4C86A

Mouse znrf3 ectodomain crystal form i
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
152
structure length
152
Chain Sequence
ETAFVEVVLFESSPSGDYTTHTTGLTGRFSRAGAMLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
total genus 40
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4c86A00
3SJFA 4NGMA 3BXMA 4NGTA 1WVMA 4CDKA 2XEJA 3IIBA 3I6SA 4OMEA 4OC3A 4TWEA 1DE4C 2CIJA 4C8FA 3D7DA 2EK9A 3I74A 4JYWA 4C8AA 4OC1A 4OC5A 4NGNA 3EIFA 2C6PA 4C8PA 4MCRA 2PVVA 4P4EA 4KNGE 4TJXA 3VTAA 4OC4A 4P45A 4MCPA 4P4FA 4C8TA 4NGSA 4C8CA 2JBJA 3ICUA 2PVWA 4C8UA 4NGPA 4C9VA 2JBKA 4NGQA 5F09A 4C9AA 4C84A 4P44A 1V6CA 3BHXA 2XEFA 5ELYA 4LQGA 4C9EA 3KASA 4C86A 4MCSA 1Z8LA 4MCQA 2EK8A 2OR4A 3FEDA 3S9MA 4P4IA 4CDJA 4P4DA 3BI0A 3SJGA 2XEIA 3D7HA 2XEGA 5D29A 3IWWA 3BI1A 4NGRA 3D7FA 3SJXA 4OC0A 3RBUA 4C99A 4YN3A 3D7GA 3SJEA 4C9RA 4X3RA 4W9YA 2C6GA 2C6CA 4OC2A 4P4BA 4C9UA 1CX8A 1XF1A 3FEEA 2OOTA 3S9LA 5IB9A 3FECA 4C85A 1Y9ZA 4TJVA 3S9NA 4JZ0A 4P4JA 3FF3A
chains in the Genus database with same CATH superfamily
3SJFA 4NGMA 3BXMA 3TLGB 1C30B 4NGTA 2EZCA 4INJA 1WVMA 4CDKA 2XEJA 1M6VB 3IIBA 4E94A 3T0TA 3I6SA 1Q5XA 4IIXA 4JVOA 4OMEA 4OC3A 4TWEA 1DE4C 1KC7A 2CIJA 1BXRB 3TLYA 3EZEA 1GGOA 2GP4A 2EZBA 3D7DA 4C8FA 2EZAA 1EZBA 3TLBA 2EK9A 3I74A 2AUMA 4JYWA 3TLEA 1CE8B 4OC1A 4C8AA 4OC5A 4NGNA 3T05A 3EIFA 2C6PA 4MJXA 4C8PA 2HI6A 3K4IA 4MCRA 2PVVA 4P4EA 2HWGA 4CZ1A 5FD8A 4KNGE 4TJXA 3VTAA 4OC4A 5IR2A 4P45A 4MCPA 3T5MA 2R82A 4P4FA 4C8TA 3G23A 4NGSA 1DIKA 4C8CA 1KEEB 4H1HA 2JBJA 2D0PA 1JDBC 3ICUA 2PVWA 4C8UA 1NXJA 5K99A 4NGPA 4C9VA 1KBLA 2JBKA 4NGQA 1NBWA 5F09A 4C9AA 3SR3A 4C84A 2OLSA 4P44A 4COGA 2MP0A 1V6CA 3BHXA 2XEFA 5ELYA 4LQGA 3U1BA 2E28A 4C9EA 1EZAA 3KASA 4C86A 3K9TA 2D0OA 4J0NA 4MCSA 4COBA 2DIKA 3NOJA 1Z8LA 4MCQA 2EK8A 2C5QA 2OR4A 4CO9A 1J3LA 4EYSA 3FEDA 4IIYA 3S9MA 4P4IA 4CDJA 4P4DA 5F5XA 1VBGA 3BI0A 3SJGA 2XEIA 3D7HA 1CS0B 2XEGA 5D29A 3IWWA 1C3OB 2YJTA 3TLGA 3GJZA 1R61A 3BI1A 3EZBA 4NGRA 4MI1A 3EZAA 3D7FA 5F1YA 1ZYMA 1A9XB 3SJXA 4OC0A 3RBUA 3T07A 4C99A 4YN3A 1JDEA 5JVLA 3D7GA 3SJEA 1T36B 4C9RA 4X3RA 3TLCA 2B0AA 4W9YA 1ZRSA 2C6CA 2C6GA 1VBHA 4OC2A 4P4BA 3TYXA 4C9UA 4E5SA 2FM4A 1CX8A 3TLZA 2HROA 5JYBA 1XF1A 3C8OA 5F9MA 3FEEA 2OOTA 1ZL0A 2X0SA 3TLAA 3S9LA 2YJVA 5IB9A 3FECA 4C85A 1Y9ZA 1VI4A 4TJVA 4M8DA 3S9NA 4JZ0A 2AUNA 2PCNA 3KRVA 4P4JA 3FF3A
chains in the Genus database with same CATH topology
