4KNGE

Crystal structure of human lgr5-rspo1-rnf43
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
149
structure length
149
Chain Sequence
QKAIIRVIPLKMDPTGKLNLTLEGVFAGVAEITPAEGKLMQSHPLYLCNASDDDNLEPGFISIVKLESPRRAPRPCLSLASKARMAGERGASAVLFDITEDRAAAEQLQQPLGLTWPVVLIWGNDAEKLMEFVYKNQKAHVRIELKEPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leucine-rich repeat-containing G-protein coupled receptor 5
publication title The structural basis of R-spondin recognition by LGR5 and RNF43.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein, membrane protein
total genus 32
structure length 149
sequence length 149
chains with identical sequence F
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4kngE00
4X3RA 3SJGA 4OC1A 4NGSA 3I74A 4P4FA 4NGMA 3IIBA 4NGNA 3VTAA 4LQGA 3BXMA 3SJEA 4CDKA 2EK8A 4C99A 4P4EA 4C8PA 2OR4A 4C84A 3D7FA 3BI1A 4OC2A 5ELYA 2JBKA 4TWEA 4NGTA 4OC3A 3EIFA 4P4DA 4TJVA 2JBJA 3S9NA 4C8TA 4C8UA 1DE4C 4NGPA 4C8CA 4NGRA 5IB9A 4W9YA 4NGQA 4JYWA 4C8FA 2XEFA 4P4JA 3IWWA 3SJFA 4C9EA 1V6CA 2C6GA 2EK9A 4OC0A 2XEGA 4JZ0A 4P4IA 2PVWA 4YN3A 3D7HA 3FF3A 3D7DA 4KNGE 2XEJA 4TJXA 2C6PA 4C9UA 4C86A 4MCQA 4MCSA 3I6SA 3FECA 3ICUA 5D29A 3RBUA 4CDJA 2C6CA 4C9RA 2PVVA 3D7GA 3BI0A 4P4BA 3BHXA 2OOTA 4OMEA 1WVMA 3S9LA 1XF1A 1Z8LA 3FEEA 3S9MA 4OC5A 2CIJA 1CX8A 3KASA 4C9AA 4C9VA 4OC4A 2XEIA 4MCPA 1Y9ZA 4P44A 4C85A 3FEDA 4C8AA 4P45A 5F09A 4MCRA 3SJXA
chains in the Genus database with same CATH superfamily
3EZAA 3KRVA 5F5XA 1EZAA 4X3RA 2EZCA 1KBLA 3SJGA 4OC1A 1NXJA 4NGSA 3I74A 1CS0B 4NGMA 4P4FA 1CE8B 3IIBA 4NGNA 3VTAA 3EZBA 3BXMA 4LQGA 3SJEA 4CDKA 2EK8A 3TLBA 3TLZA 3T07A 3TLGA 1VBHA 5FD8A 3EZEA 2YJVA 4C99A 1VBGA 2E28A 2PCNA 4P4EA 4C8PA 3T0TA 2OR4A 2HWGA 3C8OA 4C84A 1VI4A 3T05A 3D7FA 2YJTA 3BI1A 4OC2A 5ELYA 3TLEA 1ZL0A 2HROA 2JBKA 5JVLA 4INJA 4TWEA 1EZBA 4NGTA 4OC3A 3EIFA 4P4DA 4TJVA 2JBJA 3S9NA 2OLSA 4C8TA 2HI6A 3TLYA 2D0OA 4C8UA 4JVOA 5JYBA 1DE4C 3NOJA 1A9XB 2D0PA 4H1HA 4NGPA 2B0AA 4C8CA 1DIKA 3G23A 4NGRA 5IB9A 1GGOA 4IIYA 4W9YA 4NGQA 4JYWA 1JDBC 4C8FA 2XEFA 4P4JA 3IWWA 1KC7A 1M6VB 4MJXA 3SJFA 4E94A 3GJZA 4C9EA 1T36B 2AUMA 1V6CA 2C6GA 2EZBA 2EK9A 4OC0A 2XEGA 5K99A 4JZ0A 5F9MA 4P4IA 1ZYMA 1C3OB 3TLCA 2DIKA 2X0SA 2PVWA 3TLGB 4M8DA 4YN3A 4J0NA 3D7HA 3FF3A 3D7DA 3U1BA 2AUNA 2MP0A 4IIXA 4KNGE 2XEJA 1C30B 4TJXA 2C6PA 4C9UA 4C86A 1Q5XA 4MCQA 3TLAA 3FECA 3I6SA 4MCSA 3ICUA 5D29A 3RBUA 4CDJA 4COGA 2C6CA 4C9RA 2PVVA 1BXRB 1R61A 3BI0A 3D7GA 2R82A 4P4BA 3BHXA 2OOTA 1NBWA 5F1YA 1J3LA 4OMEA 3SR3A 1WVMA 3S9LA 1XF1A 1Z8LA 2C5QA 3FEEA 4E5SA 3S9MA 4OC5A 1JDEA 2CIJA 1CX8A 3KASA 4CZ1A 3TYXA 4C9AA 4C9VA 4COBA 3K4IA 2EZAA 4OC4A 2XEIA 4MCPA 2GP4A 4MI1A 3T5MA 1Y9ZA 4P44A 3K9TA 4C85A 3FEDA 4C8AA 4CO9A 1ZRSA 2FM4A 4P45A 5F09A 1KEEB 5IR2A 4EYSA 4MCRA 3SJXA
