4KNGE

Crystal structure of human lgr5-rspo1-rnf43
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
149
structure length
149
Chain Sequence
QKAIIRVIPLKMDPTGKLNLTLEGVFAGVAEITPAEGKLMQSHPLYLCNASDDDNLEPGFISIVKLESPRRAPRPCLSLASKARMAGERGASAVLFDITEDRAAAEQLQQPLGLTWPVVLIWGNDAEKLMEFVYKNQKAHVRIELKEPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis of R-spondin recognition by LGR5 and RNF43.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein, membrane protein
molecule keywords Leucine-rich repeat-containing G-protein coupled receptor 5
total genus 32
structure length 149
sequence length 149
chains with identical sequence F
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4kngE00
1Z8LA 4P4BA 4NGRA 3EIFA 2XEFA 3D7DA 3ICUA 4NGMA 4JZ0A 1XF1A 3SJXA 5D29A 3VTAA 4C84A 4C8PA 3D7GA 3I6SA 3BI1A 4OC3A 2JBJA 2PVVA 4C8FA 4C9AA 2C6CA 3S9MA 4YN3A 4LQGA 4C8TA 3S9LA 2CIJA 3S9NA 4MCRA 4C9UA 4OC2A 2XEJA 4NGPA 2XEIA 4C9EA 4NGTA 4OC1A 4CDJA 4P44A 4P4DA 2OOTA 3IWWA 3BHXA 4C8CA 4C86A 2EK8A 1Y9ZA 3BI0A 4OMEA 3I74A 3KASA 2EK9A 4C9VA 3BXMA 5F09A 4OC4A 2C6PA 3RBUA 3IIBA 4JYWA 4TJVA 4P4JA 4W9YA 5ELYA 4NGSA 4X3RA 4KNGE 4TWEA 4OC0A 2PVWA 2C6GA 3FF3A 4OC5A 3FECA 3SJFA 4MCSA 4P4FA 4P4EA 4C8AA 4TJXA 3D7HA 4P45A 3SJEA 2JBKA 4MCQA 3FEDA 4P4IA 4C9RA 4MCPA 4NGNA 3FEEA 3D7FA 4C85A 3SJGA 2XEGA 1WVMA 2OR4A 1V6CA 4CDKA 1CX8A 4C8UA 4C99A 1DE4C 5IB9A 4NGQA
chains in the Genus database with same CATH superfamily
2FM4A 1Z8LA 4P4BA 4NGRA 5F9MA 3TLBA 3EIFA 3T5MA 2XEFA 3D7DA 3ICUA 4COGA 4NGMA 4COBA 3K9TA 5JYBA 4JZ0A 3U1BA 1XF1A 3SJXA 5D29A 3VTAA 2D0PA 1KBLA 4C84A 2AUMA 3TLGA 4C8PA 2X0SA 1CS0B 2DIKA 2R82A 3D7GA 3NOJA 5F1YA 3I6SA 3GJZA 3BI1A 4OC3A 2JBJA 1VBGA 2PVVA 2HROA 1R61A 4C8FA 1KEEB 4E94A 4C9AA 2C6CA 3S9MA 3TLZA 5IR2A 1JDEA 4YN3A 4LQGA 4C8TA 2B0AA 2MP0A 2YJTA 2HWGA 2PCNA 4CZ1A 1NXJA 1GGOA 3TLAA 3S9LA 2CIJA 1VI4A 3S9NA 4MCRA 4C9UA 5JVLA 1ZYMA 4OC2A 2XEJA 1A9XB 4NGPA 2XEIA 4C9EA 4NGTA 4OC1A 3SR3A 1C30B 4CDJA 3EZEA 4P44A 4IIXA 4P4DA 2OOTA 3IWWA 3BHXA 4CO9A 4C8CA 3TLEA 2EK8A 4INJA 1Y9ZA 3BI0A 4C86A 1KC7A 4OMEA 2D0OA 1J3LA 3G23A 3I74A 3KASA 2EK9A 4C9VA 2EZBA 3TLGB 3TYXA 2OLSA 2HI6A 4MI1A 1VBHA 3BXMA 3T07A 5F09A 4OC4A 2C6PA 3TLCA 1T36B 2AUNA 3RBUA 3IIBA 4JYWA 4TJVA 5K99A 4P4JA 2YJVA 1JDBC 4W9YA 5ELYA 4NGSA 3T0TA 3C8OA 4X3RA 4KNGE 5F5XA 4TWEA 4M8DA 3KRVA 4OC0A 4H1HA 4E5SA 1BXRB 2C6GA 2PVWA 1NBWA 3FF3A 4OC5A 3FECA 1ZRSA 2EZAA 3SJFA 2GP4A 1C3OB 4MCSA 5FD8A 1M6VB 4IIYA 4P4FA 4P4EA 4C8AA 4TJXA 3D7HA 4P45A 2E28A 3SJEA 2JBKA 4MCQA 3TLYA 3FEDA 4P4IA 4C9RA 1EZBA 1CE8B 4JVOA 4MCPA 4EYSA 4NGNA 3FEEA 1ZL0A 1EZAA 3D7FA 4C85A 3SJGA 2XEGA 1Q5XA 3EZBA 1WVMA 2EZCA 2OR4A 5IB9A 1V6CA 4CDKA 1CX8A 1DIKA 2C5QA 4C8UA 3T05A 4C99A 1DE4C 4MJXA 3EZAA 3K4IA 4NGQA 4J0NA
