4C99A

Mouse znrf3 ectodomain in complex with mouse rspo2 fu1-fu2 crystal form i
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
153
structure length
153
Chain Sequence
KETAFVEVVLFESSPSGDYTTHTTGLTGRFSRAGAMLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
publication title Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase/signaling protein
total genus 35
structure length 153
sequence length 153
chains with identical sequence C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4c99A00
4CDKA 2XEGA 2OR4A 4P4DA 4P4EA 4X3RA 3SJEA 3I6SA 4MCSA 4C8UA 1CX8A 4TJXA 1XF1A 4NGSA 4C9UA 2JBKA 4NGTA 4C85A 1Y9ZA 5ELYA 4OC4A 4NGRA 2EK9A 4P4FA 4C84A 3FF3A 3D7HA 2C6CA 3SJFA 4MCQA 3FECA 3BXMA 2OOTA 3IWWA 4C9AA 4C9EA 4TWEA 4C99A 3S9NA 3BHXA 3D7FA 3FEEA 3D7GA 4JYWA 2XEFA 2EK8A 4KNGE 4NGQA 3SJGA 3VTAA 4P4JA 4CDJA 3I74A 4TJVA 4OMEA 4C8AA 4C8TA 4MCRA 4NGPA 4OC3A 4MCPA 4OC1A 4JZ0A 2XEJA 4P4BA 3KASA 4P45A 4LQGA 3S9MA 3FEDA 4C8CA 5D29A 4NGNA 4OC0A 4P44A 2PVVA 2JBJA 2C6GA 4OC2A 3EIFA 2CIJA 4C8PA 4P4IA 3IIBA 2C6PA 2XEIA 4YN3A 3ICUA 3RBUA 1WVMA 5IB9A 3SJXA 4OC5A 4NGMA 4W9YA 4C8FA 3BI1A 3D7DA 4C9RA 3BI0A 1Z8LA 1V6CA 1DE4C 2PVWA 3S9LA 4C9VA 4C86A 5F09A
chains in the Genus database with same CATH superfamily
4CDKA 4CZ1A 2XEGA 2OR4A 4P4DA 4P4EA 4X3RA 2FM4A 5K99A 3SJEA 3I6SA 1DIKA 1KBLA 4MCSA 4C8UA 1CX8A 4TJXA 1JDBC 3TLGB 1XF1A 4NGSA 4C9UA 2JBKA 4NGTA 4C85A 1Y9ZA 5ELYA 2D0PA 2C5QA 3TLGA 3T07A 4OC4A 4NGRA 2EK9A 2AUNA 4P4FA 3TLEA 3TLYA 4C84A 3FF3A 4COBA 1Q5XA 1J3LA 1ZRSA 3D7HA 1C3OB 1NXJA 2C6CA 3SJFA 4MCQA 3FECA 3BXMA 3GJZA 1VBHA 3TYXA 2OOTA 1JDEA 4IIXA 4H1HA 3TLCA 2EZBA 3IWWA 4INJA 4MJXA 4C9AA 4C9EA 4TWEA 2YJVA 4C99A 5F5XA 3S9NA 3BHXA 3D7FA 3FEEA 2E28A 1BXRB 3KRVA 5JVLA 2OLSA 1T36B 3D7GA 4JYWA 1M6VB 3EZBA 2HWGA 1VBGA 3TLBA 1VI4A 2XEFA 2EK8A 2PCNA 4KNGE 4NGQA 3SJGA 3VTAA 3K4IA 4P4JA 4CDJA 4CO9A 2HI6A 2EZCA 1A9XB 3I74A 3SR3A 4OMEA 4TJVA 4C8AA 1CE8B 5JYBA 3U1BA 2EZAA 4C8TA 4MCRA 2YJTA 3TLAA 4NGPA 4OC3A 4MCPA 3EZAA 4OC1A 4JZ0A 2X0SA 2XEJA 1GGOA 4MI1A 3K9TA 1ZL0A 4P4BA 3KASA 4P45A 3NOJA 4LQGA 3S9MA 3FEDA 4C8CA 2D0OA 5D29A 4NGNA 4OC0A 4P44A 2PVVA 2JBJA 2C6GA 3T5MA 4OC2A 1R61A 3EIFA 2CIJA 2DIKA 4C8PA 4P4IA 4JVOA 1EZBA 3EZEA 1NBWA 4COGA 3IIBA 3TLZA 2C6PA 5FD8A 2XEIA 3C8OA 2MP0A 1CS0B 1ZYMA 4E94A 4EYSA 5F9MA 4YN3A 3G23A 3ICUA 3RBUA 4J0NA 4M8DA 1EZAA 2HROA 1WVMA 5IB9A 3SJXA 4OC5A 2GP4A 1KEEB 2AUMA 4NGMA 4W9YA 3T0TA 4C8FA 3BI1A 3D7DA 4C9RA 5F1YA 3BI0A 1C30B 1Z8LA 2R82A 1V6CA 1DE4C 2PVWA 3S9LA 5IR2A 1KC7A 4E5SA 4C9VA 3T05A 2B0AA 4IIYA 4C86A 5F09A
