4C8CA

Mouse znrf3 ectodomain crystal form iii
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
151
structure length
146
Chain Sequence
ETAFVEVVLFESSPSGDYTTHTTGLTGRFSRAGAMLSAEGEIVQMHPLGLCEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
publication title Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
total genus 37
structure length 146
sequence length 151
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4c8cA00
3I6SA 4C8FA 4NGNA 4C85A 3BHXA 1V6CA 4C84A 2C6CA 2XEFA 4OC4A 4MCSA 3I74A 2EK8A 4TJVA 1CX8A 3EIFA 4C99A 3D7DA 4OC3A 1WVMA 4P44A 3VTAA 3S9LA 2OR4A 4C8CA 4C9RA 1DE4C 4LQGA 4C8AA 3SJFA 4NGMA 4C8UA 4P4FA 3SJXA 4MCQA 4P4EA 2JBKA 3IIBA 4JZ0A 4NGSA 4OC1A 1Z8LA 4P4IA 4OC5A 3S9NA 3BXMA 3D7GA 4OC2A 4CDKA 2CIJA 5ELYA 4P45A 3D7FA 3IWWA 3ICUA 4NGRA 4P4BA 2XEIA 4NGTA 4C9AA 4KNGE 2OOTA 4NGQA 4P4JA 3FF3A 3SJEA 4C9UA 4C8PA 4OC0A 2XEGA 4YN3A 1XF1A 2PVVA 4C9VA 2C6GA 3SJGA 3BI1A 3RBUA 1Y9ZA 4TWEA 2PVWA 5IB9A 4MCPA 4W9YA 4C86A 3D7HA 3FEDA 4P4DA 2EK9A 4JYWA 4MCRA 2JBJA 4OMEA 4TJXA 5F09A 2XEJA 5D29A 3FECA 4X3RA 3S9MA 4NGPA 3KASA 4C8TA 4C9EA 4CDJA 3FEEA 3BI0A 2C6PA
chains in the Genus database with same CATH superfamily
3I6SA 4C8FA 4JVOA 4NGNA 4C85A 3BHXA 4CZ1A 1VBHA 1V6CA 4E94A 4C84A 2C6CA 3K4IA 2XEFA 4OC4A 1ZRSA 2HI6A 2EZBA 4MCSA 1JDBC 1KC7A 2HROA 3I74A 1VBGA 2EK8A 3EZAA 4TJVA 1VI4A 1CX8A 2GP4A 3EIFA 4C99A 3D7DA 4H1HA 4OC3A 1WVMA 4P44A 3VTAA 3S9LA 2OR4A 4C8CA 4C9RA 1DE4C 4LQGA 3TLCA 4C8AA 3SJFA 3TYXA 4NGMA 3TLEA 4C8UA 2D0PA 1T36B 2PCNA 5JVLA 2OLSA 4P4FA 4EYSA 1ZYMA 3SJXA 2YJTA 4MCQA 4P4EA 3SR3A 2JBKA 3EZEA 4COGA 1EZBA 2D0OA 1JDEA 3IIBA 2HWGA 3TLBA 3T05A 1EZAA 4JZ0A 4NGSA 2EZAA 3TLGA 4OC1A 1A9XB 3TLZA 5K99A 1R61A 1Z8LA 4P4IA 1J3LA 5FD8A 3TLAA 4OC5A 2R82A 3TLYA 1M6VB 3BXMA 3D7GA 3S9NA 4OC2A 1BXRB 4CDKA 2CIJA 3NOJA 5ELYA 3T07A 4P45A 4MJXA 3T0TA 1KBLA 3D7FA 3IWWA 3ICUA 4NGRA 4P4BA 1CS0B 1CE8B 5F1YA 2XEIA 1GGOA 4NGTA 4C9AA 4E5SA 5JYBA 4KNGE 3K9TA 2OOTA 4NGQA 3U1BA 1NXJA 3EZBA 4P4JA 3FF3A 3SJEA 1Q5XA 4COBA 4C9UA 3T5MA 3GJZA 4OC0A 4C8PA 2XEGA 3TLGB 2MP0A 4YN3A 1XF1A 2C5QA 2PVVA 4C9VA 2C6GA 3SJGA 2AUMA 3BI1A 3RBUA 1Y9ZA 4TWEA 2EZCA 2FM4A 2PVWA 2X0SA 4IIYA 5IB9A 4MCPA 5F5XA 1C30B 3C8OA 4W9YA 1DIKA 3D7HA 3G23A 4IIXA 4MI1A 3FEDA 4P4DA 4C86A 1KEEB 2EK9A 1NBWA 2YJVA 4JYWA 4MCRA 4J0NA 2JBJA 2DIKA 4OMEA 4TJXA 5F9MA 2AUNA 3KRVA 4M8DA 5F09A 2XEJA 2B0AA 5D29A 3FECA 4X3RA 3S9MA 1C3OB 4NGPA 3KASA 1ZL0A 4CO9A 2E28A 4C8TA 5IR2A 4C9EA 4INJA 4CDJA 3FEEA 3BI0A 2C6PA
