4C8AA

Mouse znrf3 ectodomain crystal form ii
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
153
structure length
146
Chain Sequence
KETAFVEVVLFESSPSGDYTTHTTGLTGRFSRAGAMLSAEGEIVQMHPLGLCLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
total genus 33
structure length 146
sequence length 153
chains with identical sequence B, C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4c8aA00
2OR4A 4JYWA 3SJGA 4TJXA 4C8UA 4C86A 3RBUA 4C8PA 2C6CA 3IWWA 4C8FA 5IB9A 4C99A 2JBKA 4C8TA 4MCRA 3S9MA 4P4IA 2PVVA 5D29A 4OC0A 3BI1A 3FF3A 4NGSA 2OOTA 4KNGE 3SJXA 3IIBA 3FECA 3VTAA 3S9NA 4C9AA 2EK9A 4C8AA 4C85A 3BI0A 5F09A 4NGMA 1CX8A 4C8CA 3BXMA 2XEFA 4P4DA 4CDJA 4OC3A 4NGTA 4NGQA 3SJFA 1DE4C 4P4BA 1Z8LA 4MCQA 2CIJA 4TJVA 3D7GA 4P4EA 1XF1A 4OC4A 4OC1A 3S9LA 4OC5A 4X3RA 4MCPA 4TWEA 4W9YA 4C9VA 2JBJA 4LQGA 2XEJA 4MCSA 4P45A 4YN3A 3D7HA 4C84A 4CDKA 3FEEA 3SJEA 4JZ0A 4P44A 4OMEA 3ICUA 3EIFA 4C9RA 4P4FA 4C9UA 4NGPA 2PVWA 4C9EA 1V6CA 4P4JA 4OC2A 5ELYA 2C6GA 3D7FA 3I6SA 3FEDA 3KASA 3BHXA 3I74A 4NGNA 2C6PA 2XEIA 1WVMA 1Y9ZA 3D7DA 2EK8A 2XEGA 4NGRA
chains in the Genus database with same CATH superfamily
2OR4A 4COGA 4JYWA 1R61A 2HI6A 1EZAA 3EZEA 3C8OA 3SJGA 2EZBA 3TLGB 4TJXA 4C8UA 4CZ1A 4C86A 4COBA 3RBUA 4C8PA 5F1YA 2GP4A 2C6CA 3IWWA 1JDBC 4C8FA 5IB9A 4C99A 2JBKA 2C5QA 5IR2A 1KBLA 4C8TA 4MCRA 4IIXA 4P4IA 3S9MA 2PVVA 5D29A 4OC0A 2R82A 3BI1A 3FF3A 4NGSA 4KNGE 2OOTA 3U1BA 3SJXA 3EZAA 1C30B 3IIBA 3FECA 3VTAA 3S9NA 4C9AA 2EK9A 4C8AA 5JVLA 2E28A 4C85A 2X0SA 2AUMA 3G23A 4JVOA 2MP0A 3BI0A 5F09A 2FM4A 4NGMA 1CX8A 2HWGA 1VBGA 4C8CA 3BXMA 2XEFA 3TLZA 2OLSA 2HROA 3K9TA 1J3LA 2PCNA 4P4DA 4CDJA 4OC3A 4NGTA 4NGQA 3T0TA 3SJFA 2D0PA 1DE4C 1JDEA 4P4BA 1Z8LA 5K99A 1A9XB 4MCQA 2CIJA 4TJVA 3D7GA 4P4EA 1XF1A 1ZYMA 4OC4A 2DIKA 4OC1A 3S9LA 3SR3A 4OC5A 1T36B 4X3RA 3TYXA 4MCPA 5FD8A 4EYSA 5JYBA 1ZRSA 1VI4A 4TWEA 4W9YA 4C9VA 3GJZA 2JBJA 3K4IA 2XEJA 4LQGA 4MCSA 1KEEB 4P45A 1CS0B 4YN3A 1NXJA 1KC7A 4CO9A 3D7HA 4C84A 2YJVA 1GGOA 3TLYA 1NBWA 4CDKA 3T07A 3FEEA 3SJEA 4JZ0A 4IIYA 1Q5XA 4P44A 4OMEA 3TLGA 3ICUA 1CE8B 3T5MA 3EIFA 4C9RA 4J0NA 3TLEA 3EZBA 4E5SA 1M6VB 4P4FA 1DIKA 1C3OB 4C9UA 4NGPA 3TLCA 2PVWA 3TLBA 1VBHA 3NOJA 2EZCA 4C9EA 1V6CA 5F9MA 4P4JA 1BXRB 4OC2A 5ELYA 3KRVA 2C6GA 3D7FA 3I6SA 3FEDA 3KASA 1EZBA 2AUNA 2YJTA 5F5XA 3TLAA 3BHXA 3I74A 1ZL0A 2C6PA 4MI1A 2B0AA 4NGNA 1WVMA 1Y9ZA 2XEIA 3D7DA 2EZAA 2EK8A 3T05A 2XEGA 4MJXA 4M8DA 4INJA 4NGRA 4E94A 4H1HA 2D0OA
chains in the Genus database with same CATH topology
