4KNGE

Crystal structure of human lgr5-rspo1-rnf43
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
149
structure length
149
Chain Sequence
QKAIIRVIPLKMDPTGKLNLTLEGVFAGVAEITPAEGKLMQSHPLYLCNASDDDNLEPGFISIVKLESPRRAPRPCLSLASKARMAGERGASAVLFDITEDRAAAEQLQQPLGLTWPVVLIWGNDAEKLMEFVYKNQKAHVRIELKEPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis of R-spondin recognition by LGR5 and RNF43.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein, membrane protein
molecule keywords Leucine-rich repeat-containing G-protein coupled receptor 5
total genus 32
structure length 149
sequence length 149
chains with identical sequence F
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4kngE00
3D7DA 4OC3A 2PVVA 4P4IA 3EIFA 3FEDA 2OOTA 4C9VA 4C9RA 3FECA 4MCRA 1DE4C 4OC1A 4CDJA 3S9MA 4OC2A 4LQGA 5F09A 4NGTA 2PVWA 3FEEA 3KASA 3D7GA 3IWWA 3BI1A 2XEIA 4C86A 1WVMA 4P44A 4P4FA 3BHXA 4X3RA 4TJXA 3BXMA 2EK9A 3I6SA 3D7FA 4NGNA 1Z8LA 2C6PA 3BI0A 4P4DA 3VTAA 5D29A 4JYWA 4C8FA 4C9AA 3I74A 3ICUA 2C6CA 4P4BA 3SJEA 2JBJA 3S9LA 5IB9A 4YN3A 4KNGE 4OMEA 2XEJA 4TJVA 4C99A 2OR4A 3SJFA 4MCSA 2XEGA 1CX8A 3D7HA 4NGQA 4TWEA 4W9YA 4C85A 4NGRA 4C84A 4OC4A 4NGSA 1XF1A 4JZ0A 4OC0A 3RBUA 4C9EA 4NGMA 4NGPA 1V6CA 3S9NA 4OC5A 1Y9ZA 4C8CA 3IIBA 2C6GA 4MCQA 4P45A 4C8UA 4P4EA 4C8PA 4P4JA 4MCPA 2XEFA 2CIJA 3SJGA 4C8TA 2EK8A 5ELYA 2JBKA 3FF3A 4C9UA 3SJXA 4C8AA 4CDKA
chains in the Genus database with same CATH superfamily
1A9XB 3D7DA 4OC3A 1GGOA 2PVVA 3U1BA 3KRVA 4P4IA 1NBWA 1NXJA 3EIFA 4IIXA 3FEDA 2OOTA 5FD8A 2YJTA 2YJVA 4C9VA 4C9RA 3FECA 2HWGA 2MP0A 1DE4C 4MCRA 4OC1A 2AUNA 4CDJA 1EZBA 3S9MA 3TLBA 1KEEB 4OC2A 4LQGA 5F09A 4NGTA 3T07A 4EYSA 2PVWA 2HROA 3FEEA 3KASA 3D7GA 3SJXA 3IWWA 2AUMA 3BI1A 2GP4A 1JDBC 2XEIA 3GJZA 2OLSA 1JDEA 4C86A 5JYBA 1ZYMA 1WVMA 4P44A 4P4FA 3BHXA 2X0SA 3TLEA 4X3RA 4TJXA 1M6VB 3TLGB 2EZCA 2DIKA 3BXMA 2EK9A 4E94A 1Q5XA 4INJA 2PCNA 3I6SA 4NGNA 3NOJA 1Z8LA 1VBGA 2C6PA 1ZL0A 3BI0A 3SR3A 4P4DA 2R82A 5D29A 3VTAA 5K99A 4JYWA 4C8FA 3T0TA 4C9AA 3I74A 3ICUA 2C6CA 4P4BA 2B0AA 3SJEA 4CZ1A 1KC7A 2D0PA 2JBJA 3S9LA 3T05A 5IB9A 4YN3A 1DIKA 3K9TA 3EZEA 3T5MA 4KNGE 1VBHA 4OMEA 2XEJA 3TLZA 4TJVA 4C99A 1KBLA 2OR4A 3SJFA 5JVLA 4MCSA 4IIYA 5F1YA 1J3LA 1C3OB 2XEGA 1CX8A 3D7HA 1R61A 1ZRSA 3K4IA 3TLCA 2HI6A 4NGQA 4MJXA 2EZBA 4TWEA 4W9YA 4C85A 2E28A 3TLYA 1CS0B 4NGRA 4C84A 4OC4A 1T36B 1XF1A 4NGSA 4JZ0A 4OC0A 3RBUA 3C8OA 2D0OA 4COGA 4J0NA 3EZBA 4C9EA 4NGMA 4NGPA 3TLGA 5F9MA 4H1HA 1V6CA 3S9NA 3TYXA 4OC5A 1Y9ZA 4CO9A 5F5XA 1VI4A 3EZAA 3IIBA 4C8CA 2C6GA 4MCQA 4P45A 4JVOA 4P4EA 4C8UA 4P4JA 4C8PA 4E5SA 4MCPA 2XEFA 3TLAA 4M8DA 1CE8B 4COBA 2CIJA 3SJGA 2FM4A 4C8TA 1BXRB 3G23A 2EK8A 5ELYA 4MI1A 2C5QA 2JBKA 1C30B 2EZAA 3FF3A 5IR2A 1EZAA 4C9UA 3D7FA 4C8AA 4CDKA
