2B0AA

Crystal structure of protein mj0783 from methanococcus jannaschii
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
186
structure length
186
Chain Sequence
EILDLTQTLINFPRPGDPELRIIEKKIDGFIVSEIIMGSHLCTHIDYPKHVGLENRIPFKDGIIKGKGYCISLDDFPGNKLPACDILLIYTGFSKYWGRDEYFEKIPEIPFLDDIIKSNIKCVGIDACTIGGFEEHKRLLSNNILIIENLNENLKNLVGKSFYFLGLPLKIFDIDASPIRCIAILE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein MJ0783
publication title Crystal Structure of Hypothetical Protein Mj0783 from Methanococcus Jannaschii
rcsb
source organism Methanocaldococcus jannaschii
total genus 47
structure length 186
sequence length 186
ec nomenclature
pdb deposition date 2005-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04199 Cyclase Putative cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.50 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Putative cyclase 2b0aA00
1R61A 4COGA 4COBA 4CO9A 2B0AA 4J0NA 4M8DA 3KRVA 4CZ1A
chains in the Genus database with same CATH superfamily
5JVLA 5JYBA 4OMEA 4YN3A 3BHXA 4TWEA 3KASA 2JBKA 3D7GA 1WVMA 3K9TA 4C85A 1J3LA 3EZBA 3FF3A 3TLBA 3T0TA 4P4JA 5F9MA 4TJVA 1ZRSA 3I6SA 3NOJA 1C30B 4J0NA 4CDKA 2C6PA 1DIKA 4C9AA 4MCSA 1GGOA 2C6GA 2EK9A 2XEJA 3D7HA 1CE8B 3S9MA 4C9UA 1C3OB 3TLGB 3EZEA 3T5MA 3IIBA 1DE4C 4H1HA 4NGMA 1NXJA 4OC2A 3SJXA 3TLGA 2PVWA 1Q5XA 4OC5A 3GJZA 4JYWA 3S9NA 4C8FA 4P4FA 4P4IA 3T05A 4C8PA 2PVVA 4NGRA 4EYSA 3FEEA 3SJFA 1KEEB 2MP0A 4NGTA 2R82A 1VI4A 1EZAA 4IIXA 2DIKA 5K99A 3I74A 2EK8A 4C8CA 4LQGA 4P44A 4NGNA 2XEGA 1CS0B 4TJXA 2XEIA 4E94A 1JDBC 3IWWA 5F09A 4X3RA 2GP4A 4JVOA 5FD8A 3FECA 4C9RA 4MCPA 2EZBA 3FEDA 1V6CA 2YJTA 4P45A 2X0SA 2D0OA 3S9LA 3D7FA 3TLZA 4C9VA 4P4DA 1VBHA 4C8UA 5D29A 1KBLA 4IIYA 5IB9A 4INJA 3BXMA 4C8TA 2D0PA 4C99A 3BI0A 3D7DA 4C86A 1A9XB 1T36B 1KC7A 2OOTA 4W9YA 2OR4A 4MJXA 4NGSA 3KRVA 1ZL0A 1CX8A 3U1BA 4COGA 3G23A 2EZAA 1Z8LA 2HI6A 5F5XA 3EZAA 2AUMA 3TYXA 2YJVA 4P4EA 3TLEA 4COBA 4C8AA 4CO9A 4OC0A 4OC1A 3T07A 4NGQA 4C84A 1VBGA 1BXRB 2OLSA 2EZCA 1R61A 3TLAA 3C8OA 2AUNA 3ICUA 4OC3A 2HROA 3SJEA 2C5QA 1NBWA 2XEFA 1XF1A 4KNGE 1EZBA 4MI1A 3K4IA 3EIFA 1M6VB 3SJGA 2FM4A 2HWGA 4JZ0A 4NGPA 2E28A 3RBUA 4MCRA 4OC4A 2JBJA 3TLYA 1ZYMA 4CDJA 2CIJA 1JDEA 4M8DA 4MCQA 4E5SA 3TLCA 5F1YA 3SR3A 2B0AA 4C9EA 5ELYA 2PCNA 3BI1A 2C6CA 5IR2A 4P4BA 3VTAA 1Y9ZA 4CZ1A
chains in the Genus database with same CATH topology
