4C8TA

Xenopus znrf3 ectodomain crystal form i
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
152
structure length
146
Chain Sequence
ETAFVEVVLFESSPNGDYKTHTTELQGRFSRAGATISAEGEIVQMHPLGLCDLYEYGWVGVVKLEQPEMDPKPCLTVLGKAKRAVQRGATAVIFDVSDNPDAVEQLNQGLEDPLKRPVVYMKGMDAIKLMNIVNKQKGARARIQHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
publication title Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb
source organism Xenopus (silurana) tropicalis
molecule tags Ligase
total genus 33
structure length 146
sequence length 152
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4c8tA00
4JYWA 4NGMA 1Y9ZA 1Z8LA 3D7GA 4TJVA 3D7FA 4JZ0A 3FECA 3IIBA 4C99A 4MCRA 4C9UA 2OR4A 3SJXA 4C85A 4C8CA 3FF3A 4TJXA 3BI0A 4C8TA 4KNGE 3SJFA 5ELYA 2XEIA 2C6PA 4P45A 4MCQA 2XEGA 3SJEA 2JBJA 2C6GA 4MCSA 4NGSA 4X3RA 4NGNA 3D7HA 4C84A 1V6CA 4LQGA 4YN3A 3S9LA 1DE4C 3I6SA 3S9MA 2XEJA 1WVMA 2PVVA 4OC2A 4P44A 3VTAA 4C9AA 2C6CA 3FEEA 1XF1A 3BXMA 1CX8A 4W9YA 4P4BA 4MCPA 4OC5A 4OMEA 4TWEA 3IWWA 3KASA 2CIJA 4CDKA 4C9VA 4P4IA 5IB9A 4OC4A 3EIFA 4P4FA 4NGPA 4C9RA 4CDJA 4OC0A 4C8AA 5D29A 3FEDA 4C8UA 2EK9A 3D7DA 3I74A 2PVWA 4NGRA 4C8PA 4NGTA 4C8FA 4OC1A 2EK8A 2JBKA 3SJGA 4OC3A 3RBUA 3BHXA 3BI1A 4P4DA 4C86A 4NGQA 4P4JA 4P4EA 2XEFA 3S9NA 2OOTA 4C9EA 5F09A 3ICUA
chains in the Genus database with same CATH superfamily
4CO9A 4JYWA 4NGMA 1Y9ZA 1Z8LA 2YJTA 2AUMA 3D7GA 2GP4A 4TJVA 3D7FA 4JZ0A 3FECA 3IIBA 1ZRSA 2PCNA 3K4IA 4JVOA 4C99A 1CE8B 5F9MA 1M6VB 4MCRA 4C9UA 2OR4A 3SJXA 4C85A 4C8CA 3FF3A 3EZAA 4TJXA 4INJA 3BI0A 1T36B 3T0TA 5JVLA 4CZ1A 4C8TA 4E94A 4KNGE 2DIKA 4J0NA 3NOJA 4M8DA 1C30B 3T07A 2FM4A 2EZBA 3SJFA 1NXJA 5ELYA 2XEIA 3TLCA 2C6PA 1C3OB 2AUNA 4P45A 2OLSA 4MCQA 2HI6A 2XEGA 3SJEA 1NBWA 2JBJA 2HROA 3TLGA 1R61A 2C6GA 4MCSA 4MI1A 4NGSA 4X3RA 4H1HA 1JDBC 4EYSA 4COBA 4NGNA 3TLGB 3D7HA 1VI4A 4C84A 1KEEB 1V6CA 4LQGA 4YN3A 3TLAA 1CS0B 3S9LA 1J3LA 1DE4C 3I6SA 5IR2A 3S9MA 2XEJA 1WVMA 2PVVA 4OC2A 4P44A 3VTAA 3TYXA 1KBLA 3EZEA 3EZBA 2X0SA 3TLYA 4C9AA 3GJZA 2C6CA 3TLEA 3TLBA 3FEEA 3T05A 2EZAA 5FD8A 1XF1A 1EZAA 1CX8A 1Q5XA 3BXMA 4W9YA 4P4BA 4MCPA 4OC5A 4OMEA 4MJXA 2YJVA 3K9TA 4TWEA 2HWGA 3U1BA 3IWWA 3KASA 2CIJA 2E28A 3KRVA 4IIYA 5K99A 4CDKA 2EZCA 4C9VA 2C5QA 4P4IA 5IB9A 4OC4A 1GGOA 3EIFA 4P4FA 4NGPA 4C9RA 4CDJA 4OC0A 1JDEA 4C8AA 5D29A 1BXRB 2R82A 3FEDA 4C8UA 2D0PA 2EK9A 3TLZA 3G23A 2B0AA 1KC7A 5F5XA 3D7DA 3I74A 3SR3A 2PVWA 1A9XB 4NGRA 3T5MA 4C8PA 5JYBA 4NGTA 1VBHA 1ZL0A 4C8FA 1ZYMA 4OC1A 1EZBA 1VBGA 5F1YA 2EK8A 4IIXA 4COGA 2JBKA 3SJGA 2D0OA 4OC3A 4E5SA 3RBUA 3BHXA 3BI1A 4P4DA 4C86A 2MP0A 4NGQA 4P4JA 4P4EA 2XEFA 3S9NA 2OOTA 4C9EA 1DIKA 3C8OA 5F09A 3ICUA
