4C8TA

Xenopus znrf3 ectodomain crystal form i
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
152
structure length
146
Chain Sequence
ETAFVEVVLFESSPNGDYKTHTTELQGRFSRAGATISAEGEIVQMHPLGLCDLYEYGWVGVVKLEQPEMDPKPCLTVLGKAKRAVQRGATAVIFDVSDNPDAVEQLNQGLEDPLKRPVVYMKGMDAIKLMNIVNKQKGARARIQHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
publication title Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb
source organism Xenopus (silurana) tropicalis
molecule tags Ligase
total genus 33
structure length 146
sequence length 152
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4c8tA00
1XF1A 4NGTA 3FECA 4KNGE 2PVWA 4NGQA 4P44A 4P4JA 3IWWA 4C8AA 4TJVA 5IB9A 4P4FA 2C6GA 3SJEA 4P4IA 3EIFA 3FEDA 3IIBA 2PVVA 4C8TA 4C99A 4C9UA 2XEFA 3BI1A 4NGSA 4W9YA 4MCQA 3VTAA 4C85A 4CDJA 5F09A 2OR4A 4C8CA 5D29A 3BXMA 2EK8A 3I74A 4TWEA 1Y9ZA 1Z8LA 4OC1A 3D7DA 4C9VA 4LQGA 1V6CA 3RBUA 3BHXA 4P4DA 2CIJA 4NGMA 4MCSA 3S9MA 3D7GA 4P4BA 4C9RA 3SJGA 2XEGA 3FEEA 4C8UA 1WVMA 4JYWA 2JBJA 4TJXA 2JBKA 4CDKA 4C9EA 3I6SA 4P4EA 1CX8A 3FF3A 3BI0A 4JZ0A 4NGNA 3KASA 3D7FA 4P45A 4YN3A 4OMEA 5ELYA 4OC5A 2OOTA 3S9LA 2XEIA 4C84A 3SJFA 3D7HA 4MCRA 2C6CA 4NGRA 4C8PA 4OC4A 2C6PA 3SJXA 4C8FA 4OC2A 1DE4C 3ICUA 4MCPA 4C86A 2EK9A 4NGPA 4OC3A 3S9NA 4C9AA 4X3RA 4OC0A 2XEJA
chains in the Genus database with same CATH superfamily
1XF1A 4NGTA 3FECA 1GGOA 4KNGE 3U1BA 4M8DA 1NBWA 2AUNA 2PVWA 4NGQA 4P44A 1J3LA 4H1HA 4P4JA 3EZBA 3T0TA 3IWWA 4C8AA 4TJVA 4COBA 5IB9A 1VI4A 2AUMA 3KRVA 4P4FA 2C6GA 4EYSA 3SJEA 1KC7A 4P4IA 2EZAA 2X0SA 1M6VB 2HI6A 3EIFA 3FEDA 3EZAA 4E5SA 3IIBA 2PVVA 4C8TA 3TLBA 4C99A 3TLCA 3T5MA 2XEFA 4C9UA 1VBGA 3BI1A 2D0PA 3K4IA 4INJA 2PCNA 4COGA 2R82A 4NGSA 4W9YA 4MCQA 3VTAA 1KEEB 4C85A 4CDJA 4JVOA 5F09A 3NOJA 4MJXA 2OR4A 3TLGA 4C8CA 4IIXA 3EZEA 5D29A 3BXMA 2EK8A 3GJZA 1KBLA 3I74A 4TWEA 1Y9ZA 1Z8LA 4MI1A 2B0AA 5IR2A 4OC1A 3TLYA 3D7DA 1NXJA 1C30B 1JDBC 2MP0A 4C9VA 4LQGA 1V6CA 1ZRSA 3RBUA 3BHXA 4P4DA 1DIKA 3T07A 3T05A 5F1YA 2E28A 2GP4A 2CIJA 4NGMA 3TLAA 2EZCA 4MCSA 3S9MA 4CZ1A 3D7GA 1CS0B 4P4BA 4C9RA 5FD8A 2XEGA 3FEEA 3SJGA 4C8UA 3K9TA 1ZL0A 1WVMA 2YJTA 1JDEA 4JYWA 1ZYMA 2JBJA 1A9XB 4TJXA 4IIYA 2HROA 2C5QA 1Q5XA 2D0OA 1CE8B 2JBKA 4CDKA 4C9EA 3SR3A 3I6SA 4P4EA 3G23A 1CX8A 3C8OA 3BI0A 3FF3A 2HWGA 4JZ0A 4NGNA 1EZAA 1T36B 3KASA 2DIKA 5K99A 3D7FA 4P45A 4YN3A 4CO9A 1EZBA 2FM4A 4OMEA 5ELYA 4J0NA 4OC5A 2OOTA 3TLZA 3TYXA 3S9LA 2XEIA 4C84A 3SJFA 3D7HA 4MCRA 1C3OB 5F9MA 2C6CA 5JYBA 4NGRA 4C8PA 1R61A 4OC4A 2C6PA 3SJXA 4C8FA 3TLEA 4OC2A 1DE4C 3ICUA 4MCPA 5JVLA 5F5XA 4C86A 3TLGB 2EK9A 2YJVA 2OLSA 4E94A 4NGPA 4OC3A 1BXRB 3S9NA 4C9AA 4X3RA 4OC0A 2EZBA 2XEJA 1VBHA
