2B0AA

Crystal structure of protein mj0783 from methanococcus jannaschii
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
186
structure length
186
Chain Sequence
EILDLTQTLINFPRPGDPELRIIEKKIDGFIVSEIIMGSHLCTHIDYPKHVGLENRIPFKDGIIKGKGYCISLDDFPGNKLPACDILLIYTGFSKYWGRDEYFEKIPEIPFLDDIIKSNIKCVGIDACTIGGFEEHKRLLSNNILIIENLNENLKNLVGKSFYFLGLPLKIFDIDASPIRCIAILE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein MJ0783
publication title Crystal Structure of Hypothetical Protein Mj0783 from Methanococcus Jannaschii
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Structural genomics, unknown function
total genus 47
structure length 186
sequence length 186
ec nomenclature
pdb deposition date 2005-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04199 Cyclase Putative cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.50 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Putative cyclase 2b0aA00
4M8DA 1R61A 4CO9A 3KRVA 4COBA 4J0NA 4CZ1A 2B0AA 4COGA
chains in the Genus database with same CATH superfamily
4C9AA 2XEJA 3I74A 4TWEA 2C6CA 3ICUA 3U1BA 3SR3A 4LQGA 2EK9A 3TLGA 2OLSA 2C6PA 5F5XA 1VI4A 1M6VB 3D7FA 4X3RA 1WVMA 1C30B 2X0SA 1EZAA 4CDJA 1VBGA 3EZBA 2C5QA 2DIKA 3T07A 3TLCA 3SJXA 2XEIA 1C3OB 2EZBA 5IR2A 4KNGE 2FM4A 4H1HA 3C8OA 4COBA 2D0OA 4J0NA 4JYWA 2EK8A 1ZRSA 4P4IA 4C9EA 2XEFA 4OMEA 4OC1A 1J3LA 3NOJA 4NGNA 4TJXA 4C85A 2OOTA 2GP4A 3I6SA 4INJA 2PCNA 1Q5XA 3GJZA 4NGSA 2YJVA 1ZL0A 4IIYA 4JZ0A 3TLYA 4C8AA 3BHXA 4P4JA 5JVLA 3T5MA 1A9XB 1CX8A 4P4BA 4C8UA 4CDKA 3SJFA 1T36B 3IIBA 2HROA 3BI1A 1JDEA 3BI0A 4NGMA 2OR4A 1NBWA 3G23A 4P44A 4P4DA 4P4EA 4C99A 1KEEB 4YN3A 4NGRA 3EZEA 2HI6A 3FECA 4OC5A 4OC3A 4EYSA 3TLGB 3SJEA 5ELYA 1KC7A 3T0TA 1XF1A 3S9MA 3K4IA 3FF3A 2EZAA 4MCRA 5JYBA 3S9LA 4NGQA 2AUNA 3TLEA 4C9VA 4C9UA 3TYXA 1ZYMA 4IIXA 3T05A 5K99A 2YJTA 4P4FA 4E94A 3D7DA 1V6CA 4MI1A 4C8CA 4MCQA 3D7HA 3KRVA 4OC2A 4P45A 4CO9A 2R82A 5F09A 3K9TA 2JBKA 2PVWA 3TLBA 1BXRB 2B0AA 2AUMA 3FEEA 1Z8LA 3TLAA 3VTAA 4C8FA 5F1YA 1VBHA 3IWWA 4C8PA 4OC0A 1DE4C 1R61A 2C6GA 4CZ1A 4OC4A 2JBJA 2CIJA 4JVOA 4TJVA 1CE8B 1DIKA 4C9RA 2HWGA 3EIFA 2PVVA 4C86A 4M8DA 3KASA 3TLZA 1GGOA 1NXJA 4C8TA 5F9MA 2XEGA 4MCSA 4NGPA 5IB9A 1KBLA 4MCPA 5FD8A 4MJXA 3S9NA 2MP0A 4C84A 3D7GA 3EZAA 2EZCA 1CS0B 1Y9ZA 3BXMA 1JDBC 4NGTA 3SJGA 4W9YA 3FEDA 1EZBA 4E5SA 3RBUA 2E28A 5D29A 2D0PA 4COGA
chains in the Genus database with same CATH topology
