4C9AA

Mouse znrf3 ectodomain in complex with xenopus rspo2 fu1-fu2 (seleno met) crystal form i
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
153
structure length
153
Chain Sequence
b'KETAFVEVVLFESSPSGDYTTHTTGLTGRFSRAGAMLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
publication title Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
total genus 38
structure length 153
sequence length 153
chains with identical sequence C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4c9aA00
3I6SA 4C85A 3D7GA 4C8PA 4P4IA 1XF1A 4NGNA 3VTAA 1Z8LA 4P4FA 1WVMA 3FEDA 5IB9A 4CDKA 4C84A 3FF3A 4CDJA 4OC0A 4C9RA 3S9NA 3FEEA 2C6CA 2PVWA 4JYWA 3D7DA 4C8FA 2C6GA 4KNGE 4OC5A 2EK9A 2OOTA 3BHXA 4C99A 4NGSA 1V6CA 2OR4A 4C8TA 4X3RA 3SJXA 4P4JA 4NGMA 3ICUA 2XEFA 3IIBA 3S9LA 2CIJA 4MCRA 5D29A 1CX8A 4NGTA 4OMEA 3S9MA 4W9YA 4C9UA 3RBUA 4OC4A 5F09A 4YN3A 3SJFA 4JZ0A 4P45A 2JBJA 3IWWA 5ELYA 3BXMA 2XEJA 3D7FA 4NGQA 3BI1A 4MCPA 2PVVA 3FECA 4C9AA 3D7HA 1DE4C 4P4BA 4MCQA 4TJXA 4OC3A 3SJEA 2JBKA 3I74A 4C86A 4P4EA 2EK8A 2C6PA 4MCSA 4NGRA 3BI0A 4LQGA 4C9EA 4TWEA 4NGPA 2XEIA 1Y9ZA 4P4DA 2XEGA 3EIFA 4OC2A 3KASA 4C8CA 4OC1A 4C8AA 3SJGA 4TJVA 4P44A 4C9VA 4C8UA
chains in the Genus database with same CATH superfamily
3I6SA 3NOJA 3SR3A 3T05A 4E5SA 5JVLA 5IR2A 4C85A 3D7GA 2HWGA 3K9TA 4P4IA 5FD8A 4C8PA 1XF1A 4IIXA 4NGNA 3VTAA 2B0AA 1Z8LA 4P4FA 1WVMA 3TLAA 3FEDA 4COGA 2D0PA 5IB9A 4CDKA 4C84A 1BXRB 3FF3A 4CDJA 4OC0A 4C9RA 1KC7A 3S9NA 1VI4A 3FEEA 3TLZA 4E94A 1EZBA 2C6CA 2PVWA 2HI6A 4H1HA 2R82A 4JYWA 3D7DA 4C8FA 1A9XB 2C6GA 4KNGE 4OC5A 1C30B 5F9MA 2EK9A 3EZEA 2YJTA 2OOTA 5F5XA 3BHXA 3G23A 2E28A 4C99A 2HROA 4NGSA 2OLSA 1NBWA 1CE8B 1V6CA 1KBLA 3TLBA 2OR4A 4C8TA 4X3RA 3SJXA 4P4JA 2AUNA 4NGMA 5K99A 3ICUA 1DIKA 2MP0A 2XEFA 3TLYA 4COBA 1VBHA 1JDEA 1GGOA 3IIBA 1ZL0A 3S9LA 2CIJA 4MCRA 1JDBC 5D29A 1CX8A 4JVOA 4NGTA 3EZAA 4OMEA 2C5QA 3T07A 3S9MA 4CZ1A 3K4IA 4W9YA 1VBGA 4C9UA 3RBUA 4OC4A 5F09A 4YN3A 3SJFA 4JZ0A 4P45A 2JBJA 3IWWA 1Q5XA 4MI1A 4MJXA 3BXMA 3KRVA 5ELYA 3EZBA 2XEJA 3D7FA 3T0TA 4NGQA 2AUMA 3BI1A 1KEEB 4MCPA 2PVVA 2D0OA 3FECA 2EZCA 4C9AA 3T5MA 1CS0B 3D7HA 2PCNA 5JYBA 1R61A 1DE4C 4P4BA 2FM4A 4MCQA 4TJXA 1EZAA 2EZAA 1ZYMA 2X0SA 4OC3A 3SJEA 1C3OB 2JBKA 3I74A 4INJA 4C86A 4P4EA 3U1BA 2EK8A 2GP4A 2C6PA 4MCSA 4NGRA 4M8DA 3BI0A 3C8OA 4EYSA 4LQGA 3TLEA 3TLGA 3TLGB 4C9EA 1J3LA 4TWEA 4NGPA 3GJZA 2XEIA 4CO9A 1Y9ZA 1NXJA 4P4DA 2YJVA 2XEGA 3EIFA 4OC2A 1T36B 3KASA 2DIKA 4C8CA 4OC1A 4C8AA 3SJGA 1M6VB 1ZRSA 2EZBA 4TJVA 4IIYA 5F1YA 4P44A 4C9VA 4C8UA 4J0NA 3TYXA 3TLCA
