XEF A;  1XF1 A;  3FEC A;  4C8T A;  4P4B A;  3S9N A;  2CIJ A;  4P4F A;  4C86 A;  4OC3 A;  3FED A;  2C6G A;  3IIB A;  4JYW A;  3D7D A;  4OC5 A;  4OC0 A;  4C9A A;  3S9M A;  3RBU A;  4JZ0 A;  3SJF A;  4MCQ A;  4TJV A;  3BI1 A;  2XEG A;  4C8P A;  4NGR A;  4C9R A;  5ELY A;  1V6C A;  4NGT A;  2C6P A;  3VTA A;  4CDK A;  2EK8 A;  4LQG A;  4OC1 A;  4YN3 A;  1Z8L A;  2PVV A;  4P4J A;  3KAS A;  4C8F A;  3SJG A;  2OOT A;  1DE4 C;  4KNG E;  4C99 A;  4W9Y A;  2XEI A;  3BI0 A;  4OC4 A;  2C6C A;  2XEJ A;  4P44 A;  4MCP A;  4NGN A;  3SJE A;  3I6S A;  3D7H A;  4C85 A;  5F09 A;  4MCS A;  4CDJ A;  2OR4 A;  3BXM A;  1Y9Z A;  2JBK A;  3FEE A;  3S9L A;  4X3R A;  3FF3 A;  4C84 A;  5IB9 A;  4C9U A;  3BHX A;  3I74 A;  4NGP A;  4C8A A;  2JBJ A;  4NGM A;  4P45 A;  3EIF A;  3IWW A; 
#chains in the Genus database with same CATH topology
 2GP4 A;  5D29 A;  4C9V A;  4CZ1 A;  3D7G A;  4IIY A;  4P4E A;  4C8C A;  1EZB A;  2AUM A;  4NGQ A;  4OC2 A;  3KRV A;  4EYS A;  3K4I A;  3D7F A;  4C9E A;  3SJX A;  2YJT A;  5F5X A;  1WVM A;  4MCR A;  5IR2 A;  5JYB A;  2PVW A;  3ICU A;  4TWE A;  4P4D A;  2AUN A;  4C8U A;  4J0N A;  4P4I A;  1M6V B;  2EK9 A;  4NGS A;  1KBL A;  1JDE A;  2YJV A;  4OME A;  2OLS A;  1CX8 A;  1C3O B;  4TJX A;  2XEF A;  3SR3 A;  2EZA A;  1A9X B;  1XF1 A;  2D0O A;  4E5S A;  5JVL A;  1J3L A;  3EZA A;  2DIK A;  3FEC A;  4INJ A;  4P4B A;  4C8T A;  3S9N A;  2CIJ A;  2EZB A;  1T36 B;  4P4F A;  1JDB C;  3T05 A;  3TLE A;  1VBG A;  3NOJ A;  4C86 A;  4OC3 A;  3FED A;  2C6G A;  3TLY A;  1CS0 B;  3IIB A;  5FD8 A;  1ZL0 A;  4JYW A;  3D7D A;  4OC5 A;  4OC0 A;  4C9A A;  3EZB A;  3S9M A;  1DIK A;  3TYX A;  3EZE A;  1BXR B;  2B0A A;  3RBU A;  2EZC A;  4JZ0 A;  3SJF A;  1NBW A;  2C5Q A;  3TLZ A;  3TLG A;  4MCQ A;  1VI4 A;  4MI1 A;  4TJV A;  3T07 A;  3BI1 A;  2HWG A;  2XEG A;  4C8P A;  4NGR A;  4C9R A;  5ELY A;  1V6C A;  2PCN A;  4NGT A;  2C6P A;  3VTA A;  4CDK A;  2EK8 A;  1KEE B;  4LQG A;  5F9M A;  4IIX A;  3T0T A;  4OC1 A;  2MP0 A;  5F1Y A;  4YN3 A;  1Z8L A;  1EZA A;  3GJZ A;  2PVV A;  3KAS A;  2E28 A;  4P4J A;  4C8F A;  3SJG A;  3K9T A;  2OOT A;  1R61 A;  1DE4 C;  2HRO A;  4KNG E;  4E94 A;  4C99 A;  4W9Y A;  4MJX A;  2XEI A;  2D0P A;  3BI0 A;  3TLB A;  3U1B A;  1Q5X A;  3TLC A;  2C6C A;  4OC4 A;  2XEJ A;  1ZYM A;  1VBH A;  4P44 A;  2FM4 A;  4MCP A;  4M8D A;  4NGN A;  3SJE A;  4H1H A;  3TLG B;  2HI6 A;  3D7H A;  3I6S A;  3C8O A;  2R82 A;  1NXJ A;  4C85 A;  5F09 A;  4MCS A;  2X0S A;  3G23 A;  1KC7 A;  4CO9 A;  4CDJ A;  2OR4 A;  1CE8 B;  3BXM A;  5K99 A;  4JVO A;  3TLA A;  1Y9Z A;  1C30 B;  2JBK A;  3FEE A;  1ZRS A;  3S9L A;  4X3R A;  3FF3 A;  4C84 A;  5IB9 A;  4C9U A;  3BHX A;  3I74 A;  4NGP A;  4COG A;  4C8A A;  4COB A;  2JBJ A;  4NGM A;  1GGO A;  4P45 A;  3EIF A;  3T5M A;  3IWW A; 
#chains in the Genus database with same CATH homology
 2GP4 A;  5D29 A;  4C9V A;  3D7G A;  4P4E A;  4C8C A;  4NGQ A;  4OC2 A;  3D7F A;  4C9E A;  3SJX A;  1WVM A;  4MCR A;  5IR2 A;  2PVW A;  3ICU A;  4TWE A;  4P4D A;  4C8U A;  4P4I A;  2EK9 A;  4NGS A;  4OME A;  1CX8 A;  4TJX A;  2XEF A;  1XF1 A;  3FEC A;  4C8T A;  4P4B A;  3S9N A;  2CIJ A;  4P4F A;  4C86 A;  4OC3 A;  3FED A;  2C6G A;  3IIB A;  4JYW A;  3D7D A;  4OC5 A;  4OC0 A;  4C9A A;  3S9M A;  3RBU A;  4JZ0 A;  3SJF A;  2C5Q A;  4MCQ A;  4TJV A;  3BI1 A;  2XEG A;  4C8P A;  4NGR A;  4C9R A;  5ELY A;  1V6C A;  4NGT A;  2C6P A;  3VTA A;  4CDK A;  2EK8 A;  4LQG A;  4OC1 A;  4YN3 A;  1Z8L A;  2PVV A;  4P4J A;  3KAS A;  4C8F A;  3SJG A;  3K9T A;  2OOT A;  1DE4 C;  4KNG E;  4C99 A;  4W9Y A;  2XEI A;  3BI0 A;  4OC4 A;  2C6C A;  2XEJ A;  4P44 A;  4MCP A;  4NGN A;  3SJE A;  3I6S A;  3D7H A;  4C85 A;  5F09 A;  4MCS A;  4CDJ A;  2OR4 A;  3BXM A;  1Y9Z A;  2JBK A;  3FEE A;  3S9L A;  4X3R A;  3FF3 A;  4C84 A;  5IB9 A;  4C9U A;  3BHX A;  3I74 A;  4NGP A;  4C8A A;  2JBJ A;  4NGM A;  4P45 A;  3EIF A;  3IWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...