4C8AA

Mouse znrf3 ectodomain crystal form ii
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
153
structure length
146
Chain Sequence
KETAFVEVVLFESSPSGDYTTHTTGLTGRFSRAGAMLSAEGEIVQMHPLGLCLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
publication title Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb
source organism Mus musculus
total genus 33
structure length 146
sequence length 153
chains with identical sequence B, C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4c8aA00
3FF3A 4TJXA 5IB9A 2C6GA 2C6CA 4MCQA 2XEIA 3D7DA 4MCSA 4C9RA 4OC5A 3IIBA 4P4JA 4C9AA 4C84A 4P4BA 3BHXA 2XEJA 4OC4A 1Z8LA 3IWWA 3SJEA 4OMEA 4P4IA 3BXMA 4CDKA 5D29A 1WVMA 4W9YA 3FEEA 2EK8A 4C8TA 3D7FA 2JBKA 4NGPA 2EK9A 4P4DA 2PVVA 2OOTA 4OC1A 3I6SA 3S9LA 4C99A 3S9MA 3VTAA 3SJFA 2OR4A 3S9NA 3BI0A 3KASA 4NGSA 3SJXA 4X3RA 3D7HA 2CIJA 1DE4C 2PVWA 3FEDA 4C8FA 4YN3A 4MCPA 4TJVA 4KNGE 5ELYA 4C9EA 2XEGA 1V6CA 4CDJA 2JBJA 4NGTA 4JYWA 4NGRA 4C86A 4NGNA 4C8AA 3BI1A 4NGMA 4OC0A 4C85A 2XEFA 3D7GA 3EIFA 4P4EA 4P44A 3SJGA 5F09A 1Y9ZA 4C9VA 4TWEA 1XF1A 2C6PA 3I74A 4NGQA 4OC3A 4MCRA 3ICUA 4P4FA 4C8CA 1CX8A 3FECA 3RBUA 4OC2A 4P45A 4C8UA 4LQGA 4C8PA 4C9UA 4JZ0A
chains in the Genus database with same CATH superfamily
3TLYA 3FF3A 4TJXA 1KBLA 2AUNA 5IB9A 2C6GA 3U1BA 2C6CA 3KRVA 4MCQA 3TLBA 2XEIA 3NOJA 3D7DA 4MCSA 4C9RA 4OC5A 1NBWA 4E94A 1DIKA 3IIBA 4P4JA 1VI4A 4C9AA 2HI6A 4C84A 2D0OA 1VBHA 1ZRSA 4P4BA 3SR3A 3BHXA 2XEJA 4OC4A 4E5SA 1BXRB 1Z8LA 1J3LA 1A9XB 3IWWA 3SJEA 2GP4A 4OMEA 3TLAA 4P4IA 4COGA 3K9TA 4J0NA 3BXMA 4CDKA 3GJZA 2EZAA 3TLGB 2PCNA 5JYBA 5D29A 4MJXA 1WVMA 5F9MA 4W9YA 3FEEA 2EK8A 2EZCA 3D7FA 3EZAA 2JBKA 4C8TA 4NGPA 2EK9A 5JVLA 4MI1A 4P4DA 2PVVA 4M8DA 2OOTA 4OC1A 2AUMA 3I6SA 3S9LA 4C99A 5K99A 3S9MA 3TYXA 3VTAA 3SJFA 2OR4A 2MP0A 3S9NA 1R61A 4EYSA 3EZBA 3T07A 3TLZA 1KC7A 3BI0A 3KASA 1NXJA 4NGSA 4IIYA 3SJXA 4X3RA 3D7HA 2CIJA 1EZBA 1DE4C 2PVWA 3FEDA 3T5MA 4LQGA 2HWGA 4C8FA 4YN3A 1JDEA 4MCPA 4TJVA 4KNGE 5ELYA 4C9EA 2XEGA 1V6CA 2D0PA 2HROA 4H1HA 4CO9A 4CDJA 2E28A 2JBJA 1CE8B 2R82A 4INJA 4JYWA 4NGTA 4NGRA 2DIKA 5IR2A 3TLGA 4C86A 2X0SA 1ZYMA 4NGNA 4C8AA 2OLSA 3BI1A 4NGMA 1Q5XA 2B0AA 3C8OA 3TLCA 1C3OB 4OC0A 5FD8A 2XEFA 3D7GA 3EIFA 4P4EA 4C85A 4COBA 3T0TA 1JDBC 1CS0B 4P44A 3SJGA 3T05A 5F09A 1Y9ZA 1GGOA 1VBGA 4TWEA 4C9VA 1XF1A 2C6PA 1T36B 3I74A 4CZ1A 1M6VB 3EZEA 3TLEA 1ZL0A 5F1YA 1C30B 4NGQA 4OC3A 1KEEB 4MCRA 1EZAA 2FM4A 3G23A 2C5QA 3ICUA 3K4IA 5F5XA 4JVOA 4P4FA 4C8CA 1CX8A 2YJTA 3FECA 3RBUA 4OC2A 2EZBA 2YJVA 4P45A 4C8UA 4IIXA 4C8PA 4C9UA 4JZ0A
