2B0AA

Crystal structure of protein mj0783 from methanococcus jannaschii
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
186
structure length
186
Chain Sequence
EILDLTQTLINFPRPGDPELRIIEKKIDGFIVSEIIMGSHLCTHIDYPKHVGLENRIPFKDGIIKGKGYCISLDDFPGNKLPACDILLIYTGFSKYWGRDEYFEKIPEIPFLDDIIKSNIKCVGIDACTIGGFEEHKRLLSNNILIIENLNENLKNLVGKSFYFLGLPLKIFDIDASPIRCIAILE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein MJ0783
publication title Crystal Structure of Hypothetical Protein Mj0783 from Methanococcus Jannaschii
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Structural genomics, unknown function
total genus 47
structure length 186
sequence length 186
ec nomenclature
pdb deposition date 2005-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04199 Cyclase Putative cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.50 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Putative cyclase 2b0aA00
4CO9A 3KRVA 4COGA 4CZ1A 4COBA 4J0NA 4M8DA 1R61A 2B0AA
chains in the Genus database with same CATH superfamily
3SR3A 5F09A 4P45A 4IIXA 4C8FA 3T07A 3TLAA 2MP0A 4C85A 4P44A 3D7FA 3BXMA 3KASA 2XEGA 3SJXA 3T5MA 2HWGA 1V6CA 4MCQA 4P4BA 4J0NA 2C6PA 5F9MA 4EYSA 2C6GA 2D0OA 4C8AA 3FECA 2PCNA 5F1YA 4CO9A 3TLGB 2DIKA 3IIBA 2E28A 4C8CA 4TJXA 2YJTA 4CZ1A 4NGMA 1CE8B 3ICUA 3D7HA 4NGQA 3GJZA 1CX8A 4COGA 4KNGE 2EK9A 1VBGA 2XEJA 2EK8A 3BHXA 1KC7A 2CIJA 4P4FA 4OC0A 4MI1A 3I6SA 3C8OA 3IWWA 5D29A 4INJA 4W9YA 5IB9A 2XEIA 4JYWA 4C9VA 3FEDA 4C84A 2C5QA 4MCPA 3TLEA 4OC4A 5JVLA 2YJVA 2JBJA 2PVVA 2C6CA 4P4EA 3EZBA 1DIKA 4MCSA 4H1HA 2HI6A 2OR4A 2XEFA 4IIYA 5F5XA 1XF1A 3BI1A 3U1BA 2AUNA 5FD8A 3EIFA 5ELYA 3TLCA 4COBA 1C30B 3SJEA 1CS0B 1C3OB 4LQGA 3FF3A 1Q5XA 4OC2A 4YN3A 4CDKA 1VI4A 4NGSA 1GGOA 4C9RA 4MJXA 3BI0A 3TLYA 1VBHA 2D0PA 2R82A 4NGNA 4C9AA 4M8DA 1JDEA 1Y9ZA 4C8UA 1A9XB 1DE4C 3EZEA 4C9UA 2PVWA 3SJFA 1EZBA 1NBWA 3G23A 1KEEB 3S9LA 4NGTA 2B0AA 3S9MA 4OMEA 3TLZA 4E5SA 4NGRA 1NXJA 4P4IA 4TWEA 3TYXA 2X0SA 2OOTA 3TLGA 1R61A 1EZAA 5K99A 3K4IA 3D7DA 1Z8LA 5JYBA 4E94A 1ZRSA 3SJGA 4CDJA 2GP4A 2EZAA 1J3LA 4P4JA 3VTAA 4JVOA 3I74A 1ZL0A 4OC3A 4P4DA 4C86A 3D7GA 3TLBA 1ZYMA 2EZCA 2EZBA 3FEEA 4OC1A 4X3RA 1KBLA 2JBKA 4OC5A 2OLSA 3KRVA 3EZAA 1T36B 4NGPA 2AUMA 4JZ0A 4MCRA 4C8TA 4C9EA 2HROA 4TJVA 1WVMA 4C99A 3K9TA 3T0TA 3S9NA 2FM4A 3T05A 3RBUA 1M6VB 1BXRB 5IR2A 1JDBC 3NOJA 4C8PA
chains in the Genus database with same CATH topology
