4C99A

Mouse znrf3 ectodomain in complex with mouse rspo2 fu1-fu2 crystal form i
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
153
structure length
153
Chain Sequence
KETAFVEVVLFESSPSGDYTTHTTGLTGRFSRAGAMLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
publication title Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase/signaling protein
total genus 35
structure length 153
sequence length 153
chains with identical sequence C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4c99A00
4OC0A 3S9MA 4NGQA 4P4JA 3FF3A 3SJEA 2XEFA 3D7DA 4C8FA 1DE4C 4OC3A 3KASA 4KNGE 4C8AA 2OR4A 4LQGA 4NGMA 3BI0A 3FEEA 4C84A 3D7HA 3ICUA 2CIJA 3S9LA 4NGRA 2EK9A 3I74A 4CDKA 1WVMA 4MCQA 1XF1A 3D7GA 5IB9A 4C99A 4C9AA 3BHXA 2OOTA 4CDJA 4C86A 5ELYA 4JYWA 1V6CA 4C8TA 4OC4A 2EK8A 3I6SA 2C6CA 4P4BA 4C9RA 5D29A 4C8CA 4P44A 3D7FA 1CX8A 4P4IA 3FEDA 4MCSA 3BI1A 2JBKA 4NGSA 2PVVA 4P4FA 4OMEA 4P4DA 4MCPA 3VTAA 5F09A 4TJXA 4JZ0A 4C8UA 4C8PA 2PVWA 2XEIA 4OC5A 1Z8LA 2C6PA 3FECA 4X3RA 4NGPA 3S9NA 1Y9ZA 4MCRA 2C6GA 4C9VA 3SJGA 4C9EA 4OC2A 4OC1A 4W9YA 4P45A 3IWWA 3SJFA 3IIBA 2JBJA 4YN3A 4P4EA 4NGTA 3BXMA 4TWEA 2XEJA 3SJXA 4C85A 4C9UA 3RBUA 2XEGA 4TJVA 3EIFA 4NGNA
chains in the Genus database with same CATH superfamily
3T05A 4OC0A 3S9MA 1GGOA 2D0PA 5F9MA 4NGQA 2AUNA 1ZRSA 4P4JA 3SJEA 2XEFA 1Q5XA 3D7DA 1CS0B 3EZAA 2EZBA 4C8FA 4IIYA 1DE4C 4OC3A 3KASA 1T36B 2GP4A 4KNGE 3TLAA 4C8AA 2OR4A 4LQGA 4NGMA 3GJZA 3BI0A 3FEEA 4C84A 5JYBA 3T5MA 3D7HA 3ICUA 2CIJA 4E5SA 3S9LA 3T0TA 4NGRA 2EK9A 3I74A 4CDKA 1WVMA 1KC7A 4MCQA 1A9XB 2HWGA 1XF1A 2FM4A 5FD8A 3KRVA 3D7GA 5IB9A 1EZAA 2AUMA 4C99A 2YJVA 4C9AA 3BHXA 2OOTA 4CDJA 4C86A 4MJXA 5ELYA 4CO9A 4JYWA 1V6CA 4C8TA 4OC4A 2C5QA 2EK8A 3I6SA 4IIXA 2C6CA 2R82A 4P4BA 3TLGB 4C9RA 4TJVA 3TLCA 2OLSA 3TLZA 5D29A 3TLBA 2X0SA 3SR3A 4C8CA 4P44A 1CX8A 4P4IA 3U1BA 2E28A 3C8OA 1BXRB 3TYXA 3FEDA 2HROA 4MCSA 5F1YA 5IR2A 4M8DA 1CE8B 3G23A 2DIKA 1ZL0A 1J3LA 3BI1A 1KEEB 1VBHA 2JBKA 4NGSA 2PVVA 4P4FA 3EZBA 4OMEA 4P4DA 1EZBA 4MCPA 3VTAA 4INJA 2EZAA 2HI6A 2B0AA 5F09A 4TJXA 4JZ0A 1JDEA 4C8UA 1JDBC 4C8PA 4JVOA 3TLGA 2PVWA 2XEIA 4OC5A 3TLEA 1NBWA 1Z8LA 2EZCA 2C6PA 3EZEA 3FECA 4X3RA 4NGPA 3TLYA 3S9NA 1Y9ZA 4NGNA 4EYSA 1C30B 3NOJA 1C3OB 4MCRA 2YJTA 2D0OA 2PCNA 4CZ1A 1DIKA 5F5XA 4MI1A 5K99A 2C6GA 4C9VA 1KBLA 3SJGA 1VBGA 4OC2A 4C9EA 4OC1A 3T07A 4W9YA 4E94A 1R61A 1ZYMA 4P45A 2MP0A 3IWWA 3K4IA 3SJFA 3IIBA 2JBJA 3K9TA 1VI4A 4YN3A 1M6VB 4COGA 4P4EA 4NGTA 3BXMA 4TWEA 2XEJA 3SJXA 4COBA 4C85A 4H1HA 4C9UA 1NXJA 3RBUA 2XEGA 4J0NA 3FF3A 3EIFA 3D7FA 5JVLA