chains in the Genus database with same CATH topology
4JYWA 4NGMA 1Y9ZA 1Z8LA 3D7GA 4TJVA 2GP4A 3D7FA 4JZ0A 3FECA 3IIBA 4C99A 4MCRA 4C9UA 2OR4A 3SJXA 4C85A 4C8CA 3FF3A 4TJXA 3BI0A 4C8TA 4KNGE 3SJFA 5ELYA 2XEIA 2C6PA 4P45A 4MCQA 2XEGA 3SJEA 2JBJA 2C6GA 4MCSA 4NGSA 4X3RA 4NGNA 3D7HA 4C84A 1V6CA 4LQGA 4YN3A 3S9LA 1DE4C 3I6SA 5IR2A 3S9MA 2XEJA 1WVMA 2PVVA 4OC2A 4P44A 3VTAA 4C9AA 2C6CA 3FEEA 1XF1A 3BXMA 1CX8A 4W9YA 4P4BA 4MCPA 4OC5A 4OMEA 3K9TA 4TWEA 3IWWA 3KASA 2CIJA 4CDKA 4C9VA 2C5QA 4P4IA 5IB9A 4OC4A 3EIFA 4P4FA 4NGPA 4C9RA 4CDJA 4OC0A 4C8AA 5D29A 3FEDA 4C8UA 2EK9A 3D7DA 3I74A 2PVWA 4NGRA 4C8PA 4NGTA 4C8FA 4OC1A 2EK8A 2JBKA 3SJGA 4OC3A 3RBUA 3BHXA 3BI1A 4P4DA 4C86A 4NGQA 4P4JA 4P4EA 2XEFA 3S9NA 2OOTA 4C9EA 5F09A 3ICUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JYW A;  4NGM A;  1Y9Z A;  1Z8L A;  3D7G A;  4TJV A;  3D7F A;  4JZ0 A;  3FEC A;  3IIB A;  4C99 A;  4MCR A;  4C9U A;  2OR4 A;  3SJX A;  4C85 A;  4C8C A;  3FF3 A;  4TJX A;  3BI0 A;  4C8T A;  4KNG E;  3SJF A;  5ELY A;  2XEI A;  2C6P A;  4P45 A;  4MCQ A;  2XEG A;  3SJE A;  2JBJ A;  2C6G A;  4MCS A;  4NGS A;  4X3R A;  4NGN A;  3D7H A;  4C84 A;  1V6C A;  4LQG A;  4YN3 A;  3S9L A;  1DE4 C;  3I6S A;  3S9M A;  2XEJ A;  1WVM A;  2PVV A;  4OC2 A;  4P44 A;  3VTA A;  4C9A A;  2C6C A;  3FEE A;  1XF1 A;  3BXM A;  1CX8 A;  4W9Y A;  4P4B A;  4MCP A;  4OC5 A;  4OME A;  4TWE A;  3IWW A;  3KAS A;  2CIJ A;  4CDK A;  4C9V A;  4P4I A;  5IB9 A;  4OC4 A;  3EIF A;  4P4F A;  4NGP A;  4C9R A;  4CDJ A;  4OC0 A;  4C8A A;  5D29 A;  3FED A;  4C8U A;  2EK9 A;  3D7D A;  3I74 A;  2PVW A;  4NGR A;  4C8P A;  4NGT A;  4C8F A;  4OC1 A;  2EK8 A;  2JBK A;  3SJG A;  4OC3 A;  3RBU A;  3BHX A;  3BI1 A;  4P4D A;  4C86 A;  4NGQ A;  4P4J A;  4P4E A;  2XEF A;  3S9N A;  2OOT A;  4C9E A;  5F09 A;  3ICU A; 
#chains in the Genus database with same CATH topology
 4CO9 A;  4JYW A;  4NGM A;  1Y9Z A;  1Z8L A;  2YJT A;  2AUM A;  3D7G A;  2GP4 A;  4TJV A;  3D7F A;  4JZ0 A;  3FEC A;  3IIB A;  1ZRS A;  2PCN A;  3K4I A;  4JVO A;  4C99 A;  1CE8 B;  5F9M A;  1M6V B;  4MCR A;  4C9U A;  2OR4 A;  3SJX A;  4C85 A;  4C8C A;  3FF3 A;  3EZA A;  4TJX A;  4INJ A;  3BI0 A;  1T36 B;  3T0T A;  5JVL A;  4CZ1 A;  4C8T A;  4E94 A;  4KNG E;  2DIK A;  4J0N A;  3NOJ A;  4M8D A;  1C30 B;  3T07 A;  2FM4 A;  2EZB A;  3SJF A;  1NXJ A;  5ELY A;  2XEI A;  3TLC A;  2C6P A;  1C3O B;  2AUN A;  4P45 A;  2OLS A;  4MCQ A;  2HI6 A;  