4C8AA

Mouse znrf3 ectodomain crystal form ii
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
153
structure length
146
Chain Sequence
KETAFVEVVLFESSPSGDYTTHTTGLTGRFSRAGAMLSAEGEIVQMHPLGLCLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
total genus 33
structure length 146
sequence length 153
chains with identical sequence B, C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4c8aA00
2XEFA 4TJXA 4C9EA 3I6SA 3SJEA 5IB9A 4MCRA 5ELYA 3FEDA 4C8CA 2XEIA 4JYWA 1V6CA 4NGSA 2EK9A 4P4EA 4CDKA 4TJVA 2JBJA 2OOTA 4P45A 4W9YA 2OR4A 3RBUA 3S9MA 1XF1A 4C84A 4C8FA 3I74A 3BHXA 3S9LA 5F09A 4OC4A 2C6CA 4CDJA 3SJXA 3ICUA 4KNGE 2EK8A 4P4JA 1Z8LA 3FEEA 2CIJA 4C85A 1DE4C 4OC3A 4C9AA 1CX8A 4C86A 4C8TA 4C9UA 4NGTA 4C9RA 4C8UA 4P4DA 4P4IA 3IWWA 4P4BA 4OMEA 2XEGA 4LQGA 4OC0A 3D7DA 3SJFA 3SJGA 4NGRA 4C99A 3IIBA 4YN3A 3EIFA 3BXMA 4JZ0A 2C6PA 3FF3A 4NGMA 5D29A 3FECA 4C8PA 2JBKA 2PVVA 3BI0A 1WVMA 4OC1A 4OC5A 2XEJA 3KASA 3S9NA 4TWEA 3D7HA 4NGQA 1Y9ZA 4NGNA 4MCPA 2C6GA 4C8AA 2PVWA 4C9VA 3D7GA 4NGPA 3D7FA 4P44A 3VTAA 4X3RA 4P4FA 4MCSA 3BI1A 4MCQA 4OC2A
chains in the Genus database with same CATH superfamily
2XEFA 4TJXA 4C9EA 3I6SA 3TLEA 3SJEA 1C30B 5IB9A 2B0AA 4MCRA 5ELYA 4MI1A 3TLCA 1EZBA 2X0SA 3FEDA 4C8CA 4INJA 2XEIA 3EZBA 3TLYA 5JYBA 4JYWA 1V6CA 1VBHA 4NGSA 2EK9A 4P4EA 2GP4A 3EZAA 1JDEA 5F9MA 1A9XB 2C5QA 2R82A 4CDKA 4TJVA 2JBJA 2OOTA 3K4IA 4P45A 1ZRSA 1JDBC 2OR4A 4W9YA 2E28A 3RBUA 4EYSA 3S9MA 1XF1A 4IIXA 4C84A 4JVOA 4C8FA 3I74A 4CZ1A 3BHXA 5K99A 5F1YA 3TLAA 3S9LA 5F5XA 5F09A 1R61A 2EZAA 4OC4A 2C6CA 1VI4A 1NXJA 4CDJA 2MP0A 3SJXA 1NBWA 3ICUA 4MJXA 4KNGE 2EK8A 2EZBA 1T36B 3K9TA 4P4JA 1Z8LA 1KEEB 4COBA 1EZAA 4CO9A 3FEEA 2CIJA 4C85A 2EZCA 1DIKA 1DE4C 2AUNA 4OC3A 4C9AA 1CX8A 2DIKA 4C86A 5FD8A 3NOJA 4C8TA 2D0OA 2YJTA 3SR3A 4C9UA 4NGTA 4C9RA 4C8UA 2HI6A 4P4DA 4H1HA 4P4IA 3IWWA 4P4BA 4OMEA 3G23A 2XEGA 4LQGA 1M6VB 4M8DA 1VBGA 2YJVA 4OC0A 3D7DA 3SJFA 3SJGA 4NGRA 2AUMA 4C99A 3IIBA 5IR2A 1C3OB 1BXRB 4J0NA 4YN3A 3KRVA 3EIFA 2PCNA 3BXMA 4JZ0A 2C6PA 3FF3A 3T07A 1CE8B 4NGMA 1KC7A 1GGOA 5D29A 2OLSA 3FECA 4C8PA 2JBKA 1CS0B 3T0TA 2PVVA 5JVLA 3BI0A 3EZEA 1WVMA 4E5SA 3C8OA 3GJZA 4IIYA 4OC1A 1Q5XA 3TLBA 4OC5A 2HROA 2XEJA 3KASA 3S9NA 4TWEA 3TLZA 3D7HA 4NGQA 3TYXA 1Y9ZA 4NGNA 4MCPA 4E94A 2C6GA 4C8AA 1ZYMA 2PVWA 3TLGA 1J3LA 4C9VA 3D7GA 4NGPA 3U1BA 1KBLA 3D7FA 4P44A 3TLGB 3T05A 2FM4A 3VTAA 4X3RA 4P4FA 2D0PA 4MCSA 3T5MA 3BI1A 2HWGA 4COGA 1ZL0A 4MCQA 4OC2A
chains in the Genus database with same CATH topology
