4C8AA

Mouse znrf3 ectodomain crystal form ii
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
153
structure length
146
Chain Sequence
KETAFVEVVLFESSPSGDYTTHTTGLTGRFSRAGAMLSAEGEIVQMHPLGLCLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
publication title Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
total genus 33
structure length 146
sequence length 153
chains with identical sequence B, C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4c8aA00
2OR4A 3BI1A 4OC2A 4P4DA 3FEDA 4C99A 3ICUA 3FEEA 4OC0A 3BHXA 4X3RA 3EIFA 2JBKA 4NGTA 4C9EA 4C9UA 4TWEA 4NGNA 4TJVA 4MCRA 4C86A 4NGMA 4MCPA 4OMEA 3S9LA 4C8AA 3SJXA 3SJFA 4JZ0A 4LQGA 4MCSA 4OC1A 2OOTA 4P44A 3BXMA 4CDJA 3D7FA 3KASA 5F09A 3FF3A 4P4FA 4OC5A 1V6CA 2PVWA 4C8FA 4P4EA 4C8TA 3S9NA 4C85A 2EK9A 3SJGA 4C8UA 2EK8A 4C84A 4P45A 2C6PA 5ELYA 3D7GA 4C9RA 3D7DA 4P4JA 2XEGA 4NGQA 3BI0A 4KNGE 5IB9A 1Y9ZA 1Z8LA 4OC4A 4P4BA 4NGSA 4OC3A 3RBUA 3IIBA 4C9VA 1CX8A 2JBJA 2C6GA 2C6CA 4TJXA 2XEIA 4P4IA 4W9YA 4C8PA 2CIJA 3I74A 2XEJA 1WVMA 3FECA 4C8CA 2XEFA 2PVVA 4NGRA 3VTAA 3IWWA 3SJEA 4C9AA 3I6SA 4CDKA 1XF1A 1DE4C 4YN3A 4NGPA 4MCQA 5D29A 3D7HA 4JYWA 3S9MA
chains in the Genus database with same CATH superfamily
4M8DA 2OR4A 3BI1A 4OC2A 4P4DA 3TLAA 2C5QA 1KEEB 3FEDA 4C99A 3ICUA 1CS0B 4EYSA 3C8OA 3FEEA 3G23A 4OC0A 3BHXA 4X3RA 5K99A 3EIFA 1M6VB 2JBKA 4NGTA 2EZAA 4H1HA 4C9EA 1VBHA 4C9UA 1DIKA 2EZBA 4TWEA 1KC7A 4NGNA 1VI4A 5F5XA 4TJVA 3TLZA 4MCRA 4JVOA 4C86A 4NGMA 3U1BA 5FD8A 2AUMA 3KRVA 4MCPA 4OMEA 1ZRSA 2YJVA 2FM4A 5JYBA 2GP4A 1A9XB 1NXJA 4C8AA 3SJXA 1R61A 3S9LA 3SJFA 4JZ0A 2YJTA 4LQGA 4MCSA 4OC1A 1T36B 4MI1A 2OOTA 3T5MA 4P44A 2OLSA 3BXMA 3K4IA 3EZAA 4CDJA 3D7FA 5IR2A 3KASA 3EZEA 5F9MA 3TLYA 5F09A 1ZYMA 1EZBA 1JDEA 3SR3A 4MJXA 3T07A 3TLCA 1EZAA 3FF3A 4P4FA 4OC5A 1V6CA 2PCNA 2PVWA 4C8FA 4P4EA 4C8TA 2B0AA 4C85A 3S9NA 2EK9A 1C3OB 3SJGA 4C8UA 2EK8A 1C30B 4IIYA 4C84A 3K9TA 2C6PA 4P45A 5ELYA 3D7GA 4E94A 4C9RA 1ZL0A 3D7DA 4COGA 4P4JA 2XEGA 4NGQA 3BI0A 4KNGE 5IB9A 1Y9ZA 1Z8LA 2HI6A 4OC4A 4P4BA 5F1YA 4E5SA 4NGSA 4OC3A 3RBUA 3IIBA 4C9VA 2HROA 3TLEA 1CX8A 1Q5XA 2JBJA 2C6GA 4COBA 2C6CA 4TJXA 2AUNA 2XEIA 2EZCA 4P4IA 3TYXA 2DIKA 2MP0A 4W9YA 4IIXA 2D0OA 2X0SA 4C8PA 2CIJA 3NOJA 3I74A 2XEJA 1BXRB 1WVMA 3FECA 4C8CA 2XEFA 5JVLA 4INJA 2PVVA 4NGRA 3VTAA 3IWWA 3EZBA 3SJEA 4C9AA 1J3LA 1NBWA 3I6SA 4J0NA 2R82A 3T05A 4CDKA 1XF1A 3T0TA 1DE4C 3GJZA 4YN3A 3TLGA 4NGPA 4MCQA 1JDBC 4CO9A 1VBGA 5D29A 2HWGA 3D7HA 1GGOA 2D0PA 1CE8B 3TLGB 1KBLA 4JYWA 3S9MA 3TLBA 4CZ1A 2E28A
