4C8CA

Mouse znrf3 ectodomain crystal form iii
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
151
structure length
146
Chain Sequence
ETAFVEVVLFESSPSGDYTTHTTGLTGRFSRAGAMLSAEGEIVQMHPLGLCEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
publication title Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb
source organism Mus musculus
total genus 37
structure length 146
sequence length 151
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4c8cA00
4TJVA 2JBKA 4OC5A 3KASA 4P4IA 4MCRA 3SJEA 4KNGE 2PVWA 4YN3A 4C8PA 5F09A 4CDKA 4C8AA 3D7FA 4P4BA 3VTAA 4C8TA 3S9MA 4NGTA 4C8UA 4TWEA 3SJGA 3IWWA 4C9AA 1XF1A 4OC0A 4LQGA 2EK9A 4P4FA 1Z8LA 3ICUA 4NGRA 4NGSA 4C8FA 3D7HA 3I6SA 1WVMA 5D29A 4C9RA 2XEGA 2CIJA 2OR4A 4NGMA 4P4EA 4JZ0A 4MCSA 1DE4C 5IB9A 4JYWA 2XEFA 4OMEA 4C86A 4C9EA 2EK8A 4C84A 3BI0A 3RBUA 3FF3A 4C8CA 2XEIA 1V6CA 4OC3A 4W9YA 3FEDA 4OC2A 3FEEA 4CDJA 3D7DA 4C85A 3SJFA 4X3RA 2C6PA 2C6CA 2C6GA 5ELYA 3BI1A 4P4JA 4TJXA 3IIBA 4NGQA 2XEJA 4NGPA 3FECA 3BHXA 3BXMA 4C99A 4OC4A 3D7GA 2PVVA 4P4DA 4OC1A 4P44A 2JBJA 4C9VA 3SJXA 4C9UA 1CX8A 4MCQA 4MCPA 3S9LA 3S9NA 2OOTA 1Y9ZA 3I74A 4NGNA 4P45A 3EIFA
chains in the Genus database with same CATH superfamily
1R61A 4MJXA 1GGOA 1CE8B 2JBKA 4TJVA 4OC5A 2PCNA 1Q5XA 3KASA 4P4IA 4COGA 2MP0A 4MCRA 3SJEA 4KNGE 4E5SA 2PVWA 4YN3A 5IR2A 3T0TA 4C8PA 5F09A 4CDKA 3K4IA 4C8AA 4INJA 1ZYMA 3D7FA 3EZEA 2C5QA 4P4BA 3TLEA 3VTAA 4C8TA 3U1BA 5JYBA 3S9MA 4NGTA 5F9MA 2EZAA 4MI1A 3TLBA 4H1HA 2EZCA 4C8UA 1VBGA 3C8OA 4TWEA 3SJGA 3IWWA 1KEEB 1BXRB 2AUNA 4C9AA 1C3OB 3K9TA 1XF1A 1JDEA 3GJZA 4OC0A 4LQGA 2R82A 3T5MA 1VBHA 2EK9A 3TLYA 4P4FA 1Z8LA 4CO9A 3ICUA 4NGRA 4NGSA 2DIKA 4C8FA 3D7HA 2EZBA 3I6SA 2YJTA 1WVMA 1JDBC 4J0NA 5D29A 1T36B 4CZ1A 5K99A 1CS0B 4C9RA 2XEGA 2CIJA 2OR4A 4NGMA 4P4EA 2HROA 3KRVA 4JZ0A 4MCSA 1DE4C 4IIXA 2YJVA 2GP4A 5F5XA 5IB9A 2B0AA 3NOJA 1KC7A 4JYWA 2XEFA 4OMEA 4IIYA 4C86A 4E94A 2AUMA 3TYXA 5F1YA 4C9EA 2EK8A 3TLGA 1DIKA 3BI0A 4C84A 3RBUA 2HI6A 3FF3A 4C8CA 1VI4A 1V6CA 2XEIA 4OC3A 4W9YA 1NBWA 3FEDA 1EZAA 2HWGA 3TLAA 2X0SA 3EZAA 4OC2A 3TLZA 3FEEA 4CDJA 1EZBA 2E28A 1J3LA 3D7DA 4C85A 3EZBA 2OLSA 3SJFA 4M8DA 2FM4A 3SR3A 4X3RA 2C6PA 2C6CA 2C6GA 5ELYA 3BI1A 4P4JA 3T07A 2D0PA 4JVOA 3T05A 4TJXA 3IIBA 2D0OA 4NGQA 3TLCA 4COBA 2XEJA 1ZRSA 4NGPA 3FECA 1ZL0A 3BHXA 3BXMA 4C99A 4OC4A 1A9XB 3D7GA 2PVVA 4P4DA 4OC1A 3G23A 4P44A 4EYSA 2JBJA 5FD8A 4C9VA 3SJXA 4C9UA 1CX8A 5JVLA 4MCQA 4MCPA 3TLGB 3S9LA 1C30B 3S9NA 2OOTA 1Y9ZA 3I74A 1M6VB 1NXJA 1KBLA 4NGNA 4P45A 3EIFA