3SJFA 4NGMA 3BXMA 4NGTA 1WVMA 4CDKA 2XEJA 3IIBA 3I6SA 4OMEA 4OC3A 4TWEA 1DE4C 2CIJA 2GP4A 4C8FA 3D7DA 2EK9A 3I74A 4JYWA 4C8AA 4OC1A 4OC5A 4NGNA 3EIFA 2C6PA 4C8PA 4MCRA 2PVVA 4P4EA 4KNGE 4TJXA 3VTAA 4OC4A 5IR2A 4P45A 4MCPA 4P4FA 4C8TA 4NGSA 4C8CA 2JBJA 3ICUA 2PVWA 4C8UA 4NGPA 4C9VA 2JBKA 4NGQA 5F09A 4C9AA 4C84A 4P44A 1V6CA 3BHXA 2XEFA 5ELYA 4LQGA 4C9EA 3KASA 4C86A 3K9TA 4MCSA 1Z8LA 4MCQA 2EK8A 2C5QA 2OR4A 3FEDA 3S9MA 4P4IA 4CDJA 4P4DA 3BI0A 3SJGA 2XEIA 3D7HA 2XEGA 5D29A 3IWWA 3BI1A 4NGRA 3D7FA 3SJXA 4OC0A 3RBUA 4C99A 4YN3A 3D7GA 3SJEA 4C9RA 4X3RA 4W9YA 2C6GA 2C6CA 4OC2A 4P4BA 4C9UA 1CX8A 1XF1A 3FEEA 2OOTA 3S9LA 5IB9A 3FECA 4C85A 1Y9ZA 4TJVA 3S9NA 4JZ0A 4P4JA 3FF3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SJF A;  4NGM A;  3BXM A;  4NGT A;  1WVM A;  4CDK A;  2XEJ A;  3IIB A;  3I6S A;  4OME A;  4OC3 A;  4TWE A;  1DE4 C;  2CIJ A;  4C8F A;  3D7D A;  2EK9 A;  3I74 A;  4JYW A;  4C8A A;  4OC1 A;  4OC5 A;  4NGN A;  3EIF A;  2C6P A;  4C8P A;  4MCR A;  2PVV A;  4P4E A;  4KNG E;  4TJX A;  3VTA A;  4OC4 A;  4P45 A;  4MCP A;  4P4F A;  4C8T A;  4NGS A;  4C8C A;  2JBJ A;  3ICU A;  2PVW A;  4C8U A;  4NGP A;  4C9V A;  2JBK A;  4NGQ A;  5F09 A;  4C9A A;  4C84 A;  4P44 A;  1V6C A;  3BHX A;  2XEF A;  5ELY A;  4LQG A;  4C9E A;  3KAS A;  4C86 A;  4MCS A;  1Z8L A;  4MCQ A;  2EK8 A;  2OR4 A;  3FED A;  3S9M A;  4P4I A;  4CDJ A;  4P4D A;  3BI0 A;  3SJG A;  2XEI A;  3D7H A;  2XEG A;  5D29 A;  3IWW A;  3BI1 A;  4NGR A;  3D7F A;  3SJX A;  4OC0 A;  3RBU A;  4C99 A;  4YN3 A;  3D7G A;  3SJE A;  4C9R A;  4X3R A;  4W9Y A;  2C6G A;  2C6C A;  4OC2 A;  4P4B A;  4C9U A;  1CX8 A;  1XF1 A;  3FEE A;  2OOT A;  3S9L A;  5IB9 A;  3FEC A;  4C85 A;  1Y9Z A;  4TJV A;  3S9N A;  4JZ0 A;  4P4J A;  3FF3 A; 
#chains in the Genus database with same CATH topology
 3SJF A;  4NGM A;  3BXM A;  3TLG B;  1C30 B;  4NGT A;  2EZC A;  4INJ A;  1WVM A;  4CDK A;  2XEJ A;  1M6V B;  3IIB A;  4E94 A;  3T0T A;  3I6S A;  1Q5X A;  4IIX A;  4JVO A;  4OME A;  4OC3 A;  4TWE A;  1DE4 C;  1KC7 A;  2CIJ A;  1BXR B;  3TLY A;  3EZE A;  1GGO A;  2GP4 A;  2EZB A;  3D7D A;  4C8F A;  2EZA A;  1EZB A;  3TLB A;  2EK9 A;  3I74 A;  2AUM A;  4JYW A;  3TLE A;  1CE8 B;  4OC1 A;  4C8A A;  4OC5 A;  4NGN A;  3T05 A;  3EIF A;  2C6P A;  4MJX A;  4C8P A;  2HI6 A;  3K4I A;  4MCR A;  2PVV A;  4P4E A;  2HWG A;  4CZ1 A;  5FD8 A;  4KNG E;  4TJX A;  3VTA A;  4OC4 A;  5IR2 A;  4P45 A;  4MCP A;  3T5M A;  2R82 A;  4P4F A;  4C8T A;  3G23 A;  