4C86A

Mouse znrf3 ectodomain crystal form i
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
152
structure length
152
Chain Sequence
ETAFVEVVLFESSPSGDYTTHTTGLTGRFSRAGAMLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
publication title Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb
source organism Mus musculus
total genus 40
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4c86A00
4C9AA 2JBJA 3FF3A 3IIBA 2C6CA 3FEDA 2C6GA 3BXMA 3VTAA 4OC2A 4OC5A 4C86A 3I6SA 3SJEA 1Z8LA 2XEGA 4P45A 4TWEA 3S9LA 4C8CA 3D7HA 4NGTA 4OC1A 4MCPA 4YN3A 4CDKA 4P4IA 1XF1A 4KNGE 4NGMA 3EIFA 2CIJA 4NGQA 3SJGA 2PVWA 3FECA 4C9UA 3D7DA 4C99A 4LQGA 3SJFA 4CDJA 4OC4A 4C9VA 4MCRA 4P4JA 4NGNA 3BI1A 1V6CA 5F09A 3FEEA 4P4EA 3ICUA 3S9NA 5IB9A 1WVMA 5ELYA 4C84A 4P4FA 3RBUA 4P4BA 3BHXA 4C9RA 4NGRA 1CX8A 4C9EA 4OC0A 2OR4A 4X3RA 4W9YA 4C8FA 4C85A 3D7FA 4TJXA 4NGPA 1Y9ZA 2OOTA 2JBKA 3KASA 2XEFA 4C8UA 2PVVA 1DE4C 4NGSA 4MCQA 2EK8A 4MCSA 4OC3A 4TJVA 4C8AA 4JZ0A 4P44A 2XEIA 3S9MA 2C6PA 3D7GA 4P4DA 3IWWA 4C8PA 3I74A 3BI0A 2EK9A 3SJXA 4C8TA 4OMEA 5D29A 4JYWA 2XEJA
chains in the Genus database with same CATH superfamily
4C9AA 4IIXA 4M8DA 2JBJA 1BXRB 3FF3A 1CS0B 3IIBA 2MP0A 3T0TA 4CO9A 3C8OA 1NXJA 2C6CA 2OLSA 3TYXA 3FEDA 2C6GA 3BXMA 3VTAA 4OC2A 3EZBA 3G23A 4OC5A 4C86A 3I6SA 3SJEA 1Z8LA 3TLYA 1M6VB 2XEGA 5JYBA 2YJTA 2D0OA 2HROA 4P45A 2EZCA 4TWEA 5F1YA 1ZYMA 3S9LA 4C8CA 3D7HA 1ZL0A 2D0PA 4NGTA 1J3LA 2AUNA 2E28A 4OC1A 1KEEB 4MCPA 2DIKA 4YN3A 2HI6A 4P4IA 3TLZA 4CDKA 1XF1A 4KNGE 4NGMA 3EIFA 3GJZA 1JDBC 2CIJA 1VI4A 4NGQA 3SJGA 2PVWA 3FECA 4MJXA 4C9UA 1C30B 2B0AA 3D7DA 2R82A 4C99A 4LQGA 1JDEA 4JVOA 3SJFA 4CDJA 1ZRSA 4OC4A 4C9VA 4MCRA 4P4JA 4INJA 1T36B 4NGNA 3BI1A 3TLGB 3K4IA 1DIKA 3NOJA 1V6CA 5F09A 4COGA 4EYSA 3FEEA 2EZAA 4P4EA 3ICUA 3S9NA 5IB9A 1A9XB 1EZBA 1WVMA 5ELYA 2GP4A 4C84A 1CE8B 4P4FA 3RBUA 3BHXA 4P4BA 4C9RA 4NGRA 1CX8A 3SR3A 3T5MA 4C9EA 2C5QA 3KRVA 2OR4A 2X0SA 4OC0A 5F9MA 5IR2A 4X3RA 1KBLA 3U1BA 3TLEA 1C3OB 1EZAA 2HWGA 4IIYA 4W9YA 3D7FA 4C8FA 4TJXA 4NGPA 1Y9ZA 4C85A 2OOTA 3T07A 3EZEA 2JBKA 4CZ1A 5FD8A 3KASA 2XEFA 3K9TA 1GGOA 4C8UA 2PVVA 5JVLA 2AUMA 1KC7A 1DE4C 4NGSA 4MCQA 1VBHA 2EK8A 2YJVA 4MCSA 4E5SA 4OC3A 4TJVA 4C8AA 3EZAA 4JZ0A 4P44A 2FM4A 3TLGA 2XEIA 3S9MA 2C6PA 3D7GA 4P4DA 1VBGA 3IWWA 4MI1A 3TLCA 3I74A 3T05A 4C8PA 2EZBA 4COBA 3TLBA 5K99A 4H1HA 3BI0A 3TLAA 2EK9A 1R61A 3SJXA 4C8TA 4E94A 4OMEA 5D29A 5F5XA 1NBWA 4JYWA 2PCNA 4J0NA 1Q5XA 2XEJA