chains in the Genus database with same CATH topology
4OC0A 3S9MA 4NGQA 4P4JA 3FF3A 3SJEA 2XEFA 3D7DA 4C8FA 1DE4C 4OC3A 3KASA 4KNGE 2GP4A 4C8AA 2OR4A 4LQGA 4NGMA 3BI0A 3FEEA 4C84A 3D7HA 3ICUA 2CIJA 3S9LA 4NGRA 2EK9A 3I74A 4CDKA 1WVMA 4MCQA 1XF1A 3D7GA 5IB9A 4C99A 4C9AA 3BHXA 2OOTA 4CDJA 4C86A 5ELYA 4JYWA 1V6CA 4C8TA 4OC4A 2C5QA 2EK8A 3I6SA 2C6CA 4P4BA 4C9RA 5D29A 4C8CA 4P44A 3D7FA 1CX8A 4P4IA 3FEDA 4MCSA 5IR2A 3BI1A 2JBKA 4NGSA 2PVVA 4P4FA 4OMEA 4P4DA 4MCPA 3VTAA 5F09A 4TJXA 4JZ0A 4C8UA 4C8PA 2PVWA 2XEIA 4OC5A 1Z8LA 2C6PA 3FECA 4X3RA 4NGPA 3S9NA 1Y9ZA 4MCRA 2C6GA 4C9VA 3SJGA 4C9EA 4OC2A 4OC1A 4W9YA 4P45A 3IWWA 3SJFA 3IIBA 2JBJA 3K9TA 4YN3A 4P4EA 4NGTA 3BXMA 4TWEA 2XEJA 3SJXA 4C85A 4C9UA 3RBUA 2XEGA 4TJVA 3EIFA 4NGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OC0 A;  3S9M A;  4NGQ A;  4P4J A;  3FF3 A;  3SJE A;  2XEF A;  3D7D A;  4C8F A;  1DE4 C;  4OC3 A;  3KAS A;  4KNG E;  4C8A A;  2OR4 A;  4LQG A;  4NGM A;  3BI0 A;  3FEE A;  4C84 A;  3D7H A;  3ICU A;  2CIJ A;  3S9L A;  4NGR A;  2EK9 A;  3I74 A;  4CDK A;  1WVM A;  4MCQ A;  1XF1 A;  3D7G A;  5IB9 A;  4C99 A;  4C9A A;  3BHX A;  2OOT A;  4CDJ A;  4C86 A;  5ELY A;  4JYW A;  1V6C A;  4C8T A;  4OC4 A;  2EK8 A;  3I6S A;  2C6C A;  4P4B A;  4C9R A;  5D29 A;  4C8C A;  4P44 A;  3D7F A;  1CX8 A;  4P4I A;  3FED A;  4MCS A;  3BI1 A;  2JBK A;  4NGS A;  2PVV A;  4P4F A;  4OME A;  4P4D A;  4MCP A;  3VTA A;  5F09 A;  4TJX A;  4JZ0 A;  4C8U A;  4C8P A;  2PVW A;  2XEI A;  4OC5 A;  1Z8L A;  2C6P A;  3FEC A;  4X3R A;  4NGP A;  3S9N A;  1Y9Z A;  4MCR A;  2C6G A;  4C9V A;  3SJG A;  4C9E A;  4OC2 A;  4OC1 A;  4W9Y A;  4P45 A;  3IWW A;  3SJF A;  3IIB A;  2JBJ A;  4YN3 A;  4P4E A;  4NGT A;  3BXM A;  4TWE A;  2XEJ A;  3SJX A;  4C85 A;  4C9U A;  3RBU A;  2XEG A;  4TJV A;  3EIF A;  4NGN A; 
#chains in the Genus database with same CATH topology
 3T05 A;  4OC0 A;  3S9M A;  1GGO A;  2D0P A;  5F9M A;  4NGQ A;  2AUN A;  1ZRS A;  4P4J A;  3SJE A;  2XEF A;  1Q5X A;  3D7D A;  1CS0 B;  3EZA A;  2EZB A;  4C8F A;  4IIY A;  1DE4 C;  4OC3 A;  3KAS A;  1T36 B;  2GP4 A;  4KNG E;  3TLA A;  4C8A A;  2OR4 A;  4LQG A;  4NGM A;  3GJZ A;  3BI0 A;  3FEE A;  4C84 A;  5JYB A;  3T5M A;  3D7H A;  3ICU A;  2CIJ A;  4E5S A;  3S9L A;  3T0T A;  4NGR A;  2EK9 A;  3I74 A;  4CDK A;  1WVM A;  1KC7 A;  4MCQ A;  1A9X B;  2HWG A;  1XF1 A;  2FM4 A;  5FD8 A;  3KRV A;  3D7G A;  5IB9 A;  1EZA A;  2AUM A;  4C99 A;  2YJV A;  4C9A A;  3BHX A;  2OOT