chains in the Genus database with same CATH topology
2OR4A 3BI1A 4OC2A 4P4DA 2C5QA 3FEDA 4C99A 3ICUA 3FEEA 4OC0A 3BHXA 4X3RA 3EIFA 2JBKA 4NGTA 4C9EA 4C9UA 4TWEA 4NGNA 4TJVA 4MCRA 4C86A 4NGMA 4MCPA 4OMEA 2GP4A 4C8AA 3S9LA 3SJXA 3SJFA 4JZ0A 4LQGA 4MCSA 4OC1A 2OOTA 4P44A 3BXMA 4CDJA 3D7FA 5IR2A 3KASA 5F09A 3FF3A 4P4FA 4OC5A 1V6CA 2PVWA 4C8FA 4P4EA 4C8TA 3S9NA 4C85A 2EK9A 3SJGA 4C8UA 2EK8A 4C84A 3K9TA 2C6PA 4P45A 5ELYA 3D7GA 4C9RA 3D7DA 4P4JA 2XEGA 4NGQA 3BI0A 4KNGE 5IB9A 1Y9ZA 1Z8LA 4OC4A 4P4BA 4NGSA 4OC3A 3RBUA 3IIBA 4C9VA 1CX8A 2JBJA 2C6GA 2C6CA 4TJXA 2XEIA 4P4IA 4W9YA 4C8PA 2CIJA 3I74A 2XEJA 1WVMA 3FECA 4C8CA 2XEFA 2PVVA 4NGRA 3VTAA 3IWWA 3SJEA 4C9AA 3I6SA 4CDKA 1XF1A 1DE4C 4YN3A 4NGPA 4MCQA 5D29A 3D7HA 4JYWA 3S9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OR4 A;  3BI1 A;  4OC2 A;  4P4D A;  3FED A;  4C99 A;  3ICU A;  3FEE A;  4OC0 A;  3BHX A;  4X3R A;  3EIF A;  2JBK A;  4NGT A;  4C9E A;  4C9U A;  4TWE A;  4NGN A;  4TJV A;  4MCR A;  4C86 A;  4NGM A;  4MCP A;  4OME A;  3S9L A;  4C8A A;  3SJX A;  3SJF A;  4JZ0 A;  4LQG A;  4MCS A;  4OC1 A;  2OOT A;  4P44 A;  3BXM A;  4CDJ A;  3D7F A;  3KAS A;  5F09 A;  3FF3 A;  4P4F A;  4OC5 A;  1V6C A;  2PVW A;  4C8F A;  4P4E A;  4C8T A;  3S9N A;  4C85 A;  2EK9 A;  3SJG A;  4C8U A;  2EK8 A;  4C84 A;  4P45 A;  2C6P A;  5ELY A;  3D7G A;  4C9R A;  3D7D A;  4P4J A;  2XEG A;  4NGQ A;  3BI0 A;  4KNG E;  5IB9 A;  1Y9Z A;  1Z8L A;  4OC4 A;  4P4B A;  4NGS A;  4OC3 A;  3RBU A;  3IIB A;  4C9V A;  1CX8 A;  2JBJ A;  2C6G A;  2C6C A;  4TJX A;  2XEI A;  4P4I A;  4W9Y A;  4C8P A;  2CIJ A;  3I74 A;  2XEJ A;  1WVM A;  3FEC A;  4C8C A;  2XEF A;  2PVV A;  4NGR A;  3VTA A;  3IWW A;  3SJE A;  4C9A A;  3I6S A;  4CDK A;  1XF1 A;  1DE4 C;  4YN3 A;  4NGP A;  4MCQ A;  5D29 A;  3D7H A;  4JYW A;  3S9M A; 
#chains in the Genus database with same CATH topology
 4M8D A;  2OR4 A;  3BI1 A;  4OC2 A;  4P4D A;  3TLA A;  2C5Q A;  1KEE B;  3FED A;  4C99 A;  3ICU A;  1CS0 B;  4EYS A;  3C8O A;  3FEE A;  3G23 A;  4OC0 A;  3BHX A;  4X3R A;  5K99 A;  3EIF A;  1M6V B;  2JBK A;  4NGT A;  2EZA A;  4H1H A;  4C9E A;  1VBH A;  4C9U A;  1DIK A;  2EZB A;  4TWE A;  1KC7 A;  4NGN A;  1VI4 A;  5F5X A;  4TJV A;  3TLZ A;  4MCR A;  4JVO A;  4C86 A;  4NGM A;  3U1B A;  5FD8 A;  2AUM A;  3KRV A;  4MCP A;  4OME A;  1ZRS A;  2YJV A;  2FM4 A;  5JYB A;  2GP4 A;  1A9X B;  1NXJ A;  4C8A A;  3SJX A;  1R61 A;  3S9L A;  3SJF A;  4JZ0 A;  2YJT A;  4LQG A;  4MCS A;  4OC1 