4NGS A;  1DIK A;  4C8C A;  1KEE B;  4H1H A;  2JBJ A;  2D0P A;  1JDB C;  3ICU A;  2PVW A;  4C8U A;  1NXJ A;  5K99 A;  4NGP A;  4C9V A;  1KBL A;  2JBK A;  4NGQ A;  1NBW A;  5F09 A;  4C9A A;  3SR3 A;  4C84 A;  2OLS A;  4P44 A;  4COG A;  2MP0 A;  1V6C A;  3BHX A;  2XEF A;  5ELY A;  4LQG A;  3U1B A;  2E28 A;  4C9E A;  1EZA A;  3KAS A;  4C86 A;  3K9T A;  2D0O A;  4J0N A;  4MCS A;  4COB A;  2DIK A;  3NOJ A;  1Z8L A;  4MCQ A;  2EK8 A;  2C5Q A;  2OR4 A;  4CO9 A;  1J3L A;  4EYS A;  3FED A;  4IIY A;  3S9M A;  4P4I A;  4CDJ A;  4P4D A;  5F5X A;  1VBG A;  3BI0 A;  3SJG A;  2XEI A;  3D7H A;  1CS0 B;  2XEG A;  5D29 A;  3IWW A;  1C3O B;  2YJT A;  3TLG A;  3GJZ A;  1R61 A;  3BI1 A;  3EZB A;  4NGR A;  4MI1 A;  3EZA A;  3D7F A;  5F1Y A;  1ZYM A;  1A9X B;  3SJX A;  4OC0 A;  3RBU A;  3T07 A;  4C99 A;  4YN3 A;  1JDE A;  5JVL A;  3D7G A;  3SJE A;  1T36 B;  4C9R A;  4X3R A;  3TLC A;  2B0A A;  4W9Y A;  1ZRS A;  2C6C A;  2C6G A;  1VBH A;  4OC2 A;  4P4B A;  3TYX A;  4C9U A;  4E5S A;  2FM4 A;  1CX8 A;  3TLZ A;  2HRO A;  5JYB A;  1XF1 A;  3C8O A;  5F9M A;  3FEE A;  2OOT A;  1ZL0 A;  2X0S A;  3TLA A;  3S9L A;  2YJV A;  5IB9 A;  3FEC A;  4C85 A;  1Y9Z A;  1VI4 A;  4TJV A;  4M8D A;  3S9N A;  4JZ0 A;  2AUN A;  2PCN A;  3KRV A;  4P4J A;  3FF3 A; 
#chains in the Genus database with same CATH homology
 3SJF A;  4NGM A;  3BXM A;  4NGT A;  1WVM A;  4CDK A;  2XEJ A;  3IIB A;  3I6S A;  4OME A;  4OC3 A;  4TWE A;  1DE4 C;  2CIJ A;  2GP4 A;  4C8F A;  3D7D A;  2EK9 A;  3I74 A;  4JYW A;  4C8A A;  4OC1 A;  4OC5 A;  4NGN A;  3EIF A;  2C6P A;  4C8P A;  4MCR A;  2PVV A;  4P4E A;  4KNG E;  4TJX A;  3VTA A;  4OC4 A;  5IR2 A;  4P45 A;  4MCP A;  4P4F A;  4C8T A;  4NGS A;  4C8C A;  2JBJ A;  3ICU A;  2PVW A;  4C8U A;  4NGP A;  4C9V A;  2JBK A;  4NGQ A;  5F09 A;  4C9A A;  4C84 A;  4P44 A;  1V6C A;  3BHX A;  2XEF A;  5ELY A;  4LQG A;  4C9E A;  3KAS A;  4C86 A;  3K9T A;  4MCS A;  1Z8L A;  4MCQ A;  2EK8 A;  2C5Q A;  2OR4 A;  3FED A;  3S9M A;  4P4I A;  4CDJ A;  4P4D A;  3BI0 A;  3SJG A;  2XEI A;  3D7H A;  2XEG A;  5D29 A;  3IWW A;  3BI1 A;  4NGR A;  3D7F A;  3SJX A;  4OC0 A;  3RBU A;  4C99 A;  4YN3 A;  3D7G A;  3SJE A;  4C9R A;  4X3R A;  4W9Y A;  2C6G A;  2C6C A;  4OC2 A;  4P4B A;  4C9U A;  1CX8 A;  1XF1 A;  3FEE A;  2OOT A;  3S9L A;  5IB9 A;  3FEC A;  4C85 A;  1Y9Z A;  4TJV A;  3S9N A;  4JZ0 A;  4P4J A;  3FF3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...