4C8AA

Mouse znrf3 ectodomain crystal form ii
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
153
structure length
146
Chain Sequence
KETAFVEVVLFESSPSGDYTTHTTGLTGRFSRAGAMLSAEGEIVQMHPLGLCLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
publication title Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
total genus 33
structure length 146
sequence length 153
chains with identical sequence B, C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4c8aA00
2OR4A 4C86A 3FECA 2XEJA 3D7GA 1Z8LA 4P4IA 4TJXA 4OC4A 4CDJA 1V6CA 4C8PA 3EIFA 4NGTA 4YN3A 4C99A 4JYWA 4P44A 4LQGA 3KASA 4TJVA 2XEFA 1Y9ZA 2C6PA 4OC2A 4MCPA 4X3RA 4NGQA 1CX8A 3BI0A 4C9VA 3BHXA 3BI1A 4MCSA 3SJGA 1DE4C 3S9NA 4P4DA 3FEEA 5IB9A 1WVMA 4MCQA 4P4JA 3I6SA 2JBKA 4OMEA 4W9YA 4C8UA 4NGSA 4C9RA 4CDKA 4NGNA 3SJXA 4C8FA 3IWWA 2XEGA 4OC5A 4OC0A 3SJFA 2OOTA 4NGPA 2PVWA 3ICUA 3IIBA 1XF1A 3S9MA 2C6CA 2C6GA 4NGRA 4C9AA 4JZ0A 4P4BA 2XEIA 3D7FA 4C8TA 4C8CA 4C84A 4C9UA 3D7DA 2JBJA 5D29A 3D7HA 3RBUA 4KNGE 4MCRA 5ELYA 4C9EA 3FEDA 3VTAA 4OC3A 4TWEA 4C85A 2CIJA 3I74A 3SJEA 5F09A 3BXMA 4C8AA 2EK9A 3FF3A 2PVVA 4P4EA 4NGMA 2EK8A 4OC1A 4P4FA 4P45A 3S9LA
chains in the Genus database with same CATH superfamily
3TLEA 2OR4A 3TLCA 4C86A 2EZBA 1JDEA 3FECA 2XEJA 1C30B 1BXRB 1CS0B 4IIYA 3D7GA 1ZL0A 1Z8LA 4MI1A 4P4IA 3K9TA 1GGOA 4OC4A 4TJXA 3TLBA 4CDJA 1V6CA 4C8PA 1NXJA 3EIFA 4J0NA 4NGTA 4YN3A 5FD8A 4C99A 4JYWA 5F1YA 4P44A 1ZRSA 2DIKA 2D0OA 2HROA 4IIXA 4COBA 2AUMA 4JVOA 3TLZA 4LQGA 3TLGB 3KASA 4TJVA 2XEFA 1Y9ZA 3C8OA 2C6PA 4OC2A 4MCPA 4X3RA 2E28A 5F5XA 3NOJA 4NGQA 1CX8A 2X0SA 3BI0A 4M8DA 4C9VA 3BHXA 1VBHA 3BI1A 4MCSA 3SJGA 1DE4C 3SR3A 2FM4A 3S9NA 4H1HA 1Q5XA 4P4DA 3FEEA 5IB9A 1WVMA 4MCQA 3K4IA 4P4JA 2B0AA 1NBWA 2JBKA 3I6SA 4OMEA 4W9YA 1EZBA 1JDBC 4C8UA 5K99A 4NGSA 4C9RA 5JVLA 4CDKA 1T36B 2R82A 4NGNA 3SJXA 4C8FA 3IWWA 2XEGA 4OC5A 2GP4A 4OC0A 1CE8B 3SJFA 4INJA 5JYBA 2OOTA 2C5QA 4NGPA 2PVWA 3ICUA 3TLGA 3IIBA 1XF1A 3S9MA 2C6CA 2C6GA 4NGRA 2EZCA 4JZ0A 4P4BA 4C9AA 4E5SA 2XEIA 3D7FA 5IR2A 3TLYA 2AUNA 1M6VB 4C8TA 1KEEB 4C84A 4C8CA 2OLSA 4C9UA 3D7DA 1VI4A 2YJTA 3TYXA 2JBJA 5D29A 4EYSA 3EZEA 3D7HA 1KC7A 3RBUA 1EZAA 1VBGA 4KNGE 1C3OB 4COGA 3T05A 4MCRA 2EZAA 2D0PA 5ELYA 4MJXA 4C9EA 4CO9A 3FEDA 3VTAA 3T0TA 1J3LA 4OC3A 2MP0A 4TWEA 4C85A 2CIJA 3I74A 3SJEA 1DIKA 2HWGA 5F09A 5F9MA 3GJZA 3BXMA 3KRVA 4C8AA 4E94A 2EK9A 1ZYMA 1A9XB 3FF3A 3EZAA 2PVVA 3T07A 3U1BA 2PCNA 4P4EA 3TLAA 4NGMA 2EK8A 2HI6A 4OC1A 4P4FA 3EZBA 4P45A 4CZ1A 1R61A 3G23A 2YJVA 1KBLA 3T5MA 3S9LA