2XEG A;  3SJE A;  1NBW A;  2JBJ A;  2HRO A;  3TLG A;  1R61 A;  2C6G A;  4MCS A;  4MI1 A;  4NGS A;  4X3R A;  4H1H A;  1JDB C;  4EYS A;  4COB A;  4NGN A;  3TLG B;  3D7H A;  1VI4 A;  4C84 A;  1KEE B;  1V6C A;  4LQG A;  4YN3 A;  3TLA A;  1CS0 B;  3S9L A;  1J3L A;  1DE4 C;  3I6S A;  5IR2 A;  3S9M A;  2XEJ A;  1WVM A;  2PVV A;  4OC2 A;  4P44 A;  3VTA A;  3TYX A;  1KBL A;  3EZE A;  3EZB A;  2X0S A;  3TLY A;  4C9A A;  3GJZ A;  2C6C A;  3TLE A;  3TLB A;  3FEE A;  3T05 A;  2EZA A;  5FD8 A;  1XF1 A;  1EZA A;  1CX8 A;  1Q5X A;  3BXM A;  4W9Y A;  4P4B A;  4MCP A;  4OC5 A;  4OME A;  4MJX A;  2YJV A;  3K9T A;  4TWE A;  2HWG A;  3U1B A;  3IWW A;  3KAS A;  2CIJ A;  2E28 A;  3KRV A;  4IIY A;  5K99 A;  4CDK A;  2EZC A;  4C9V A;  2C5Q A;  4P4I A;  5IB9 A;  4OC4 A;  1GGO A;  3EIF A;  4P4F A;  4NGP A;  4C9R A;  4CDJ A;  4OC0 A;  1JDE A;  4C8A A;  5D29 A;  1BXR B;  2R82 A;  3FED A;  4C8U A;  2D0P A;  2EK9 A;  3TLZ A;  3G23 A;  2B0A A;  1KC7 A;  5F5X A;  3D7D A;  3I74 A;  3SR3 A;  2PVW A;  1A9X B;  4NGR A;  3T5M A;  4C8P A;  5JYB A;  4NGT A;  1VBH A;  1ZL0 A;  4C8F A;  1ZYM A;  4OC1 A;  1EZB A;  1VBG A;  5F1Y A;  2EK8 A;  4IIX A;  4COG A;  2JBK A;  3SJG A;  2D0O A;  4OC3 A;  4E5S A;  3RBU A;  3BHX A;  3BI1 A;  4P4D A;  4C86 A;  2MP0 A;  4NGQ A;  4P4J A;  4P4E A;  2XEF A;  3S9N A;  2OOT A;  4C9E A;  1DIK A;  3C8O A;  5F09 A;  3ICU A; 
#chains in the Genus database with same CATH homology
 4JYW A;  4NGM A;  1Y9Z A;  1Z8L A;  3D7G A;  4TJV A;  2GP4 A;  3D7F A;  4JZ0 A;  3FEC A;  3IIB A;  4C99 A;  4MCR A;  4C9U A;  2OR4 A;  3SJX A;  4C85 A;  4C8C A;  3FF3 A;  4TJX A;  3BI0 A;  4C8T A;  4KNG E;  3SJF A;  5ELY A;  2XEI A;  2C6P A;  4P45 A;  4MCQ A;  2XEG A;  3SJE A;  2JBJ A;  2C6G A;  4MCS A;  4NGS A;  4X3R A;  4NGN A;  3D7H A;  4C84 A;  1V6C A;  4LQG A;  4YN3 A;  3S9L A;  1DE4 C;  3I6S A;  5IR2 A;  3S9M A;  2XEJ A;  1WVM A;  2PVV A;  4OC2 A;  4P44 A;  3VTA A;  4C9A A;  2C6C A;  3FEE A;  1XF1 A;  3BXM A;  1CX8 A;  4W9Y A;  4P4B A;  4MCP A;  4OC5 A;  4OME A;  3K9T A;  4TWE A;  3IWW A;  3KAS A;  2CIJ A;  4CDK A;  4C9V A;  2C5Q A;  4P4I A;  5IB9 A;  4OC4 A;  3EIF A;  4P4F A;  4NGP A;  4C9R A;  4CDJ A;  4OC0 A;  4C8A A;  5D29 A;  3FED A;  4C8U A;  2EK9 A;  3D7D A;  3I74 A;  2PVW A;  4NGR A;  4C8P A;  4NGT A;  4C8F A;  4OC1 A;  2EK8 A;  2JBK A;  3SJG A;  4OC3 A;  3RBU A;  3BHX A;  3BI1 A;  4P4D A;  4C86 A;  4NGQ A;  4P4J A;  4P4E A;  2XEF A;  3S9N A;  2OOT A;  4C9E A;  5F09 A;  3ICU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...