4KNGE

Crystal structure of human lgr5-rspo1-rnf43
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
149
structure length
149
Chain Sequence
b'QKAIIRVIPLKMDPTGKLNLTLEGVFAGVAEITPAEGKLMQSHPLYLCNASDDDNLEPGFISIVKLESPRRAPRPCLSLASKARMAGERGASAVLFDITEDRAAAEQLQQPLGLTWPVVLIWGNDAEKLMEFVYKNQKAHVRIELKEPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leucine-rich repeat-containing G-protein coupled receptor 5
publication title The structural basis of R-spondin recognition by LGR5 and RNF43.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein, membrane protein
total genus 32
structure length 149
sequence length 149
chains with identical sequence F
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4kngE00
4C9EA 1DE4C 4C9AA 1Z8LA 4NGNA 3IWWA 3D7GA 4P4BA 4P4IA 5D29A 4LQGA 2PVWA 2C6GA 4P4DA 2OOTA 1WVMA 2XEGA 3FF3A 1V6CA 4P45A 3SJEA 2JBJA 4OC5A 2CIJA 2OR4A 4OC4A 4OMEA 5F09A 4MCPA 3I6SA 2JBKA 4NGTA 4TJXA 4C8PA 4OC1A 2EK9A 4P4EA 3VTAA 4TWEA 2C6PA 4TJVA 3D7FA 3D7HA 4C9RA 4C8TA 4NGPA 5IB9A 4C84A 4C85A 3D7DA 4C9UA 4NGMA 4P44A 4KNGE 4C8AA 2EK8A 4C99A 4C8CA 3RBUA 4C8FA 2C6CA 4CDJA 3SJXA 2PVVA 3BI0A 4C9VA 2XEIA 3SJFA 3BHXA 4C86A 4NGRA 4P4FA 3BXMA 1CX8A 4JYWA 3SJGA 5ELYA 4OC3A 3FEDA 4C8UA 4OC0A 3KASA 3FECA 4MCRA 4NGSA 3EIFA 4OC2A 3S9MA 4CDKA 4W9YA 4MCQA 4NGQA 3ICUA 3I74A 4JZ0A 3S9NA 4X3RA 4P4JA 3BI1A 4YN3A 2XEJA 4MCSA 3FEEA 2XEFA 1Y9ZA 3S9LA 3IIBA 1XF1A
chains in the Genus database with same CATH superfamily
4C9EA 1DE4C 4C9AA 1Z8LA 4NGNA 3IWWA 3D7GA 4P4BA 2D0OA 4P4IA 5D29A 1J3LA 1A9XB 4H1HA 4LQGA 1Q5XA 2PVWA 2EZBA 2C6GA 4INJA 4P4DA 1KC7A 1JDBC 2OOTA 1WVMA 3K9TA 1EZAA 2B0AA 5F9MA 3TLBA 2XEGA 3FF3A 1V6CA 4P45A 4CO9A 3SJEA 2JBJA 2HWGA 4OC5A 2CIJA 2OR4A 4OC4A 4OMEA 3T05A 5F09A 4MCPA 1VBGA 2HI6A 3I6SA 2JBKA 1C30B 2X0SA 4J0NA 4NGTA 5FD8A 3TLGB 4TJXA 4C8PA 3KRVA 3EZBA 4OC1A 2EK9A 1CS0B 4P4EA 2PCNA 3TLYA 5JYBA 3VTAA 4TWEA 4COBA 2C6PA 2DIKA 4TJVA 3NOJA 3D7FA 1EZBA 1JDEA 3TLZA 2HROA 1ZL0A 1GGOA 3D7HA 4C9RA 4C8TA 4NGPA 5IB9A 2FM4A 3SR3A 5K99A 1NBWA 2GP4A 1R61A 2YJVA 4C84A 2E28A 4C85A 3D7DA 4C9UA 1KEEB 1M6VB 4NGMA 4P44A 4KNGE 1T36B 3EZEA 4C8AA 2EK8A 4C99A 4EYSA 4C8CA 3RBUA 3K4IA 2EZAA 4C8FA 2C6CA 4IIYA 4CDJA 1DIKA 1CE8B 3G23A 5F1YA 3SJXA 2AUNA 2PVVA 3BI0A 2XEIA 3TLGA 4C9VA 3TLAA 2OLSA 3SJFA 3BHXA 4C86A 4NGRA 4P4FA 4IIXA 4CZ1A 3U1BA 3T5MA 4E5SA 3BXMA 3TYXA 1CX8A 1KBLA 4JYWA 3SJGA 4COGA 5ELYA 3GJZA 4OC3A 3FEDA 4C8UA 1BXRB 4OC0A 3FECA 3KASA 4MCRA 2YJTA 4NGSA 3EIFA 4OC2A 3S9MA 3TLCA 3EZAA 4M8DA 3C8OA 4MI1A 1ZYMA 4W9YA 4CDKA 5JVLA 4MCQA 4JVOA 4NGQA 1C3OB 2EZCA 1NXJA 2D0PA 1VI4A 3ICUA 3I74A 2C5QA 3T0TA 2R82A 4MJXA 5F5XA 4JZ0A 3S9NA 4X3RA 3TLEA 1VBHA 4P4JA 3BI1A 5IR2A 3T07A 4YN3A 2XEJA 1ZRSA 4E94A 4MCSA 3FEEA 2XEFA 1Y9ZA 2AUMA 3S9LA 3IIBA 2MP0A 1XF1A
