4C9AA

Mouse znrf3 ectodomain in complex with xenopus rspo2 fu1-fu2 (seleno met) crystal form i
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
153
structure length
153
Chain Sequence
KETAFVEVVLFESSPSGDYTTHTTGLTGRFSRAGAMLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
total genus 38
structure length 153
sequence length 153
chains with identical sequence C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4c9aA00
3BI1A 4OC0A 3SJFA 4C8PA 5F09A 4C8TA 3D7FA 3D7GA 3FEEA 4C9RA 4NGQA 3D7HA 3SJGA 4C84A 2JBJA 4JZ0A 4P4FA 4OMEA 1XF1A 2C6CA 4OC5A 3I6SA 4MCRA 4P45A 4JYWA 3S9MA 4LQGA 4MCSA 4NGNA 4P4BA 4CDJA 4X3RA 3KASA 3IWWA 4P44A 4C8CA 3BHXA 4MCPA 3SJXA 4NGPA 4OC2A 4C86A 5ELYA 3I74A 2OR4A 3EIFA 4YN3A 2XEFA 3S9NA 4C9EA 4C9AA 4C9VA 4OC4A 4P4EA 1Z8LA 3VTAA 4KNGE 3BXMA 4OC1A 4W9YA 4NGTA 4NGRA 3FECA 4NGMA 3RBUA 4NGSA 1Y9ZA 4TWEA 4TJXA 4CDKA 4C85A 3IIBA 2C6PA 4P4DA 4OC3A 1DE4C 4C99A 3S9LA 2PVVA 2XEIA 4C9UA 4P4JA 4C8FA 2OOTA 1CX8A 3FEDA 2EK9A 3BI0A 3SJEA 2JBKA 5D29A 2PVWA 2EK8A 2C6GA 2CIJA 3D7DA 5IB9A 4P4IA 4C8UA 2XEJA 2XEGA 4TJVA 1V6CA 1WVMA 4C8AA 4MCQA 3ICUA 3FF3A
chains in the Genus database with same CATH superfamily
3BI1A 1KEEB 3T05A 1VI4A 4OC0A 3SJFA 2YJTA 3T5MA 4C8PA 4E94A 5F09A 1VBHA 4C8TA 3D7FA 2GP4A 3D7GA 3FEEA 4C9RA 4NGQA 3D7HA 3SJGA 4C84A 2JBJA 4JZ0A 1C3OB 1EZBA 4P4FA 4OMEA 5F5XA 1VBGA 1XF1A 2C6CA 1KC7A 4OC5A 4E5SA 3I6SA 4MCRA 3EZAA 1CS0B 2MP0A 4JYWA 4P45A 3S9MA 4LQGA 1R61A 2X0SA 4MCSA 4NGNA 4P4BA 5F1YA 4CDJA 4X3RA 4IIYA 3KASA 5F9MA 3GJZA 2D0PA 2HI6A 2DIKA 3TLAA 3IWWA 4P44A 4C8CA 3BHXA 4MCPA 4MJXA 1DIKA 2R82A 3SJXA 4NGPA 1NXJA 4OC2A 2E28A 4MI1A 4C86A 4IIXA 5ELYA 1KBLA 1JDEA 3I74A 1ZYMA 3EZBA 2OR4A 3EIFA 4YN3A 3T07A 2XEFA 3C8OA 3TYXA 2C5QA 3S9NA 1GGOA 4C9EA 2HROA 2EZCA 3KRVA 4EYSA 4C9AA 3T0TA 4C9VA 5K99A 4OC4A 4P4EA 3SR3A 5FD8A 1Z8LA 3VTAA 4KNGE 3TLBA 3TLCA 3BXMA 5IR2A 1ZRSA 4OC1A 1BXRB 2EZAA 4NGTA 4NGRA 4W9YA 4COBA 3TLYA 3FECA 4NGMA 1A9XB 5JVLA 2B0AA 1Q5XA 3RBUA 4NGSA 1EZAA 3K9TA 1Y9ZA 4TWEA 4TJXA 2OLSA 2D0OA 3TLZA 5JYBA 3U1BA 4CDKA 4C85A 3IIBA 2EZBA 1CE8B 2YJVA 2C6PA 3TLGB 4P4DA 2FM4A 4OC3A 4M8DA 1DE4C 4C99A 3S9LA 2PVVA 1J3LA 4INJA 2XEIA 4C9UA 4P4JA 2AUMA 4C8FA 2OOTA 3G23A 1M6VB 1CX8A 3FEDA 2EK9A 3BI0A 4CZ1A 1NBWA 3SJEA 2JBKA 5D29A 2HWGA 3EZEA 2AUNA 4JVOA 2PVWA 4COGA 1JDBC 3TLEA 2EK8A 3K4IA 2C6GA 2CIJA 3D7DA 3NOJA 5IB9A 4P4IA 4C8UA 2XEJA 3TLGA 4J0NA 2XEGA 2PCNA 4TJVA 1V6CA 1WVMA 1ZL0A 4H1HA 4MCQA 4C8AA 3ICUA 3FF3A 1C30B 1T36B 4CO9A