chains in the Genus database with same CATH topology
4C9AA 2JBJA 3FF3A 3IIBA 2C6CA 3FEDA 2C6GA 3BXMA 3VTAA 4OC2A 4OC5A 4C86A 3I6SA 3SJEA 1Z8LA 2XEGA 4P45A 4TWEA 3S9LA 4C8CA 3D7HA 4NGTA 4OC1A 4MCPA 4YN3A 4CDKA 4P4IA 1XF1A 4KNGE 4NGMA 3EIFA 2CIJA 4NGQA 3SJGA 2PVWA 3FECA 4C9UA 3D7DA 4C99A 4LQGA 3SJFA 4CDJA 4OC4A 4C9VA 4MCRA 4P4JA 4NGNA 3BI1A 1V6CA 5F09A 3FEEA 4P4EA 3ICUA 3S9NA 5IB9A 1WVMA 5ELYA 2GP4A 4C84A 4P4FA 3RBUA 4P4BA 3BHXA 4C9RA 4NGRA 1CX8A 4C9EA 2C5QA 4OC0A 2OR4A 5IR2A 4X3RA 4W9YA 4C8FA 4C85A 3D7FA 4TJXA 4NGPA 1Y9ZA 2OOTA 2JBKA 3KASA 2XEFA 3K9TA 4C8UA 2PVVA 1DE4C 4NGSA 4MCQA 2EK8A 4MCSA 4OC3A 4TJVA 4C8AA 4JZ0A 4P44A 2XEIA 3S9MA 2C6PA 3D7GA 4P4DA 3IWWA 4C8PA 3I74A 3BI0A 2EK9A 3SJXA 4C8TA 4OMEA 5D29A 4JYWA 2XEJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C9A A;  2JBJ A;  3FF3 A;  3IIB A;  2C6C A;  3FED A;  2C6G A;  3BXM A;  3VTA A;  4OC2 A;  4OC5 A;  4C86 A;  3I6S A;  3SJE A;  1Z8L A;  2XEG A;  4P45 A;  4TWE A;  3S9L A;  4C8C A;  3D7H A;  4NGT A;  4OC1 A;  4MCP A;  4YN3 A;  4CDK A;  4P4I A;  1XF1 A;  4KNG E;  4NGM A;  3EIF A;  2CIJ A;  4NGQ A;  3SJG A;  2PVW A;  3FEC A;  4C9U A;  3D7D A;  4C99 A;  4LQG A;  3SJF A;  4CDJ A;  4OC4 A;  4C9V A;  4MCR A;  4P4J A;  4NGN A;  3BI1 A;  1V6C A;  5F09 A;  3FEE A;  4P4E A;  3ICU A;  3S9N A;  5IB9 A;  1WVM A;  5ELY A;  4C84 A;  4P4F A;  3RBU A;  4P4B A;  3BHX A;  4C9R A;  4NGR A;  1CX8 A;  4C9E A;  4OC0 A;  2OR4 A;  4X3R A;  4W9Y A;  4C8F A;  4C85 A;  3D7F A;  4TJX A;  4NGP A;  1Y9Z A;  2OOT A;  2JBK A;  3KAS A;  2XEF A;  4C8U A;  2PVV A;  1DE4 C;  4NGS A;  4MCQ A;  2EK8 A;  4MCS A;  4OC3 A;  4TJV A;  4C8A A;  4JZ0 A;  4P44 A;  2XEI A;  3S9M A;  2C6P A;  3D7G A;  4P4D A;  3IWW A;  4C8P A;  3I74 A;  3BI0 A;  2EK9 A;  3SJX A;  4C8T A;  4OME A;  5D29 A;  4JYW A;  2XEJ A; 
#chains in the Genus database with same CATH topology
 4C9A A;  4IIX A;  4M8D A;  2JBJ A;  1BXR B;  3FF3 A;  1CS0 B;  3IIB A;  2MP0 A;  3T0T A;  4CO9 A;  3C8O A;  1NXJ A;  2C6C A;  2OLS A;  3TYX A;  3FED A;  2C6G A;  3BXM A;  3VTA A;  4OC2 A;  3EZB A;  3G23 A;  4OC5 A;  4C86 A;  3I6S A;  3SJE A;  1Z8L A;  3TLY A;  1M6V B;  2XEG A;  5JYB A;  2YJT A;  2D0O A;  2HRO A;  4P45 A;  2EZC A;  4TWE A;  5F1Y A;  1ZYM A;  3S9L A;  4C8C A;  3D7H A;  1ZL0 A;  2D0P A;  4NGT A;  1J3L A;  2AUN A;  2E28 A;  4OC1 A;  1KEE B;  4MCP A;  2DIK A;  4YN3 A;  2HI6 A;  4P4I A;  3TLZ A;  4CDK A;  1XF1 A;  4KNG E;  4NGM A;  3EIF A;  3GJZ A;  1JDB C;  2CIJ A;  1VI4 A;  4NGQ A;  