4C8CA

Mouse znrf3 ectodomain crystal form iii
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
151
structure length
146
Chain Sequence
b'ETAFVEVVLFESSPSGDYTTHTTGLTGRFSRAGAMLSAEGEIVQMHPLGLCEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
publication title Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
total genus 37
structure length 146
sequence length 151
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4c8cA00
2XEGA 4C8CA 2PVWA 1CX8A 4OC2A 3I6SA 2XEJA 4TWEA 4NGRA 4OC5A 4KNGE 3SJXA 4CDKA 2JBJA 2EK9A 3SJGA 4C99A 4P44A 3IIBA 2CIJA 3EIFA 4YN3A 4C9AA 5F09A 4OC3A 2JBKA 5IB9A 4X3RA 4JZ0A 4MCPA 2PVVA 3S9NA 3SJFA 3I74A 3SJEA 4JYWA 2C6CA 3BI0A 3IWWA 3D7GA 4TJXA 4P4JA 2XEIA 3KASA 4P4IA 4P4DA 1WVMA 3S9MA 4NGNA 4C84A 4NGQA 3VTAA 2C6GA 3BXMA 4C8UA 3ICUA 2C6PA 5D29A 3RBUA 3S9LA 2EK8A 4MCQA 1DE4C 4C9UA 3BI1A 3FEDA 4C86A 4NGMA 3FECA 4LQGA 4MCSA 4C8TA 4P45A 4NGPA 4OC0A 4P4EA 3D7DA 4C8AA 4OC1A 4P4FA 3BHXA 4C85A 4C9VA 4TJVA 4W9YA 4OC4A 3D7FA 2OOTA 2OR4A 4MCRA 2XEFA 4OMEA 4NGTA 3D7HA 4NGSA 4C8PA 4CDJA 4C9EA 1Z8LA 1XF1A 3FF3A 3FEEA 4P4BA 5ELYA 4C9RA 4C8FA 1V6CA 1Y9ZA
chains in the Genus database with same CATH superfamily
1C3OB 2XEGA 4C8CA 4COBA 2PVWA 1CX8A 4OC2A 3I6SA 2XEJA 4TWEA 4NGRA 2OLSA 3EZEA 4OC5A 4KNGE 3SJXA 1KC7A 4CDKA 1VBHA 2JBJA 2EK9A 2YJTA 3SJGA 3TLCA 2DIKA 2PCNA 2AUNA 2R82A 2D0PA 4C99A 4P44A 3GJZA 3IIBA 2CIJA 3EIFA 1EZBA 4E94A 4CZ1A 4YN3A 4C9AA 5F09A 4INJA 4OC3A 2JBKA 5F5XA 3SR3A 4COGA 1T36B 2HROA 5IB9A 4X3RA 1A9XB 3T05A 4JZ0A 2E28A 3TLGB 1NBWA 4MCPA 2PVVA 3S9NA 3SJFA 5JVLA 2D0OA 3I74A 3TLAA 3EZBA 3TLZA 1C30B 1JDBC 3SJEA 1JDEA 4JYWA 4M8DA 2C6CA 3BI0A 3IWWA 3K9TA 1CS0B 3D7GA 4TJXA 1KBLA 4P4JA 2XEIA 2HWGA 4EYSA 2AUMA 3KASA 4P4IA 4P4DA 1WVMA 2EZCA 3S9MA 4NGNA 4C84A 4NGQA 3T0TA 3VTAA 3T5MA 2C6GA 1ZL0A 1VBGA 3BXMA 4C8UA 3ICUA 5FD8A 1M6VB 2C6PA 5D29A 3RBUA 3T07A 1ZRSA 1NXJA 3TLYA 4CO9A 3S9LA 3KRVA 2EK8A 1VI4A 4MCQA 4JVOA 1DE4C 4C9UA 3BI1A 3FEDA 4C86A 4NGMA 3FECA 4LQGA 4J0NA 3G23A 4MCSA 5JYBA 1BXRB 1J3LA 3U1BA 4C8TA 1EZAA 4P45A 1ZYMA 2EZAA 4NGPA 3TYXA 4OC0A 4P4EA 3D7DA 4C8AA 3TLEA 4OC1A 4P4FA 4E5SA 3BHXA 1CE8B 4C85A 1R61A 1KEEB 4IIXA 4C9VA 4TJVA 5F1YA 4OC4A 4W9YA 3D7FA 2OOTA 2X0SA 4IIYA 1Q5XA 2YJVA 2OR4A 4MCRA 4MJXA 2XEFA 2MP0A 4OMEA 4MI1A 2HI6A 4NGTA 1DIKA 1GGOA 3D7HA 2FM4A 4H1HA 4NGSA 2GP4A 4C8PA 4CDJA 4C9EA 1Z8LA 1XF1A 2EZBA 3FF3A 3FEEA 4P4BA 5IR2A 3TLBA 5K99A 5ELYA 4C9RA 2B0AA 3C8OA 5F9MA 3TLGA 3EZAA 4C8FA 3K4IA 1V6CA 2C5QA 3NOJA 1Y9ZA
