4C8CA

Mouse znrf3 ectodomain crystal form iii
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
151
structure length
146
Chain Sequence
ETAFVEVVLFESSPSGDYTTHTTGLTGRFSRAGAMLSAEGEIVQMHPLGLCEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
total genus 37
structure length 146
sequence length 151
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4c8cA00
4C8AA 1XF1A 1V6CA 4MCRA 4W9YA 3D7GA 2CIJA 4C85A 2EK9A 4C9RA 5ELYA 1DE4C 5IB9A 5F09A 4LQGA 4C86A 4OC2A 4MCSA 4OC5A 4P44A 4P4BA 4NGRA 4X3RA 4OC4A 2EK8A 2C6GA 1CX8A 1Z8LA 3ICUA 3VTAA 3RBUA 4P4FA 3IIBA 4C8PA 4JZ0A 4NGMA 4P4JA 3FEEA 4OC3A 2XEGA 3SJGA 2PVWA 4TJXA 3S9LA 2XEIA 2C6CA 4OMEA 4MCPA 3FEDA 4P4IA 4NGPA 4P4EA 2OOTA 5D29A 4C8FA 3SJEA 4C9UA 3BI1A 1Y9ZA 4C8UA 3D7FA 4JYWA 4TJVA 3D7DA 3KASA 3EIFA 2PVVA 4NGQA 4C84A 1WVMA 4C8TA 3SJXA 3S9MA 3BXMA 2JBJA 4P4DA 3SJFA 3I6SA 3BI0A 3I74A 2JBKA 2XEJA 3FF3A 4YN3A 3FECA 4NGSA 3BHXA 4C99A 3D7HA 3S9NA 2OR4A 2C6PA 4OC1A 4NGTA 4C9VA 4OC0A 4KNGE 4C9EA 4TWEA 4C8CA 4CDJA 2XEFA 4P45A 3IWWA 4NGNA 4C9AA 4MCQA 4CDKA
chains in the Genus database with same CATH superfamily
4C8AA 1XF1A 2GP4A 1V6CA 3K9TA 4MCRA 3D7GA 4W9YA 4CO9A 4IIXA 2CIJA 4JVOA 1BXRB 4C85A 2EK9A 4C9RA 5ELYA 1DE4C 5IB9A 3EZEA 3TLZA 5F09A 2EZAA 4LQGA 1JDBC 4C86A 4OC2A 1VI4A 4MCSA 3K4IA 4OC5A 1M6VB 4P44A 1NXJA 4MI1A 4M8DA 3TLEA 3T0TA 4EYSA 2R82A 4P4BA 2EZCA 4NGRA 4X3RA 2YJVA 4MJXA 2EZBA 4OC4A 2EK8A 2C6GA 1CX8A 2OLSA 1C3OB 1Z8LA 3ICUA 3C8OA 3TLGB 3VTAA 2AUMA 3RBUA 4P4FA 1DIKA 3IIBA 2HI6A 4C8PA 4JZ0A 4NGMA 1EZBA 1C30B 3KRVA 4COGA 4CZ1A 4P4JA 3U1BA 3FEEA 4OC3A 3TLGA 2XEGA 3SJGA 2PVWA 4TJXA 1ZRSA 3S9LA 2PCNA 2XEIA 4J0NA 2E28A 2C6CA 5F9MA 4OMEA 4MCPA 4COBA 2YJTA 3FEDA 4P4IA 4NGPA 4P4EA 5FD8A 2C5QA 2OOTA 5D29A 4C8FA 3SJEA 3TYXA 4C9UA 3BI1A 1T36B 1Y9ZA 3T07A 1ZL0A 4C8UA 4E94A 3D7FA 1CE8B 4JYWA 4TJVA 3D7DA 3KASA 2X0SA 5F1YA 3EIFA 1VBHA 2PVVA 4NGQA 4C84A 2D0PA 3GJZA 4E5SA 1NBWA 2HWGA 1WVMA 4C8TA 1KC7A 2MP0A 3EZBA 3SJXA 3TLYA 3S9MA 3BXMA 1ZYMA 2JBJA 4P4DA 3SR3A 2B0AA 3SJFA 3T05A 5JYBA 3I6SA 3BI0A 3I74A 2JBKA 2HROA 2XEJA 2D0OA 3FF3A 4YN3A 2DIKA 3FECA 4IIYA 4INJA 4NGSA 1VBGA 3BHXA 3TLAA 5JVLA 5IR2A 4C99A 4H1HA 3D7HA 5F5XA 3G23A 1Q5XA 3S9NA 2OR4A 1KBLA 2AUNA 2C6PA 4OC1A 4NGTA 2FM4A 4C9VA 1GGOA 1CS0B 1JDEA 3TLBA 4OC0A 4KNGE 4C9EA 1J3LA 3TLCA 4TWEA 4C8CA 5K99A 1KEEB 3NOJA 3T5MA 2XEFA 4CDJA 1EZAA 1R61A 4P45A 3IWWA 4NGNA 1A9XB 4C9AA 4MCQA 4CDKA 3EZAA
chains in the Genus database with same CATH topology
