4C86A

Mouse znrf3 ectodomain crystal form i
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
152
structure length
152
Chain Sequence
ETAFVEVVLFESSPSGDYTTHTTGLTGRFSRAGAMLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
publication title Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
total genus 40
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4c86A00
4TJVA 2OOTA 4NGMA 3BHXA 4OMEA 4OC4A 4C9AA 3FEDA 5ELYA 4P4FA 3S9LA 3FECA 2EK8A 5IB9A 4P4JA 3BXMA 4YN3A 2XEJA 4C9RA 4P4EA 3IWWA 3D7GA 3SJFA 3VTAA 3I6SA 3D7HA 4OC2A 4C86A 4MCPA 4OC5A 4TJXA 1DE4C 2OR4A 1V6CA 2JBJA 2C6GA 3ICUA 4C9EA 4OC3A 4KNGE 2EK9A 4C8AA 4NGQA 4C85A 3FEEA 2PVWA 4C8PA 4C8UA 2XEFA 1XF1A 1Y9ZA 4W9YA 4MCQA 2PVVA 3D7FA 2C6CA 4C99A 3BI1A 4NGNA 4OC1A 4NGRA 4P44A 1CX8A 3SJEA 2JBKA 4C9UA 4JZ0A 4LQGA 4C8TA 4C8FA 3IIBA 4P45A 4CDJA 4P4BA 3EIFA 4OC0A 4C84A 4MCRA 4MCSA 5F09A 4NGPA 4C8CA 1Z8LA 4C9VA 2XEGA 3FF3A 2C6PA 2CIJA 4P4IA 3SJGA 3S9NA 4JYWA 1WVMA 4TWEA 4NGSA 2XEIA 3SJXA 4NGTA 3RBUA 4X3RA 3D7DA 3I74A 4CDKA 3S9MA 3KASA 3BI0A 4P4DA 5D29A
chains in the Genus database with same CATH superfamily
3T0TA 1VBGA 4TJVA 4CO9A 2OOTA 4NGMA 3BHXA 4OMEA 4OC4A 3G23A 4C9AA 3FEDA 1JDEA 1JDBC 4P4FA 5ELYA 3S9LA 3FECA 5K99A 2EK8A 5IB9A 4P4JA 1CE8B 3BXMA 2EZCA 4YN3A 2DIKA 1M6VB 2OLSA 5IR2A 3TLGB 1ZL0A 3TLAA 5JVLA 4H1HA 2XEJA 4C9RA 1T36B 2MP0A 4P4EA 1GGOA 3C8OA 3IWWA 3D7GA 2HROA 5F1YA 2D0OA 3SJFA 3VTAA 2B0AA 3I6SA 5F5XA 4JVOA 3D7HA 2HI6A 1ZYMA 1KC7A 4OC2A 4C86A 4MCPA 4OC5A 2X0SA 1DE4C 2D0PA 4TJXA 2OR4A 1V6CA 2JBJA 2C6GA 3KRVA 3ICUA 3T5MA 4C9EA 4OC3A 5JYBA 1BXRB 1DIKA 4KNGE 2EK9A 2YJTA 3EZBA 4J0NA 4C8AA 4NGQA 2EZBA 4C85A 3FEEA 2PVWA 4C8PA 4C8UA 2XEFA 3NOJA 4E94A 1R61A 1XF1A 3TLEA 3K9TA 1KBLA 1Y9ZA 1C30B 4INJA 4W9YA 4CZ1A 4MCQA 1CS0B 2PVVA 3D7FA 2C6CA 4IIYA 3BI1A 3TLBA 4C99A 4COGA 4NGNA 3EZEA 4OC1A 5FD8A 4NGRA 4P44A 1Q5XA 1CX8A 1ZRSA 3SJEA 2JBKA 2YJVA 4C9UA 4JZ0A 3T05A 4LQGA 4C8TA 4C8FA 2GP4A 2PCNA 3IIBA 4P45A 4COBA 4CDJA 4P4BA 3EIFA 2FM4A 3GJZA 3T07A 2R82A 2AUNA 4OC0A 4C84A 3TLGA 2C5QA 4MCRA 4IIXA 4M8DA 4MCSA 5F09A 1NBWA 1VBHA 3U1BA 4NGPA 4C8CA 1Z8LA 1A9XB 4EYSA 4C9VA 1KEEB 2XEGA 3EZAA 3FF3A 2C6PA 1EZBA 1VI4A 2CIJA 2AUMA 4P4IA 3SJGA 4MJXA 3SR3A 4JYWA 3S9NA 1NXJA 1WVMA 3K4IA 4E5SA 2E28A 2HWGA 4TWEA 1J3LA 3TYXA 4MI1A 2XEIA 4NGSA 3SJXA 4NGTA 2EZAA 4X3RA 5F9MA 3RBUA 3TLYA 3D7DA 3I74A 4CDKA 3TLZA 3S9MA 3KASA 3TLCA 3BI0A 1EZAA 4P4DA 5D29A 1C3OB
chains in the Genus database with same CATH topology