A;  4CDJ A;  4C86 A;  4MJX A;  5ELY A;  4CO9 A;  4JYW A;  1V6C A;  4C8T A;  4OC4 A;  2C5Q A;  2EK8 A;  3I6S A;  4IIX A;  2C6C A;  2R82 A;  4P4B A;  3TLG B;  4C9R A;  4TJV A;  3TLC A;  2OLS A;  3TLZ A;  5D29 A;  3TLB A;  2X0S A;  3SR3 A;  4C8C A;  4P44 A;  1CX8 A;  4P4I A;  3U1B A;  2E28 A;  3C8O A;  1BXR B;  3TYX A;  3FED A;  2HRO A;  4MCS A;  5F1Y A;  5IR2 A;  4M8D A;  1CE8 B;  3G23 A;  2DIK A;  1ZL0 A;  1J3L A;  3BI1 A;  1KEE B;  1VBH A;  2JBK A;  4NGS A;  2PVV A;  4P4F A;  3EZB A;  4OME A;  4P4D A;  1EZB A;  4MCP A;  3VTA A;  4INJ A;  2EZA A;  2HI6 A;  2B0A A;  5F09 A;  4TJX A;  4JZ0 A;  1JDE A;  4C8U A;  1JDB C;  4C8P A;  4JVO A;  3TLG A;  2PVW A;  2XEI A;  4OC5 A;  3TLE A;  1NBW A;  1Z8L A;  2EZC A;  2C6P A;  3EZE A;  3FEC A;  4X3R A;  4NGP A;  3TLY A;  3S9N A;  1Y9Z A;  4NGN A;  4EYS A;  1C30 B;  3NOJ A;  1C3O B;  4MCR A;  2YJT A;  2D0O A;  2PCN A;  4CZ1 A;  1DIK A;  5F5X A;  4MI1 A;  5K99 A;  2C6G A;  4C9V A;  1KBL A;  3SJG A;  1VBG A;  4OC2 A;  4C9E A;  4OC1 A;  3T07 A;  4W9Y A;  4E94 A;  1R61 A;  1ZYM A;  4P45 A;  2MP0 A;  3IWW A;  3K4I A;  3SJF A;  3IIB A;  2JBJ A;  3K9T A;  1VI4 A;  4YN3 A;  1M6V B;  4COG A;  4P4E A;  4NGT A;  3BXM A;  4TWE A;  2XEJ A;  3SJX A;  4COB A;  4C85 A;  4H1H A;  4C9U A;  1NXJ A;  3RBU A;  2XEG A;  4J0N A;  3FF3 A;  3EIF A;  3D7F A;  5JVL A; 
#chains in the Genus database with same CATH homology
 4OC0 A;  3S9M A;  4NGQ A;  4P4J A;  3FF3 A;  3SJE A;  2XEF A;  3D7D A;  4C8F A;  1DE4 C;  4OC3 A;  3KAS A;  4KNG E;  2GP4 A;  4C8A A;  2OR4 A;  4LQG A;  4NGM A;  3BI0 A;  3FEE A;  4C84 A;  3D7H A;  3ICU A;  2CIJ A;  3S9L A;  4NGR A;  2EK9 A;  3I74 A;  4CDK A;  1WVM A;  4MCQ A;  1XF1 A;  3D7G A;  5IB9 A;  4C99 A;  4C9A A;  3BHX A;  2OOT A;  4CDJ A;  4C86 A;  5ELY A;  4JYW A;  1V6C A;  4C8T A;  4OC4 A;  2C5Q A;  2EK8 A;  3I6S A;  2C6C A;  4P4B A;  4C9R A;  5D29 A;  4C8C A;  4P44 A;  3D7F A;  1CX8 A;  4P4I A;  3FED A;  4MCS A;  5IR2 A;  3BI1 A;  2JBK A;  4NGS A;  2PVV A;  4P4F A;  4OME A;  4P4D A;  4MCP A;  3VTA A;  5F09 A;  4TJX A;  4JZ0 A;  4C8U A;  4C8P A;  2PVW A;  2XEI A;  4OC5 A;  1Z8L A;  2C6P A;  3FEC A;  4X3R A;  4NGP A;  3S9N A;  1Y9Z A;  4MCR A;  2C6G A;  4C9V A;  3SJG A;  4C9E A;  4OC2 A;  4OC1 A;  4W9Y A;  4P45 A;  3IWW A;  3SJF A;  3IIB A;  2JBJ A;  3K9T A;  4YN3 A;  4P4E A;  4NGT A;  3BXM A;  4TWE A;  2XEJ A;  3SJX A;  4C85 A;  4C9U A;  3RBU A;  2XEG A;  4TJV A;  3EIF A;  4NGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...