chains in the Genus database with same CATH topology
2OR4A 4C86A 3FECA 2XEJA 3D7GA 1Z8LA 4P4IA 3K9TA 4TJXA 4OC4A 4CDJA 1V6CA 4C8PA 3EIFA 4NGTA 4YN3A 4C99A 4JYWA 4P44A 4LQGA 3KASA 4TJVA 2XEFA 1Y9ZA 2C6PA 4OC2A 4MCPA 4X3RA 4NGQA 1CX8A 3BI0A 4C9VA 3BHXA 3BI1A 4MCSA 3SJGA 1DE4C 3S9NA 4P4DA 3FEEA 5IB9A 1WVMA 4MCQA 4P4JA 3I6SA 2JBKA 4OMEA 4W9YA 4C8UA 4NGSA 4C9RA 4CDKA 4NGNA 3SJXA 4C8FA 3IWWA 2XEGA 4OC5A 2GP4A 4OC0A 3SJFA 2OOTA 2C5QA 4NGPA 2PVWA 3ICUA 3IIBA 1XF1A 3S9MA 2C6CA 2C6GA 4NGRA 4C9AA 4JZ0A 4P4BA 2XEIA 3D7FA 5IR2A 4C8TA 4C8CA 4C84A 4C9UA 3D7DA 2JBJA 5D29A 3D7HA 3RBUA 4KNGE 4MCRA 5ELYA 4C9EA 3FEDA 3VTAA 4OC3A 4TWEA 4C85A 2CIJA 3I74A 3SJEA 5F09A 3BXMA 4C8AA 2EK9A 3FF3A 2PVVA 4P4EA 4NGMA 2EK8A 4OC1A 4P4FA 4P45A 3S9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OR4 A;  4C86 A;  3FEC A;  2XEJ A;  3D7G A;  1Z8L A;  4P4I A;  4TJX A;  4OC4 A;  4CDJ A;  1V6C A;  4C8P A;  3EIF A;  4NGT A;  4YN3 A;  4C99 A;  4JYW A;  4P44 A;  4LQG A;  3KAS A;  4TJV A;  2XEF A;  1Y9Z A;  2C6P A;  4OC2 A;  4MCP A;  4X3R A;  4NGQ A;  1CX8 A;  3BI0 A;  4C9V A;  3BHX A;  3BI1 A;  4MCS A;  3SJG A;  1DE4 C;  3S9N A;  4P4D A;  3FEE A;  5IB9 A;  1WVM A;  4MCQ A;  4P4J A;  3I6S A;  2JBK A;  4OME A;  4W9Y A;  4C8U A;  4NGS A;  4C9R A;  4CDK A;  4NGN A;  3SJX A;  4C8F A;  3IWW A;  2XEG A;  4OC5 A;  4OC0 A;  3SJF A;  2OOT A;  4NGP A;  2PVW A;  3ICU A;  3IIB A;  1XF1 A;  3S9M A;  2C6C A;  2C6G A;  4NGR A;  4C9A A;  4JZ0 A;  4P4B A;  2XEI A;  3D7F A;  4C8T A;  4C8C A;  4C84 A;  4C9U A;  3D7D A;  2JBJ A;  5D29 A;  3D7H A;  3RBU A;  4KNG E;  4MCR A;  5ELY A;  4C9E A;  3FED A;  3VTA A;  4OC3 A;  4TWE A;  4C85 A;  2CIJ A;  3I74 A;  3SJE A;  5F09 A;  3BXM A;  4C8A A;  2EK9 A;  3FF3 A;  2PVV A;  4P4E A;  4NGM A;  2EK8 A;  4OC1 A;  4P4F A;  4P45 A;  3S9L A; 
#chains in the Genus database with same CATH topology
 3TLE A;  2OR4 A;  3TLC A;  4C86 A;  2EZB A;  1JDE A;  3FEC A;  2XEJ A;  1C30 B;  1BXR B;  1CS0 B;  4IIY A;  3D7G A;  1ZL0 A;  1Z8L A;  4MI1 A;  4P4I A;  3K9T A;  1GGO A;  4OC4 A;  4TJX A;  3TLB A;  4CDJ A;  1V6C A;  4C8P A;  1NXJ A;  3EIF A;  4J0N A;  4NGT A;  4YN3 A;  5FD8 A;  4C99 A;  4JYW A;  5F1Y A;  4P44 A;  1ZRS A;  2DIK A;  2D0O A;  2HRO A;  4IIX A;  4COB A;  2AUM A;  4JVO A;  3TLZ A;  4LQG A;  3TLG B;  3KAS A;  4TJV A;  2XEF A;  1Y9Z A;  3C8O A;  2C6P A;  4OC2 A;  4MCP A;  4X3R A;  2E28 A;  5F5X A;  3NOJ A;  4NGQ A;  1CX8 A;  2X0S A;  3BI0 A;  4M8D A;  4C9V A;  3BHX