4C99A

Mouse znrf3 ectodomain in complex with mouse rspo2 fu1-fu2 crystal form i
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
153
structure length
153
Chain Sequence
b'KETAFVEVVLFESSPSGDYTTHTTGLTGRFSRAGAMLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
publication title Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase/signaling protein
total genus 35
structure length 153
sequence length 153
chains with identical sequence C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4c99A00
3BXMA 2OOTA 1V6CA 4C99A 2PVWA 3D7FA 4P4EA 4OC0A 3I6SA 2JBJA 3ICUA 1DE4C 2CIJA 4P4FA 3VTAA 4C8CA 3FEDA 1XF1A 4C86A 4C8FA 4C8TA 4P4IA 5D29A 3D7DA 2OR4A 1WVMA 2XEGA 2C6CA 4JYWA 3SJEA 3RBUA 4YN3A 4MCQA 3S9LA 4TWEA 3D7HA 4OC2A 4C9AA 3I74A 4LQGA 4C9VA 3EIFA 3BI0A 4NGRA 4TJXA 4C9RA 4P4JA 4W9YA 3IWWA 3FEEA 4C8PA 3SJXA 3S9MA 1CX8A 4OC5A 4P45A 4NGMA 3FF3A 4P4DA 4C8UA 4C9EA 4NGTA 3D7GA 4TJVA 1Z8LA 4OC3A 2PVVA 1Y9ZA 2C6PA 4CDJA 4NGSA 4C85A 4JZ0A 3SJGA 2EK8A 4C8AA 4MCSA 4NGNA 4CDKA 4OC4A 4P44A 4KNGE 4MCPA 3KASA 4X3RA 2EK9A 2C6GA 3FECA 2JBKA 4OMEA 2XEIA 3BHXA 3SJFA 4NGQA 4C9UA 4C84A 3BI1A 3IIBA 4OC1A 4NGPA 5IB9A 5ELYA 2XEFA 3S9NA 5F09A 4P4BA 2XEJA 4MCRA
chains in the Genus database with same CATH superfamily
1NXJA 3BXMA 2OOTA 3C8OA 3KRVA 1V6CA 4CZ1A 1JDBC 4C99A 2PVWA 1ZL0A 3D7FA 4P4EA 2DIKA 3NOJA 4OC0A 1VI4A 2JBJA 3I6SA 5FD8A 3ICUA 1DE4C 2X0SA 1M6VB 2CIJA 2R82A 4P4FA 3T05A 4E94A 3VTAA 4C8CA 2EZAA 3FEDA 4E5SA 1XF1A 4C86A 1EZBA 4C8FA 4C8TA 1CE8B 4P4IA 5D29A 3D7DA 2OR4A 1KC7A 1WVMA 2XEGA 2C6CA 2HI6A 2AUMA 1CS0B 4JYWA 3SJEA 3TLGA 1VBHA 1GGOA 3RBUA 3SR3A 2EZCA 4YN3A 4MCQA 3S9LA 3TLYA 4TWEA 3D7HA 3EZBA 2HWGA 4OC2A 4C9AA 3I74A 4LQGA 3TLCA 4C9VA 2YJVA 3EIFA 2HROA 3BI0A 4NGRA 3TLGB 4TJXA 4J0NA 3TLEA 1KEEB 3TLBA 2E28A 4C9RA 4P4JA 4W9YA 1C3OB 3IWWA 1JDEA 3FEEA 4C8PA 3SJXA 1NBWA 1T36B 3S9MA 3TLZA 1CX8A 4OC5A 4COGA 5JYBA 4P45A 2D0PA 2GP4A 3G23A 4NGMA 3TYXA 4IIXA 3FF3A 3T07A 4P4DA 3T5MA 4C8UA 3GJZA 4C9EA 1R61A 5F9MA 3EZEA 3U1BA 1A9XB 3TLAA 4INJA 4CO9A 3K9TA 4NGTA 3D7GA 4TJVA 4EYSA 1Z8LA 2YJTA 4OC3A 2PVVA 1Y9ZA 2C6PA 4CDJA 2MP0A 4NGSA 2C5QA 4C85A 4JZ0A 3SJGA 2D0OA 2EK8A 4C8AA 4MCSA 4COBA 4NGNA 2AUNA 4M8DA 4H1HA 1ZRSA 2B0AA 4IIYA 4OC4A 4P44A 4CDKA 4KNGE 4MCPA 2EZBA 3KASA 2FM4A 1KBLA 4MI1A 1EZAA 5K99A 4X3RA 2EK9A 2C6GA 5F1YA 3FECA 1C30B 1VBGA 2JBKA 4OMEA 1J3LA 2XEIA 3BHXA 3SJFA 4NGQA 4C9UA 4C84A 1Q5XA 3BI1A 1DIKA 3IIBA 4MJXA 2PCNA 4NGPA 2XEFA 4OC1A 1BXRB 5ELYA 5IB9A 1ZYMA 5IR2A 3EZAA 5JVLA 4JVOA 3S9NA 5F09A 2OLSA 5F5XA 4P4BA 3T0TA 3K4IA 2XEJA 4MCRA