4TJVA 2OOTA 4NGMA 3BHXA 4OMEA 4OC4A 4C9AA 3FEDA 5ELYA 4P4FA 3S9LA 3FECA 2EK8A 5IB9A 4P4JA 3BXMA 4YN3A 5IR2A 2XEJA 4C9RA 4P4EA 3IWWA 3D7GA 3SJFA 3VTAA 3I6SA 3D7HA 4OC2A 4C86A 4MCPA 4OC5A 4TJXA 1DE4C 2OR4A 1V6CA 2JBJA 2C6GA 3ICUA 4C9EA 4OC3A 4KNGE 2EK9A 4C8AA 4NGQA 4C85A 3FEEA 2PVWA 4C8PA 4C8UA 2XEFA 1XF1A 3K9TA 1Y9ZA 4W9YA 4MCQA 2PVVA 3D7FA 2C6CA 4C99A 3BI1A 4NGNA 4OC1A 4NGRA 4P44A 1CX8A 3SJEA 2JBKA 4C9UA 4JZ0A 4LQGA 4C8TA 4C8FA 2GP4A 3IIBA 4P45A 4CDJA 4P4BA 3EIFA 4OC0A 4C84A 2C5QA 4MCRA 4MCSA 5F09A 4NGPA 4C8CA 1Z8LA 4C9VA 2XEGA 3FF3A 2C6PA 2CIJA 4P4IA 3SJGA 3S9NA 4JYWA 1WVMA 4TWEA 4NGSA 2XEIA 3SJXA 4NGTA 3RBUA 4X3RA 3D7DA 3I74A 4CDKA 3S9MA 3KASA 3BI0A 4P4DA 5D29A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TJV A;  2OOT A;  4NGM A;  3BHX A;  4OME A;  4OC4 A;  4C9A A;  3FED A;  5ELY A;  4P4F A;  3S9L A;  3FEC A;  2EK8 A;  5IB9 A;  4P4J A;  3BXM A;  4YN3 A;  2XEJ A;  4C9R A;  4P4E A;  3IWW A;  3D7G A;  3SJF A;  3VTA A;  3I6S A;  3D7H A;  4OC2 A;  4C86 A;  4MCP A;  4OC5 A;  4TJX A;  1DE4 C;  2OR4 A;  1V6C A;  2JBJ A;  2C6G A;  3ICU A;  4C9E A;  4OC3 A;  4KNG E;  2EK9 A;  4C8A A;  4NGQ A;  4C85 A;  3FEE A;  2PVW A;  4C8P A;  4C8U A;  2XEF A;  1XF1 A;  1Y9Z A;  4W9Y A;  4MCQ A;  2PVV A;  3D7F A;  2C6C A;  4C99 A;  3BI1 A;  4NGN A;  4OC1 A;  4NGR A;  4P44 A;  1CX8 A;  3SJE A;  2JBK A;  4C9U A;  4JZ0 A;  4LQG A;  4C8T A;  4C8F A;  3IIB A;  4P45 A;  4CDJ A;  4P4B A;  3EIF A;  4OC0 A;  4C84 A;  4MCR A;  4MCS A;  5F09 A;  4NGP A;  4C8C A;  1Z8L A;  4C9V A;  2XEG A;  3FF3 A;  2C6P A;  2CIJ A;  4P4I A;  3SJG A;  3S9N A;  4JYW A;  1WVM A;  4TWE A;  4NGS A;  2XEI A;  3SJX A;  4NGT A;  3RBU A;  4X3R A;  3D7D A;  3I74 A;  4CDK A;  3S9M A;  3KAS A;  3BI0 A;  4P4D A;  5D29 A; 
#chains in the Genus database with same CATH topology
 3T0T A;  1VBG A;  4TJV A;  4CO9 A;  2OOT A;  4NGM A;  3BHX A;  4OME A;  4OC4 A;  3G23 A;  4C9A A;  3FED A;  1JDE A;  1JDB C;  4P4F A;  5ELY A;  3S9L A;  3FEC A;  5K99 A;  2EK8 A;  5IB9 A;  4P4J A;  1CE8 B;  3BXM A;  2EZC A;  4YN3 A;  2DIK A;  1M6V B;  2OLS A;  5IR2 A;  3TLG B;  1ZL0 A;  3TLA A;  5JVL A;  4H1H A;  2XEJ A;  4C9R A;  1T36 B;  2MP0 A;  4P4E A;  1GGO A;  3C8O A;  3IWW A;  3D7G A;  2HRO A;  5F1Y A;  2D0O A;  3SJF A;  3VTA A;  2B0A A;  3I6S A;  5F5X A;  4JVO A;  3D7H A;  2HI6 A;  1ZYM A;  1KC7 A;  4OC2 A;  4C86 A;  4MCP A;  4OC5 A;  2X0S A;  1DE4 C;  2D0P A;  4TJX A;  2OR4 A;  1V6C A;  2JBJ A;  