4C8AA 1XF1A 2GP4A 1V6CA 3K9TA 4MCRA 3D7GA 4W9YA 2CIJA 4C85A 2EK9A 4C9RA 5ELYA 1DE4C 5IB9A 5F09A 4LQGA 4C86A 4OC2A 4MCSA 4OC5A 4P44A 4P4BA 4NGRA 4X3RA 4OC4A 2EK8A 2C6GA 1CX8A 1Z8LA 3ICUA 3VTAA 3RBUA 4P4FA 3IIBA 4C8PA 4JZ0A 4NGMA 4P4JA 3FEEA 4OC3A 2XEGA 3SJGA 2PVWA 4TJXA 3S9LA 2XEIA 2C6CA 4OMEA 4MCPA 3FEDA 4P4IA 4NGPA 4P4EA 2C5QA 2OOTA 5D29A 4C8FA 3SJEA 4C9UA 3BI1A 1Y9ZA 4C8UA 3D7FA 4JYWA 4TJVA 3D7DA 3KASA 3EIFA 2PVVA 4NGQA 4C84A 1WVMA 4C8TA 3SJXA 3S9MA 3BXMA 2JBJA 4P4DA 3SJFA 3I6SA 3BI0A 3I74A 2JBKA 2XEJA 3FF3A 4YN3A 3FECA 4NGSA 3BHXA 5IR2A 4C99A 3D7HA 3S9NA 2OR4A 2C6PA 4OC1A 4NGTA 4C9VA 4OC0A 4KNGE 4C9EA 4TWEA 4C8CA 4CDJA 2XEFA 4P45A 3IWWA 4NGNA 4C9AA 4MCQA 4CDKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C8A A;  1XF1 A;  1V6C A;  4MCR A;  4W9Y A;  3D7G A;  2CIJ A;  4C85 A;  2EK9 A;  4C9R A;  5ELY A;  1DE4 C;  5IB9 A;  5F09 A;  4LQG A;  4C86 A;  4OC2 A;  4MCS A;  4OC5 A;  4P44 A;  4P4B A;  4NGR A;  4X3R A;  4OC4 A;  2EK8 A;  2C6G A;  1CX8 A;  1Z8L A;  3ICU A;  3VTA A;  3RBU A;  4P4F A;  3IIB A;  4C8P A;  4JZ0 A;  4NGM A;  4P4J A;  3FEE A;  4OC3 A;  2XEG A;  3SJG A;  2PVW A;  4TJX A;  3S9L A;  2XEI A;  2C6C A;  4OME A;  4MCP A;  3FED A;  4P4I A;  4NGP A;  4P4E A;  2OOT A;  5D29 A;  4C8F A;  3SJE A;  4C9U A;  3BI1 A;  1Y9Z A;  4C8U A;  3D7F A;  4JYW A;  4TJV A;  3D7D A;  3KAS A;  3EIF A;  2PVV A;  4NGQ A;  4C84 A;  1WVM A;  4C8T A;  3SJX A;  3S9M A;  3BXM A;  2JBJ A;  4P4D A;  3SJF A;  3I6S A;  3BI0 A;  3I74 A;  2JBK A;  2XEJ A;  3FF3 A;  4YN3 A;  3FEC A;  4NGS A;  3BHX A;  4C99 A;  3D7H A;  3S9N A;  2OR4 A;  2C6P A;  4OC1 A;  4NGT A;  4C9V A;  4OC0 A;  4KNG E;  4C9E A;  4TWE A;  4C8C A;  4CDJ A;  2XEF A;  4P45 A;  3IWW A;  4NGN A;  4C9A A;  4MCQ A;  4CDK A; 
#chains in the Genus database with same CATH topology
 4C8A A;  1XF1 A;  2GP4 A;  1V6C A;  3K9T A;  4MCR A;  3D7G A;  4W9Y A;  4CO9 A;  4IIX A;  2CIJ A;  4JVO A;  1BXR B;  4C85 A;  2EK9 A;  4C9R A;  5ELY A;  1DE4 C;  5IB9 A;  3EZE A;  3TLZ A;  5F09 A;  2EZA A;  4LQG A;  1JDB C;  4C86 A;  4OC2 A;  1VI4 A;  4MCS A;  3K4I A;  4OC5 A;  1M6V B;  4P44 A;  1NXJ A;  4MI1 A;  4M8D A;  3TLE A;  3T0T A;  4EYS A;  2R82 A;  4P4B A;  2EZC A;  4NGR A;  4X3R A;  2YJV A;  4MJX A;  2EZB A;  4OC4 A;  2EK8 A;  2C6G A;  1CX8 A;  2OLS A;  1C3O B;  1Z8L A;  3ICU A;  3C8O A;  3TLG B;  3VTA A;  2AUM A;  3RBU A;  4P4F A;  1DIK A;  3IIB A;  2HI6 A;  4C8P A;  4JZ0 A;  4NGM A;  1EZB A;  1C30 