chains in the Genus database with same CATH topology
3FF3A 4TJXA 5IB9A 2C6GA 2C6CA 4MCQA 2XEIA 3D7DA 4MCSA 4C9RA 4OC5A 3IIBA 4P4JA 4C9AA 4C84A 4P4BA 3BHXA 2XEJA 4OC4A 1Z8LA 3IWWA 3SJEA 2GP4A 4OMEA 4P4IA 3K9TA 3BXMA 4CDKA 5D29A 1WVMA 4W9YA 3FEEA 2EK8A 4C8TA 3D7FA 2JBKA 4NGPA 2EK9A 4P4DA 2PVVA 2OOTA 4OC1A 3I6SA 3S9LA 4C99A 3S9MA 3VTAA 3SJFA 2OR4A 3S9NA 3BI0A 3KASA 4NGSA 3SJXA 4X3RA 3D7HA 2CIJA 1DE4C 2PVWA 3FEDA 4C8FA 4YN3A 4MCPA 4TJVA 4KNGE 5ELYA 4C9EA 2XEGA 1V6CA 4CDJA 2JBJA 4NGTA 5IR2A 4JYWA 4NGRA 4C86A 4NGNA 4C8AA 3BI1A 4NGMA 4OC0A 4C85A 2XEFA 3D7GA 3EIFA 4P4EA 4P44A 3SJGA 5F09A 1Y9ZA 4C9VA 4TWEA 1XF1A 2C6PA 3I74A 4NGQA 4OC3A 4MCRA 3ICUA 2C5QA 4P4FA 4C8CA 1CX8A 3FECA 3RBUA 4OC2A 4P45A 4C8UA 4LQGA 4C8PA 4C9UA 4JZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FF3 A;  4TJX A;  5IB9 A;  2C6G A;  2C6C A;  4MCQ A;  2XEI A;  3D7D A;  4MCS A;  4C9R A;  4OC5 A;  3IIB A;  4P4J A;  4C9A A;  4C84 A;  4P4B A;  3BHX A;  2XEJ A;  4OC4 A;  1Z8L A;  3IWW A;  3SJE A;  4OME A;  4P4I A;  3BXM A;  4CDK A;  5D29 A;  1WVM A;  4W9Y A;  3FEE A;  2EK8 A;  4C8T A;  3D7F A;  2JBK A;  4NGP A;  2EK9 A;  4P4D A;  2PVV A;  2OOT A;  4OC1 A;  3I6S A;  3S9L A;  4C99 A;  3S9M A;  3VTA A;  3SJF A;  2OR4 A;  3S9N A;  3BI0 A;  3KAS A;  4NGS A;  3SJX A;  4X3R A;  3D7H A;  2CIJ A;  1DE4 C;  2PVW A;  3FED A;  4C8F A;  4YN3 A;  4MCP A;  4TJV A;  4KNG E;  5ELY A;  4C9E A;  2XEG A;  1V6C A;  4CDJ A;  2JBJ A;  4NGT A;  4JYW A;  4NGR A;  4C86 A;  4NGN A;  4C8A A;  3BI1 A;  4NGM A;  4OC0 A;  4C85 A;  2XEF A;  3D7G A;  3EIF A;  4P4E A;  4P44 A;  3SJG A;  5F09 A;  1Y9Z A;  4C9V A;  4TWE A;  1XF1 A;  2C6P A;  3I74 A;  4NGQ A;  4OC3 A;  4MCR A;  3ICU A;  4P4F A;  4C8C A;  1CX8 A;  3FEC A;  3RBU A;  4OC2 A;  4P45 A;  4C8U A;  4LQG A;  4C8P A;  4C9U A;  4JZ0 A; 
#chains in the Genus database with same CATH topology
 3TLY A;  3FF3 A;  4TJX A;  1KBL A;  2AUN A;  5IB9 A;  2C6G A;  3U1B A;  2C6C A;  3KRV A;  4MCQ A;  3TLB A;  2XEI A;  3NOJ A;  3D7D A;  4MCS A;  4C9R A;  4OC5 A;  1NBW A;  4E94 A;  1DIK A;  3IIB A;  4P4J A;  1VI4 A;  4C9A A;  2HI6 A;  4C84 A;  2D0O A;  1VBH A;  1ZRS A;  4P4B A;  3SR3 A;  3BHX A;  2XEJ A;  4OC4 A;  4E5S A;  1BXR B;  1Z8L A;  1J3L A;  1A9X B;  3IWW A;  3SJE A;  2GP4 A;  4OME A;  3TLA A;  4P4I A;  4COG A;  3K9T A;  4J0N A;  3BXM A;  4CDK A;  3GJZ A;  2EZA A;  3TLG B;  2PCN A;  5JYB A;  5D29 A;  4MJX A;  1WVM A;  5F9M A;  4W9Y A;  3FEE A;  2EK8 A;  2EZC A;  3D7F A;  3EZA A;  2JBK A;  4C8T A;  4NGP A;  2EK9 A;  5JVL A;  4MI1 A;  4P4D A;  2PVV A;  4M8D A;  2OOT A;  4OC1 A;  2AUM A;  3I6S A;  3S9L A;  4C99 A;  5K99 A;  3S9M A;  3TYX A;  3VTA A;  3SJF A;  2OR4 A;  2MP0 A;  3S9N A;  1R61 A;  4EYS A;  3EZB A;  3T07 A;  3TLZ A;  1KC7 A;  3BI0 A;  3KAS A;  1NXJ A;  4NGS A;  4IIY A;  3SJX A;  4X3R A;  3D7H A;  2CIJ A;  1EZB A;  1DE4 C;  2PVW A;  3FED A;  3T5M A;  4LQG A;  2HWG A;  4C8F A;  4YN3 A;  1JDE A;  4MCP A;  4TJV A;  4KNG E;  5ELY A;  4C9E A;  2XEG A;  1V6C A;  2D0P A;  2HRO A;  4H1H A;  4CO9 A;  4CDJ A;  2E28 A;  2JBJ A;  1CE8 B;  2R82 A;  4INJ A;  4JYW A;  4NGT A;  4NGR A;  2DIK A;  5IR2 A;  3TLG A;  4C86 A;  2X0S A;  1ZYM A;  4NGN A;  4C8A A;  2OLS A;  3BI1 A;  4NGM A;  1Q5X A;  2B0A A;  3C8O A;  3TLC A;  1C3O B;  4OC0 A;  5FD8 A;  2XEF A;  3D7G A;  3EIF A;  4P4E A;  4C85 A;  4COB A;  3T0T A;  1JDB C;  1CS0 B;  4P44 A;  3SJG A;  3T05 A;  5F09 A;  1Y9Z A;  1GGO A;  1VBG A;  4TWE A;  4C9V A;  1XF1 A;  2C6P A;  1T36 B;  3I74 A;  4CZ1 A;  1M6V B;  3EZE A;  3TLE A;  1ZL0 A;  5F1Y A;  1C30 B;  4NGQ A;  4OC3 A;  1KEE B;  4MCR A;  1EZA A;  2FM4 A;  3G23 A;  2C5Q A;  3ICU A;  3K4I A;  5F5X A;  4JVO A;  4P4F A;  4C8C A;  1CX8 A;  2YJT A;  3FEC A;  3RBU A;  4OC2 A;  2EZB A;  2YJV A;  4P45 A;  4C8U A;  4IIX A;  4C8P A;  4C9U A;  4JZ0 A; 
#chains in the Genus database with same CATH homology
 3FF3 A;  4TJX A;  5IB9 A;  2C6G A;  2C6C A;  4MCQ A;  2XEI A;  3D7D A;  4MCS A;  4C9R A;  4OC5 A;  3IIB A;  4P4J A;  4C9A A;  4C84 A;  4P4B A;  3BHX A;  2XEJ A;  4OC4 A;  1Z8L A;  3IWW A;  3SJE A;  2GP4 A;  4OME A;  4P4I A;  3K9T A;  3BXM A;  4CDK A;  5D29 A;  1WVM A;  4W9Y A;  3FEE A;  2EK8 A;  4C8T A;  3D7F A;  2JBK A;  4NGP A;  2EK9 A;  4P4D A;  2PVV A;  2OOT A;  4OC1 A;  3I6S A;  3S9L A;  4C99 A;  3S9M A;  3VTA A;  3SJF A;  2OR4 A;  3S9N A;  3BI0 A;  3KAS A;  4NGS A;  3SJX A;  4X3R A;  3D7H A;  2CIJ A;  1DE4 C;  2PVW A;  3FED A;  4C8F A;  4YN3 A;  4MCP A;  4TJV A;  4KNG E;  5ELY A;  4C9E A;  2XEG A;  1V6C A;  4CDJ A;  2JBJ A;  4NGT A;  5IR2 A;  4JYW A;  4NGR A;  4C86 A;  4NGN A;  4C8A A;  3BI1 A;  4NGM A;  4OC0 A;  4C85 A;  2XEF A;  3D7G A;  3EIF A;  4P4E A;  4P44 A;  3SJG A;  5F09 A;  1Y9Z A;  4C9V A;  4TWE A;  1XF1 A;  2C6P A;  3I74 A;  4NGQ A;  4OC3 A;  4MCR A;  3ICU A;  2C5Q A;  4P4F A;  4C8C A;  1CX8 A;  3FEC A;  3RBU A;  4OC2 A;  4P45 A;  4C8U A;  4LQG A;  4C8P A;  4C9U A;  4JZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...