4C86A

Mouse znrf3 ectodomain crystal form i
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
152
structure length
152
Chain Sequence
ETAFVEVVLFESSPSGDYTTHTTGLTGRFSRAGAMLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
total genus 40
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4c86A00
3KASA 3FF3A 4MCQA 4P4DA 4C8TA 3SJXA 1Y9ZA 4C9VA 4NGNA 3I6SA 4KNGE 4NGRA 2OOTA 3EIFA 4CDJA 4OC2A 2C6CA 4C9RA 5IB9A 4NGMA 3SJFA 4OMEA 3FECA 3ICUA 1DE4C 4P4IA 3S9NA 3S9MA 4C8PA 4C84A 2XEGA 5ELYA 4C8CA 4CDKA 2XEFA 3D7FA 5F09A 3D7HA 4OC1A 2JBKA 4C8AA 4OC0A 4OC4A 3SJGA 3BI0A 4P45A 3BHXA 4NGPA 3IWWA 4C8FA 3FEDA 4JYWA 5D29A 4MCPA 2PVVA 2C6PA 2PVWA 1Z8LA 4TJVA 4C86A 4OC3A 3S9LA 4MCRA 4C99A 4JZ0A 4OC5A 4C8UA 4MCSA 3BI1A 1V6CA 3D7DA 4P4BA 4TWEA 2OR4A 4X3RA 2EK8A 4W9YA 4C9AA 4C9EA 1WVMA 4P4FA 4P4EA 2XEIA 4C9UA 3FEEA 4LQGA 2JBJA 4P4JA 1CX8A 3VTAA 2XEJA 2CIJA 3RBUA 1XF1A 3I74A 4YN3A 3SJEA 4P44A 3IIBA 4NGQA 4C85A 2C6GA 3BXMA 3D7GA 4NGSA 2EK9A 4NGTA 4TJXA
chains in the Genus database with same CATH superfamily
3KASA 3FF3A 4MCQA 4P4DA 2EZCA 4C8TA 3SJXA 1Q5XA 1Y9ZA 4C9VA 4NGNA 1KEEB 2B0AA 3I6SA 4KNGE 1DIKA 2YJTA 4JVOA 5F5XA 4NGRA 2OOTA 1BXRB 3EIFA 4CDJA 2YJVA 4OC2A 1EZAA 2HROA 2C6CA 4C9RA 5IB9A 4NGMA 3SJFA 4CO9A 2C5QA 4OMEA 3T0TA 3FECA 3ICUA 1DE4C 4P4IA 2EZAA 1NXJA 2DIKA 3S9NA 1CE8B 3S9MA 1A9XB 3G23A 3K4IA 3TLAA 3TLGA 3TLBA 4C8PA 3EZBA 4COBA 5JVLA 5JYBA 4C84A 4MI1A 1VBHA 2XEGA 5ELYA 1VBGA 1ZL0A 2X0SA 4C8CA 4CDKA 2XEFA 3D7FA 5F09A 3D7HA 4OC1A 2JBKA 4C8AA 4CZ1A 3K9TA 3C8OA 3T05A 2AUMA 4OC0A 4OC4A 3SJGA 3BI0A 1C3OB 1EZBA 2D0OA 1J3LA 4P45A 3BHXA 4NGPA 2GP4A 4H1HA 3T5MA 4J0NA 3IWWA 4C8FA 3FEDA 3EZAA 4IIYA 5F1YA 1CS0B 2AUNA 4JYWA 5IR2A 3TYXA 5D29A 3EZEA 4MCPA 2PVVA 3TLEA 1GGOA 1JDBC 1NBWA 3TLYA 2C6PA 1M6VB 2PVWA 3U1BA 1Z8LA 4E94A 2OLSA 2FM4A 4TJVA 4C86A 2HWGA 4IIXA 4OC3A 3S9LA 4MCRA 4C99A 5F9MA 4JZ0A 4OC5A 1T36B 4C8UA 2D0PA 4MCSA 1C30B 3BI1A 1V6CA 3D7DA 4P4BA 1R61A 4TWEA 2OR4A 4X3RA 2E28A 2PCNA 1KBLA 5FD8A 1VI4A 2EK8A 2HI6A 2R82A 3TLGB 4W9YA 4C9AA 4C9EA 3GJZA 2EZBA 1WVMA 4P4FA 4P4EA 1KC7A 2XEIA 4C9UA 3FEEA 4LQGA 3TLCA 2JBJA 4MJXA 4P4JA 1CX8A 3VTAA 3KRVA 2XEJA 1ZYMA 2CIJA 4COGA 3RBUA 3NOJA 1XF1A 2MP0A 3I74A 4YN3A 4P44A 3SJEA 5K99A 3IIBA 4INJA 4M8DA 4NGQA 4C85A 2C6GA 3T07A 1ZRSA 4EYSA 3BXMA 3D7GA 4NGSA 2EK9A 4NGTA 4E5SA 3SR3A 4TJXA 1JDEA 3TLZA
chains in the Genus database with same CATH topology