4CO9A 3KRVA 4COGA 4CZ1A 4COBA 4J0NA 4M8DA 1R61A 2B0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CO9 A;  3KRV A;  4COG A;  4CZ1 A;  4COB A;  4J0N A;  4M8D A;  1R61 A;  2B0A A; 
#chains in the Genus database with same CATH topology
 3SR3 A;  5F09 A;  4P45 A;  4IIX A;  4C8F A;  3T07 A;  3TLA A;  2MP0 A;  4C85 A;  4P44 A;  3D7F A;  3BXM A;  3KAS A;  2XEG A;  3SJX A;  3T5M A;  2HWG A;  1V6C A;  4MCQ A;  4P4B A;  4J0N A;  2C6P A;  5F9M A;  4EYS A;  2C6G A;  2D0O A;  4C8A A;  3FEC A;  2PCN A;  5F1Y A;  4CO9 A;  3TLG B;  2DIK A;  3IIB A;  2E28 A;  4C8C A;  4TJX A;  2YJT A;  4CZ1 A;  4NGM A;  1CE8 B;  3ICU A;  3D7H A;  4NGQ A;  3GJZ A;  1CX8 A;  4COG A;  4KNG E;  2EK9 A;  1VBG A;  2XEJ A;  2EK8 A;  3BHX A;  1KC7 A;  2CIJ A;  4P4F A;  4OC0 A;  4MI1 A;  3I6S A;  3C8O A;  3IWW A;  5D29 A;  4INJ A;  4W9Y A;  5IB9 A;  2XEI A;  4JYW A;  4C9V A;  3FED A;  4C84 A;  2C5Q A;  4MCP A;  3TLE A;  4OC4 A;  5JVL A;  2YJV A;  2JBJ A;  2PVV A;  2C6C A;  4P4E A;  3EZB A;  1DIK A;  4MCS A;  4H1H A;  2HI6 A;  2OR4 A;  2XEF A;  4IIY A;  5F5X A;  1XF1 A;  3BI1 A;  3U1B A;  2AUN A;  5FD8 A;  3EIF A;  5ELY A;  3TLC A;  4COB A;  1C30 B;  3SJE A;  1CS0 B;  1C3O B;  4LQG A;  3FF3 A;  1Q5X A;  4OC2 A;  4YN3 A;  4CDK A;  1VI4 A;  4NGS A;  1GGO A;  4C9R A;  4MJX A;  3BI0 A;  3TLY A;  1VBH A;  2D0P A;  2R82 A;  4NGN A;  4C9A A;  4M8D A;  1JDE A;  1Y9Z A;  4C8U A;  1A9X B;  1DE4 C;  3EZE A;  4C9U A;  2PVW A;  3SJF A;  1EZB A;  1NBW A;  3G23 A;  1KEE B;  3S9L A;  4NGT A;  2B0A A;  3S9M A;  4OME A;  3TLZ A;  4E5S A;  4NGR A;  1NXJ A;  4P4I A;  4TWE A;  3TYX A;  2X0S A;  2OOT A;  3TLG A;  1R61 A;  1EZA A;  5K99 A;  3K4I A;  3D7D A;  1Z8L A;  5JYB A;  4E94 A;  1ZRS A;  3SJG A;  4CDJ A;  2GP4 A;  2EZA A;  1J3L A;  4P4J A;  3VTA A;  4JVO A;  3I74 A;  1ZL0 A;  4OC3 A;  4P4D A;  4C86 A;  3D7G A;  3TLB A;  1ZYM A;  2EZC A;  2EZB A;  3FEE A;  4OC1 A;  4X3R A;  1KBL A;  2JBK A;  4OC5 A;  2OLS A;  3KRV A;  3EZA A;  1T36 B;  4NGP A;  2AUM A;  4JZ0 A;  4MCR A;  4C8T A;  4C9E A;  2HRO A;  4TJV A;  1WVM A;  4C99 A;  3K9T A;  3T0T A;  3S9N A;  2FM4 A;  3T05 A;  3RBU A;  1M6V B;  1BXR B;  5IR2 A;  1JDB C;  3NOJ A;  4C8P A; 
#chains in the Genus database with same CATH homology
 4CO9 A;  3KRV A;  4COG A;  4CZ1 A;  4COB A;  4J0N A;  4M8D A;  1R61 A;  2B0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...