chains in the Genus database with same CATH topology
4X3RA 3SJGA 4OC1A 4NGSA 3I74A 4P4FA 4NGMA 3IIBA 4NGNA 3VTAA 4LQGA 3BXMA 3SJEA 4CDKA 2EK8A 4C99A 4P4EA 4C8PA 2OR4A 4C84A 3D7FA 3BI1A 4OC2A 5ELYA 2JBKA 4TWEA 4NGTA 4OC3A 3EIFA 4P4DA 4TJVA 2JBJA 3S9NA 4C8TA 4C8UA 1DE4C 4NGPA 4C8CA 4NGRA 5IB9A 4W9YA 4NGQA 4JYWA 4C8FA 2XEFA 4P4JA 3IWWA 3SJFA 4C9EA 1V6CA 2C6GA 2EK9A 4OC0A 2XEGA 4JZ0A 4P4IA 2PVWA 4YN3A 3D7HA 3FF3A 3D7DA 4KNGE 2XEJA 4TJXA 2C6PA 4C9UA 4C86A 4MCQA 4MCSA 3I6SA 3FECA 3ICUA 5D29A 3RBUA 4CDJA 2C6CA 4C9RA 2PVVA 3D7GA 3BI0A 4P4BA 3BHXA 2OOTA 4OMEA 1WVMA 3S9LA 1XF1A 1Z8LA 2C5QA 3FEEA 3S9MA 4OC5A 2CIJA 1CX8A 3KASA 4C9AA 4C9VA 4OC4A 2XEIA 4MCPA 2GP4A 1Y9ZA 4P44A 3K9TA 4C85A 3FEDA 4C8AA 4P45A 5F09A 5IR2A 4MCRA 3SJXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X3R A;  3SJG A;  4OC1 A;  4NGS A;  3I74 A;  4P4F A;  4NGM A;  3IIB A;  4NGN A;  3VTA A;  4LQG A;  3BXM A;  3SJE A;  4CDK A;  2EK8 A;  4C99 A;  4P4E A;  4C8P A;  2OR4 A;  4C84 A;  3D7F A;  3BI1 A;  4OC2 A;  5ELY A;  2JBK A;  4TWE A;  4NGT A;  4OC3 A;  3EIF A;  4P4D A;  4TJV A;  2JBJ A;  3S9N A;  4C8T A;  4C8U A;  1DE4 C;  4NGP A;  4C8C A;  4NGR A;  5IB9 A;  4W9Y A;  4NGQ A;  4JYW A;  4C8F A;  2XEF A;  4P4J A;  3IWW A;  3SJF A;  4C9E A;  1V6C A;  2C6G A;  2EK9 A;  4OC0 A;  2XEG A;  4JZ0 A;  4P4I A;  2PVW A;  4YN3 A;  3D7H A;  3FF3 A;  3D7D A;  4KNG E;  2XEJ A;  4TJX A;  2C6P A;  4C9U A;  4C86 A;  4MCQ A;  4MCS A;  3I6S A;  3FEC A;  3ICU A;  5D29 A;  3RBU A;  4CDJ A;  2C6C A;  4C9R A;  2PVV A;  3D7G A;  3BI0 A;  4P4B A;  3BHX A;  2OOT A;  4OME A;  1WVM A;  3S9L A;  1XF1 A;  1Z8L A;  3FEE A;  3S9M A;  4OC5 A;  2CIJ A;  1CX8 A;  3KAS A;  4C9A A;  4C9V A;  4OC4 A;  2XEI A;  4MCP A;  1Y9Z A;  4P44 A;  4C85 A;  3FED A;  4C8A A;  4P45 A;  5F09 A;  4MCR A;  3SJX A; 
#chains in the Genus database with same CATH topology
 3EZA A;  3KRV A;  5F5X A;  1EZA A;  4X3R A;  2EZC A;  1KBL A;  3SJG A;  4OC1 A;  1NXJ A;  4NGS A;  3I74 A;  1CS0 B;  4NGM A;  4P4F A;  1CE8 B;  3IIB A;  4NGN A;  3VTA A;  3EZB A;  3BXM A;  4LQG A;  3SJE A;  4CDK A;  2EK8 A;  3TLB A;  3TLZ A;  3T07 A;  3TLG A;  1VBH A;  5FD8 A;  3EZE A;  2YJV A;  4C99 A;  1VBG A;  2E28 A;  2PCN A;  4P4E A;  4C8P A;  3T0T A;  2OR4 A;  2HWG A;  3C8O A;  4C84 A;  1VI4 A;  3T05 A;  3D7F A;  2YJT A;  3BI1 A;  4OC2 A;  5ELY A;  3TLE A;  1ZL0 A;  2HRO A;  2JBK A;  5JVL