chains in the Genus database with same CATH topology
4CDKA 2XEGA 2OR4A 4P4DA 4P4EA 4X3RA 3SJEA 3I6SA 4MCSA 4C8UA 1CX8A 4TJXA 1XF1A 4NGSA 4C9UA 2JBKA 4NGTA 4C85A 1Y9ZA 5ELYA 2C5QA 4OC4A 4NGRA 2EK9A 4P4FA 4C84A 3FF3A 3D7HA 2C6CA 3SJFA 4MCQA 3FECA 3BXMA 2OOTA 3IWWA 4C9AA 4C9EA 4TWEA 4C99A 3S9NA 3BHXA 3D7FA 3FEEA 3D7GA 4JYWA 2XEFA 2EK8A 4KNGE 4NGQA 3SJGA 3VTAA 4P4JA 4CDJA 3I74A 4TJVA 4OMEA 4C8AA 4C8TA 4MCRA 4NGPA 4OC3A 4MCPA 4OC1A 4JZ0A 2XEJA 3K9TA 4P4BA 3KASA 4P45A 4LQGA 3S9MA 3FEDA 4C8CA 5D29A 4NGNA 4OC0A 4P44A 2PVVA 2JBJA 2C6GA 4OC2A 3EIFA 2CIJA 4C8PA 4P4IA 3IIBA 2C6PA 2XEIA 4YN3A 3ICUA 3RBUA 1WVMA 5IB9A 3SJXA 4OC5A 2GP4A 4NGMA 4W9YA 4C8FA 3BI1A 3D7DA 4C9RA 3BI0A 1Z8LA 1V6CA 1DE4C 2PVWA 3S9LA 5IR2A 4C9VA 4C86A 5F09A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CDK A;  2XEG A;  2OR4 A;  4P4D A;  4P4E A;  4X3R A;  3SJE A;  3I6S A;  4MCS A;  4C8U A;  1CX8 A;  4TJX A;  1XF1 A;  4NGS A;  4C9U A;  2JBK A;  4NGT A;  4C85 A;  1Y9Z A;  5ELY A;  4OC4 A;  4NGR A;  2EK9 A;  4P4F A;  4C84 A;  3FF3 A;  3D7H A;  2C6C A;  3SJF A;  4MCQ A;  3FEC A;  3BXM A;  2OOT A;  3IWW A;  4C9A A;  4C9E A;  4TWE A;  4C99 A;  3S9N A;  3BHX A;  3D7F A;  3FEE A;  3D7G A;  4JYW A;  2XEF A;  2EK8 A;  4KNG E;  4NGQ A;  3SJG A;  3VTA A;  4P4J A;  4CDJ A;  3I74 A;  4TJV A;  4OME A;  4C8A A;  4C8T A;  4MCR A;  4NGP A;  4OC3 A;  4MCP A;  4OC1 A;  4JZ0 A;  2XEJ A;  4P4B A;  3KAS A;  4P45 A;  4LQG A;  3S9M A;  3FED A;  4C8C A;  5D29 A;  4NGN A;  4OC0 A;  4P44 A;  2PVV A;  2JBJ A;  2C6G A;  4OC2 A;  3EIF A;  2CIJ A;  4C8P A;  4P4I A;  3IIB A;  2C6P A;  2XEI A;  4YN3 A;  3ICU A;  3RBU A;  1WVM A;  5IB9 A;  3SJX A;  4OC5 A;  4NGM A;  4W9Y A;  4C8F A;  3BI1 A;  3D7D A;  4C9R A;  3BI0 A;  1Z8L A;  1V6C A;  1DE4 C;  2PVW A;  3S9L A;  4C9V A;  4C86 A;  5F09 A; 
#chains in the Genus database with same CATH topology
 4CDK A;  4CZ1 A;  2XEG A;  2OR4 A;  4P4D A;  4P4E A;  4X3R A;  2FM4 A;  5K99 A;  3SJE A;  3I6S A;  1DIK A;  1KBL A;  4MCS A;  4C8U A;  1CX8 A;  4TJX A;  1JDB C;  3TLG B;  1XF1 A;  4NGS A;  4C9U A;  2JBK A;  4NGT A;  4C85 A;  1Y9Z A;  5ELY A;  2D0P A;  2C5Q A;  3TLG A;  3T07 A;  4OC4 A;  4NGR A;  2EK9 A;  2AUN A;  4P4F A;  3TLE A;  3TLY A;  4C84 A;  3FF3 A;  4COB A;  1Q5X A;  1J3L A;  1ZRS A;  3D7H A;  1C3O B;  1NXJ A;  2C6C A;  3SJF A;  4MCQ A;  3FEC A;  3BXM A;  3GJZ A;  1VBH A;  3TYX A;  2OOT A;  1JDE A;  4IIX A;  4H1H A;  3TLC A;  2EZB A;  3IWW A;  4INJ A;  4MJX