3SJG A;  2PVW A;  3FEC A;  4MJX A;  4C9U A;  1C30 B;  2B0A A;  3D7D A;  2R82 A;  4C99 A;  4LQG A;  1JDE A;  4JVO A;  3SJF A;  4CDJ A;  1ZRS A;  4OC4 A;  4C9V A;  4MCR A;  4P4J A;  4INJ A;  1T36 B;  4NGN A;  3BI1 A;  3TLG B;  3K4I A;  1DIK A;  3NOJ A;  1V6C A;  5F09 A;  4COG A;  4EYS A;  3FEE A;  2EZA A;  4P4E A;  3ICU A;  3S9N A;  5IB9 A;  1A9X B;  1EZB A;  1WVM A;  5ELY A;  2GP4 A;  4C84 A;  1CE8 B;  4P4F A;  3RBU A;  3BHX A;  4P4B A;  4C9R A;  4NGR A;  1CX8 A;  3SR3 A;  3T5M A;  4C9E A;  2C5Q A;  3KRV A;  2OR4 A;  2X0S A;  4OC0 A;  5F9M A;  5IR2 A;  4X3R A;  1KBL A;  3U1B A;  3TLE A;  1C3O B;  1EZA A;  2HWG A;  4IIY A;  4W9Y A;  3D7F A;  4C8F A;  4TJX A;  4NGP A;  1Y9Z A;  4C85 A;  2OOT A;  3T07 A;  3EZE A;  2JBK A;  4CZ1 A;  5FD8 A;  3KAS A;  2XEF A;  3K9T A;  1GGO A;  4C8U A;  2PVV A;  5JVL A;  2AUM A;  1KC7 A;  1DE4 C;  4NGS A;  4MCQ A;  1VBH A;  2EK8 A;  2YJV A;  4MCS A;  4E5S A;  4OC3 A;  4TJV A;  4C8A A;  3EZA A;  4JZ0 A;  4P44 A;  2FM4 A;  3TLG A;  2XEI A;  3S9M A;  2C6P A;  3D7G A;  4P4D A;  1VBG A;  3IWW A;  4MI1 A;  3TLC A;  3I74 A;  3T05 A;  4C8P A;  2EZB A;  4COB A;  3TLB A;  5K99 A;  4H1H A;  3BI0 A;  3TLA A;  2EK9 A;  1R61 A;  3SJX A;  4C8T A;  4E94 A;  4OME A;  5D29 A;  5F5X A;  1NBW A;  4JYW A;  2PCN A;  4J0N A;  1Q5X A;  2XEJ A; 
#chains in the Genus database with same CATH homology
 4C9A A;  2JBJ A;  3FF3 A;  3IIB A;  2C6C A;  3FED A;  2C6G A;  3BXM A;  3VTA A;  4OC2 A;  4OC5 A;  4C86 A;  3I6S A;  3SJE A;  1Z8L A;  2XEG A;  4P45 A;  4TWE A;  3S9L A;  4C8C A;  3D7H A;  4NGT A;  4OC1 A;  4MCP A;  4YN3 A;  4CDK A;  4P4I A;  1XF1 A;  4KNG E;  4NGM A;  3EIF A;  2CIJ A;  4NGQ A;  3SJG A;  2PVW A;  3FEC A;  4C9U A;  3D7D A;  4C99 A;  4LQG A;  3SJF A;  4CDJ A;  4OC4 A;  4C9V A;  4MCR A;  4P4J A;  4NGN A;  3BI1 A;  1V6C A;  5F09 A;  3FEE A;  4P4E A;  3ICU A;  3S9N A;  5IB9 A;  1WVM A;  5ELY A;  2GP4 A;  4C84 A;  4P4F A;  3RBU A;  4P4B A;  3BHX A;  4C9R A;  4NGR A;  1CX8 A;  4C9E A;  2C5Q A;  4OC0 A;  2OR4 A;  5IR2 A;  4X3R A;  4W9Y A;  4C8F A;  4C85 A;  3D7F A;  4TJX A;  4NGP A;  1Y9Z A;  2OOT A;  2JBK A;  3KAS A;  2XEF A;  3K9T A;  4C8U A;  2PVV A;  1DE4 C;  4NGS A;  4MCQ A;  2EK8 A;  4MCS A;  4OC3 A;  4TJV A;  4C8A A;  4JZ0 A;  4P44 A;  2XEI A;  3S9M A;  2C6P A;  3D7G A;  4P4D A;  3IWW A;  4C8P A;  3I74 A;  3BI0 A;  2EK9 A;  3SJX A;  4C8T A;  4OME A;  5D29 A;  4JYW A;  2XEJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...