chains in the Genus database with same CATH topology
3BXMA 2OOTA 1V6CA 4C99A 2PVWA 3D7FA 4P4EA 4OC0A 3I6SA 2JBJA 3ICUA 1DE4C 2CIJA 4P4FA 3VTAA 4C8CA 3FEDA 1XF1A 4C86A 4C8FA 4C8TA 4P4IA 5D29A 3D7DA 2OR4A 1WVMA 2XEGA 2C6CA 4JYWA 3SJEA 3RBUA 4YN3A 4MCQA 3S9LA 4TWEA 3D7HA 4OC2A 4C9AA 3I74A 4LQGA 4C9VA 3EIFA 3BI0A 4NGRA 4TJXA 4C9RA 4P4JA 4W9YA 3IWWA 3FEEA 4C8PA 3SJXA 3S9MA 1CX8A 4OC5A 4P45A 2GP4A 4NGMA 3FF3A 4P4DA 4C8UA 4C9EA 3K9TA 4NGTA 3D7GA 4TJVA 1Z8LA 4OC3A 2PVVA 1Y9ZA 2C6PA 4CDJA 4NGSA 2C5QA 4C85A 4JZ0A 3SJGA 2EK8A 4C8AA 4MCSA 4NGNA 4CDKA 4OC4A 4P44A 4KNGE 4MCPA 3KASA 4X3RA 2EK9A 2C6GA 3FECA 2JBKA 4OMEA 2XEIA 3BHXA 3SJFA 4NGQA 4C9UA 4C84A 3BI1A 3IIBA 4OC1A 4NGPA 5IB9A 5ELYA 2XEFA 5IR2A 3S9NA 5F09A 4P4BA 2XEJA 4MCRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BXM A;  2OOT A;  1V6C A;  4C99 A;  2PVW A;  3D7F A;  4P4E A;  4OC0 A;  3I6S A;  2JBJ A;  3ICU A;  1DE4 C;  2CIJ A;  4P4F A;  3VTA A;  4C8C A;  3FED A;  1XF1 A;  4C86 A;  4C8F A;  4C8T A;  4P4I A;  5D29 A;  3D7D A;  2OR4 A;  1WVM A;  2XEG A;  2C6C A;  4JYW A;  3SJE A;  3RBU A;  4YN3 A;  4MCQ A;  3S9L A;  4TWE A;  3D7H A;  4OC2 A;  4C9A A;  3I74 A;  4LQG A;  4C9V A;  3EIF A;  3BI0 A;  4NGR A;  4TJX A;  4C9R A;  4P4J A;  4W9Y A;  3IWW A;  3FEE A;  4C8P A;  3SJX A;  3S9M A;  1CX8 A;  4OC5 A;  4P45 A;  4NGM A;  3FF3 A;  4P4D A;  4C8U A;  4C9E A;  4NGT A;  3D7G A;  4TJV A;  1Z8L A;  4OC3 A;  2PVV A;  1Y9Z A;  2C6P A;  4CDJ A;  4NGS A;  4C85 A;  4JZ0 A;  3SJG A;  2EK8 A;  4C8A A;  4MCS A;  4NGN A;  4CDK A;  4OC4 A;  4P44 A;  4KNG E;  4MCP A;  3KAS A;  4X3R A;  2EK9 A;  2C6G A;  3FEC A;  2JBK A;  4OME A;  2XEI A;  3BHX A;  3SJF A;  4NGQ A;  4C9U A;  4C84 A;  3BI1 A;  3IIB A;  4OC1 A;  4NGP A;  5IB9 A;  5ELY A;  2XEF A;  3S9N A;  5F09 A;  4P4B A;  2XEJ A;  4MCR A; 
#chains in the Genus database with same CATH topology
 1NXJ A;  3BXM A;  2OOT A;  3C8O A;  3KRV A;  1V6C A;  4CZ1 A;  1JDB C;  4C99 A;  2PVW A;  1ZL0 A;  3D7F A;  4P4E A;  2DIK A;  3NOJ A;  4OC0 A;  1VI4 A;  2JBJ A;  3I6S A;  5FD8 A;  3ICU A;  1DE4 C;  2X0S A;  1M6V B;  2CIJ A;  2R82 A;  4P4F A;  3T05 A;  4E94 A;  3VTA A;  4C8C A;  2EZA A;  3FED A;  4E5S A;  1XF1 A;  4C86 A;  1EZB A;  4C8F A;  4C8T A;  1CE8 B;  4P4I A;  5D29 A;  3D7D A;  2OR4 A;  1KC7 A;  1WVM A;  2XEG A;  2C6C A;  2HI6 A;  2AUM A;  1CS0 B;  4JYW A;  3SJE A;  3TLG A;  1VBH A;  1GGO A;  3RBU A;  3SR3 A;  2EZC A;  4YN3 A;  4MCQ A;  3S9L A;  3TLY A;  4TWE