chains in the Genus database with same CATH topology
3D7DA 4OC3A 2PVVA 4P4IA 3EIFA 3FEDA 2OOTA 4C9VA 4C9RA 3FECA 4MCRA 1DE4C 4OC1A 4CDJA 3S9MA 4OC2A 4LQGA 5F09A 4NGTA 2PVWA 3FEEA 3KASA 3D7GA 3SJXA 3IWWA 3BI1A 2GP4A 2XEIA 4C86A 1WVMA 4P44A 4P4FA 3BHXA 4X3RA 4TJXA 3BXMA 2EK9A 3I6SA 4NGNA 1Z8LA 2C6PA 3BI0A 4P4DA 3VTAA 5D29A 4JYWA 4C8FA 4C9AA 3I74A 3ICUA 2C6CA 4P4BA 3SJEA 2JBJA 3S9LA 5IB9A 4YN3A 3K9TA 4KNGE 4OMEA 2XEJA 4TJVA 4C99A 2OR4A 3SJFA 4MCSA 2XEGA 1CX8A 3D7HA 4NGQA 4TWEA 4W9YA 4C85A 4NGRA 4C84A 4OC4A 4NGSA 1XF1A 4JZ0A 3RBUA 4OC0A 4C9EA 4NGMA 4NGPA 1V6CA 3S9NA 4OC5A 1Y9ZA 4C8CA 3IIBA 2C6GA 4MCQA 4P45A 4C8UA 4P4EA 4C8PA 4P4JA 4MCPA 2XEFA 2CIJA 3SJGA 4C8TA 2EK8A 5ELYA 2C5QA 2JBKA 3FF3A 5IR2A 4C9UA 3D7FA 4C8AA 4CDKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D7D A;  4OC3 A;  2PVV A;  4P4I A;  3EIF A;  3FED A;  2OOT A;  4C9V A;  4C9R A;  3FEC A;  4MCR A;  1DE4 C;  4OC1 A;  4CDJ A;  3S9M A;  4OC2 A;  4LQG A;  5F09 A;  4NGT A;  2PVW A;  3FEE A;  3KAS A;  3D7G A;  3IWW A;  3BI1 A;  2XEI A;  4C86 A;  1WVM A;  4P44 A;  4P4F A;  3BHX A;  4X3R A;  4TJX A;  3BXM A;  2EK9 A;  3I6S A;  3D7F A;  4NGN A;  1Z8L A;  2C6P A;  3BI0 A;  4P4D A;  3VTA A;  5D29 A;  4JYW A;  4C8F A;  4C9A A;  3I74 A;  3ICU A;  2C6C A;  4P4B A;  3SJE A;  2JBJ A;  3S9L A;  5IB9 A;  4YN3 A;  4KNG E;  4OME A;  2XEJ A;  4TJV A;  4C99 A;  2OR4 A;  3SJF A;  4MCS A;  2XEG A;  1CX8 A;  3D7H A;  4NGQ A;  4TWE A;  4W9Y A;  4C85 A;  4NGR A;  4C84 A;  4OC4 A;  4NGS A;  1XF1 A;  4JZ0 A;  4OC0 A;  3RBU A;  4C9E A;  4NGM A;  4NGP A;  1V6C A;  3S9N A;  4OC5 A;  1Y9Z A;  4C8C A;  3IIB A;  2C6G A;  4MCQ A;  4P45 A;  4C8U A;  4P4E A;  4C8P A;  4P4J A;  4MCP A;  2XEF A;  2CIJ A;  3SJG A;  4C8T A;  2EK8 A;  5ELY A;  2JBK A;  3FF3 A;  4C9U A;  3SJX A;  4C8A A;  4CDK A; 
#chains in the Genus database with same CATH topology
 1A9X B;  3D7D A;  4OC3 A;  1GGO A;  2PVV A;  3U1B A;  3KRV A;  4P4I A;  1NBW A;  1NXJ A;  3EIF A;  4IIX A;  3FED A;  2OOT A;  5FD8 A;  2YJT A;  2YJV A;  4C9V A;  4C9R A;  3FEC A;  2HWG A;  2MP0 A;  1DE4 C;  4MCR A;  4OC1 A;  2AUN A;  4CDJ A;  1EZB A;  3S9M A;  3TLB A;  1KEE B;  4OC2 A;  4LQG A;  5F09 A;  4NGT A;  3T07 A;  4EYS A;  2PVW A;  2HRO A;  3FEE A;  3KAS A;  3D7G A;  3SJX A;  3IWW A;  2AUM A;  3BI1 A;  2GP4 A;  1JDB C;  2XEI A;  3GJZ A;  2OLS A;  1JDE A;  4C86 A;  5JYB A;  1ZYM A;  1WVM A;  4P44 