chains in the Genus database with same CATH topology
1Z8LA 4P4BA 4NGRA 3EIFA 2XEFA 3D7DA 3ICUA 4NGMA 3K9TA 4JZ0A 1XF1A 3SJXA 5D29A 3VTAA 4C84A 4C8PA 3D7GA 3I6SA 3BI1A 4OC3A 2JBJA 2PVVA 4C8FA 4C9AA 2C6CA 3S9MA 5IR2A 4YN3A 4LQGA 4C8TA 3S9LA 2CIJA 3S9NA 4MCRA 4C9UA 4OC2A 2XEJA 4NGPA 2XEIA 4C9EA 4NGTA 4OC1A 4CDJA 4P44A 4P4DA 2OOTA 3IWWA 3BHXA 4C8CA 4C86A 2EK8A 1Y9ZA 3BI0A 4OMEA 3I74A 3KASA 2EK9A 4C9VA 3BXMA 5F09A 4OC4A 2C6PA 3RBUA 3IIBA 4JYWA 4TJVA 4P4JA 4W9YA 5ELYA 4NGSA 4X3RA 4KNGE 4TWEA 4OC0A 2PVWA 2C6GA 3FF3A 4OC5A 3FECA 3SJFA 2GP4A 4MCSA 4P4FA 4P4EA 4C8AA 4TJXA 3D7HA 4P45A 3SJEA 2JBKA 4MCQA 3FEDA 4P4IA 4C9RA 4MCPA 4NGNA 3FEEA 3D7FA 4C85A 3SJGA 2XEGA 1WVMA 2OR4A 1V6CA 4CDKA 1CX8A 2C5QA 4C8UA 4C99A 1DE4C 5IB9A 4NGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z8L A;  4P4B A;  4NGR A;  3EIF A;  2XEF A;  3D7D A;  3ICU A;  4NGM A;  4JZ0 A;  1XF1 A;  3SJX A;  5D29 A;  3VTA A;  4C84 A;  4C8P A;  3D7G A;  3I6S A;  3BI1 A;  4OC3 A;  2JBJ A;  2PVV A;  4C8F A;  4C9A A;  2C6C A;  3S9M A;  4YN3 A;  4LQG A;  4C8T A;  3S9L A;  2CIJ A;  3S9N A;  4MCR A;  4C9U A;  4OC2 A;  2XEJ A;  4NGP A;  2XEI A;  4C9E A;  4NGT A;  4OC1 A;  4CDJ A;  4P44 A;  4P4D A;  2OOT A;  3IWW A;  3BHX A;  4C8C A;  4C86 A;  2EK8 A;  1Y9Z A;  3BI0 A;  4OME A;  3I74 A;  3KAS A;  2EK9 A;  4C9V A;  3BXM A;  5F09 A;  4OC4 A;  2C6P A;  3RBU A;  3IIB A;  4JYW A;  4TJV A;  4P4J A;  4W9Y A;  5ELY A;  4NGS A;  4X3R A;  4KNG E;  4TWE A;  4OC0 A;  2PVW A;  2C6G A;  3FF3 A;  4OC5 A;  3FEC A;  3SJF A;  4MCS A;  4P4F A;  4P4E A;  4C8A A;  4TJX A;  3D7H A;  4P45 A;  3SJE A;  2JBK A;  4MCQ A;  3FED A;  4P4I A;  4C9R A;  4MCP A;  4NGN A;  3FEE A;  3D7F A;  4C85 A;  3SJG A;  2XEG A;  1WVM A;  2OR4 A;  1V6C A;  4CDK A;  1CX8 A;  4C8U A;  4C99 A;  1DE4 C;  5IB9 A;  4NGQ A; 
#chains in the Genus database with same CATH topology
 2FM4 A;  1Z8L A;  4P4B A;  4NGR A;  5F9M A;  3TLB A;  3EIF A;  3T5M A;  2XEF A;  3D7D A;  3ICU A;  4COG A;  4NGM A;  4COB A;  3K9T A;  5JYB A;  4JZ0 A;  3U1B A;  1XF1 A;  3SJX A;  5D29 A;  3VTA A;  2D0P A;  1KBL A;  4C84 A;  2AUM A;  3TLG A;  4C8P A;  2X0S A;  1CS0 B;  2DIK A;  2R82 A;  3D7G A;  3NOJ A;  5F1Y A;  3I6S A;  3GJZ A;  3BI1 A;  4OC3 A;  2JBJ A;  1VBG A;  2PVV A;  2HRO A;  1R61 A;  4C8F A;  1KEE B;  4E94 A;  4C9A A;  2C6C A;  3S9M A;  3TLZ A;  5IR2 A;  1JDE A;  4YN3 A;  4LQG A;  4C8T A;  2B0A