4M8DA 1R61A 4CO9A 3KRVA 4COBA 4J0NA 4CZ1A 2B0AA 4COGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M8D A;  1R61 A;  4CO9 A;  3KRV A;  4COB A;  4J0N A;  4CZ1 A;  2B0A A;  4COG A; 
#chains in the Genus database with same CATH topology
 4C9A A;  2XEJ A;  3I74 A;  4TWE A;  2C6C A;  3ICU A;  3U1B A;  3SR3 A;  4LQG A;  2EK9 A;  3TLG A;  2OLS A;  2C6P A;  5F5X A;  1VI4 A;  1M6V B;  3D7F A;  4X3R A;  1WVM A;  1C30 B;  2X0S A;  1EZA A;  4CDJ A;  1VBG A;  3EZB A;  2C5Q A;  2DIK A;  3T07 A;  3TLC A;  3SJX A;  2XEI A;  1C3O B;  2EZB A;  5IR2 A;  4KNG E;  2FM4 A;  4H1H A;  3C8O A;  4COB A;  2D0O A;  4J0N A;  4JYW A;  2EK8 A;  1ZRS A;  4P4I A;  4C9E A;  2XEF A;  4OME A;  4OC1 A;  1J3L A;  3NOJ A;  4NGN A;  4TJX A;  4C85 A;  2OOT A;  2GP4 A;  3I6S A;  4INJ A;  2PCN A;  1Q5X A;  3GJZ A;  4NGS A;  2YJV A;  1ZL0 A;  4IIY A;  4JZ0 A;  3TLY A;  4C8A A;  3BHX A;  4P4J A;  5JVL A;  3T5M A;  1A9X B;  1CX8 A;  4P4B A;  4C8U A;  4CDK A;  3SJF A;  1T36 B;  3IIB A;  2HRO A;  3BI1 A;  1JDE A;  3BI0 A;  4NGM A;  2OR4 A;  1NBW A;  3G23 A;  4P44 A;  4P4D A;  4P4E A;  4C99 A;  1KEE B;  4YN3 A;  4NGR A;  3EZE A;  2HI6 A;  3FEC A;  4OC5 A;  4OC3 A;  4EYS A;  3TLG B;  3SJE A;  5ELY A;  1KC7 A;  3T0T A;  1XF1 A;  3S9M A;  3K4I A;  3FF3 A;  2EZA A;  4MCR A;  5JYB A;  3S9L A;  4NGQ A;  2AUN A;  3TLE A;  4C9V A;  4C9U A;  3TYX A;  1ZYM A;  4IIX A;  3T05 A;  5K99 A;  2YJT A;  4P4F A;  4E94 A;  3D7D A;  1V6C A;  4MI1 A;  4C8C A;  4MCQ A;  3D7H A;  3KRV A;  4OC2 A;  4P45 A;  4CO9 A;  2R82 A;  5F09 A;  3K9T A;  2JBK A;  2PVW A;  3TLB A;  1BXR B;  2B0A A;  2AUM A;  3FEE A;  1Z8L A;  3TLA A;  3VTA A;  4C8F A;  5F1Y A;  1VBH A;  3IWW A;  4C8P A;  4OC0 A;  1DE4 C;  1R61 A;  2C6G A;  4CZ1 A;  4OC4 A;  2JBJ A;  2CIJ A;  4JVO A;  4TJV A;  1CE8 B;  1DIK A;  4C9R A;  2HWG A;  3EIF A;  2PVV A;  4C86 A;  4M8D A;  3KAS A;  3TLZ A;  1GGO A;  1NXJ A;  4C8T A;  5F9M A;  2XEG A;  4MCS A;  4NGP A;  5IB9 A;  1KBL A;  4MCP A;  5FD8 A;  4MJX A;  3S9N A;  2MP0 A;  4C84 A;  3D7G A;  3EZA A;  2EZC A;  1CS0 B;  1Y9Z A;  3BXM A;  1JDB C;  4NGT A;  3SJG A;  4W9Y A;  3FED A;  1EZB A;  4E5S A;  3RBU A;  2E28 A;  5D29 A;  2D0P A;  4COG A; 
#chains in the Genus database with same CATH homology
 4M8D A;  1R61 A;  4CO9 A;  3KRV A;  4COB A;  4J0N A;  4CZ1 A;  2B0A A;  4COG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...