chains in the Genus database with same CATH topology
3BI1A 4OC0A 3SJFA 4C8PA 5F09A 4C8TA 3D7FA 2GP4A 3D7GA 3FEEA 4C9RA 4NGQA 3D7HA 3SJGA 4C84A 2JBJA 4JZ0A 4P4FA 4OMEA 1XF1A 2C6CA 4OC5A 3I6SA 4MCRA 4P45A 4JYWA 3S9MA 4LQGA 4MCSA 4NGNA 4P4BA 4CDJA 4X3RA 3KASA 3IWWA 4P44A 4C8CA 3BHXA 4MCPA 3SJXA 4NGPA 4OC2A 4C86A 5ELYA 3I74A 2OR4A 3EIFA 4YN3A 2XEFA 2C5QA 3S9NA 4C9EA 4C9AA 4C9VA 4OC4A 4P4EA 1Z8LA 3VTAA 4KNGE 3BXMA 5IR2A 4OC1A 4W9YA 4NGTA 4NGRA 3FECA 4NGMA 3RBUA 4NGSA 3K9TA 1Y9ZA 4TWEA 4TJXA 4CDKA 4C85A 3IIBA 2C6PA 4P4DA 4OC3A 1DE4C 4C99A 3S9LA 2PVVA 2XEIA 4C9UA 4P4JA 4C8FA 2OOTA 1CX8A 3FEDA 2EK9A 3BI0A 3SJEA 2JBKA 5D29A 2PVWA 2EK8A 2C6GA 2CIJA 3D7DA 5IB9A 4P4IA 4C8UA 2XEJA 2XEGA 4TJVA 1V6CA 1WVMA 4C8AA 4MCQA 3ICUA 3FF3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BI1 A;  4OC0 A;  3SJF A;  4C8P A;  5F09 A;  4C8T A;  3D7F A;  3D7G A;  3FEE A;  4C9R A;  4NGQ A;  3D7H A;  3SJG A;  4C84 A;  2JBJ A;  4JZ0 A;  4P4F A;  4OME A;  1XF1 A;  2C6C A;  4OC5 A;  3I6S A;  4MCR A;  4P45 A;  4JYW A;  3S9M A;  4LQG A;  4MCS A;  4NGN A;  4P4B A;  4CDJ A;  4X3R A;  3KAS A;  3IWW A;  4P44 A;  4C8C A;  3BHX A;  4MCP A;  3SJX A;  4NGP A;  4OC2 A;  4C86 A;  5ELY A;  3I74 A;  2OR4 A;  3EIF A;  4YN3 A;  2XEF A;  3S9N A;  4C9E A;  4C9A A;  4C9V A;  4OC4 A;  4P4E A;  1Z8L A;  3VTA A;  4KNG E;  3BXM A;  4OC1 A;  4W9Y A;  4NGT A;  4NGR A;  3FEC A;  4NGM A;  3RBU A;  4NGS A;  1Y9Z A;  4TWE A;  4TJX A;  4CDK A;  4C85 A;  3IIB A;  2C6P A;  4P4D A;  4OC3 A;  1DE4 C;  4C99 A;  3S9L A;  2PVV A;  2XEI A;  4C9U A;  4P4J A;  4C8F A;  2OOT A;  1CX8 A;  3FED A;  2EK9 A;  3BI0 A;  3SJE A;  2JBK A;  5D29 A;  2PVW A;  2EK8 A;  2C6G A;  2CIJ A;  3D7D A;  5IB9 A;  4P4I A;  4C8U A;  2XEJ A;  2XEG A;  4TJV A;  1V6C A;  1WVM A;  4C8A A;  4MCQ A;  3ICU A;  3FF3 A; 
#chains in the Genus database with same CATH topology
 3BI1 A;  1KEE B;  3T05 A;  1VI4 A;  4OC0 A;  3SJF A;  2YJT A;  3T5M A;  4C8P A;  4E94 A;  5F09 A;  1VBH A;  4C8T A;  3D7F A;  2GP4 A;  3D7G A;  3FEE A;  4C9R A;  4NGQ A;  3D7H A;  3SJG A;  4C84 A;  2JBJ A;  4JZ0 A;  1C3O B;  1EZB A;  4P4F A;  4OME A;  5F5X A;  1VBG A;  1XF1 A;  2C6C A;  1KC7 A;  4OC5 A;  4E5S A;  3I6S A;  4MCR A;  3EZA A;  1CS0 B;  2MP0 A;  4JYW A;  4P45 A;  3S9M A;  4LQG A;  1R61 A;  2X0S A;  4MCS A;  4NGN A;  4P4B A;  5F1Y A;  4CDJ A;  4X3R A;  4IIY A;  3KAS A;  5F9M A;  3GJZ A;  2D0P A;  2HI6 A;  2DIK A;  3TLA A;  3IWW A;  4P44 A;  4C8C A;  3BHX A;  4MCP A;  4MJX A;  