chains in the Genus database with same CATH topology
4TJVA 2JBKA 4OC5A 3KASA 4P4IA 4MCRA 3SJEA 4KNGE 2PVWA 4YN3A 5IR2A 4C8PA 5F09A 4CDKA 4C8AA 3D7FA 2C5QA 4P4BA 3VTAA 4C8TA 3S9MA 4NGTA 4C8UA 4TWEA 3SJGA 3IWWA 4C9AA 3K9TA 1XF1A 4OC0A 4LQGA 2EK9A 4P4FA 1Z8LA 3ICUA 4NGRA 4NGSA 4C8FA 3D7HA 3I6SA 1WVMA 5D29A 4C9RA 2XEGA 2CIJA 2OR4A 4NGMA 4P4EA 4JZ0A 4MCSA 1DE4C 2GP4A 5IB9A 4JYWA 2XEFA 4OMEA 4C86A 4C9EA 2EK8A 4C84A 3BI0A 3RBUA 3FF3A 4C8CA 2XEIA 1V6CA 4OC3A 4W9YA 3FEDA 4OC2A 3FEEA 4CDJA 3D7DA 4C85A 3SJFA 4X3RA 2C6PA 2C6CA 2C6GA 5ELYA 3BI1A 4P4JA 4TJXA 3IIBA 4NGQA 2XEJA 4NGPA 3FECA 3BHXA 3BXMA 4C99A 4OC4A 3D7GA 2PVVA 4P4DA 4OC1A 4P44A 2JBJA 4C9VA 3SJXA 4C9UA 1CX8A 4MCQA 4MCPA 3S9LA 3S9NA 2OOTA 1Y9ZA 3I74A 4NGNA 4P45A 3EIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TJV A;  2JBK A;  4OC5 A;  3KAS A;  4P4I A;  4MCR A;  3SJE A;  4KNG E;  2PVW A;  4YN3 A;  4C8P A;  5F09 A;  4CDK A;  4C8A A;  3D7F A;  4P4B A;  3VTA A;  4C8T A;  3S9M A;  4NGT A;  4C8U A;  4TWE A;  3SJG A;  3IWW A;  4C9A A;  1XF1 A;  4OC0 A;  4LQG A;  2EK9 A;  4P4F A;  1Z8L A;  3ICU A;  4NGR A;  4NGS A;  4C8F A;  3D7H A;  3I6S A;  1WVM A;  5D29 A;  4C9R A;  2XEG A;  2CIJ A;  2OR4 A;  4NGM A;  4P4E A;  4JZ0 A;  4MCS A;  1DE4 C;  5IB9 A;  4JYW A;  2XEF A;  4OME A;  4C86 A;  4C9E A;  2EK8 A;  4C84 A;  3BI0 A;  3RBU A;  3FF3 A;  4C8C A;  2XEI A;  1V6C A;  4OC3 A;  4W9Y A;  3FED A;  4OC2 A;  3FEE A;  4CDJ A;  3D7D A;  4C85 A;  3SJF A;  4X3R A;  2C6P A;  2C6C A;  2C6G A;  5ELY A;  3BI1 A;  4P4J A;  4TJX A;  3IIB A;  4NGQ A;  2XEJ A;  4NGP A;  3FEC A;  3BHX A;  3BXM A;  4C99 A;  4OC4 A;  3D7G A;  2PVV A;  4P4D A;  4OC1 A;  4P44 A;  2JBJ A;  4C9V A;  3SJX A;  4C9U A;  1CX8 A;  4MCQ A;  4MCP A;  3S9L A;  3S9N A;  2OOT A;  1Y9Z A;  3I74 A;  4NGN A;  4P45 A;  3EIF A; 
#chains in the Genus database with same CATH topology
 1R61 A;  4MJX A;  1GGO A;  1CE8 B;  2JBK A;  4TJV A;  4OC5 A;  2PCN A;  1Q5X A;  3KAS A;  4P4I A;  4COG A;  2MP0 A;  4MCR A;  3SJE A;  4KNG E;  4E5S A;  2PVW A;  4YN3 A;  5IR2 A;  3T0T A;  4C8P A;  5F09 A;  4CDK A;  3K4I A;  4C8A A;  4INJ A;  1ZYM A;  3D7F A;  3EZE A;  2C5Q A;  4P4B A;  3TLE A;  3VTA A;  4C8T A;  3U1B A;  5JYB A;  3S9M A;  4NGT A;  5F9M A;  2EZA A;  4MI1 A;  3TLB A;  4H1H A;  2EZC A;  4C8U A;  1VBG A;  3C8O A;  4TWE A;  3SJG A;  3IWW A;  1KEE B;  1BXR B;  2AUN A;  4C9A A;  1C3O B;  3K9T A;  1XF1 A;  1JDE A;  3GJZ A;  4OC0 A;  4LQG A;  2R82 A;  3T5M A;  1VBH A;  