4KNGE

Crystal structure of human lgr5-rspo1-rnf43
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
149
structure length
149
Chain Sequence
QKAIIRVIPLKMDPTGKLNLTLEGVFAGVAEITPAEGKLMQSHPLYLCNASDDDNLEPGFISIVKLESPRRAPRPCLSLASKARMAGERGASAVLFDITEDRAAAEQLQQPLGLTWPVVLIWGNDAEKLMEFVYKNQKAHVRIELKEPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein, membrane protein
molecule keywords Leucine-rich repeat-containing G-protein coupled receptor 5
publication title The structural basis of R-spondin recognition by LGR5 and RNF43.
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 149
sequence length 149
chains with identical sequence F
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4kngE00
3EIFA 5ELYA 4P44A 3BHXA 4C8TA 3IWWA 4C84A 4C85A 3FEDA 3D7GA 1V6CA 2JBKA 4P4DA 3RBUA 2CIJA 4NGRA 3BXMA 4C9RA 3S9MA 2XEIA 4CDJA 3IIBA 2C6GA 1DE4C 4CDKA 4X3RA 4C9VA 4OMEA 4P4FA 4P45A 4LQGA 2EK8A 4MCPA 3BI1A 3S9LA 1WVMA 4P4IA 4KNGE 2XEJA 3D7HA 5IB9A 4OC1A 4C86A 3SJGA 1Z8LA 4TJVA 3S9NA 4MCRA 3KASA 4JYWA 3FECA 4NGNA 3I74A 2XEGA 2C6CA 4P4BA 5F09A 3ICUA 2OOTA 1Y9ZA 3D7FA 4OC3A 4C8UA 4TJXA 4TWEA 4NGMA 4YN3A 5D29A 2PVVA 1XF1A 2JBJA 2PVWA 4P4JA 4OC5A 3SJXA 4NGPA 4C9UA 3D7DA 3FF3A 4NGSA 4C8CA 3SJFA 4C9AA 4OC4A 4MCQA 3SJEA 3BI0A 4MCSA 2OR4A 4C8FA 3I6SA 4W9YA 3FEEA 3VTAA 2EK9A 4OC2A 4C9EA 2XEFA 4NGQA 4OC0A 2C6PA 4JZ0A 4NGTA 4P4EA 4C8AA 1CX8A 4C99A 4C8PA
chains in the Genus database with same CATH superfamily
2D0PA 3EIFA 5ELYA 3NOJA 5K99A 1GGOA 4P44A 3BHXA 4C8TA 3EZEA 3IWWA 4C84A 4C85A 3TLGA 3FEDA 3D7GA 1V6CA 2JBKA 4P4DA 3RBUA 1Q5XA 2HWGA 2CIJA 4NGRA 3BXMA 4C9RA 3T5MA 3S9MA 4IIXA 2XEIA 4CDJA 3KRVA 3IIBA 3TLAA 1R61A 2E28A 4CZ1A 2C6GA 1M6VB 1DE4C 3GJZA 2X0SA 4CDKA 4X3RA 4C9VA 3TLGB 4OMEA 4INJA 4P4FA 2YJTA 4P45A 4LQGA 5FD8A 2AUNA 2EK8A 4MCPA 3BI1A 3S9LA 1WVMA 4P4IA 4E5SA 1VBHA 4KNGE 5F5XA 2XEJA 3D7HA 2MP0A 5IB9A 4OC1A 4C86A 3SJGA 2FM4A 3TYXA 1Z8LA 4TJVA 3S9NA 1EZBA 4MCRA 3KASA 4JYWA 3T05A 3FECA 2OLSA 4NGNA 3I74A 2XEGA 2C6CA 4P4BA 5F09A 3ICUA 2B0AA 1KEEB 4EYSA 3EZAA 2EZAA 2YJVA 2OOTA 2GP4A 1Y9ZA 3SR3A 3D7FA 4OC3A 3K9TA 5IR2A 1DIKA 4C8UA 4JVOA 1KC7A 3TLZA 4E94A 1NXJA 1BXRB 4TJXA 4TWEA 3T07A 3TLYA 2EZCA 4NGMA 1KBLA 4YN3A 2DIKA 5D29A 4J0NA 4COBA 1NBWA 2C5QA 1A9XB 1ZYMA 2PVVA 4IIYA 3TLEA 1XF1A 2JBJA 2PVWA 4MJXA 4P4JA 4COGA 4H1HA 3U1BA 2AUMA 4OC5A 3SJXA 4NGPA 4C9UA 1ZRSA 2EZBA 4CO9A 3D7DA 3FF3A 1VI4A 1JDBC 4NGSA 3TLCA 4C8CA 3SJFA 1T36B 4C9AA 2D0OA 2R82A 4OC4A 3EZBA 1C30B 3C8OA 4MCQA 1ZL0A 3SJEA 3BI0A 3G23A 2OR4A 4MCSA 1J3LA 4C8FA 3I6SA 3T0TA 4MI1A 4W9YA 5F9MA 1CE8B 1C3OB 1CS0B 2EK9A 3FEEA 4OC2A 3VTAA 4C9EA 5JVLA 5JYBA 5F1YA 2HI6A 2XEFA 4NGQA 4M8DA 3K4IA 4OC0A 2C6PA 4JZ0A 4NGTA 4P4EA 4C8AA 1EZAA 1JDEA 3TLBA 1CX8A 2HROA 4C99A 1VBGA 4C8PA 2PCNA
