4C8CA

Mouse znrf3 ectodomain crystal form iii
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
151
structure length
146
Chain Sequence
ETAFVEVVLFESSPSGDYTTHTTGLTGRFSRAGAMLSAEGEIVQMHPLGLCEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
total genus 37
structure length 146
sequence length 151
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4c8cA00
4OC1A 2C6GA 4OC2A 3S9NA 2XEGA 4JZ0A 3D7HA 3RBUA 3BXMA 3BI1A 3S9MA 4KNGE 4C8PA 1V6CA 3S9LA 2OOTA 4LQGA 4CDJA 4P4IA 4P4JA 3SJEA 3EIFA 4NGQA 2XEFA 4JYWA 3FF3A 4TJVA 2C6CA 1DE4C 2JBJA 3IWWA 4NGSA 4MCQA 3SJGA 3BHXA 2OR4A 4C8CA 4C84A 3D7GA 4MCSA 4OC4A 2XEJA 3I74A 4P4BA 2PVWA 4C99A 2C6PA 4TJXA 3FECA 4CDKA 4OC3A 2EK8A 3FEDA 2PVVA 2CIJA 3BI0A 5F09A 4NGPA 3ICUA 4X3RA 3VTAA 4C85A 3SJFA 1WVMA 3IIBA 4C9EA 4P45A 4OMEA 4C8FA 4MCPA 2EK9A 5D29A 4C9UA 1Z8LA 4OC5A 3SJXA 3KASA 1Y9ZA 4P4FA 4C9AA 4C8AA 1XF1A 4NGRA 3D7FA 4P4DA 2JBKA 4NGMA 4OC0A 4P4EA 4TWEA 3FEEA 4C8UA 4P44A 3D7DA 1CX8A 4C9VA 2XEIA 4YN3A 4C86A 4C9RA 4C8TA 4W9YA 4MCRA 3I6SA 5IB9A 4NGNA 5ELYA 4NGTA
chains in the Genus database with same CATH superfamily
4OC1A 2C5QA 2C6GA 1NBWA 2D0OA 2EZBA 4M8DA 2OLSA 2YJVA 3GJZA 4OC2A 3T07A 1CE8B 3S9NA 3TLGA 3TLZA 1C30B 5K99A 2XEGA 4JZ0A 3D7HA 3RBUA 1T36B 2HI6A 3TLBA 5F5XA 2AUNA 3BXMA 3BI1A 5F9MA 3S9MA 4KNGE 4C8PA 1V6CA 3S9LA 2PCNA 1DIKA 2OOTA 4EYSA 4LQGA 1C3OB 4COGA 3TLGB 1VI4A 4CDJA 1R61A 4P4IA 2GP4A 4P4JA 5JVLA 3SJEA 2X0SA 4E94A 3EIFA 4NGQA 1KEEB 2XEFA 5F1YA 5IR2A 4JYWA 3TLEA 3KRVA 3FF3A 4TJVA 2C6CA 1EZBA 1ZRSA 1DE4C 2JBJA 3TLYA 1M6VB 1VBGA 1CS0B 3IWWA 4NGSA 4MCQA 4COBA 2HWGA 2YJTA 3NOJA 3SJGA 4INJA 3BHXA 1ZYMA 2OR4A 4C8CA 3EZAA 3D7GA 4C84A 2MP0A 4MCSA 3K9TA 4OC4A 2XEJA 3I74A 4P4BA 2PVWA 4C99A 2AUMA 2C6PA 4TJXA 4JVOA 5JYBA 3FECA 4CDKA 4OC3A 2EK8A 3FEDA 1EZAA 2E28A 2PVVA 3T05A 3EZEA 2CIJA 3BI0A 3T5MA 1KC7A 1GGOA 4H1HA 5F09A 3U1BA 3TYXA 4NGPA 4CO9A 3ICUA 4X3RA 3TLAA 1NXJA 3VTAA 4C85A 3SJFA 1KBLA 3C8OA 1ZL0A 2FM4A 1WVMA 1VBHA 3IIBA 4C9EA 2HROA 4P45A 2DIKA 3K4IA 2EK9A 2EZCA 4MCPA 2EZAA 4MI1A 4OMEA 5D29A 4C8FA 4C9UA 4J0NA 1Z8LA 1JDEA 4MJXA 4OC5A 3SJXA 3KASA 4IIYA 4E5SA 1Y9ZA 4P4FA 4C9AA 4C8AA 1XF1A 4NGRA 3D7FA 4P4DA 2JBKA 4NGMA 1JDBC 4OC0A 4P4EA 3T0TA 1J3LA 4TWEA 3FEEA 4C8UA 4P44A 4IIXA 3TLCA 3D7DA 2D0PA 1CX8A 4C9VA 2XEIA 2B0AA 2R82A 4YN3A 3SR3A 4C86A 1BXRB 1Q5XA 1A9XB 4C9RA 5FD8A 4C8TA 4CZ1A 4W9YA 4MCRA 3I6SA 3G23A 5IB9A 4NGNA 5ELYA 3EZBA 4NGTA
chains in the Genus database with same CATH topology