chains in the Genus database with same CATH topology
2XEGA 4C8CA 2PVWA 1CX8A 4OC2A 3I6SA 2XEJA 4TWEA 4NGRA 4OC5A 4KNGE 3SJXA 4CDKA 2JBJA 2EK9A 3SJGA 4C99A 4P44A 3IIBA 2CIJA 3EIFA 4YN3A 4C9AA 5F09A 4OC3A 2JBKA 5IB9A 4X3RA 4JZ0A 4MCPA 2PVVA 3S9NA 3SJFA 3I74A 3SJEA 4JYWA 2C6CA 3BI0A 3IWWA 3K9TA 3D7GA 4TJXA 4P4JA 2XEIA 3KASA 4P4IA 4P4DA 1WVMA 3S9MA 4NGNA 4C84A 4NGQA 3VTAA 2C6GA 3BXMA 4C8UA 3ICUA 2C6PA 5D29A 3RBUA 3S9LA 2EK8A 4MCQA 1DE4C 4C9UA 3BI1A 3FEDA 4C86A 4NGMA 3FECA 4LQGA 4MCSA 4C8TA 4P45A 4NGPA 4OC0A 4P4EA 3D7DA 4C8AA 4OC1A 4P4FA 3BHXA 4C85A 4C9VA 4TJVA 4OC4A 4W9YA 3D7FA 2OOTA 2OR4A 4MCRA 2XEFA 4OMEA 4NGTA 3D7HA 4NGSA 2GP4A 4C8PA 4CDJA 4C9EA 1Z8LA 1XF1A 3FF3A 3FEEA 4P4BA 5IR2A 5ELYA 4C9RA 4C8FA 1V6CA 2C5QA 1Y9ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XEG A;  4C8C A;  2PVW A;  1CX8 A;  4OC2 A;  3I6S A;  2XEJ A;  4TWE A;  4NGR A;  4OC5 A;  4KNG E;  3SJX A;  4CDK A;  2JBJ A;  2EK9 A;  3SJG A;  4C99 A;  4P44 A;  3IIB A;  2CIJ A;  3EIF A;  4YN3 A;  4C9A A;  5F09 A;  4OC3 A;  2JBK A;  5IB9 A;  4X3R A;  4JZ0 A;  4MCP A;  2PVV A;  3S9N A;  3SJF A;  3I74 A;  3SJE A;  4JYW A;  2C6C A;  3BI0 A;  3IWW A;  3D7G A;  4TJX A;  4P4J A;  2XEI A;  3KAS A;  4P4I A;  4P4D A;  1WVM A;  3S9M A;  4NGN A;  4C84 A;  4NGQ A;  3VTA A;  2C6G A;  3BXM A;  4C8U A;  3ICU A;  2C6P A;  5D29 A;  3RBU A;  3S9L A;  2EK8 A;  4MCQ A;  1DE4 C;  4C9U A;  3BI1 A;  3FED A;  4C86 A;  4NGM A;  3FEC A;  4LQG A;  4MCS A;  4C8T A;  4P45 A;  4NGP A;  4OC0 A;  4P4E A;  3D7D A;  4C8A A;  4OC1 A;  4P4F A;  3BHX A;  4C85 A;  4C9V A;  4TJV A;  4W9Y A;  4OC4 A;  3D7F A;  2OOT A;  2OR4 A;  4MCR A;  2XEF A;  4OME A;  4NGT A;  3D7H A;  4NGS A;  4C8P A;  4CDJ A;  4C9E A;  1Z8L A;  1XF1 A;  3FF3 A;  3FEE A;  4P4B A;  5ELY A;  4C9R A;  4C8F A;  1V6C A;  1Y9Z A; 
#chains in the Genus database with same CATH topology
 1C3O B;  2XEG A;  4C8C A;  4COB A;  2PVW A;  1CX8 A;  4OC2 A;  3I6S A;  2XEJ A;  4TWE A;  4NGR A;  2OLS A;  3EZE A;  4OC5 A;  4KNG E;  3SJX A;  1KC7 A;  4CDK A;  1VBH A;  2JBJ A;  2EK9 A;  2YJT A;  3SJG A;  3TLC A;  2DIK A;  2PCN A;  2AUN A;  2R82 A;  2D0P A;  4C99 A;  4P44 A;  3GJZ A;  3IIB A;  2CIJ A;  3EIF A;  1EZB A;  4E94 A;  4CZ1 A;  4YN3 A;  4C9A A;  5F09 A;  4INJ A;  4OC3 A;  2JBK A;  5F5X A;  3SR3 A;  4COG A;  1T36 B;  2HRO A;  5IB9 A;  4X3R A;  1A9X B;  3T05 A;  4JZ0 A;  2E28 A;  3TLG B;  1NBW A;  4MCP A;  2PVV A;  3S9N A;  3SJF A;  5JVL A;  2D0O A;  3I74 A;  3TLA A;  3EZB A;  