chains in the Genus database with same CATH topology
3I6SA 4C8FA 4NGNA 4C85A 3BHXA 1V6CA 4C84A 2C6CA 2XEFA 4OC4A 4MCSA 3I74A 2EK8A 4TJVA 2GP4A 1CX8A 3EIFA 4C99A 3D7DA 4OC3A 1WVMA 4P44A 3VTAA 3S9LA 2OR4A 4C8CA 4C9RA 1DE4C 4LQGA 4C8AA 3SJFA 4NGMA 4C8UA 4P4FA 3SJXA 4MCQA 4P4EA 2JBKA 3IIBA 4JZ0A 4NGSA 4OC1A 1Z8LA 4P4IA 4OC5A 3S9NA 3BXMA 3D7GA 4OC2A 4CDKA 2CIJA 5ELYA 4P45A 3D7FA 3IWWA 3ICUA 4NGRA 4P4BA 2XEIA 4NGTA 4C9AA 4KNGE 3K9TA 2OOTA 4NGQA 4P4JA 3FF3A 3SJEA 4C9UA 4C8PA 4OC0A 2XEGA 4YN3A 1XF1A 2C5QA 2PVVA 4C9VA 2C6GA 3SJGA 3BI1A 3RBUA 1Y9ZA 4TWEA 2PVWA 5IB9A 4MCPA 4W9YA 4C86A 3D7HA 3FEDA 4P4DA 2EK9A 4JYWA 4MCRA 2JBJA 4OMEA 4TJXA 5F09A 2XEJA 5D29A 3FECA 4X3RA 3S9MA 4NGPA 3KASA 4C8TA 5IR2A 4C9EA 4CDJA 3FEEA 3BI0A 2C6PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I6S A;  4C8F A;  4NGN A;  4C85 A;  3BHX A;  1V6C A;  4C84 A;  2C6C A;  2XEF A;  4OC4 A;  4MCS A;  3I74 A;  2EK8 A;  4TJV A;  1CX8 A;  3EIF A;  4C99 A;  3D7D A;  4OC3 A;  1WVM A;  4P44 A;  3VTA A;  3S9L A;  2OR4 A;  4C8C A;  4C9R A;  1DE4 C;  4LQG A;  4C8A A;  3SJF A;  4NGM A;  4C8U A;  4P4F A;  3SJX A;  4MCQ A;  4P4E A;  2JBK A;  3IIB A;  4JZ0 A;  4NGS A;  4OC1 A;  1Z8L A;  4P4I A;  4OC5 A;  3S9N A;  3BXM A;  3D7G A;  4OC2 A;  4CDK A;  2CIJ A;  5ELY A;  4P45 A;  3D7F A;  3IWW A;  3ICU A;  4NGR A;  4P4B A;  2XEI A;  4NGT A;  4C9A A;  4KNG E;  2OOT A;  4NGQ A;  4P4J A;  3FF3 A;  3SJE A;  4C9U A;  4C8P A;  4OC0 A;  2XEG A;  4YN3 A;  1XF1 A;  2PVV A;  4C9V A;  2C6G A;  3SJG A;  3BI1 A;  3RBU A;  1Y9Z A;  4TWE A;  2PVW A;  5IB9 A;  4MCP A;  4W9Y A;  4C86 A;  3D7H A;  3FED A;  4P4D A;  2EK9 A;  4JYW A;  4MCR A;  2JBJ A;  4OME A;  4TJX A;  5F09 A;  2XEJ A;  5D29 A;  3FEC A;  4X3R A;  3S9M A;  4NGP A;  3KAS A;  4C8T A;  4C9E A;  4CDJ A;  3FEE A;  3BI0 A;  2C6P A; 
#chains in the Genus database with same CATH topology
 3I6S A;  4C8F A;  4JVO A;  4NGN A;  4C85 A;  3BHX A;  4CZ1 A;  1VBH A;  1V6C A;  4E94 A;  4C84 A;  2C6C A;  3K4I A;  2XEF A;  4OC4 A;  1ZRS A;  2HI6 A;  2EZB A;  4MCS A;  1JDB C;  1KC7 A;  2HRO A;  3I74 A;  1VBG A;  2EK8 A;  3EZA A;  4TJV A;  1VI4 A;  1CX8 A;  2GP4 A;  3EIF A;  4C99 A;  3D7D A;  4H1H A;  4OC3 A;  1WVM A;  4P44 A;  3VTA A;  3S9L A;  2OR4 A;  4C8C A;  4C9R A;  1DE4 C;  4LQG A;  3TLC A;  4C8A A;  3SJF A;  3TYX A;  4NGM A;  3TLE A;  4C8U A;  2D0P A;  1T36 B;  2PCN A;  5JVL A;  2OLS A;  4P4F A;  4EYS A;  1ZYM A;  3SJX A;  2YJT A;  4MCQ A;  4P4E A;  3SR3 A;  2JBK A;  3EZE A;  