1R61A 4COGA 4COBA 4CO9A 2B0AA 4J0NA 4M8DA 3KRVA 4CZ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R61 A;  4COG A;  4COB A;  4CO9 A;  2B0A A;  4J0N A;  4M8D A;  3KRV A;  4CZ1 A; 
#chains in the Genus database with same CATH topology
 5JVL A;  5JYB A;  4OME A;  4YN3 A;  3BHX A;  4TWE A;  3KAS A;  2JBK A;  3D7G A;  1WVM A;  3K9T A;  4C85 A;  1J3L A;  3EZB A;  3FF3 A;  3TLB A;  3T0T A;  4P4J A;  5F9M A;  4TJV A;  1ZRS A;  3I6S A;  3NOJ A;  1C30 B;  4J0N A;  4CDK A;  2C6P A;  1DIK A;  4C9A A;  4MCS A;  1GGO A;  2C6G A;  2EK9 A;  2XEJ A;  3D7H A;  1CE8 B;  3S9M A;  4C9U A;  1C3O B;  3TLG B;  3EZE A;  3T5M A;  3IIB A;  1DE4 C;  4H1H A;  4NGM A;  1NXJ A;  4OC2 A;  3SJX A;  3TLG A;  2PVW A;  1Q5X A;  4OC5 A;  3GJZ A;  4JYW A;  3S9N A;  4C8F A;  4P4F A;  4P4I A;  3T05 A;  4C8P A;  2PVV A;  4NGR A;  4EYS A;  3FEE A;  3SJF A;  1KEE B;  2MP0 A;  4NGT A;  2R82 A;  1VI4 A;  1EZA A;  4IIX A;  2DIK A;  5K99 A;  3I74 A;  2EK8 A;  4C8C A;  4LQG A;  4P44 A;  4NGN A;  2XEG A;  1CS0 B;  4TJX A;  2XEI A;  4E94 A;  1JDB C;  3IWW A;  5F09 A;  4X3R A;  2GP4 A;  4JVO A;  5FD8 A;  3FEC A;  4C9R A;  4MCP A;  2EZB A;  3FED A;  1V6C A;  2YJT A;  4P45 A;  2X0S A;  2D0O A;  3S9L A;  3D7F A;  3TLZ A;  4C9V A;  4P4D A;  1VBH A;  4C8U A;  5D29 A;  1KBL A;  4IIY A;  5IB9 A;  4INJ A;  3BXM A;  4C8T A;  2D0P A;  4C99 A;  3BI0 A;  3D7D A;  4C86 A;  1A9X B;  1T36 B;  1KC7 A;  2OOT A;  4W9Y A;  2OR4 A;  4MJX A;  4NGS A;  3KRV A;  1ZL0 A;  1CX8 A;  3U1B A;  4COG A;  3G23 A;  2EZA A;  1Z8L A;  2HI6 A;  5F5X A;  3EZA A;  2AUM A;  3TYX A;  2YJV A;  4P4E A;  3TLE A;  4COB A;  4C8A A;  4CO9 A;  4OC0 A;  4OC1 A;  3T07 A;  4NGQ A;  4C84 A;  1VBG A;  1BXR B;  2OLS A;  2EZC A;  1R61 A;  3TLA A;  3C8O A;  2AUN A;  3ICU A;  4OC3 A;  2HRO A;  3SJE A;  2C5Q A;  1NBW A;  2XEF A;  1XF1 A;  4KNG E;  1EZB A;  4MI1 A;  3K4I A;  3EIF A;  1M6V B;  3SJG A;  2FM4 A;  2HWG A;  4JZ0 A;  4NGP A;  2E28 A;  3RBU A;  4MCR A;  4OC4 A;  2JBJ A;  3TLY A;  1ZYM A;  4CDJ A;  2CIJ A;  1JDE A;  4M8D A;  4MCQ A;  4E5S A;  3TLC A;  5F1Y A;  3SR3 A;  2B0A A;  4C9E A;  5ELY A;  2PCN A;  3BI1 A;  2C6C A;  5IR2 A;  4P4B A;  3VTA A;  1Y9Z A;  4CZ1 A; 
#chains in the Genus database with same CATH homology
 1R61 A;  4COG A;  4COB A;  4CO9 A;  2B0A A;  4J0N A;  4M8D A;  3KRV A;  4CZ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...