A;  2MP0 A;  2YJT A;  2HWG A;  2PCN A;  4CZ1 A;  1NXJ A;  1GGO A;  3TLA A;  3S9L A;  2CIJ A;  1VI4 A;  3S9N A;  4MCR A;  4C9U A;  5JVL A;  1ZYM A;  4OC2 A;  2XEJ A;  1A9X B;  4NGP A;  2XEI A;  4C9E A;  4NGT A;  4OC1 A;  3SR3 A;  1C30 B;  4CDJ A;  3EZE A;  4P44 A;  4IIX A;  4P4D A;  2OOT A;  3IWW A;  3BHX A;  4CO9 A;  4C8C A;  3TLE A;  2EK8 A;  4INJ A;  1Y9Z A;  3BI0 A;  4C86 A;  1KC7 A;  4OME A;  2D0O A;  1J3L A;  3G23 A;  3I74 A;  3KAS A;  2EK9 A;  4C9V A;  2EZB A;  3TLG B;  3TYX A;  2OLS A;  2HI6 A;  4MI1 A;  1VBH A;  3BXM A;  3T07 A;  5F09 A;  4OC4 A;  2C6P A;  3TLC A;  1T36 B;  2AUN A;  3RBU A;  3IIB A;  4JYW A;  4TJV A;  5K99 A;  4P4J A;  2YJV A;  1JDB C;  4W9Y A;  5ELY A;  4NGS A;  3T0T A;  3C8O A;  4X3R A;  4KNG E;  5F5X A;  4TWE A;  4M8D A;  3KRV A;  4OC0 A;  4H1H A;  4E5S A;  1BXR B;  2C6G A;  2PVW A;  1NBW A;  3FF3 A;  4OC5 A;  3FEC A;  1ZRS A;  2EZA A;  3SJF A;  2GP4 A;  1C3O B;  4MCS A;  5FD8 A;  1M6V B;  4IIY A;  4P4F A;  4P4E A;  4C8A A;  4TJX A;  3D7H A;  4P45 A;  2E28 A;  3SJE A;  2JBK A;  4MCQ A;  3TLY A;  3FED A;  4P4I A;  4C9R A;  1EZB A;  1CE8 B;  4JVO A;  4MCP A;  4EYS A;  4NGN A;  3FEE A;  1ZL0 A;  1EZA A;  3D7F A;  4C85 A;  3SJG A;  2XEG A;  1Q5X A;  3EZB A;  1WVM A;  2EZC A;  2OR4 A;  5IB9 A;  1V6C A;  4CDK A;  1CX8 A;  1DIK A;  2C5Q A;  4C8U A;  3T05 A;  4C99 A;  1DE4 C;  4MJX A;  3EZA A;  3K4I A;  4NGQ A;  4J0N A; 
#chains in the Genus database with same CATH homology
 1Z8L A;  4P4B A;  4NGR A;  3EIF A;  2XEF A;  3D7D A;  3ICU A;  4NGM A;  3K9T A;  4JZ0 A;  1XF1 A;  3SJX A;  5D29 A;  3VTA A;  4C84 A;  4C8P A;  3D7G A;  3I6S A;  3BI1 A;  4OC3 A;  2JBJ A;  2PVV A;  4C8F A;  4C9A A;  2C6C A;  3S9M A;  5IR2 A;  4YN3 A;  4LQG A;  4C8T A;  3S9L A;  2CIJ A;  3S9N A;  4MCR A;  4C9U A;  4OC2 A;  2XEJ A;  4NGP A;  2XEI A;  4C9E A;  4NGT A;  4OC1 A;  4CDJ A;  4P44 A;  4P4D A;  2OOT A;  3IWW A;  3BHX A;  4C8C A;  4C86 A;  2EK8 A;  1Y9Z A;  3BI0 A;  4OME A;  3I74 A;  3KAS A;  2EK9 A;  4C9V A;  3BXM A;  5F09 A;  4OC4 A;  2C6P A;  3RBU A;  3IIB A;  4JYW A;  4TJV A;  4P4J A;  4W9Y A;  5ELY A;  4NGS A;  4X3R A;  4KNG E;  4TWE A;  4OC0 A;  2PVW A;  2C6G A;  3FF3 A;  4OC5 A;  3FEC A;  3SJF A;  2GP4 A;  4MCS A;  4P4F A;  4P4E A;  4C8A A;  4TJX A;  3D7H A;  4P45 A;  3SJE A;  2JBK A;  4MCQ A;  3FED A;  4P4I A;  4C9R A;  4MCP A;  4NGN A;  3FEE A;  3D7F A;  4C85 A;  3SJG A;  2XEG A;  1WVM A;  2OR4 A;  1V6C A;  4CDK A;  1CX8 A;  2C5Q A;  4C8U A;  4C99 A;  1DE4 C;  5IB9 A;  4NGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...