A;  1VBH A;  3BI1 A;  4MCS A;  3SJG A;  1DE4 C;  3SR3 A;  2FM4 A;  3S9N A;  4H1H A;  1Q5X A;  4P4D A;  3FEE A;  5IB9 A;  1WVM A;  4MCQ A;  3K4I A;  4P4J A;  2B0A A;  1NBW A;  2JBK A;  3I6S A;  4OME A;  4W9Y A;  1EZB A;  1JDB C;  4C8U A;  5K99 A;  4NGS A;  4C9R A;  5JVL A;  4CDK A;  1T36 B;  2R82 A;  4NGN A;  3SJX A;  4C8F A;  3IWW A;  2XEG A;  4OC5 A;  2GP4 A;  4OC0 A;  1CE8 B;  3SJF A;  4INJ A;  5JYB A;  2OOT A;  2C5Q A;  4NGP A;  2PVW A;  3ICU A;  3TLG A;  3IIB A;  1XF1 A;  3S9M A;  2C6C A;  2C6G A;  4NGR A;  2EZC A;  4JZ0 A;  4P4B A;  4C9A A;  4E5S A;  2XEI A;  3D7F A;  5IR2 A;  3TLY A;  2AUN A;  1M6V B;  4C8T A;  1KEE B;  4C84 A;  4C8C A;  2OLS A;  4C9U A;  3D7D A;  1VI4 A;  2YJT A;  3TYX A;  2JBJ A;  5D29 A;  4EYS A;  3EZE A;  3D7H A;  1KC7 A;  3RBU A;  1EZA A;  1VBG A;  4KNG E;  1C3O B;  4COG A;  3T05 A;  4MCR A;  2EZA A;  2D0P A;  5ELY A;  4MJX A;  4C9E A;  4CO9 A;  3FED A;  3VTA A;  3T0T A;  1J3L A;  4OC3 A;  2MP0 A;  4TWE A;  4C85 A;  2CIJ A;  3I74 A;  3SJE A;  1DIK A;  2HWG A;  5F09 A;  5F9M A;  3GJZ A;  3BXM A;  3KRV A;  4C8A A;  4E94 A;  2EK9 A;  1ZYM A;  1A9X B;  3FF3 A;  3EZA A;  2PVV A;  3T07 A;  3U1B A;  2PCN A;  4P4E A;  3TLA A;  4NGM A;  2EK8 A;  2HI6 A;  4OC1 A;  4P4F A;  3EZB A;  4P45 A;  4CZ1 A;  1R61 A;  3G23 A;  2YJV A;  1KBL A;  3T5M A;  3S9L A; 
#chains in the Genus database with same CATH homology
 2OR4 A;  4C86 A;  3FEC A;  2XEJ A;  3D7G A;  1Z8L A;  4P4I A;  3K9T A;  4TJX A;  4OC4 A;  4CDJ A;  1V6C A;  4C8P A;  3EIF A;  4NGT A;  4YN3 A;  4C99 A;  4JYW A;  4P44 A;  4LQG A;  3KAS A;  4TJV A;  2XEF A;  1Y9Z A;  2C6P A;  4OC2 A;  4MCP A;  4X3R A;  4NGQ A;  1CX8 A;  3BI0 A;  4C9V A;  3BHX A;  3BI1 A;  4MCS A;  3SJG A;  1DE4 C;  3S9N A;  4P4D A;  3FEE A;  5IB9 A;  1WVM A;  4MCQ A;  4P4J A;  3I6S A;  2JBK A;  4OME A;  4W9Y A;  4C8U A;  4NGS A;  4C9R A;  4CDK A;  4NGN A;  3SJX A;  4C8F A;  3IWW A;  2XEG A;  4OC5 A;  2GP4 A;  4OC0 A;  3SJF A;  2OOT A;  2C5Q A;  4NGP A;  2PVW A;  3ICU A;  3IIB A;  1XF1 A;  3S9M A;  2C6C A;  2C6G A;  4NGR A;  4C9A A;  4JZ0 A;  4P4B A;  2XEI A;  3D7F A;  5IR2 A;  4C8T A;  4C8C A;  4C84 A;  4C9U A;  3D7D A;  2JBJ A;  5D29 A;  3D7H A;  3RBU A;  4KNG E;  4MCR A;  5ELY A;  4C9E A;  3FED A;  3VTA A;  4OC3 A;  4TWE A;  4C85 A;  2CIJ A;  3I74 A;  3SJE A;  5F09 A;  3BXM A;  4C8A A;  2EK9 A;  3FF3 A;  2PVV A;  4P4E A;  4NGM A;  2EK8 A;  4OC1 A;  4P4F A;  4P45 A;  3S9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...