2OR4A 4JYWA 3SJGA 4TJXA 4C8UA 4C86A 3RBUA 4C8PA 2GP4A 2C6CA 3IWWA 4C8FA 5IB9A 4C99A 2JBKA 2C5QA 5IR2A 4C8TA 4MCRA 3S9MA 4P4IA 2PVVA 5D29A 4OC0A 3BI1A 3FF3A 4NGSA 2OOTA 4KNGE 3SJXA 3IIBA 3FECA 3VTAA 3S9NA 4C9AA 2EK9A 4C8AA 4C85A 3BI0A 5F09A 4NGMA 1CX8A 4C8CA 3BXMA 2XEFA 3K9TA 4P4DA 4CDJA 4OC3A 4NGTA 4NGQA 3SJFA 1DE4C 4P4BA 1Z8LA 4MCQA 2CIJA 4TJVA 3D7GA 4P4EA 1XF1A 4OC4A 4OC1A 3S9LA 4OC5A 4X3RA 4MCPA 4TWEA 4W9YA 4C9VA 4MCSA 2JBJA 2XEJA 4LQGA 4P45A 4YN3A 3D7HA 4C84A 4CDKA 3FEEA 3SJEA 4JZ0A 4P44A 4OMEA 3ICUA 3EIFA 4C9RA 4P4FA 4C9UA 4NGPA 2PVWA 4C9EA 1V6CA 4P4JA 4OC2A 5ELYA 2C6GA 3D7FA 3I6SA 3FEDA 3KASA 3BHXA 3I74A 4NGNA 2C6PA 1WVMA 1Y9ZA 2XEIA 3D7DA 2EK8A 2XEGA 4NGRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OR4 A;  4JYW A;  3SJG A;  4TJX A;  4C8U A;  4C86 A;  3RBU A;  4C8P A;  2C6C A;  3IWW A;  4C8F A;  5IB9 A;  4C99 A;  2JBK A;  4C8T A;  4MCR A;  3S9M A;  4P4I A;  2PVV A;  5D29 A;  4OC0 A;  3BI1 A;  3FF3 A;  4NGS A;  2OOT A;  4KNG E;  3SJX A;  3IIB A;  3FEC A;  3VTA A;  3S9N A;  4C9A A;  2EK9 A;  4C8A A;  4C85 A;  3BI0 A;  5F09 A;  4NGM A;  1CX8 A;  4C8C A;  3BXM A;  2XEF A;  4P4D A;  4CDJ A;  4OC3 A;  4NGT A;  4NGQ A;  3SJF A;  1DE4 C;  4P4B A;  1Z8L A;  4MCQ A;  2CIJ A;  4TJV A;  3D7G A;  4P4E A;  1XF1 A;  4OC4 A;  4OC1 A;  3S9L A;  4OC5 A;  4X3R A;  4MCP A;  4TWE A;  4W9Y A;  4C9V A;  2JBJ A;  4LQG A;  2XEJ A;  4MCS A;  4P45 A;  4YN3 A;  3D7H A;  4C84 A;  4CDK A;  3FEE A;  3SJE A;  4JZ0 A;  4P44 A;  4OME A;  3ICU A;  3EIF A;  4C9R A;  4P4F A;  4C9U A;  4NGP A;  2PVW A;  4C9E A;  1V6C A;  4P4J A;  4OC2 A;  5ELY A;  2C6G A;  3D7F A;  3I6S A;  3FED A;  3KAS A;  3BHX A;  3I74 A;  4NGN A;  2C6P A;  2XEI A;  1WVM A;  1Y9Z A;  3D7D A;  2EK8 A;  2XEG A;  4NGR A; 
#chains in the Genus database with same CATH topology
 2OR4 A;  4COG A;  4JYW A;  1R61 A;  2HI6 A;  1EZA A;  3EZE A;  3C8O A;  3SJG A;  2EZB A;  3TLG B;  4TJX A;  4C8U A;  4CZ1 A;  4C86 A;  4COB A;  3RBU A;  4C8P A;  5F1Y A;  2GP4 A;  2C6C A;  3IWW A;  1JDB C;  4C8F A;  5IB9 A;  4C99 A;  2JBK A;  2C5Q A;  5IR2 A;  1KBL A;  4C8T A;  4MCR A;  4IIX A;  4P4I A;  3S9M A;  2PVV A;  5D29 A;  4OC0 A;  2R82 A;  3BI1 A;  3FF3 A;  4NGS A;  4KNG E;  2OOT A;  3U1B A;  3SJX A;  3EZA A;  1C30 B;  3IIB A;  3FEC A;  3VTA A;  3S9N A;  4C9A A;  2EK9 A;  4C8A A;  5JVL A;  2E28 A;  4C85 A;  2X0S A;  2AUM A;  3G23 A;  4JVO A;  2MP0 A;  3BI0 A;  5F09 A;  2FM4 A;  4NGM A;  1CX8 