chains in the Genus database with same CATH topology
3EIFA 5ELYA 4P44A 3BHXA 4C8TA 3IWWA 4C84A 4C85A 3FEDA 3D7GA 1V6CA 2JBKA 4P4DA 3RBUA 2CIJA 4NGRA 3BXMA 4C9RA 3S9MA 2XEIA 4CDJA 3IIBA 2C6GA 1DE4C 4CDKA 4X3RA 4C9VA 4OMEA 4P4FA 4P45A 4LQGA 2EK8A 4MCPA 3BI1A 3S9LA 1WVMA 4P4IA 4KNGE 2XEJA 3D7HA 5IB9A 4OC1A 4C86A 3SJGA 1Z8LA 4TJVA 3S9NA 4MCRA 3KASA 4JYWA 3FECA 4NGNA 3I74A 2XEGA 2C6CA 4P4BA 5F09A 3ICUA 2OOTA 2GP4A 1Y9ZA 3D7FA 4OC3A 3K9TA 5IR2A 4C8UA 4TJXA 4TWEA 4NGMA 4YN3A 5D29A 2C5QA 2PVVA 1XF1A 2JBJA 2PVWA 4P4JA 4OC5A 3SJXA 4NGPA 4C9UA 3D7DA 3FF3A 4NGSA 4C8CA 3SJFA 4C9AA 4OC4A 4MCQA 3SJEA 3BI0A 4MCSA 2OR4A 4C8FA 3I6SA 4W9YA 3FEEA 3VTAA 2EK9A 4OC2A 4C9EA 2XEFA 4NGQA 4OC0A 2C6PA 4JZ0A 4NGTA 4P4EA 4C8AA 1CX8A 4C99A 4C8PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EIF A;  5ELY A;  4P44 A;  3BHX A;  4C8T A;  3IWW A;  4C84 A;  4C85 A;  3FED A;  3D7G A;  1V6C A;  2JBK A;  4P4D A;  3RBU A;  2CIJ A;  4NGR A;  3BXM A;  4C9R A;  3S9M A;  2XEI A;  4CDJ A;  3IIB A;  2C6G A;  1DE4 C;  4CDK A;  4X3R A;  4C9V A;  4OME A;  4P4F A;  4P45 A;  4LQG A;  2EK8 A;  4MCP A;  3BI1 A;  3S9L A;  1WVM A;  4P4I A;  4KNG E;  2XEJ A;  3D7H A;  5IB9 A;  4OC1 A;  4C86 A;  3SJG A;  1Z8L A;  4TJV A;  3S9N A;  4MCR A;  3KAS A;  4JYW A;  3FEC A;  4NGN A;  3I74 A;  2XEG A;  2C6C A;  4P4B A;  5F09 A;  3ICU A;  2OOT A;  1Y9Z A;  3D7F A;  4OC3 A;  4C8U A;  4TJX A;  4TWE A;  4NGM A;  4YN3 A;  5D29 A;  2PVV A;  1XF1 A;  2JBJ A;  2PVW A;  4P4J A;  4OC5 A;  3SJX A;  4NGP A;  4C9U A;  3D7D A;  3FF3 A;  4NGS A;  4C8C A;  3SJF A;  4C9A A;  4OC4 A;  4MCQ A;  3SJE A;  3BI0 A;  4MCS A;  2OR4 A;  4C8F A;  3I6S A;  4W9Y A;  3FEE A;  3VTA A;  2EK9 A;  4OC2 A;  4C9E A;  2XEF A;  4NGQ A;  4OC0 A;  2C6P A;  4JZ0 A;  4NGT A;  4P4E A;  4C8A A;  1CX8 A;  4C99 A;  4C8P A; 
#chains in the Genus database with same CATH topology
 2D0P A;  3EIF A;  5ELY A;  3NOJ A;  5K99 A;  1GGO A;  4P44 A;  3BHX A;  4C8T A;  3EZE A;  3IWW A;  4C84 A;  4C85 A;  3TLG A;  3FED A;  3D7G A;  1V6C A;  2JBK A;  4P4D A;  3RBU A;  1Q5X A;  2HWG A;  2CIJ A;  4NGR A;  3BXM A;  4C9R A;  3T5M A;  3S9M A;  4IIX A;  2XEI A;  4CDJ A;  3KRV A;  3IIB A;  3TLA A;  1R61 A;  2E28 A;  4CZ1 A;  2C6G A;  1M6V B;  1DE4 C;  3GJZ A;  2X0S A;  4CDK A;  4X3R A;  4C9V A;  3TLG B;  4OME A;  4INJ A;  4P4F A;  2YJT A;  4P45 A;  4LQG A;  5FD8 A;  2AUN A;  2EK8 A;  4MCP A;  