2C6G A;  3KRV A;  3ICU A;  3T5M A;  4C9E A;  4OC3 A;  5JYB A;  1BXR B;  1DIK A;  4KNG E;  2EK9 A;  2YJT A;  3EZB A;  4J0N A;  4C8A A;  4NGQ A;  2EZB A;  4C85 A;  3FEE A;  2PVW A;  4C8P A;  4C8U A;  2XEF A;  3NOJ A;  4E94 A;  1R61 A;  1XF1 A;  3TLE A;  3K9T A;  1KBL A;  1Y9Z A;  1C30 B;  4INJ A;  4W9Y A;  4CZ1 A;  4MCQ A;  1CS0 B;  2PVV A;  3D7F A;  2C6C A;  4IIY A;  3BI1 A;  3TLB A;  4C99 A;  4COG A;  4NGN A;  3EZE A;  4OC1 A;  5FD8 A;  4NGR A;  4P44 A;  1Q5X A;  1CX8 A;  1ZRS A;  3SJE A;  2JBK A;  2YJV A;  4C9U A;  4JZ0 A;  3T05 A;  4LQG A;  4C8T A;  4C8F A;  2GP4 A;  2PCN A;  3IIB A;  4P45 A;  4COB A;  4CDJ A;  4P4B A;  3EIF A;  2FM4 A;  3GJZ A;  3T07 A;  2R82 A;  2AUN A;  4OC0 A;  4C84 A;  3TLG A;  2C5Q A;  4MCR A;  4IIX A;  4M8D A;  4MCS A;  5F09 A;  1NBW A;  1VBH A;  3U1B A;  4NGP A;  4C8C A;  1Z8L A;  1A9X B;  4EYS A;  4C9V A;  1KEE B;  2XEG A;  3EZA A;  3FF3 A;  2C6P A;  1EZB A;  1VI4 A;  2CIJ A;  2AUM A;  4P4I A;  3SJG A;  4MJX A;  3SR3 A;  4JYW A;  3S9N A;  1NXJ A;  1WVM A;  3K4I A;  4E5S A;  2E28 A;  2HWG A;  4TWE A;  1J3L A;  3TYX A;  4MI1 A;  2XEI A;  4NGS A;  3SJX A;  4NGT A;  2EZA A;  4X3R A;  5F9M A;  3RBU A;  3TLY A;  3D7D A;  3I74 A;  4CDK A;  3TLZ A;  3S9M A;  3KAS A;  3TLC A;  3BI0 A;  1EZA A;  4P4D A;  5D29 A;  1C3O B; 
#chains in the Genus database with same CATH homology
 4TJV A;  2OOT A;  4NGM A;  3BHX A;  4OME A;  4OC4 A;  4C9A A;  3FED A;  5ELY A;  4P4F A;  3S9L A;  3FEC A;  2EK8 A;  5IB9 A;  4P4J A;  3BXM A;  4YN3 A;  5IR2 A;  2XEJ A;  4C9R A;  4P4E A;  3IWW A;  3D7G A;  3SJF A;  3VTA A;  3I6S A;  3D7H A;  4OC2 A;  4C86 A;  4MCP A;  4OC5 A;  4TJX A;  1DE4 C;  2OR4 A;  1V6C A;  2JBJ A;  2C6G A;  3ICU A;  4C9E A;  4OC3 A;  4KNG E;  2EK9 A;  4C8A A;  4NGQ A;  4C85 A;  3FEE A;  2PVW A;  4C8P A;  4C8U A;  2XEF A;  1XF1 A;  3K9T A;  1Y9Z A;  4W9Y A;  4MCQ A;  2PVV A;  3D7F A;  2C6C A;  4C99 A;  3BI1 A;  4NGN A;  4OC1 A;  4NGR A;  4P44 A;  1CX8 A;  3SJE A;  2JBK A;  4C9U A;  4JZ0 A;  4LQG A;  4C8T A;  4C8F A;  2GP4 A;  3IIB A;  4P45 A;  4CDJ A;  4P4B A;  3EIF A;  4OC0 A;  4C84 A;  2C5Q A;  4MCR A;  4MCS A;  5F09 A;  4NGP A;  4C8C A;  1Z8L A;  4C9V A;  2XEG A;  3FF3 A;  2C6P A;  2CIJ A;  4P4I A;  3SJG A;  3S9N A;  4JYW A;  1WVM A;  4TWE A;  4NGS A;  2XEI A;  3SJX A;  4NGT A;  3RBU A;  4X3R A;  3D7D A;  3I74 A;  4CDK A;  3S9M A;  3KAS A;  3BI0 A;  4P4D A;  5D29 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...