3KASA 3FF3A 4MCQA 4P4DA 4C8TA 3SJXA 1Y9ZA 4C9VA 4NGNA 3I6SA 4KNGE 4NGRA 2OOTA 3EIFA 4CDJA 4OC2A 2C6CA 4C9RA 5IB9A 4NGMA 3SJFA 2C5QA 4OMEA 3FECA 3ICUA 1DE4C 4P4IA 3S9NA 3S9MA 4C8PA 4C84A 2XEGA 5ELYA 4C8CA 4CDKA 2XEFA 3D7FA 5F09A 3D7HA 4OC1A 2JBKA 4C8AA 3K9TA 4OC0A 4OC4A 3SJGA 3BI0A 4P45A 3BHXA 4NGPA 2GP4A 3IWWA 4C8FA 3FEDA 4JYWA 5IR2A 5D29A 4MCPA 2PVVA 2C6PA 2PVWA 1Z8LA 4TJVA 4C86A 4OC3A 3S9LA 4MCRA 4C99A 4JZ0A 4OC5A 4C8UA 4MCSA 3BI1A 1V6CA 3D7DA 4P4BA 4TWEA 2OR4A 4X3RA 2EK8A 4W9YA 4C9AA 4C9EA 1WVMA 4P4FA 4P4EA 2XEIA 4C9UA 3FEEA 4LQGA 2JBJA 4P4JA 1CX8A 3VTAA 2XEJA 2CIJA 3RBUA 1XF1A 3I74A 4YN3A 3SJEA 4P44A 3IIBA 4NGQA 4C85A 2C6GA 3BXMA 3D7GA 4NGSA 2EK9A 4NGTA 4TJXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KAS A;  3FF3 A;  4MCQ A;  4P4D A;  4C8T A;  3SJX A;  1Y9Z A;  4C9V A;  4NGN A;  3I6S A;  4KNG E;  4NGR A;  2OOT A;  3EIF A;  4CDJ A;  4OC2 A;  2C6C A;  4C9R A;  5IB9 A;  4NGM A;  3SJF A;  4OME A;  3FEC A;  3ICU A;  1DE4 C;  4P4I A;  3S9N A;  3S9M A;  4C8P A;  4C84 A;  2XEG A;  5ELY A;  4C8C A;  4CDK A;  2XEF A;  3D7F A;  5F09 A;  3D7H A;  4OC1 A;  2JBK A;  4C8A A;  4OC0 A;  4OC4 A;  3SJG A;  3BI0 A;  4P45 A;  3BHX A;  4NGP A;  3IWW A;  4C8F A;  3FED A;  4JYW A;  5D29 A;  4MCP A;  2PVV A;  2C6P A;  2PVW A;  1Z8L A;  4TJV A;  4C86 A;  4OC3 A;  3S9L A;  4MCR A;  4C99 A;  4JZ0 A;  4OC5 A;  4C8U A;  4MCS A;  3BI1 A;  1V6C A;  3D7D A;  4P4B A;  4TWE A;  2OR4 A;  4X3R A;  2EK8 A;  4W9Y A;  4C9A A;  4C9E A;  1WVM A;  4P4F A;  4P4E A;  2XEI A;  4C9U A;  3FEE A;  4LQG A;  2JBJ A;  4P4J A;  1CX8 A;  3VTA A;  2XEJ A;  2CIJ A;  3RBU A;  1XF1 A;  3I74 A;  4YN3 A;  3SJE A;  4P44 A;  3IIB A;  4NGQ A;  4C85 A;  2C6G A;  3BXM A;  3D7G A;  4NGS A;  2EK9 A;  4NGT A;  4TJX A; 
#chains in the Genus database with same CATH topology
 3KAS A;  3FF3 A;  4MCQ A;  4P4D A;  2EZC A;  4C8T A;  3SJX A;  1Q5X A;  1Y9Z A;  4C9V A;  4NGN A;  1KEE B;  2B0A A;  3I6S A;  4KNG E;  1DIK A;  2YJT A;  4JVO A;  5F5X A;  4NGR A;  2OOT A;  1BXR B;  3EIF A;  4CDJ A;  2YJV A;  4OC2 A;  1EZA A;  2HRO A;  2C6C A;  4C9R A;  5IB9 A;  4NGM A;  3SJF A;  4CO9 A;  2C5Q A;  4OME A;  3T0T A;  3FEC A;  3ICU A;  1DE4 C;  4P4I A;  2EZA A;  1NXJ A;  2DIK A;  3S9N A;  1CE8 B;  3S9M A;  1A9X B;  3G23 A;  3K4I A;  3TLA A;  3TLG A;  3TLB A;  4C8P A;  3EZB A;  4COB A;  5JVL A;  5JYB A;  4C84 A;  4MI1 A;  1VBH A;  2XEG A;  5ELY A;  1VBG A;  1ZL0 A;  2X0S A;  4C8C A;  4CDK A;  2XEF A;  3D7F A;  5F09 A;  