2XEFA 4TJXA 4C9EA 3I6SA 3SJEA 5IB9A 4MCRA 5ELYA 3FEDA 4C8CA 2XEIA 4JYWA 1V6CA 4NGSA 2EK9A 4P4EA 2GP4A 2C5QA 4CDKA 4TJVA 2JBJA 2OOTA 4P45A 4W9YA 2OR4A 3RBUA 3S9MA 1XF1A 4C84A 4C8FA 3I74A 3BHXA 3S9LA 5F09A 4OC4A 2C6CA 4CDJA 3SJXA 3ICUA 4KNGE 2EK8A 4P4JA 3K9TA 1Z8LA 3FEEA 2CIJA 4C85A 1DE4C 4OC3A 4C9AA 1CX8A 4C86A 4C8TA 4C9UA 4NGTA 4C9RA 4C8UA 4P4DA 4P4IA 3IWWA 4P4BA 4OMEA 2XEGA 4LQGA 4OC0A 3D7DA 3SJFA 3SJGA 4NGRA 4C99A 3IIBA 5IR2A 4YN3A 3EIFA 3BXMA 4JZ0A 2C6PA 3FF3A 4NGMA 5D29A 3FECA 4C8PA 2JBKA 2PVVA 3BI0A 1WVMA 4OC1A 4OC5A 2XEJA 3KASA 3S9NA 4TWEA 3D7HA 4NGQA 1Y9ZA 4NGNA 4MCPA 2C6GA 4C8AA 2PVWA 4C9VA 3D7GA 4NGPA 3D7FA 4P44A 3VTAA 4X3RA 4P4FA 4MCSA 3BI1A 4MCQA 4OC2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XEF A;  4TJX A;  4C9E A;  3I6S A;  3SJE A;  5IB9 A;  4MCR A;  5ELY A;  3FED A;  4C8C A;  2XEI A;  4JYW A;  1V6C A;  4NGS A;  2EK9 A;  4P4E A;  4CDK A;  4TJV A;  2JBJ A;  2OOT A;  4P45 A;  4W9Y A;  2OR4 A;  3RBU A;  3S9M A;  1XF1 A;  4C84 A;  4C8F A;  3I74 A;  3BHX A;  3S9L A;  5F09 A;  4OC4 A;  2C6C A;  4CDJ A;  3SJX A;  3ICU A;  4KNG E;  2EK8 A;  4P4J A;  1Z8L A;  3FEE A;  2CIJ A;  4C85 A;  1DE4 C;  4OC3 A;  4C9A A;  1CX8 A;  4C86 A;  4C8T A;  4C9U A;  4NGT A;  4C9R A;  4C8U A;  4P4D A;  4P4I A;  3IWW A;  4P4B A;  4OME A;  2XEG A;  4LQG A;  4OC0 A;  3D7D A;  3SJF A;  3SJG A;  4NGR A;  4C99 A;  3IIB A;  4YN3 A;  3EIF A;  3BXM A;  4JZ0 A;  2C6P A;  3FF3 A;  4NGM A;  5D29 A;  3FEC A;  4C8P A;  2JBK A;  2PVV A;  3BI0 A;  1WVM A;  4OC1 A;  4OC5 A;  2XEJ A;  3KAS A;  3S9N A;  4TWE A;  3D7H A;  4NGQ A;  1Y9Z A;  4NGN A;  4MCP A;  2C6G A;  4C8A A;  2PVW A;  4C9V A;  3D7G A;  4NGP A;  3D7F A;  4P44 A;  3VTA A;  4X3R A;  4P4F A;  4MCS A;  3BI1 A;  4MCQ A;  4OC2 A; 
#chains in the Genus database with same CATH topology
 2XEF A;  4TJX A;  4C9E A;  3I6S A;  3TLE A;  3SJE A;  1C30 B;  5IB9 A;  2B0A A;  4MCR A;  5ELY A;  4MI1 A;  3TLC A;  1EZB A;  2X0S A;  3FED A;  4C8C A;  4INJ A;  2XEI A;  3EZB A;  3TLY A;  5JYB A;  4JYW A;  1V6C A;  1VBH A;  4NGS A;  2EK9 A;  4P4E A;  2GP4 A;  3EZA A;  1JDE A;  5F9M A;  1A9X B;  2C5Q A;  2R82 A;  4CDK A;  4TJV A;  2JBJ A;  2OOT A;  3K4I A;  4P45 A;  1ZRS A;  1JDB C;  2OR4 A;  4W9Y A;  2E28 A;  3RBU A;  4EYS A;  3S9M A;  1XF1 A;  4IIX A;  4C84 A;  4JVO A;  4C8F A;  3I74 A;  4CZ1 A;  3BHX A;  5K99 A;  5F1Y A;  3TLA A;  3S9L A;  5F5X A;  5F09 A;  1R61 A;  2EZA A;  4OC4 A;  2C6C A;  1VI4 