4OC1A 2C5QA 2C6GA 4OC2A 3S9NA 2XEGA 4JZ0A 3D7HA 3RBUA 3BXMA 3BI1A 3S9MA 4KNGE 4C8PA 1V6CA 3S9LA 2OOTA 4LQGA 4CDJA 4P4IA 2GP4A 4P4JA 3SJEA 3EIFA 4NGQA 2XEFA 5IR2A 4JYWA 3FF3A 4TJVA 2C6CA 1DE4C 2JBJA 3IWWA 4NGSA 4MCQA 3SJGA 3BHXA 2OR4A 4C8CA 4C84A 3D7GA 4MCSA 3K9TA 4OC4A 2XEJA 3I74A 4P4BA 2PVWA 4C99A 2C6PA 4TJXA 3FECA 4CDKA 4OC3A 2EK8A 3FEDA 2PVVA 2CIJA 3BI0A 5F09A 4NGPA 3ICUA 4X3RA 3VTAA 4C85A 3SJFA 1WVMA 3IIBA 4C9EA 4P45A 4OMEA 4C8FA 4MCPA 2EK9A 5D29A 4C9UA 1Z8LA 4OC5A 3SJXA 3KASA 1Y9ZA 4P4FA 4C9AA 4C8AA 1XF1A 4NGRA 3D7FA 4P4DA 2JBKA 4NGMA 4OC0A 4P4EA 4TWEA 3FEEA 4C8UA 4P44A 3D7DA 1CX8A 4C9VA 2XEIA 4YN3A 4C86A 4C9RA 4C8TA 4W9YA 4MCRA 3I6SA 5IB9A 4NGNA 5ELYA 4NGTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OC1 A;  2C6G A;  4OC2 A;  3S9N A;  2XEG A;  4JZ0 A;  3D7H A;  3RBU A;  3BXM A;  3BI1 A;  3S9M A;  4KNG E;  4C8P A;  1V6C A;  3S9L A;  2OOT A;  4LQG A;  4CDJ A;  4P4I A;  4P4J A;  3SJE A;  3EIF A;  4NGQ A;  2XEF A;  4JYW A;  3FF3 A;  4TJV A;  2C6C A;  1DE4 C;  2JBJ A;  3IWW A;  4NGS A;  4MCQ A;  3SJG A;  3BHX A;  2OR4 A;  4C8C A;  4C84 A;  3D7G A;  4MCS A;  4OC4 A;  2XEJ A;  3I74 A;  4P4B A;  2PVW A;  4C99 A;  2C6P A;  4TJX A;  3FEC A;  4CDK A;  4OC3 A;  2EK8 A;  3FED A;  2PVV A;  2CIJ A;  3BI0 A;  5F09 A;  4NGP A;  3ICU A;  4X3R A;  3VTA A;  4C85 A;  3SJF A;  1WVM A;  3IIB A;  4C9E A;  4P45 A;  4OME A;  4C8F A;  4MCP A;  2EK9 A;  5D29 A;  4C9U A;  1Z8L A;  4OC5 A;  3SJX A;  3KAS A;  1Y9Z A;  4P4F A;  4C9A A;  4C8A A;  1XF1 A;  4NGR A;  3D7F A;  4P4D A;  2JBK A;  4NGM A;  4OC0 A;  4P4E A;  4TWE A;  3FEE A;  4C8U A;  4P44 A;  3D7D A;  1CX8 A;  4C9V A;  2XEI A;  4YN3 A;  4C86 A;  4C9R A;  4C8T A;  4W9Y A;  4MCR A;  3I6S A;  5IB9 A;  4NGN A;  5ELY A;  4NGT A; 
#chains in the Genus database with same CATH topology
 4OC1 A;  2C5Q A;  2C6G A;  1NBW A;  2D0O A;  2EZB A;  4M8D A;  2OLS A;  2YJV A;  3GJZ A;  4OC2 A;  3T07 A;  1CE8 B;  3S9N A;  3TLG A;  3TLZ A;  1C30 B;  5K99 A;  2XEG A;  4JZ0 A;  3D7H A;  3RBU A;  1T36 B;  2HI6 A;  3TLB A;  5F5X A;  2AUN A;  3BXM A;  3BI1 A;  5F9M A;  3S9M A;  4KNG E;  4C8P A;  1V6C A;  3S9L A;  2PCN A;  1DIK A;  2OOT A;  4EYS A;  4LQG A;  1C3O B;  4COG A;  3TLG B;  1VI4 A;  4CDJ A;  1R61 A;  4P4I A;  2GP4 A;  4P4J A;  5JVL A;  3SJE A;  2X0S A;  4E94 A;  3EIF A;  4NGQ A;  1KEE B;  2XEF A;  5F1Y A;  5IR2 A;  4JYW A;  3TLE A;  3KRV A;  3FF3 A;  4TJV A;  2C6C A;  1EZB A;  1ZRS A;  1DE4 C;  2JBJ A;  3TLY A;  1M6V B;  1VBG A;  1CS0 B;  3IWW A;  4NGS A;  4MCQ A;  4COB A;  2HWG A;  2YJT A;  3NOJ A;  3SJG A;  4INJ A;  3BHX A;  1ZYM A;  2OR4 A;  4C8C A;  3EZA A;  3D7G A;  4C84 A;  2MP0 A;  4MCS A;  3K9T A;  4OC4 A;  2XEJ A;  3I74 A;  4P4B A;  2PVW A;  4C99 A;  2AUM A;  2C6P A;  4TJX A;  4JVO A;  5JYB A;  3FEC A;  4CDK A;  4OC3 A;  2EK8 A;  3FED A;  1EZA A;  2E28 A;  2PVV A;  3T05 A;  3EZE A;  2CIJ A;  3BI0 A;  3T5M A;  1KC7 A;  1GGO A;  4H1H A;  5F09 A;  3U1B A;  3TYX A;  4NGP A;  4CO9 A;  3ICU A;  4X3R A;  3TLA A;  1NXJ A;  3VTA A;  4C85 A;  3SJF A;  1KBL A;  3C8O A;  1ZL0 A;  2FM4 A;  1WVM A;  1VBH A;  3IIB A;  4C9E A;  2HRO A;  4P45 A;  2DIK A;  3K4I A;  2EK9 A;  2EZC A;  4MCP A;  2EZA A;  4MI1 A;  4OME A;  5D29 A;  4C8F A;  4C9U A;  4J0N A;  1Z8L A;  1JDE A;  4MJX A;  4OC5 A;  3SJX A;  3KAS A;  4IIY A;  4E5S A;  1Y9Z A;  4P4F A;  4C9A A;  4C8A A;  1XF1 A;  4NGR A;  3D7F A;  4P4D A;  2JBK A;  4NGM A;  1JDB C;  4OC0 A;  4P4E A;  3T0T A;  1J3L A;  4TWE A;  3FEE A;  4C8U A;  4P44 A;  4IIX A;  3TLC A;  3D7D A;  2D0P A;  1CX8 A;  4C9V A;  2XEI A;  2B0A A;  2R82 A;  4YN3 A;  3SR3 A;  4C86 A;  1BXR B;  1Q5X A;  1A9X B;  4C9R A;  5FD8 A;  4C8T A;  4CZ1 A;  4W9Y A;  4MCR A;  3I6S A;  3G23 A;  5IB9 A;  4NGN A;  5ELY A;  3EZB A;  4NGT A; 
#chains in the Genus database with same CATH homology
 4OC1 A;  2C5Q A;  2C6G A;  4OC2 A;  3S9N A;  2XEG A;  4JZ0 A;  3D7H A;  3RBU A;  3BXM A;  3BI1 A;  3S9M A;  4KNG E;  4C8P A;  1V6C A;  3S9L A;  2OOT A;  4LQG A;  4CDJ A;  4P4I A;  2GP4 A;  4P4J A;  3SJE A;  3EIF A;  4NGQ A;  2XEF A;  5IR2 A;  4JYW A;  3FF3 A;  4TJV A;  2C6C A;  1DE4 C;  2JBJ A;  3IWW A;  4NGS A;  4MCQ A;  3SJG A;  3BHX A;  2OR4 A;  4C8C A;  4C84 A;  3D7G A;  4MCS A;  3K9T A;  4OC4 A;  2XEJ A;  3I74 A;  4P4B A;  2PVW A;  4C99 A;  2C6P A;  4TJX A;  3FEC A;  4CDK A;  4OC3 A;  2EK8 A;  3FED A;  2PVV A;  2CIJ A;  3BI0 A;  5F09 A;  4NGP A;  3ICU A;  4X3R A;  3VTA A;  4C85 A;  3SJF A;  1WVM A;  3IIB A;  4C9E A;  4P45 A;  4OME A;  4C8F A;  4MCP A;  2EK9 A;  5D29 A;  4C9U A;  1Z8L A;  4OC5 A;  3SJX A;  3KAS A;  1Y9Z A;  4P4F A;  4C9A A;  4C8A A;  1XF1 A;  4NGR A;  3D7F A;  4P4D A;  2JBK A;  4NGM A;  4OC0 A;  4P4E A;  4TWE A;  3FEE A;  4C8U A;  4P44 A;  3D7D A;  1CX8 A;  4C9V A;  2XEI A;  4YN3 A;  4C86 A;  4C9R A;  4C8T A;  4W9Y A;  4MCR A;  3I6S A;  5IB9 A;  4NGN A;  5ELY A;  4NGT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...