chains in the Genus database with same CATH topology
4C9EA 1DE4C 4C9AA 1Z8LA 4NGNA 3IWWA 3D7GA 4P4BA 4P4IA 5D29A 4LQGA 2PVWA 2C6GA 4P4DA 2OOTA 1WVMA 3K9TA 2XEGA 3FF3A 1V6CA 4P45A 3SJEA 2JBJA 4OC5A 2CIJA 2OR4A 4OC4A 4OMEA 5F09A 4MCPA 3I6SA 2JBKA 4NGTA 4TJXA 4C8PA 4OC1A 2EK9A 4P4EA 3VTAA 4TWEA 2C6PA 4TJVA 3D7FA 3D7HA 4C9RA 4C8TA 4NGPA 5IB9A 2GP4A 4C84A 4C85A 3D7DA 4C9UA 4NGMA 4P44A 4KNGE 4C8AA 2EK8A 4C99A 4C8CA 3RBUA 4C8FA 2C6CA 4CDJA 3SJXA 2PVVA 3BI0A 4C9VA 2XEIA 3SJFA 3BHXA 4C86A 4NGRA 4P4FA 3BXMA 1CX8A 4JYWA 3SJGA 5ELYA 4OC3A 3FEDA 4C8UA 4OC0A 3KASA 3FECA 4MCRA 4NGSA 3EIFA 4OC2A 3S9MA 4CDKA 4W9YA 4MCQA 4NGQA 3ICUA 3I74A 2C5QA 4JZ0A 3S9NA 4X3RA 4P4JA 3BI1A 5IR2A 4YN3A 2XEJA 4MCSA 3FEEA 2XEFA 1Y9ZA 3S9LA 3IIBA 1XF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C9E A;  1DE4 C;  4C9A A;  1Z8L A;  4NGN A;  3IWW A;  3D7G A;  4P4B A;  4P4I A;  5D29 A;  4LQG A;  2PVW A;  2C6G A;  4P4D A;  2OOT A;  1WVM A;  2XEG A;  3FF3 A;  1V6C A;  4P45 A;  3SJE A;  2JBJ A;  4OC5 A;  2CIJ A;  2OR4 A;  4OC4 A;  4OME A;  5F09 A;  4MCP A;  3I6S A;  2JBK A;  4NGT A;  4TJX A;  4C8P A;  4OC1 A;  2EK9 A;  4P4E A;  3VTA A;  4TWE A;  2C6P A;  4TJV A;  3D7F A;  3D7H A;  4C9R A;  4C8T A;  4NGP A;  5IB9 A;  4C84 A;  4C85 A;  3D7D A;  4C9U A;  4NGM A;  4P44 A;  4KNG E;  4C8A A;  2EK8 A;  4C99 A;  4C8C A;  3RBU A;  4C8F A;  2C6C A;  4CDJ A;  3SJX A;  2PVV A;  3BI0 A;  4C9V A;  2XEI A;  3SJF A;  3BHX A;  4C86 A;  4NGR A;  4P4F A;  3BXM A;  1CX8 A;  4JYW A;  3SJG A;  5ELY A;  4OC3 A;  3FED A;  4C8U A;  4OC0 A;  3KAS A;  3FEC A;  4MCR A;  4NGS A;  3EIF A;  4OC2 A;  3S9M A;  4CDK A;  4W9Y A;  4MCQ A;  4NGQ A;  3ICU A;  3I74 A;  4JZ0 A;  3S9N A;  4X3R A;  4P4J A;  3BI1 A;  4YN3 A;  2XEJ A;  4MCS A;  3FEE A;  2XEF A;  1Y9Z A;  3S9L A;  3IIB A;  1XF1 A; 
#chains in the Genus database with same CATH topology
 4C9E A;  1DE4 C;  4C9A A;  1Z8L A;  4NGN A;  3IWW A;  3D7G A;  4P4B A;  2D0O A;  4P4I A;  5D29 A;  1J3L A;  1A9X B;  4H1H A;  4LQG A;  1Q5X A;  2PVW A;  2EZB A;  2C6G A;  4INJ A;  4P4D A;  1KC7 A;  1JDB C;  2OOT A;  1WVM A;  3K9T A;  1EZA A;  2B0A A;  5F9M A;  3TLB A;  2XEG A;  3FF3 A;  1V6C A;  4P45 A;  4CO9 A;  3SJE A;  2JBJ A;  2HWG A;  4OC5 A;  2CIJ A;  2OR4 A;  4OC4 A;  4OME A;  3T05 A;  5F09 A;  4MCP A;  1VBG A;  2HI6 A;  3I6S A;  2JBK A;  1C30 B;  2X0S A;  4J0N A;  4NGT A;  5FD8 A;  3TLG