A;  2HWG A;  1VBG A;  4C8C A;  3BXM A;  2XEF A;  3TLZ A;  2OLS A;  2HRO A;  3K9T A;  1J3L A;  2PCN A;  4P4D A;  4CDJ A;  4OC3 A;  4NGT A;  4NGQ A;  3T0T A;  3SJF A;  2D0P A;  1DE4 C;  1JDE A;  4P4B A;  1Z8L A;  5K99 A;  1A9X B;  4MCQ A;  2CIJ A;  4TJV A;  3D7G A;  4P4E A;  1XF1 A;  1ZYM A;  4OC4 A;  2DIK A;  4OC1 A;  3S9L A;  3SR3 A;  4OC5 A;  1T36 B;  4X3R A;  3TYX A;  4MCP A;  5FD8 A;  4EYS A;  5JYB A;  1ZRS A;  1VI4 A;  4TWE A;  4W9Y A;  4C9V A;  3GJZ A;  2JBJ A;  3K4I A;  2XEJ A;  4LQG A;  4MCS A;  1KEE B;  4P45 A;  1CS0 B;  4YN3 A;  1NXJ A;  1KC7 A;  4CO9 A;  3D7H A;  4C84 A;  2YJV A;  1GGO A;  3TLY A;  1NBW A;  4CDK A;  3T07 A;  3FEE A;  3SJE A;  4JZ0 A;  4IIY A;  1Q5X A;  4P44 A;  4OME A;  3TLG A;  3ICU A;  1CE8 B;  3T5M A;  3EIF A;  4C9R A;  4J0N A;  3TLE A;  3EZB A;  4E5S A;  1M6V B;  4P4F A;  1DIK A;  1C3O B;  4C9U A;  4NGP A;  3TLC A;  2PVW A;  3TLB A;  1VBH A;  3NOJ A;  2EZC A;  4C9E A;  1V6C A;  5F9M A;  4P4J A;  1BXR B;  4OC2 A;  5ELY A;  3KRV A;  2C6G A;  3D7F A;  3I6S A;  3FED A;  3KAS A;  1EZB A;  2AUN A;  2YJT A;  5F5X A;  3TLA A;  3BHX A;  3I74 A;  1ZL0 A;  2C6P A;  4MI1 A;  2B0A A;  4NGN A;  1WVM A;  1Y9Z A;  2XEI A;  3D7D A;  2EZA A;  2EK8 A;  3T05 A;  2XEG A;  4MJX A;  4M8D A;  4INJ A;  4NGR A;  4E94 A;  4H1H A;  2D0O A; 
#chains in the Genus database with same CATH homology
 2OR4 A;  4JYW A;  3SJG A;  4TJX A;  4C8U A;  4C86 A;  3RBU A;  4C8P A;  2GP4 A;  2C6C A;  3IWW A;  4C8F A;  5IB9 A;  4C99 A;  2JBK A;  2C5Q A;  5IR2 A;  4C8T A;  4MCR A;  3S9M A;  4P4I A;  2PVV A;  5D29 A;  4OC0 A;  3BI1 A;  3FF3 A;  4NGS A;  2OOT A;  4KNG E;  3SJX A;  3IIB A;  3FEC A;  3VTA A;  3S9N A;  4C9A A;  2EK9 A;  4C8A A;  4C85 A;  3BI0 A;  5F09 A;  4NGM A;  1CX8 A;  4C8C A;  3BXM A;  2XEF A;  3K9T A;  4P4D A;  4CDJ A;  4OC3 A;  4NGT A;  4NGQ A;  3SJF A;  1DE4 C;  4P4B A;  1Z8L A;  4MCQ A;  2CIJ A;  4TJV A;  3D7G A;  4P4E A;  1XF1 A;  4OC4 A;  4OC1 A;  3S9L A;  4OC5 A;  4X3R A;  4MCP A;  4TWE A;  4W9Y A;  4C9V A;  4MCS A;  2JBJ A;  2XEJ A;  4LQG A;  4P45 A;  4YN3 A;  3D7H A;  4C84 A;  4CDK A;  3FEE A;  3SJE A;  4JZ0 A;  4P44 A;  4OME A;  3ICU A;  3EIF A;  4C9R A;  4P4F A;  4C9U A;  4NGP A;  2PVW A;  4C9E A;  1V6C A;  4P4J A;  4OC2 A;  5ELY A;  2C6G A;  3D7F A;  3I6S A;  3FED A;  3KAS A;  3BHX A;  3I74 A;  4NGN A;  2C6P A;  1WVM A;  1Y9Z A;  2XEI A;  3D7D A;  2EK8 A;  2XEG A;  4NGR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...