4COG A;  1EZB A;  2D0O A;  1JDE A;  3IIB A;  2HWG A;  3TLB A;  3T05 A;  1EZA A;  4JZ0 A;  4NGS A;  2EZA A;  3TLG A;  4OC1 A;  1A9X B;  3TLZ A;  5K99 A;  1R61 A;  1Z8L A;  4P4I A;  1J3L A;  5FD8 A;  3TLA A;  4OC5 A;  2R82 A;  3TLY A;  1M6V B;  3BXM A;  3D7G A;  3S9N A;  4OC2 A;  1BXR B;  4CDK A;  2CIJ A;  3NOJ A;  5ELY A;  3T07 A;  4P45 A;  4MJX A;  3T0T A;  1KBL A;  3D7F A;  3IWW A;  3ICU A;  4NGR A;  4P4B A;  1CS0 B;  1CE8 B;  5F1Y A;  2XEI A;  1GGO A;  4NGT A;  4C9A A;  4E5S A;  5JYB A;  4KNG E;  3K9T A;  2OOT A;  4NGQ A;  3U1B A;  1NXJ A;  3EZB A;  4P4J A;  3FF3 A;  3SJE A;  1Q5X A;  4COB A;  4C9U A;  3T5M A;  3GJZ A;  4OC0 A;  4C8P A;  2XEG A;  3TLG B;  2MP0 A;  4YN3 A;  1XF1 A;  2C5Q A;  2PVV A;  4C9V A;  2C6G A;  3SJG A;  2AUM A;  3BI1 A;  3RBU A;  1Y9Z A;  4TWE A;  2EZC A;  2FM4 A;  2PVW A;  2X0S A;  4IIY A;  5IB9 A;  4MCP A;  5F5X A;  1C30 B;  3C8O A;  4W9Y A;  1DIK A;  3D7H A;  3G23 A;  4IIX A;  4MI1 A;  3FED A;  4P4D A;  4C86 A;  1KEE B;  2EK9 A;  1NBW A;  2YJV A;  4JYW A;  4MCR A;  4J0N A;  2JBJ A;  2DIK A;  4OME A;  4TJX A;  5F9M A;  2AUN A;  3KRV A;  4M8D A;  5F09 A;  2XEJ A;  2B0A A;  5D29 A;  3FEC A;  4X3R A;  3S9M A;  1C3O B;  4NGP A;  3KAS A;  1ZL0 A;  4CO9 A;  2E28 A;  4C8T A;  5IR2 A;  4C9E A;  4INJ A;  4CDJ A;  3FEE A;  3BI0 A;  2C6P A; 
#chains in the Genus database with same CATH homology
 3I6S A;  4C8F A;  4NGN A;  4C85 A;  3BHX A;  1V6C A;  4C84 A;  2C6C A;  2XEF A;  4OC4 A;  4MCS A;  3I74 A;  2EK8 A;  4TJV A;  2GP4 A;  1CX8 A;  3EIF A;  4C99 A;  3D7D A;  4OC3 A;  1WVM A;  4P44 A;  3VTA A;  3S9L A;  2OR4 A;  4C8C A;  4C9R A;  1DE4 C;  4LQG A;  4C8A A;  3SJF A;  4NGM A;  4C8U A;  4P4F A;  3SJX A;  4MCQ A;  4P4E A;  2JBK A;  3IIB A;  4JZ0 A;  4NGS A;  4OC1 A;  1Z8L A;  4P4I A;  4OC5 A;  3S9N A;  3BXM A;  3D7G A;  4OC2 A;  4CDK A;  2CIJ A;  5ELY A;  4P45 A;  3D7F A;  3IWW A;  3ICU A;  4NGR A;  4P4B A;  2XEI A;  4NGT A;  4C9A A;  4KNG E;  3K9T A;  2OOT A;  4NGQ A;  4P4J A;  3FF3 A;  3SJE A;  4C9U A;  4C8P A;  4OC0 A;  2XEG A;  4YN3 A;  1XF1 A;  2C5Q A;  2PVV A;  4C9V A;  2C6G A;  3SJG A;  3BI1 A;  3RBU A;  1Y9Z A;  4TWE A;  2PVW A;  5IB9 A;  4MCP A;  4W9Y A;  4C86 A;  3D7H A;  3FED A;  4P4D A;  2EK9 A;  4JYW A;  4MCR A;  2JBJ A;  4OME A;  4TJX A;  5F09 A;  2XEJ A;  5D29 A;  3FEC A;  4X3R A;  3S9M A;  4NGP A;  3KAS A;  4C8T A;  5IR2 A;  4C9E A;  4CDJ A;  3FEE A;  3BI0 A;  2C6P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...