B;  4TJX A;  4C8P A;  3KRV A;  3EZB A;  4OC1 A;  2EK9 A;  1CS0 B;  4P4E A;  2PCN A;  3TLY A;  5JYB A;  3VTA A;  4TWE A;  4COB A;  2C6P A;  2DIK A;  4TJV A;  3NOJ A;  3D7F A;  1EZB A;  1JDE A;  3TLZ A;  2HRO A;  1ZL0 A;  1GGO A;  3D7H A;  4C9R A;  4C8T A;  4NGP A;  5IB9 A;  2FM4 A;  3SR3 A;  5K99 A;  1NBW A;  2GP4 A;  1R61 A;  2YJV A;  4C84 A;  2E28 A;  4C85 A;  3D7D A;  4C9U A;  1KEE B;  1M6V B;  4NGM A;  4P44 A;  4KNG E;  1T36 B;  3EZE A;  4C8A A;  2EK8 A;  4C99 A;  4EYS A;  4C8C A;  3RBU A;  3K4I A;  2EZA A;  4C8F A;  2C6C A;  4IIY A;  4CDJ A;  1DIK A;  1CE8 B;  3G23 A;  5F1Y A;  3SJX A;  2AUN A;  2PVV A;  3BI0 A;  2XEI A;  3TLG A;  4C9V A;  3TLA A;  2OLS A;  3SJF A;  3BHX A;  4C86 A;  4NGR A;  4P4F A;  4IIX A;  4CZ1 A;  3U1B A;  3T5M A;  4E5S A;  3BXM A;  3TYX A;  1CX8 A;  1KBL A;  4JYW A;  3SJG A;  4COG A;  5ELY A;  3GJZ A;  4OC3 A;  3FED A;  4C8U A;  1BXR B;  4OC0 A;  3FEC A;  3KAS A;  4MCR A;  2YJT A;  4NGS A;  3EIF A;  4OC2 A;  3S9M A;  3TLC A;  3EZA A;  4M8D A;  3C8O A;  4MI1 A;  1ZYM A;  4W9Y A;  4CDK A;  5JVL A;  4MCQ A;  4JVO A;  4NGQ A;  1C3O B;  2EZC A;  1NXJ A;  2D0P A;  1VI4 A;  3ICU A;  3I74 A;  2C5Q A;  3T0T A;  2R82 A;  4MJX A;  5F5X A;  4JZ0 A;  3S9N A;  4X3R A;  3TLE A;  1VBH A;  4P4J A;  3BI1 A;  5IR2 A;  3T07 A;  4YN3 A;  2XEJ A;  1ZRS A;  4E94 A;  4MCS A;  3FEE A;  2XEF A;  1Y9Z A;  2AUM A;  3S9L A;  3IIB A;  2MP0 A;  1XF1 A; 
#chains in the Genus database with same CATH homology
 4C9E A;  1DE4 C;  4C9A A;  1Z8L A;  4NGN A;  3IWW A;  3D7G A;  4P4B A;  4P4I A;  5D29 A;  4LQG A;  2PVW A;  2C6G A;  4P4D A;  2OOT A;  1WVM A;  3K9T A;  2XEG A;  3FF3 A;  1V6C A;  4P45 A;  3SJE A;  2JBJ A;  4OC5 A;  2CIJ A;  2OR4 A;  4OC4 A;  4OME A;  5F09 A;  4MCP A;  3I6S A;  2JBK A;  4NGT A;  4TJX A;  4C8P A;  4OC1 A;  2EK9 A;  4P4E A;  3VTA A;  4TWE A;  2C6P A;  4TJV A;  3D7F A;  3D7H A;  4C9R A;  4C8T A;  4NGP A;  5IB9 A;  2GP4 A;  4C84 A;  4C85 A;  3D7D A;  4C9U A;  4NGM A;  4P44 A;  4KNG E;  4C8A A;  2EK8 A;  4C99 A;  4C8C A;  3RBU A;  4C8F A;  2C6C A;  4CDJ A;  3SJX A;  2PVV A;  3BI0 A;  4C9V A;  2XEI A;  3SJF A;  3BHX A;  4C86 A;  4NGR A;  4P4F A;  3BXM A;  1CX8 A;  4JYW A;  3SJG A;  5ELY A;  4OC3 A;  3FED A;  4C8U A;  4OC0 A;  3KAS A;  3FEC A;  4MCR A;  4NGS A;  3EIF A;  4OC2 A;  3S9M A;  4CDK A;  4W9Y A;  4MCQ A;  4NGQ A;  3ICU A;  3I74 A;  2C5Q A;  4JZ0 A;  3S9N A;  4X3R A;  4P4J A;  3BI1 A;  5IR2 A;  4YN3 A;  2XEJ A;  4MCS A;  3FEE A;  2XEF A;  1Y9Z A;  3S9L A;  3IIB A;  1XF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...