2EK9 A;  3TLY A;  4P4F A;  1Z8L A;  4CO9 A;  3ICU A;  4NGR A;  4NGS A;  2DIK A;  4C8F A;  3D7H A;  2EZB A;  3I6S A;  2YJT A;  1WVM A;  1JDB C;  4J0N A;  5D29 A;  1T36 B;  4CZ1 A;  5K99 A;  1CS0 B;  4C9R A;  2XEG A;  2CIJ A;  2OR4 A;  4NGM A;  4P4E A;  2HRO A;  3KRV A;  4JZ0 A;  4MCS A;  1DE4 C;  4IIX A;  2YJV A;  2GP4 A;  5F5X A;  5IB9 A;  2B0A A;  3NOJ A;  1KC7 A;  4JYW A;  2XEF A;  4OME A;  4IIY A;  4C86 A;  4E94 A;  2AUM A;  3TYX A;  5F1Y A;  4C9E A;  2EK8 A;  3TLG A;  1DIK A;  3BI0 A;  4C84 A;  3RBU A;  2HI6 A;  3FF3 A;  4C8C A;  1VI4 A;  1V6C A;  2XEI A;  4OC3 A;  4W9Y A;  1NBW A;  3FED A;  1EZA A;  2HWG A;  3TLA A;  2X0S A;  3EZA A;  4OC2 A;  3TLZ A;  3FEE A;  4CDJ A;  1EZB A;  2E28 A;  1J3L A;  3D7D A;  4C85 A;  3EZB A;  2OLS A;  3SJF A;  4M8D A;  2FM4 A;  3SR3 A;  4X3R A;  2C6P A;  2C6C A;  2C6G A;  5ELY A;  3BI1 A;  4P4J A;  3T07 A;  2D0P A;  4JVO A;  3T05 A;  4TJX A;  3IIB A;  2D0O A;  4NGQ A;  3TLC A;  4COB A;  2XEJ A;  1ZRS A;  4NGP A;  3FEC A;  1ZL0 A;  3BHX A;  3BXM A;  4C99 A;  4OC4 A;  1A9X B;  3D7G A;  2PVV A;  4P4D A;  4OC1 A;  3G23 A;  4P44 A;  4EYS A;  2JBJ A;  5FD8 A;  4C9V A;  3SJX A;  4C9U A;  1CX8 A;  5JVL A;  4MCQ A;  4MCP A;  3TLG B;  3S9L A;  1C30 B;  3S9N A;  2OOT A;  1Y9Z A;  3I74 A;  1M6V B;  1NXJ A;  1KBL A;  4NGN A;  4P45 A;  3EIF A; 
#chains in the Genus database with same CATH homology
 4TJV A;  2JBK A;  4OC5 A;  3KAS A;  4P4I A;  4MCR A;  3SJE A;  4KNG E;  2PVW A;  4YN3 A;  5IR2 A;  4C8P A;  5F09 A;  4CDK A;  4C8A A;  3D7F A;  2C5Q A;  4P4B A;  3VTA A;  4C8T A;  3S9M A;  4NGT A;  4C8U A;  4TWE A;  3SJG A;  3IWW A;  4C9A A;  3K9T A;  1XF1 A;  4OC0 A;  4LQG A;  2EK9 A;  4P4F A;  1Z8L A;  3ICU A;  4NGR A;  4NGS A;  4C8F A;  3D7H A;  3I6S A;  1WVM A;  5D29 A;  4C9R A;  2XEG A;  2CIJ A;  2OR4 A;  4NGM A;  4P4E A;  4JZ0 A;  4MCS A;  1DE4 C;  2GP4 A;  5IB9 A;  4JYW A;  2XEF A;  4OME A;  4C86 A;  4C9E A;  2EK8 A;  4C84 A;  3BI0 A;  3RBU A;  3FF3 A;  4C8C A;  2XEI A;  1V6C A;  4OC3 A;  4W9Y A;  3FED A;  4OC2 A;  3FEE A;  4CDJ A;  3D7D A;  4C85 A;  3SJF A;  4X3R A;  2C6P A;  2C6C A;  2C6G A;  5ELY A;  3BI1 A;  4P4J A;  4TJX A;  3IIB A;  4NGQ A;  2XEJ A;  4NGP A;  3FEC A;  3BHX A;  3BXM A;  4C99 A;  4OC4 A;  3D7G A;  2PVV A;  4P4D A;  4OC1 A;  4P44 A;  2JBJ A;  4C9V A;  3SJX A;  4C9U A;  1CX8 A;  4MCQ A;  4MCP A;  3S9L A;  3S9N A;  2OOT A;  1Y9Z A;  3I74 A;  4NGN A;  4P45 A;  3EIF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...