chains in the Genus database with same CATH topology
1XF1A 4NGTA 3FECA 4KNGE 2PVWA 4NGQA 4P44A 4P4JA 3IWWA 4C8AA 4TJVA 5IB9A 4P4FA 2C6GA 3SJEA 4P4IA 3EIFA 3FEDA 3IIBA 2PVVA 4C8TA 4C99A 4C9UA 2XEFA 3BI1A 4NGSA 4W9YA 4MCQA 3VTAA 4C85A 4CDJA 5F09A 2OR4A 4C8CA 5D29A 3BXMA 2EK8A 3I74A 4TWEA 1Y9ZA 1Z8LA 5IR2A 4OC1A 3D7DA 4C9VA 4LQGA 1V6CA 3RBUA 3BHXA 4P4DA 2GP4A 2CIJA 4NGMA 4MCSA 3S9MA 3D7GA 4P4BA 4C9RA 3SJGA 2XEGA 3FEEA 4C8UA 3K9TA 1WVMA 4JYWA 2JBJA 4TJXA 2C5QA 2JBKA 4CDKA 4C9EA 3I6SA 4P4EA 1CX8A 3FF3A 3BI0A 4JZ0A 4NGNA 3KASA 3D7FA 4P45A 4YN3A 4OMEA 5ELYA 4OC5A 2OOTA 3S9LA 2XEIA 4C84A 3SJFA 3D7HA 4MCRA 2C6CA 4NGRA 4C8PA 4OC4A 2C6PA 3SJXA 4C8FA 4OC2A 1DE4C 3ICUA 4MCPA 4C86A 2EK9A 4NGPA 4OC3A 3S9NA 4C9AA 4X3RA 4OC0A 2XEJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XF1 A;  4NGT A;  3FEC A;  4KNG E;  2PVW A;  4NGQ A;  4P44 A;  4P4J A;  3IWW A;  4C8A A;  4TJV A;  5IB9 A;  4P4F A;  2C6G A;  3SJE A;  4P4I A;  3EIF A;  3FED A;  3IIB A;  2PVV A;  4C8T A;  4C99 A;  4C9U A;  2XEF A;  3BI1 A;  4NGS A;  4W9Y A;  4MCQ A;  3VTA A;  4C85 A;  4CDJ A;  5F09 A;  2OR4 A;  4C8C A;  5D29 A;  3BXM A;  2EK8 A;  3I74 A;  4TWE A;  1Y9Z A;  1Z8L A;  4OC1 A;  3D7D A;  4C9V A;  4LQG A;  1V6C A;  3RBU A;  3BHX A;  4P4D A;  2CIJ A;  4NGM A;  4MCS A;  3S9M A;  3D7G A;  4P4B A;  4C9R A;  3SJG A;  2XEG A;  3FEE A;  4C8U A;  1WVM A;  4JYW A;  2JBJ A;  4TJX A;  2JBK A;  4CDK A;  4C9E A;  3I6S A;  4P4E A;  1CX8 A;  3FF3 A;  3BI0 A;  4JZ0 A;  4NGN A;  3KAS A;  3D7F A;  4P45 A;  4YN3 A;  4OME A;  5ELY A;  4OC5 A;  2OOT A;  3S9L A;  2XEI A;  4C84 A;  3SJF A;  3D7H A;  4MCR A;  2C6C A;  4NGR A;  4C8P A;  4OC4 A;  2C6P A;  3SJX A;  4C8F A;  4OC2 A;  1DE4 C;  3ICU A;  4MCP A;  4C86 A;  2EK9 A;  4NGP A;  4OC3 A;  3S9N A;  4C9A A;  4X3R A;  4OC0 A;  2XEJ A; 
#chains in the Genus database with same CATH topology
 1XF1 A;  4NGT A;  3FEC A;  1GGO A;  4KNG E;  3U1B A;  4M8D A;  1NBW A;  2AUN A;  2PVW A;  4NGQ A;  4P44 A;  1J3L A;  4H1H A;  4P4J A;  3EZB A;  3T0T A;  3IWW A;  4C8A A;  4TJV A;  4COB A;  5IB9 A;  1VI4 A;  2AUM A;  3KRV A;  4P4F A;  2C6G A;  4EYS A;  3SJE A;  1KC7 A;  4P4I A;  2EZA A;  2X0S A;  1M6V B;  2HI6 A;  3EIF A;  3FED A;  3EZA A;  4E5S A;  3IIB A;  2PVV A;  4C8T A;  3TLB A;  4C99 A;  3TLC A;  3T5M A;  2XEF A;  4C9U A;  1VBG A;  3BI1 A;  2D0P A;  3K4I A;  4INJ A;  2PCN A;  4COG A;  2R82 A;  4NGS A;  4W9Y A;  4MCQ A;  3VTA A;  