3D7H A;  4OC1 A;  2JBK A;  4C8A A;  4CZ1 A;  3K9T A;  3C8O A;  3T05 A;  2AUM A;  4OC0 A;  4OC4 A;  3SJG A;  3BI0 A;  1C3O B;  1EZB A;  2D0O A;  1J3L A;  4P45 A;  3BHX A;  4NGP A;  2GP4 A;  4H1H A;  3T5M A;  4J0N A;  3IWW A;  4C8F A;  3FED A;  3EZA A;  4IIY A;  5F1Y A;  1CS0 B;  2AUN A;  4JYW A;  5IR2 A;  3TYX A;  5D29 A;  3EZE A;  4MCP A;  2PVV A;  3TLE A;  1GGO A;  1JDB C;  1NBW A;  3TLY A;  2C6P A;  1M6V B;  2PVW A;  3U1B A;  1Z8L A;  4E94 A;  2OLS A;  2FM4 A;  4TJV A;  4C86 A;  2HWG A;  4IIX A;  4OC3 A;  3S9L A;  4MCR A;  4C99 A;  5F9M A;  4JZ0 A;  4OC5 A;  1T36 B;  4C8U A;  2D0P A;  4MCS A;  1C30 B;  3BI1 A;  1V6C A;  3D7D A;  4P4B A;  1R61 A;  4TWE A;  2OR4 A;  4X3R A;  2E28 A;  2PCN A;  1KBL A;  5FD8 A;  1VI4 A;  2EK8 A;  2HI6 A;  2R82 A;  3TLG B;  4W9Y A;  4C9A A;  4C9E A;  3GJZ A;  2EZB A;  1WVM A;  4P4F A;  4P4E A;  1KC7 A;  2XEI A;  4C9U A;  3FEE A;  4LQG A;  3TLC A;  2JBJ A;  4MJX A;  4P4J A;  1CX8 A;  3VTA A;  3KRV A;  2XEJ A;  1ZYM A;  2CIJ A;  4COG A;  3RBU A;  3NOJ A;  1XF1 A;  2MP0 A;  3I74 A;  4YN3 A;  4P44 A;  3SJE A;  5K99 A;  3IIB A;  4INJ A;  4M8D A;  4NGQ A;  4C85 A;  2C6G A;  3T07 A;  1ZRS A;  4EYS A;  3BXM A;  3D7G A;  4NGS A;  2EK9 A;  4NGT A;  4E5S A;  3SR3 A;  4TJX A;  1JDE A;  3TLZ A; 
#chains in the Genus database with same CATH homology
 3KAS A;  3FF3 A;  4MCQ A;  4P4D A;  4C8T A;  3SJX A;  1Y9Z A;  4C9V A;  4NGN A;  3I6S A;  4KNG E;  4NGR A;  2OOT A;  3EIF A;  4CDJ A;  4OC2 A;  2C6C A;  4C9R A;  5IB9 A;  4NGM A;  3SJF A;  2C5Q A;  4OME A;  3FEC A;  3ICU A;  1DE4 C;  4P4I A;  3S9N A;  3S9M A;  4C8P A;  4C84 A;  2XEG A;  5ELY A;  4C8C A;  4CDK A;  2XEF A;  3D7F A;  5F09 A;  3D7H A;  4OC1 A;  2JBK A;  4C8A A;  3K9T A;  4OC0 A;  4OC4 A;  3SJG A;  3BI0 A;  4P45 A;  3BHX A;  4NGP A;  2GP4 A;  3IWW A;  4C8F A;  3FED A;  4JYW A;  5IR2 A;  5D29 A;  4MCP A;  2PVV A;  2C6P A;  2PVW A;  1Z8L A;  4TJV A;  4C86 A;  4OC3 A;  3S9L A;  4MCR A;  4C99 A;  4JZ0 A;  4OC5 A;  4C8U A;  4MCS A;  3BI1 A;  1V6C A;  3D7D A;  4P4B A;  4TWE A;  2OR4 A;  4X3R A;  2EK8 A;  4W9Y A;  4C9A A;  4C9E A;  1WVM A;  4P4F A;  4P4E A;  2XEI A;  4C9U A;  3FEE A;  4LQG A;  2JBJ A;  4P4J A;  1CX8 A;  3VTA A;  2XEJ A;  2CIJ A;  3RBU A;  1XF1 A;  3I74 A;  4YN3 A;  3SJE A;  4P44 A;  3IIB A;  4NGQ A;  4C85 A;  2C6G A;  3BXM A;  3D7G A;  4NGS A;  2EK9 A;  4NGT A;  4TJX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...