A;  4INJ A;  4TWE A;  1EZB A;  4NGT A;  4OC3 A;  3EIF A;  4P4D A;  4TJV A;  2JBJ A;  3S9N A;  2OLS A;  4C8T A;  2HI6 A;  3TLY A;  2D0O A;  4C8U A;  4JVO A;  5JYB A;  1DE4 C;  3NOJ A;  1A9X B;  2D0P A;  4H1H A;  4NGP A;  2B0A A;  4C8C A;  1DIK A;  3G23 A;  4NGR A;  5IB9 A;  1GGO A;  4IIY A;  4W9Y A;  4NGQ A;  4JYW A;  1JDB C;  4C8F A;  2XEF A;  4P4J A;  3IWW A;  1KC7 A;  1M6V B;  4MJX A;  3SJF A;  4E94 A;  3GJZ A;  4C9E A;  1T36 B;  2AUM A;  1V6C A;  2C6G A;  2EZB A;  2EK9 A;  4OC0 A;  2XEG A;  5K99 A;  4JZ0 A;  5F9M A;  4P4I A;  1ZYM A;  1C3O B;  3TLC A;  2DIK A;  2X0S A;  2PVW A;  3TLG B;  4M8D A;  4YN3 A;  4J0N A;  3D7H A;  3FF3 A;  3D7D A;  3U1B A;  2AUN A;  2MP0 A;  4IIX A;  4KNG E;  2XEJ A;  1C30 B;  4TJX A;  2C6P A;  4C9U A;  4C86 A;  1Q5X A;  4MCQ A;  3TLA A;  3FEC A;  3I6S A;  4MCS A;  3ICU A;  5D29 A;  3RBU A;  4CDJ A;  4COG A;  2C6C A;  4C9R A;  2PVV A;  1BXR B;  1R61 A;  3BI0 A;  3D7G A;  2R82 A;  4P4B A;  3BHX A;  2OOT A;  1NBW A;  5F1Y A;  1J3L A;  4OME A;  3SR3 A;  1WVM A;  3S9L A;  1XF1 A;  1Z8L A;  2C5Q A;  3FEE A;  4E5S A;  3S9M A;  4OC5 A;  1JDE A;  2CIJ A;  1CX8 A;  3KAS A;  4CZ1 A;  3TYX A;  4C9A A;  4C9V A;  4COB A;  3K4I A;  2EZA A;  4OC4 A;  2XEI A;  4MCP A;  2GP4 A;  4MI1 A;  3T5M A;  1Y9Z A;  4P44 A;  3K9T A;  4C85 A;  3FED A;  4C8A A;  4CO9 A;  1ZRS A;  2FM4 A;  4P45 A;  5F09 A;  1KEE B;  5IR2 A;  4EYS A;  4MCR A;  3SJX A; 
#chains in the Genus database with same CATH homology
 4X3R A;  3SJG A;  4OC1 A;  4NGS A;  3I74 A;  4P4F A;  4NGM A;  3IIB A;  4NGN A;  3VTA A;  4LQG A;  3BXM A;  3SJE A;  4CDK A;  2EK8 A;  4C99 A;  4P4E A;  4C8P A;  2OR4 A;  4C84 A;  3D7F A;  3BI1 A;  4OC2 A;  5ELY A;  2JBK A;  4TWE A;  4NGT A;  4OC3 A;  3EIF A;  4P4D A;  4TJV A;  2JBJ A;  3S9N A;  4C8T A;  4C8U A;  1DE4 C;  4NGP A;  4C8C A;  4NGR A;  5IB9 A;  4W9Y A;  4NGQ A;  4JYW A;  4C8F A;  2XEF A;  4P4J A;  3IWW A;  3SJF A;  4C9E A;  1V6C A;  2C6G A;  2EK9 A;  4OC0 A;  2XEG A;  4JZ0 A;  4P4I A;  2PVW A;  4YN3 A;  3D7H A;  3FF3 A;  3D7D A;  4KNG E;  2XEJ A;  4TJX A;  2C6P A;  4C9U A;  4C86 A;  4MCQ A;  4MCS A;  3I6S A;  3FEC A;  3ICU A;  5D29 A;  3RBU A;  4CDJ A;  2C6C A;  4C9R A;  2PVV A;  3D7G A;  3BI0 A;  4P4B A;  3BHX A;  2OOT A;  4OME A;  1WVM A;  3S9L A;  1XF1 A;  1Z8L A;  2C5Q A;  3FEE A;  3S9M A;  4OC5 A;  2CIJ A;  1CX8 A;  3KAS A;  4C9A A;  4C9V A;  4OC4 A;  2XEI A;  4MCP A;  2GP4 A;  1Y9Z A;  4P44 A;  3K9T A;  4C85 A;  3FED A;  4C8A A;  4P45 A;  5F09 A;  5IR2 A;  4MCR A;  3SJX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...