1KEE B;  4C85 A;  4CDJ A;  4JVO A;  5F09 A;  3NOJ A;  4MJX A;  2OR4 A;  3TLG A;  4C8C A;  4IIX A;  3EZE A;  5D29 A;  3BXM A;  2EK8 A;  3GJZ A;  1KBL A;  3I74 A;  4TWE A;  1Y9Z A;  1Z8L A;  4MI1 A;  2B0A A;  5IR2 A;  4OC1 A;  3TLY A;  3D7D A;  1NXJ A;  1C30 B;  1JDB C;  2MP0 A;  4C9V A;  4LQG A;  1V6C A;  1ZRS A;  3RBU A;  3BHX A;  4P4D A;  1DIK A;  3T07 A;  3T05 A;  5F1Y A;  2E28 A;  2GP4 A;  2CIJ A;  4NGM A;  3TLA A;  2EZC A;  4MCS A;  3S9M A;  4CZ1 A;  3D7G A;  1CS0 B;  4P4B A;  4C9R A;  5FD8 A;  2XEG A;  3FEE A;  3SJG A;  4C8U A;  3K9T A;  1ZL0 A;  1WVM A;  2YJT A;  1JDE A;  4JYW A;  1ZYM A;  2JBJ A;  1A9X B;  4TJX A;  4IIY A;  2HRO A;  2C5Q A;  1Q5X A;  2D0O A;  1CE8 B;  2JBK A;  4CDK A;  4C9E A;  3SR3 A;  3I6S A;  4P4E A;  3G23 A;  1CX8 A;  3C8O A;  3BI0 A;  3FF3 A;  2HWG A;  4JZ0 A;  4NGN A;  1EZA A;  1T36 B;  3KAS A;  2DIK A;  5K99 A;  3D7F A;  4P45 A;  4YN3 A;  4CO9 A;  1EZB A;  2FM4 A;  4OME A;  5ELY A;  4J0N A;  4OC5 A;  2OOT A;  3TLZ A;  3TYX A;  3S9L A;  2XEI A;  4C84 A;  3SJF A;  3D7H A;  4MCR A;  1C3O B;  5F9M A;  2C6C A;  5JYB A;  4NGR A;  4C8P A;  1R61 A;  4OC4 A;  2C6P A;  3SJX A;  4C8F A;  3TLE A;  4OC2 A;  1DE4 C;  3ICU A;  4MCP A;  5JVL A;  5F5X A;  4C86 A;  3TLG B;  2EK9 A;  2YJV A;  2OLS A;  4E94 A;  4NGP A;  4OC3 A;  1BXR B;  3S9N A;  4C9A A;  4X3R A;  4OC0 A;  2EZB A;  2XEJ A;  1VBH A; 
#chains in the Genus database with same CATH homology
 1XF1 A;  4NGT A;  3FEC A;  4KNG E;  2PVW A;  4NGQ A;  4P44 A;  4P4J A;  3IWW A;  4C8A A;  4TJV A;  5IB9 A;  4P4F A;  2C6G A;  3SJE A;  4P4I A;  3EIF A;  3FED A;  3IIB A;  2PVV A;  4C8T A;  4C99 A;  4C9U A;  2XEF A;  3BI1 A;  4NGS A;  4W9Y A;  4MCQ A;  3VTA A;  4C85 A;  4CDJ A;  5F09 A;  2OR4 A;  4C8C A;  5D29 A;  3BXM A;  2EK8 A;  3I74 A;  4TWE A;  1Y9Z A;  1Z8L A;  5IR2 A;  4OC1 A;  3D7D A;  4C9V A;  4LQG A;  1V6C A;  3RBU A;  3BHX A;  4P4D A;  2GP4 A;  2CIJ A;  4NGM A;  4MCS A;  3S9M A;  3D7G A;  4P4B A;  4C9R A;  3SJG A;  2XEG A;  3FEE A;  4C8U A;  3K9T A;  1WVM A;  4JYW A;  2JBJ A;  4TJX A;  2C5Q A;  2JBK A;  4CDK A;  4C9E A;  3I6S A;  4P4E A;  1CX8 A;  3FF3 A;  3BI0 A;  4JZ0 A;  4NGN A;  3KAS A;  3D7F A;  4P45 A;  4YN3 A;  4OME A;  5ELY A;  4OC5 A;  2OOT A;  3S9L A;  2XEI A;  4C84 A;  3SJF A;  3D7H A;  4MCR A;  2C6C A;  4NGR A;  4C8P A;  4OC4 A;  2C6P A;  3SJX A;  4C8F A;  4OC2 A;  1DE4 C;  3ICU A;  4MCP A;  4C86 A;  2EK9 A;  4NGP A;  4OC3 A;  3S9N A;  4C9A A;  4X3R A;  4OC0 A;  2XEJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...