A;  3D7H A;  3EZB A;  2HWG A;  4OC2 A;  4C9A A;  3I74 A;  4LQG A;  3TLC A;  4C9V A;  2YJV A;  3EIF A;  2HRO A;  3BI0 A;  4NGR A;  3TLG B;  4TJX A;  4J0N A;  3TLE A;  1KEE B;  3TLB A;  2E28 A;  4C9R A;  4P4J A;  4W9Y A;  1C3O B;  3IWW A;  1JDE A;  3FEE A;  4C8P A;  3SJX A;  1NBW A;  1T36 B;  3S9M A;  3TLZ A;  1CX8 A;  4OC5 A;  4COG A;  5JYB A;  4P45 A;  2D0P A;  2GP4 A;  3G23 A;  4NGM A;  3TYX A;  4IIX A;  3FF3 A;  3T07 A;  4P4D A;  3T5M A;  4C8U A;  3GJZ A;  4C9E A;  1R61 A;  5F9M A;  3EZE A;  3U1B A;  1A9X B;  3TLA A;  4INJ A;  4CO9 A;  3K9T A;  4NGT A;  3D7G A;  4TJV A;  4EYS A;  1Z8L A;  2YJT A;  4OC3 A;  2PVV A;  1Y9Z A;  2C6P A;  4CDJ A;  2MP0 A;  4NGS A;  2C5Q A;  4C85 A;  4JZ0 A;  3SJG A;  2D0O A;  2EK8 A;  4C8A A;  4MCS A;  4COB A;  4NGN A;  2AUN A;  4M8D A;  4H1H A;  1ZRS A;  2B0A A;  4IIY A;  4OC4 A;  4P44 A;  4CDK A;  4KNG E;  4MCP A;  2EZB A;  3KAS A;  2FM4 A;  1KBL A;  4MI1 A;  1EZA A;  5K99 A;  4X3R A;  2EK9 A;  2C6G A;  5F1Y A;  3FEC A;  1C30 B;  1VBG A;  2JBK A;  4OME A;  1J3L A;  2XEI A;  3BHX A;  3SJF A;  4NGQ A;  4C9U A;  4C84 A;  1Q5X A;  3BI1 A;  1DIK A;  3IIB A;  4MJX A;  2PCN A;  4NGP A;  2XEF A;  4OC1 A;  1BXR B;  5ELY A;  5IB9 A;  1ZYM A;  5IR2 A;  3EZA A;  5JVL A;  4JVO A;  3S9N A;  5F09 A;  2OLS A;  5F5X A;  4P4B A;  3T0T A;  3K4I A;  2XEJ A;  4MCR A; 
#chains in the Genus database with same CATH homology
 3BXM A;  2OOT A;  1V6C A;  4C99 A;  2PVW A;  3D7F A;  4P4E A;  4OC0 A;  3I6S A;  2JBJ A;  3ICU A;  1DE4 C;  2CIJ A;  4P4F A;  3VTA A;  4C8C A;  3FED A;  1XF1 A;  4C86 A;  4C8F A;  4C8T A;  4P4I A;  5D29 A;  3D7D A;  2OR4 A;  1WVM A;  2XEG A;  2C6C A;  4JYW A;  3SJE A;  3RBU A;  4YN3 A;  4MCQ A;  3S9L A;  4TWE A;  3D7H A;  4OC2 A;  4C9A A;  3I74 A;  4LQG A;  4C9V A;  3EIF A;  3BI0 A;  4NGR A;  4TJX A;  4C9R A;  4P4J A;  4W9Y A;  3IWW A;  3FEE A;  4C8P A;  3SJX A;  3S9M A;  1CX8 A;  4OC5 A;  4P45 A;  2GP4 A;  4NGM A;  3FF3 A;  4P4D A;  4C8U A;  4C9E A;  3K9T A;  4NGT A;  3D7G A;  4TJV A;  1Z8L A;  4OC3 A;  2PVV A;  1Y9Z A;  2C6P A;  4CDJ A;  4NGS A;  2C5Q A;  4C85 A;  4JZ0 A;  3SJG A;  2EK8 A;  4C8A A;  4MCS A;  4NGN A;  4CDK A;  4OC4 A;  4P44 A;  4KNG E;  4MCP A;  3KAS A;  4X3R A;  2EK9 A;  2C6G A;  3FEC A;  2JBK A;  4OME A;  2XEI A;  3BHX A;  3SJF A;  4NGQ A;  4C9U A;  4C84 A;  3BI1 A;  3IIB A;  4OC1 A;  4NGP A;  5IB9 A;  5ELY A;  2XEF A;  5IR2 A;  3S9N A;  5F09 A;  4P4B A;  2XEJ A;  4MCR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...