3TLZ A;  1C30 B;  1JDB C;  3SJE A;  1JDE A;  4JYW A;  4M8D A;  2C6C A;  3BI0 A;  3IWW A;  3K9T A;  1CS0 B;  3D7G A;  4TJX A;  1KBL A;  4P4J A;  2XEI A;  2HWG A;  4EYS A;  2AUM A;  3KAS A;  4P4I A;  4P4D A;  1WVM A;  2EZC A;  3S9M A;  4NGN A;  4C84 A;  4NGQ A;  3T0T A;  3VTA A;  3T5M A;  2C6G A;  1ZL0 A;  1VBG A;  3BXM A;  4C8U A;  3ICU A;  5FD8 A;  1M6V B;  2C6P A;  5D29 A;  3RBU A;  3T07 A;  1ZRS A;  1NXJ A;  3TLY A;  4CO9 A;  3S9L A;  3KRV A;  2EK8 A;  1VI4 A;  4MCQ A;  4JVO A;  1DE4 C;  4C9U A;  3BI1 A;  3FED A;  4C86 A;  4NGM A;  3FEC A;  4LQG A;  4J0N A;  3G23 A;  4MCS A;  5JYB A;  1BXR B;  1J3L A;  3U1B A;  4C8T A;  1EZA A;  4P45 A;  1ZYM A;  2EZA A;  4NGP A;  3TYX A;  4OC0 A;  4P4E A;  3D7D A;  4C8A A;  3TLE A;  4OC1 A;  4P4F A;  4E5S A;  3BHX A;  1CE8 B;  4C85 A;  1R61 A;  1KEE B;  4IIX A;  4C9V A;  4TJV A;  5F1Y A;  4OC4 A;  4W9Y A;  3D7F A;  2OOT A;  2X0S A;  4IIY A;  1Q5X A;  2YJV A;  2OR4 A;  4MCR A;  4MJX A;  2XEF A;  2MP0 A;  4OME A;  4MI1 A;  2HI6 A;  4NGT A;  1DIK A;  1GGO A;  3D7H A;  2FM4 A;  4H1H A;  4NGS A;  2GP4 A;  4C8P A;  4CDJ A;  4C9E A;  1Z8L A;  1XF1 A;  2EZB A;  3FF3 A;  3FEE A;  4P4B A;  5IR2 A;  3TLB A;  5K99 A;  5ELY A;  4C9R A;  2B0A A;  3C8O A;  5F9M A;  3TLG A;  3EZA A;  4C8F A;  3K4I A;  1V6C A;  2C5Q A;  3NOJ A;  1Y9Z A; 
#chains in the Genus database with same CATH homology
 2XEG A;  4C8C A;  2PVW A;  1CX8 A;  4OC2 A;  3I6S A;  2XEJ A;  4TWE A;  4NGR A;  4OC5 A;  4KNG E;  3SJX A;  4CDK A;  2JBJ A;  2EK9 A;  3SJG A;  4C99 A;  4P44 A;  3IIB A;  2CIJ A;  3EIF A;  4YN3 A;  4C9A A;  5F09 A;  4OC3 A;  2JBK A;  5IB9 A;  4X3R A;  4JZ0 A;  4MCP A;  2PVV A;  3S9N A;  3SJF A;  3I74 A;  3SJE A;  4JYW A;  2C6C A;  3BI0 A;  3IWW A;  3K9T A;  3D7G A;  4TJX A;  4P4J A;  2XEI A;  3KAS A;  4P4I A;  4P4D A;  1WVM A;  3S9M A;  4NGN A;  4C84 A;  4NGQ A;  3VTA A;  2C6G A;  3BXM A;  4C8U A;  3ICU A;  2C6P A;  5D29 A;  3RBU A;  3S9L A;  2EK8 A;  4MCQ A;  1DE4 C;  4C9U A;  3BI1 A;  3FED A;  4C86 A;  4NGM A;  3FEC A;  4LQG A;  4MCS A;  4C8T A;  4P45 A;  4NGP A;  4OC0 A;  4P4E A;  3D7D A;  4C8A A;  4OC1 A;  4P4F A;  3BHX A;  4C85 A;  4C9V A;  4TJV A;  4OC4 A;  4W9Y A;  3D7F A;  2OOT A;  2OR4 A;  4MCR A;  2XEF A;  4OME A;  4NGT A;  3D7H A;  4NGS A;  2GP4 A;  4C8P A;  4CDJ A;  4C9E A;  1Z8L A;  1XF1 A;  3FF3 A;  3FEE A;  4P4B A;  5IR2 A;  5ELY A;  4C9R A;  4C8F A;  1V6C A;  2C5Q A;  1Y9Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...