A;  4P4F A;  3BHX A;  2X0S A;  3TLE A;  4X3R A;  4TJX A;  1M6V B;  3TLG B;  2EZC A;  2DIK A;  3BXM A;  2EK9 A;  4E94 A;  1Q5X A;  4INJ A;  2PCN A;  3I6S A;  4NGN A;  3NOJ A;  1Z8L A;  1VBG A;  2C6P A;  1ZL0 A;  3BI0 A;  3SR3 A;  4P4D A;  2R82 A;  5D29 A;  3VTA A;  5K99 A;  4JYW A;  4C8F A;  3T0T A;  4C9A A;  3I74 A;  3ICU A;  2C6C A;  4P4B A;  2B0A A;  3SJE A;  4CZ1 A;  1KC7 A;  2D0P A;  2JBJ A;  3S9L A;  3T05 A;  5IB9 A;  4YN3 A;  1DIK A;  3K9T A;  3EZE A;  3T5M A;  4KNG E;  1VBH A;  4OME A;  2XEJ A;  3TLZ A;  4TJV A;  4C99 A;  1KBL A;  2OR4 A;  3SJF A;  5JVL A;  4MCS A;  4IIY A;  5F1Y A;  1J3L A;  1C3O B;  2XEG A;  1CX8 A;  3D7H A;  1R61 A;  1ZRS A;  3K4I A;  3TLC A;  2HI6 A;  4NGQ A;  4MJX A;  2EZB A;  4TWE A;  4W9Y A;  4C85 A;  2E28 A;  3TLY A;  1CS0 B;  4NGR A;  4C84 A;  4OC4 A;  1T36 B;  1XF1 A;  4NGS A;  4JZ0 A;  4OC0 A;  3RBU A;  3C8O A;  2D0O A;  4COG A;  4J0N A;  3EZB A;  4C9E A;  4NGM A;  4NGP A;  3TLG A;  5F9M A;  4H1H A;  1V6C A;  3S9N A;  3TYX A;  4OC5 A;  1Y9Z A;  4CO9 A;  5F5X A;  1VI4 A;  3EZA A;  3IIB A;  4C8C A;  2C6G A;  4MCQ A;  4P45 A;  4JVO A;  4P4E A;  4C8U A;  4P4J A;  4C8P A;  4E5S A;  4MCP A;  2XEF A;  3TLA A;  4M8D A;  1CE8 B;  4COB A;  2CIJ A;  3SJG A;  2FM4 A;  4C8T A;  1BXR B;  3G23 A;  2EK8 A;  5ELY A;  4MI1 A;  2C5Q A;  2JBK A;  1C30 B;  2EZA A;  3FF3 A;  5IR2 A;  1EZA A;  4C9U A;  3D7F A;  4C8A A;  4CDK A; 
#chains in the Genus database with same CATH homology
 3D7D A;  4OC3 A;  2PVV A;  4P4I A;  3EIF A;  3FED A;  2OOT A;  4C9V A;  4C9R A;  3FEC A;  4MCR A;  1DE4 C;  4OC1 A;  4CDJ A;  3S9M A;  4OC2 A;  4LQG A;  5F09 A;  4NGT A;  2PVW A;  3FEE A;  3KAS A;  3D7G A;  3SJX A;  3IWW A;  3BI1 A;  2GP4 A;  2XEI A;  4C86 A;  1WVM A;  4P44 A;  4P4F A;  3BHX A;  4X3R A;  4TJX A;  3BXM A;  2EK9 A;  3I6S A;  4NGN A;  1Z8L A;  2C6P A;  3BI0 A;  4P4D A;  3VTA A;  5D29 A;  4JYW A;  4C8F A;  4C9A A;  3I74 A;  3ICU A;  2C6C A;  4P4B A;  3SJE A;  2JBJ A;  3S9L A;  5IB9 A;  4YN3 A;  3K9T A;  4KNG E;  4OME A;  2XEJ A;  4TJV A;  4C99 A;  2OR4 A;  3SJF A;  4MCS A;  2XEG A;  1CX8 A;  3D7H A;  4NGQ A;  4TWE A;  4W9Y A;  4C85 A;  4NGR A;  4C84 A;  4OC4 A;  4NGS A;  1XF1 A;  4JZ0 A;  3RBU A;  4OC0 A;  4C9E A;  4NGM A;  4NGP A;  1V6C A;  3S9N A;  4OC5 A;  1Y9Z A;  4C8C A;  3IIB A;  2C6G A;  4MCQ A;  4P45 A;  4C8U A;  4P4E A;  4C8P A;  4P4J A;  4MCP A;  2XEF A;  2CIJ A;  3SJG A;  4C8T A;  2EK8 A;  5ELY A;  2C5Q A;  2JBK A;  3FF3 A;  5IR2 A;  4C9U A;  3D7F A;  4C8A A;  4CDK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...