B;  3KRV A;  4COG A;  4CZ1 A;  4P4J A;  3U1B A;  3FEE A;  4OC3 A;  3TLG A;  2XEG A;  3SJG A;  2PVW A;  4TJX A;  1ZRS A;  3S9L A;  2PCN A;  2XEI A;  4J0N A;  2E28 A;  2C6C A;  5F9M A;  4OME A;  4MCP A;  4COB A;  2YJT A;  3FED A;  4P4I A;  4NGP A;  4P4E A;  5FD8 A;  2C5Q A;  2OOT A;  5D29 A;  4C8F A;  3SJE A;  3TYX A;  4C9U A;  3BI1 A;  1T36 B;  1Y9Z A;  3T07 A;  1ZL0 A;  4C8U A;  4E94 A;  3D7F A;  1CE8 B;  4JYW A;  4TJV A;  3D7D A;  3KAS A;  2X0S A;  5F1Y A;  3EIF A;  1VBH A;  2PVV A;  4NGQ A;  4C84 A;  2D0P A;  3GJZ A;  4E5S A;  1NBW A;  2HWG A;  1WVM A;  4C8T A;  1KC7 A;  2MP0 A;  3EZB A;  3SJX A;  3TLY A;  3S9M A;  3BXM A;  1ZYM A;  2JBJ A;  4P4D A;  3SR3 A;  2B0A A;  3SJF A;  3T05 A;  5JYB A;  3I6S A;  3BI0 A;  3I74 A;  2JBK A;  2HRO A;  2XEJ A;  2D0O A;  3FF3 A;  4YN3 A;  2DIK A;  3FEC A;  4IIY A;  4INJ A;  4NGS A;  1VBG A;  3BHX A;  3TLA A;  5JVL A;  5IR2 A;  4C99 A;  4H1H A;  3D7H A;  5F5X A;  3G23 A;  1Q5X A;  3S9N A;  2OR4 A;  1KBL A;  2AUN A;  2C6P A;  4OC1 A;  4NGT A;  2FM4 A;  4C9V A;  1GGO A;  1CS0 B;  1JDE A;  3TLB A;  4OC0 A;  4KNG E;  4C9E A;  1J3L A;  3TLC A;  4TWE A;  4C8C A;  5K99 A;  1KEE B;  3NOJ A;  3T5M A;  2XEF A;  4CDJ A;  1EZA A;  1R61 A;  4P45 A;  3IWW A;  4NGN A;  1A9X B;  4C9A A;  4MCQ A;  4CDK A;  3EZA A; 
#chains in the Genus database with same CATH homology
 4C8A A;  1XF1 A;  2GP4 A;  1V6C A;  3K9T A;  4MCR A;  3D7G A;  4W9Y A;  2CIJ A;  4C85 A;  2EK9 A;  4C9R A;  5ELY A;  1DE4 C;  5IB9 A;  5F09 A;  4LQG A;  4C86 A;  4OC2 A;  4MCS A;  4OC5 A;  4P44 A;  4P4B A;  4NGR A;  4X3R A;  4OC4 A;  2EK8 A;  2C6G A;  1CX8 A;  1Z8L A;  3ICU A;  3VTA A;  3RBU A;  4P4F A;  3IIB A;  4C8P A;  4JZ0 A;  4NGM A;  4P4J A;  3FEE A;  4OC3 A;  2XEG A;  3SJG A;  2PVW A;  4TJX A;  3S9L A;  2XEI A;  2C6C A;  4OME A;  4MCP A;  3FED A;  4P4I A;  4NGP A;  4P4E A;  2C5Q A;  2OOT A;  5D29 A;  4C8F A;  3SJE A;  4C9U A;  3BI1 A;  1Y9Z A;  4C8U A;  3D7F A;  4JYW A;  4TJV A;  3D7D A;  3KAS A;  3EIF A;  2PVV A;  4NGQ A;  4C84 A;  1WVM A;  4C8T A;  3SJX A;  3S9M A;  3BXM A;  2JBJ A;  4P4D A;  3SJF A;  3I6S A;  3BI0 A;  3I74 A;  2JBK A;  2XEJ A;  3FF3 A;  4YN3 A;  3FEC A;  4NGS A;  3BHX A;  5IR2 A;  4C99 A;  3D7H A;  3S9N A;  2OR4 A;  2C6P A;  4OC1 A;  4NGT A;  4C9V A;  4OC0 A;  4KNG E;  4C9E A;  4TWE A;  4C8C A;  4CDJ A;  2XEF A;  4P45 A;  3IWW A;  4NGN A;  4C9A A;  4MCQ A;  4CDK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...