chains in the Genus database with same CATH topology
3I6SA 5IR2A 4C85A 3D7GA 3K9TA 4P4IA 4C8PA 1XF1A 4NGNA 3VTAA 1Z8LA 4P4FA 1WVMA 3FEDA 5IB9A 4CDKA 4C84A 3FF3A 4CDJA 4OC0A 4C9RA 3S9NA 3FEEA 2C6CA 2PVWA 4JYWA 3D7DA 4C8FA 2C6GA 4KNGE 4OC5A 2EK9A 2OOTA 3BHXA 4C99A 4NGSA 1V6CA 2OR4A 4C8TA 4X3RA 3SJXA 4P4JA 4NGMA 3ICUA 2XEFA 3IIBA 3S9LA 2CIJA 4MCRA 5D29A 1CX8A 4NGTA 4OMEA 2C5QA 3S9MA 4W9YA 4C9UA 3RBUA 4OC4A 5F09A 4YN3A 3SJFA 4JZ0A 4P45A 2JBJA 3IWWA 5ELYA 3BXMA 2XEJA 3D7FA 4NGQA 3BI1A 4MCPA 2PVVA 3FECA 4C9AA 3D7HA 1DE4C 4P4BA 4MCQA 4TJXA 4OC3A 3SJEA 2JBKA 3I74A 4C86A 4P4EA 2EK8A 2GP4A 2C6PA 4MCSA 4NGRA 3BI0A 4LQGA 4C9EA 4TWEA 4NGPA 2XEIA 1Y9ZA 4P4DA 2XEGA 3EIFA 4OC2A 3KASA 4C8CA 4OC1A 4C8AA 3SJGA 4TJVA 4P44A 4C9VA 4C8UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I6S A;  4C85 A;  3D7G A;  4C8P A;  4P4I A;  1XF1 A;  4NGN A;  3VTA A;  1Z8L A;  4P4F A;  1WVM A;  3FED A;  5IB9 A;  4CDK A;  4C84 A;  3FF3 A;  4CDJ A;  4OC0 A;  4C9R A;  3S9N A;  3FEE A;  2C6C A;  2PVW A;  4JYW A;  3D7D A;  4C8F A;  2C6G A;  4KNG E;  4OC5 A;  2EK9 A;  2OOT A;  3BHX A;  4C99 A;  4NGS A;  1V6C A;  2OR4 A;  4C8T A;  4X3R A;  3SJX A;  4P4J A;  4NGM A;  3ICU A;  2XEF A;  3IIB A;  3S9L A;  2CIJ A;  4MCR A;  5D29 A;  1CX8 A;  4NGT A;  4OME A;  3S9M A;  4W9Y A;  4C9U A;  3RBU A;  4OC4 A;  5F09 A;  4YN3 A;  3SJF A;  4JZ0 A;  4P45 A;  2JBJ A;  3IWW A;  5ELY A;  3BXM A;  2XEJ A;  3D7F A;  4NGQ A;  3BI1 A;  4MCP A;  2PVV A;  3FEC A;  4C9A A;  3D7H A;  1DE4 C;  4P4B A;  4MCQ A;  4TJX A;  4OC3 A;  3SJE A;  2JBK A;  3I74 A;  4C86 A;  4P4E A;  2EK8 A;  2C6P A;  4MCS A;  4NGR A;  3BI0 A;  4LQG A;  4C9E A;  4TWE A;  4NGP A;  2XEI A;  1Y9Z A;  4P4D A;  2XEG A;  3EIF A;  4OC2 A;  3KAS A;  4C8C A;  4OC1 A;  4C8A A;  3SJG A;  4TJV A;  4P44 A;  4C9V A;  4C8U A; 
#chains in the Genus database with same CATH topology
 3I6S A;  3NOJ A;  3SR3 A;  3T05 A;  4E5S A;  5JVL A;  5IR2 A;  4C85 A;  3D7G A;  2HWG A;  3K9T A;  4P4I A;  5FD8 A;  4C8P A;  1XF1 A;  4IIX A;  4NGN A;  3VTA A;  2B0A A;  1Z8L A;  4P4F A;  1WVM A;  3TLA A;  3FED A;  4COG A;  2D0P A;  5IB9 A;  4CDK A;  4C84 A;  1BXR B;  3FF3 A;  4CDJ A;  4OC0 A;  4C9R A;  1KC7 A;  3S9N A;  1VI4 A;  3FEE A;  3TLZ A;  4E94 A;  1EZB A;  2C6C A;  2PVW A;  2HI6 A;  4H1H A;  2R82 A;  4JYW A;  3D7D A;  4C8F A;  1A9X B;  2C6G A;  4KNG E;  4OC5 A;  1C30 B;  5F9M A;  2EK9 A;  3EZE A;  2YJT A;  2OOT A;  5F5X A;  3BHX A;  3G23 A;  2E28 A;  4C99 