1DIK A;  2R82 A;  3SJX A;  4NGP A;  1NXJ A;  4OC2 A;  2E28 A;  4MI1 A;  4C86 A;  4IIX A;  5ELY A;  1KBL A;  1JDE A;  3I74 A;  1ZYM A;  3EZB A;  2OR4 A;  3EIF A;  4YN3 A;  3T07 A;  2XEF A;  3C8O A;  3TYX A;  2C5Q A;  3S9N A;  1GGO A;  4C9E A;  2HRO A;  2EZC A;  3KRV A;  4EYS A;  4C9A A;  3T0T A;  4C9V A;  5K99 A;  4OC4 A;  4P4E A;  3SR3 A;  5FD8 A;  1Z8L A;  3VTA A;  4KNG E;  3TLB A;  3TLC A;  3BXM A;  5IR2 A;  1ZRS A;  4OC1 A;  1BXR B;  2EZA A;  4NGT A;  4NGR A;  4W9Y A;  4COB A;  3TLY A;  3FEC A;  4NGM A;  1A9X B;  5JVL A;  2B0A A;  1Q5X A;  3RBU A;  4NGS A;  1EZA A;  3K9T A;  1Y9Z A;  4TWE A;  4TJX A;  2OLS A;  2D0O A;  3TLZ A;  5JYB A;  3U1B A;  4CDK A;  4C85 A;  3IIB A;  2EZB A;  1CE8 B;  2YJV A;  2C6P A;  3TLG B;  4P4D A;  2FM4 A;  4OC3 A;  4M8D A;  1DE4 C;  4C99 A;  3S9L A;  2PVV A;  1J3L A;  4INJ A;  2XEI A;  4C9U A;  4P4J A;  2AUM A;  4C8F A;  2OOT A;  3G23 A;  1M6V B;  1CX8 A;  3FED A;  2EK9 A;  3BI0 A;  4CZ1 A;  1NBW A;  3SJE A;  2JBK A;  5D29 A;  2HWG A;  3EZE A;  2AUN A;  4JVO A;  2PVW A;  4COG A;  1JDB C;  3TLE A;  2EK8 A;  3K4I A;  2C6G A;  2CIJ A;  3D7D A;  3NOJ A;  5IB9 A;  4P4I A;  4C8U A;  2XEJ A;  3TLG A;  4J0N A;  2XEG A;  2PCN A;  4TJV A;  1V6C A;  1WVM A;  1ZL0 A;  4H1H A;  4MCQ A;  4C8A A;  3ICU A;  3FF3 A;  1C30 B;  1T36 B;  4CO9 A; 
#chains in the Genus database with same CATH homology
 3BI1 A;  4OC0 A;  3SJF A;  4C8P A;  5F09 A;  4C8T A;  3D7F A;  2GP4 A;  3D7G A;  3FEE A;  4C9R A;  4NGQ A;  3D7H A;  3SJG A;  4C84 A;  2JBJ A;  4JZ0 A;  4P4F A;  4OME A;  1XF1 A;  2C6C A;  4OC5 A;  3I6S A;  4MCR A;  4P45 A;  4JYW A;  3S9M A;  4LQG A;  4MCS A;  4NGN A;  4P4B A;  4CDJ A;  4X3R A;  3KAS A;  3IWW A;  4P44 A;  4C8C A;  3BHX A;  4MCP A;  3SJX A;  4NGP A;  4OC2 A;  4C86 A;  5ELY A;  3I74 A;  2OR4 A;  3EIF A;  4YN3 A;  2XEF A;  2C5Q A;  3S9N A;  4C9E A;  4C9A A;  4C9V A;  4OC4 A;  4P4E A;  1Z8L A;  3VTA A;  4KNG E;  3BXM A;  5IR2 A;  4OC1 A;  4W9Y A;  4NGT A;  4NGR A;  3FEC A;  4NGM A;  3RBU A;  4NGS A;  3K9T A;  1Y9Z A;  4TWE A;  4TJX A;  4CDK A;  4C85 A;  3IIB A;  2C6P A;  4P4D A;  4OC3 A;  1DE4 C;  4C99 A;  3S9L A;  2PVV A;  2XEI A;  4C9U A;  4P4J A;  4C8F A;  2OOT A;  1CX8 A;  3FED A;  2EK9 A;  3BI0 A;  3SJE A;  2JBK A;  5D29 A;  2PVW A;  2EK8 A;  2C6G A;  2CIJ A;  3D7D A;  5IB9 A;  4P4I A;  4C8U A;  2XEJ A;  2XEG A;  4TJV A;  1V6C A;  1WVM A;  4C8A A;  4MCQ A;  3ICU A;  3FF3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...