A;  1T36 B;  4MI1 A;  2OOT A;  3T5M A;  4P44 A;  2OLS A;  3BXM A;  3K4I A;  3EZA A;  4CDJ A;  3D7F A;  5IR2 A;  3KAS A;  3EZE A;  5F9M A;  3TLY A;  5F09 A;  1ZYM A;  1EZB A;  1JDE A;  3SR3 A;  4MJX A;  3T07 A;  3TLC A;  1EZA A;  3FF3 A;  4P4F A;  4OC5 A;  1V6C A;  2PCN A;  2PVW A;  4C8F A;  4P4E A;  4C8T A;  2B0A A;  4C85 A;  3S9N A;  2EK9 A;  1C3O B;  3SJG A;  4C8U A;  2EK8 A;  1C30 B;  4IIY A;  4C84 A;  3K9T A;  2C6P A;  4P45 A;  5ELY A;  3D7G A;  4E94 A;  4C9R A;  1ZL0 A;  3D7D A;  4COG A;  4P4J A;  2XEG A;  4NGQ A;  3BI0 A;  4KNG E;  5IB9 A;  1Y9Z A;  1Z8L A;  2HI6 A;  4OC4 A;  4P4B A;  5F1Y A;  4E5S A;  4NGS A;  4OC3 A;  3RBU A;  3IIB A;  4C9V A;  2HRO A;  3TLE A;  1CX8 A;  1Q5X A;  2JBJ A;  2C6G A;  4COB A;  2C6C A;  4TJX A;  2AUN A;  2XEI A;  2EZC A;  4P4I A;  3TYX A;  2DIK A;  2MP0 A;  4W9Y A;  4IIX A;  2D0O A;  2X0S A;  4C8P A;  2CIJ A;  3NOJ A;  3I74 A;  2XEJ A;  1BXR B;  1WVM A;  3FEC A;  4C8C A;  2XEF A;  5JVL A;  4INJ A;  2PVV A;  4NGR A;  3VTA A;  3IWW A;  3EZB A;  3SJE A;  4C9A A;  1J3L A;  1NBW A;  3I6S A;  4J0N A;  2R82 A;  3T05 A;  4CDK A;  1XF1 A;  3T0T A;  1DE4 C;  3GJZ A;  4YN3 A;  3TLG A;  4NGP A;  4MCQ A;  1JDB C;  4CO9 A;  1VBG A;  5D29 A;  2HWG A;  3D7H A;  1GGO A;  2D0P A;  1CE8 B;  3TLG B;  1KBL A;  4JYW A;  3S9M A;  3TLB A;  4CZ1 A;  2E28 A; 
#chains in the Genus database with same CATH homology
 2OR4 A;  3BI1 A;  4OC2 A;  4P4D A;  2C5Q A;  3FED A;  4C99 A;  3ICU A;  3FEE A;  4OC0 A;  3BHX A;  4X3R A;  3EIF A;  2JBK A;  4NGT A;  4C9E A;  4C9U A;  4TWE A;  4NGN A;  4TJV A;  4MCR A;  4C86 A;  4NGM A;  4MCP A;  4OME A;  2GP4 A;  4C8A A;  3S9L A;  3SJX A;  3SJF A;  4JZ0 A;  4LQG A;  4MCS A;  4OC1 A;  2OOT A;  4P44 A;  3BXM A;  4CDJ A;  3D7F A;  5IR2 A;  3KAS A;  5F09 A;  3FF3 A;  4P4F A;  4OC5 A;  1V6C A;  2PVW A;  4C8F A;  4P4E A;  4C8T A;  3S9N A;  4C85 A;  2EK9 A;  3SJG A;  4C8U A;  2EK8 A;  4C84 A;  3K9T A;  2C6P A;  4P45 A;  5ELY A;  3D7G A;  4C9R A;  3D7D A;  4P4J A;  2XEG A;  4NGQ A;  3BI0 A;  4KNG E;  5IB9 A;  1Y9Z A;  1Z8L A;  4OC4 A;  4P4B A;  4NGS A;  4OC3 A;  3RBU A;  3IIB A;  4C9V A;  1CX8 A;  2JBJ A;  2C6G A;  2C6C A;  4TJX A;  2XEI A;  4P4I A;  4W9Y A;  4C8P A;  2CIJ A;  3I74 A;  2XEJ A;  1WVM A;  3FEC A;  4C8C A;  2XEF A;  2PVV A;  4NGR A;  3VTA A;  3IWW A;  3SJE A;  4C9A A;  3I6S A;  4CDK A;  1XF1 A;  1DE4 C;  4YN3 A;  4NGP A;  4MCQ A;  5D29 A;  3D7H A;  4JYW A;  3S9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...