A;  2HRO A;  4NGS A;  2OLS A;  1NBW A;  1CE8 B;  1V6C A;  1KBL A;  3TLB A;  2OR4 A;  4C8T A;  4X3R A;  3SJX A;  4P4J A;  2AUN A;  4NGM A;  5K99 A;  3ICU A;  1DIK A;  2MP0 A;  2XEF A;  3TLY A;  4COB A;  1VBH A;  1JDE A;  1GGO A;  3IIB A;  1ZL0 A;  3S9L A;  2CIJ A;  4MCR A;  1JDB C;  5D29 A;  1CX8 A;  4JVO A;  4NGT A;  3EZA A;  4OME A;  2C5Q A;  3T07 A;  3S9M A;  4CZ1 A;  3K4I A;  4W9Y A;  1VBG A;  4C9U A;  3RBU A;  4OC4 A;  5F09 A;  4YN3 A;  3SJF A;  4JZ0 A;  4P45 A;  2JBJ A;  3IWW A;  1Q5X A;  4MI1 A;  4MJX A;  3BXM A;  3KRV A;  5ELY A;  3EZB A;  2XEJ A;  3D7F A;  3T0T A;  4NGQ A;  2AUM A;  3BI1 A;  1KEE B;  4MCP A;  2PVV A;  2D0O A;  3FEC A;  2EZC A;  4C9A A;  3T5M A;  1CS0 B;  3D7H A;  2PCN A;  5JYB A;  1R61 A;  1DE4 C;  4P4B A;  2FM4 A;  4MCQ A;  4TJX A;  1EZA A;  2EZA A;  1ZYM A;  2X0S A;  4OC3 A;  3SJE A;  1C3O B;  2JBK A;  3I74 A;  4INJ A;  4C86 A;  4P4E A;  3U1B A;  2EK8 A;  2GP4 A;  2C6P A;  4MCS A;  4NGR A;  4M8D A;  3BI0 A;  3C8O A;  4EYS A;  4LQG A;  3TLE A;  3TLG A;  3TLG B;  4C9E A;  1J3L A;  4TWE A;  4NGP A;  3GJZ A;  2XEI A;  4CO9 A;  1Y9Z A;  1NXJ A;  4P4D A;  2YJV A;  2XEG A;  3EIF A;  4OC2 A;  1T36 B;  3KAS A;  2DIK A;  4C8C A;  4OC1 A;  4C8A A;  3SJG A;  1M6V B;  1ZRS A;  2EZB A;  4TJV A;  4IIY A;  5F1Y A;  4P44 A;  4C9V A;  4C8U A;  4J0N A;  3TYX A;  3TLC A; 
#chains in the Genus database with same CATH homology
 3I6S A;  5IR2 A;  4C85 A;  3D7G A;  3K9T A;  4P4I A;  4C8P A;  1XF1 A;  4NGN A;  3VTA A;  1Z8L A;  4P4F A;  1WVM A;  3FED A;  5IB9 A;  4CDK A;  4C84 A;  3FF3 A;  4CDJ A;  4OC0 A;  4C9R A;  3S9N A;  3FEE A;  2C6C A;  2PVW A;  4JYW A;  3D7D A;  4C8F A;  2C6G A;  4KNG E;  4OC5 A;  2EK9 A;  2OOT A;  3BHX A;  4C99 A;  4NGS A;  1V6C A;  2OR4 A;  4C8T A;  4X3R A;  3SJX A;  4P4J A;  4NGM A;  3ICU A;  2XEF A;  3IIB A;  3S9L A;  2CIJ A;  4MCR A;  5D29 A;  1CX8 A;  4NGT A;  4OME A;  2C5Q A;  3S9M A;  4W9Y A;  4C9U A;  3RBU A;  4OC4 A;  5F09 A;  4YN3 A;  3SJF A;  4JZ0 A;  4P45 A;  2JBJ A;  3IWW A;  5ELY A;  3BXM A;  2XEJ A;  3D7F A;  4NGQ A;  3BI1 A;  4MCP A;  2PVV A;  3FEC A;  4C9A A;  3D7H A;  1DE4 C;  4P4B A;  4MCQ A;  4TJX A;  4OC3 A;  3SJE A;  2JBK A;  3I74 A;  4C86 A;  4P4E A;  2EK8 A;  2GP4 A;  2C6P A;  4MCS A;  4NGR A;  3BI0 A;  4LQG A;  4C9E A;  4TWE A;  4NGP A;  2XEI A;  1Y9Z A;  4P4D A;  2XEG A;  3EIF A;  4OC2 A;  3KAS A;  4C8C A;  4OC1 A;  4C8A A;  3SJG A;  4TJV A;  4P44 A;  4C9V A;  4C8U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...