3BI1 A;  3S9L A;  1WVM A;  4P4I A;  4E5S A;  1VBH A;  4KNG E;  5F5X A;  2XEJ A;  3D7H A;  2MP0 A;  5IB9 A;  4OC1 A;  4C86 A;  3SJG A;  2FM4 A;  3TYX A;  1Z8L A;  4TJV A;  3S9N A;  1EZB A;  4MCR A;  3KAS A;  4JYW A;  3T05 A;  3FEC A;  2OLS A;  4NGN A;  3I74 A;  2XEG A;  2C6C A;  4P4B A;  5F09 A;  3ICU A;  2B0A A;  1KEE B;  4EYS A;  3EZA A;  2EZA A;  2YJV A;  2OOT A;  2GP4 A;  1Y9Z A;  3SR3 A;  3D7F A;  4OC3 A;  3K9T A;  5IR2 A;  1DIK A;  4C8U A;  4JVO A;  1KC7 A;  3TLZ A;  4E94 A;  1NXJ A;  1BXR B;  4TJX A;  4TWE A;  3T07 A;  3TLY A;  2EZC A;  4NGM A;  1KBL A;  4YN3 A;  2DIK A;  5D29 A;  4J0N A;  4COB A;  1NBW A;  2C5Q A;  1A9X B;  1ZYM A;  2PVV A;  4IIY A;  3TLE A;  1XF1 A;  2JBJ A;  2PVW A;  4MJX A;  4P4J A;  4COG A;  4H1H A;  3U1B A;  2AUM A;  4OC5 A;  3SJX A;  4NGP A;  4C9U A;  1ZRS A;  2EZB A;  4CO9 A;  3D7D A;  3FF3 A;  1VI4 A;  1JDB C;  4NGS A;  3TLC A;  4C8C A;  3SJF A;  1T36 B;  4C9A A;  2D0O A;  2R82 A;  4OC4 A;  3EZB A;  1C30 B;  3C8O A;  4MCQ A;  1ZL0 A;  3SJE A;  3BI0 A;  3G23 A;  2OR4 A;  4MCS A;  1J3L A;  4C8F A;  3I6S A;  3T0T A;  4MI1 A;  4W9Y A;  5F9M A;  1CE8 B;  1C3O B;  1CS0 B;  2EK9 A;  3FEE A;  4OC2 A;  3VTA A;  4C9E A;  5JVL A;  5JYB A;  5F1Y A;  2HI6 A;  2XEF A;  4NGQ A;  4M8D A;  3K4I A;  4OC0 A;  2C6P A;  4JZ0 A;  4NGT A;  4P4E A;  4C8A A;  1EZA A;  1JDE A;  3TLB A;  1CX8 A;  2HRO A;  4C99 A;  1VBG A;  4C8P A;  2PCN A; 
#chains in the Genus database with same CATH homology
 3EIF A;  5ELY A;  4P44 A;  3BHX A;  4C8T A;  3IWW A;  4C84 A;  4C85 A;  3FED A;  3D7G A;  1V6C A;  2JBK A;  4P4D A;  3RBU A;  2CIJ A;  4NGR A;  3BXM A;  4C9R A;  3S9M A;  2XEI A;  4CDJ A;  3IIB A;  2C6G A;  1DE4 C;  4CDK A;  4X3R A;  4C9V A;  4OME A;  4P4F A;  4P45 A;  4LQG A;  2EK8 A;  4MCP A;  3BI1 A;  3S9L A;  1WVM A;  4P4I A;  4KNG E;  2XEJ A;  3D7H A;  5IB9 A;  4OC1 A;  4C86 A;  3SJG A;  1Z8L A;  4TJV A;  3S9N A;  4MCR A;  3KAS A;  4JYW A;  3FEC A;  4NGN A;  3I74 A;  2XEG A;  2C6C A;  4P4B A;  5F09 A;  3ICU A;  2OOT A;  2GP4 A;  1Y9Z A;  3D7F A;  4OC3 A;  3K9T A;  5IR2 A;  4C8U A;  4TJX A;  4TWE A;  4NGM A;  4YN3 A;  5D29 A;  2C5Q A;  2PVV A;  1XF1 A;  2JBJ A;  2PVW A;  4P4J A;  4OC5 A;  3SJX A;  4NGP A;  4C9U A;  3D7D A;  3FF3 A;  4NGS A;  4C8C A;  3SJF A;  4C9A A;  4OC4 A;  4MCQ A;  3SJE A;  3BI0 A;  4MCS A;  2OR4 A;  4C8F A;  3I6S A;  4W9Y A;  3FEE A;  3VTA A;  2EK9 A;  4OC2 A;  4C9E A;  2XEF A;  4NGQ A;  4OC0 A;  2C6P A;  4JZ0 A;  4NGT A;  4P4E A;  4C8A A;  1CX8 A;  4C99 A;  4C8P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...