A;  1NXJ A;  4CDJ A;  2MP0 A;  3SJX A;  1NBW A;  3ICU A;  4MJX A;  4KNG E;  2EK8 A;  2EZB A;  1T36 B;  3K9T A;  4P4J A;  1Z8L A;  1KEE B;  4COB A;  1EZA A;  4CO9 A;  3FEE A;  2CIJ A;  4C85 A;  2EZC A;  1DIK A;  1DE4 C;  2AUN A;  4OC3 A;  4C9A A;  1CX8 A;  2DIK A;  4C86 A;  5FD8 A;  3NOJ A;  4C8T A;  2D0O A;  2YJT A;  3SR3 A;  4C9U A;  4NGT A;  4C9R A;  4C8U A;  2HI6 A;  4P4D A;  4H1H A;  4P4I A;  3IWW A;  4P4B A;  4OME A;  3G23 A;  2XEG A;  4LQG A;  1M6V B;  4M8D A;  1VBG A;  2YJV A;  4OC0 A;  3D7D A;  3SJF A;  3SJG A;  4NGR A;  2AUM A;  4C99 A;  3IIB A;  5IR2 A;  1C3O B;  1BXR B;  4J0N A;  4YN3 A;  3KRV A;  3EIF A;  2PCN A;  3BXM A;  4JZ0 A;  2C6P A;  3FF3 A;  3T07 A;  1CE8 B;  4NGM A;  1KC7 A;  1GGO A;  5D29 A;  2OLS A;  3FEC A;  4C8P A;  2JBK A;  1CS0 B;  3T0T A;  2PVV A;  5JVL A;  3BI0 A;  3EZE A;  1WVM A;  4E5S A;  3C8O A;  3GJZ A;  4IIY A;  4OC1 A;  1Q5X A;  3TLB A;  4OC5 A;  2HRO A;  2XEJ A;  3KAS A;  3S9N A;  4TWE A;  3TLZ A;  3D7H A;  4NGQ A;  3TYX A;  1Y9Z A;  4NGN A;  4MCP A;  4E94 A;  2C6G A;  4C8A A;  1ZYM A;  2PVW A;  3TLG A;  1J3L A;  4C9V A;  3D7G A;  4NGP A;  3U1B A;  1KBL A;  3D7F A;  4P44 A;  3TLG B;  3T05 A;  2FM4 A;  3VTA A;  4X3R A;  4P4F A;  2D0P A;  4MCS A;  3T5M A;  3BI1 A;  2HWG A;  4COG A;  1ZL0 A;  4MCQ A;  4OC2 A; 
#chains in the Genus database with same CATH homology
 2XEF A;  4TJX A;  4C9E A;  3I6S A;  3SJE A;  5IB9 A;  4MCR A;  5ELY A;  3FED A;  4C8C A;  2XEI A;  4JYW A;  1V6C A;  4NGS A;  2EK9 A;  4P4E A;  2GP4 A;  2C5Q A;  4CDK A;  4TJV A;  2JBJ A;  2OOT A;  4P45 A;  4W9Y A;  2OR4 A;  3RBU A;  3S9M A;  1XF1 A;  4C84 A;  4C8F A;  3I74 A;  3BHX A;  3S9L A;  5F09 A;  4OC4 A;  2C6C A;  4CDJ A;  3SJX A;  3ICU A;  4KNG E;  2EK8 A;  4P4J A;  3K9T A;  1Z8L A;  3FEE A;  2CIJ A;  4C85 A;  1DE4 C;  4OC3 A;  4C9A A;  1CX8 A;  4C86 A;  4C8T A;  4C9U A;  4NGT A;  4C9R A;  4C8U A;  4P4D A;  4P4I A;  3IWW A;  4P4B A;  4OME A;  2XEG A;  4LQG A;  4OC0 A;  3D7D A;  3SJF A;  3SJG A;  4NGR A;  4C99 A;  3IIB A;  5IR2 A;  4YN3 A;  3EIF A;  3BXM A;  4JZ0 A;  2C6P A;  3FF3 A;  4NGM A;  5D29 A;  3FEC A;  4C8P A;  2JBK A;  2PVV A;  3BI0 A;  1WVM A;  4OC1 A;  4OC5 A;  2XEJ A;  3KAS A;  3S9N A;  4TWE A;  3D7H A;  4NGQ A;  1Y9Z A;  4NGN A;  4MCP A;  2C6G A;  4C8A A;  2PVW A;  4C9V A;  3D7G A;  4NGP A;  3D7F A;  4P44 A;  3VTA A;  4X3R A;  4P4F A;  4MCS A;  3BI1 A;  4MCQ A;  4OC2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...