A;  4C9A A;  4C9E A;  4TWE A;  2YJV A;  4C99 A;  5F5X A;  3S9N A;  3BHX A;  3D7F A;  3FEE A;  2E28 A;  1BXR B;  3KRV A;  5JVL A;  2OLS A;  1T36 B;  3D7G A;  4JYW A;  1M6V B;  3EZB A;  2HWG A;  1VBG A;  3TLB A;  1VI4 A;  2XEF A;  2EK8 A;  2PCN A;  4KNG E;  4NGQ A;  3SJG A;  3VTA A;  3K4I A;  4P4J A;  4CDJ A;  4CO9 A;  2HI6 A;  2EZC A;  1A9X B;  3I74 A;  3SR3 A;  4OME A;  4TJV A;  4C8A A;  1CE8 B;  5JYB A;  3U1B A;  2EZA A;  4C8T A;  4MCR A;  2YJT A;  3TLA A;  4NGP A;  4OC3 A;  4MCP A;  3EZA A;  4OC1 A;  4JZ0 A;  2X0S A;  2XEJ A;  1GGO A;  4MI1 A;  3K9T A;  1ZL0 A;  4P4B A;  3KAS A;  4P45 A;  3NOJ A;  4LQG A;  3S9M A;  3FED A;  4C8C A;  2D0O A;  5D29 A;  4NGN A;  4OC0 A;  4P44 A;  2PVV A;  2JBJ A;  2C6G A;  3T5M A;  4OC2 A;  1R61 A;  3EIF A;  2CIJ A;  2DIK A;  4C8P A;  4P4I A;  4JVO A;  1EZB A;  3EZE A;  1NBW A;  4COG A;  3IIB A;  3TLZ A;  2C6P A;  5FD8 A;  2XEI A;  3C8O A;  2MP0 A;  1CS0 B;  1ZYM A;  4E94 A;  4EYS A;  5F9M A;  4YN3 A;  3G23 A;  3ICU A;  3RBU A;  4J0N A;  4M8D A;  1EZA A;  2HRO A;  1WVM A;  5IB9 A;  3SJX A;  4OC5 A;  2GP4 A;  1KEE B;  2AUM A;  4NGM A;  4W9Y A;  3T0T A;  4C8F A;  3BI1 A;  3D7D A;  4C9R A;  5F1Y A;  3BI0 A;  1C30 B;  1Z8L A;  2R82 A;  1V6C A;  1DE4 C;  2PVW A;  3S9L A;  5IR2 A;  1KC7 A;  4E5S A;  4C9V A;  3T05 A;  2B0A A;  4IIY A;  4C86 A;  5F09 A; 
#chains in the Genus database with same CATH homology
 4CDK A;  2XEG A;  2OR4 A;  4P4D A;  4P4E A;  4X3R A;  3SJE A;  3I6S A;  4MCS A;  4C8U A;  1CX8 A;  4TJX A;  1XF1 A;  4NGS A;  4C9U A;  2JBK A;  4NGT A;  4C85 A;  1Y9Z A;  5ELY A;  2C5Q A;  4OC4 A;  4NGR A;  2EK9 A;  4P4F A;  4C84 A;  3FF3 A;  3D7H A;  2C6C A;  3SJF A;  4MCQ A;  3FEC A;  3BXM A;  2OOT A;  3IWW A;  4C9A A;  4C9E A;  4TWE A;  4C99 A;  3S9N A;  3BHX A;  3D7F A;  3FEE A;  3D7G A;  4JYW A;  2XEF A;  2EK8 A;  4KNG E;  4NGQ A;  3SJG A;  3VTA A;  4P4J A;  4CDJ A;  3I74 A;  4TJV A;  4OME A;  4C8A A;  4C8T A;  4MCR A;  4NGP A;  4OC3 A;  4MCP A;  4OC1 A;  4JZ0 A;  2XEJ A;  3K9T A;  4P4B A;  3KAS A;  4P45 A;  4LQG A;  3S9M A;  3FED A;  4C8C A;  5D29 A;  4NGN A;  4OC0 A;  4P44 A;  2PVV A;  2JBJ A;  2C6G A;  4OC2 A;  3EIF A;  2CIJ A;  4C8P A;  4P4I A;  3IIB A;  2C6P A;  2XEI A;  4YN3 A;  3ICU A;  3RBU A;  1WVM A;  5IB9 A;  3SJX A;  4OC5 A;  2GP4 A;  4NGM A;  4W9Y A;  4C8F A;  3BI1 A;  3D7D A;  4C9R A;  3BI0 A;  1Z8L A;  1V6C A;  1DE4 C;  2PVW A;  3S9L A;  5IR2 A;  4C9V A;  4C86 A;  5F09 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...