3C8OA

The crystal structure of rraa from pao1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
160
structure length
160
Chain Sequence
HYVTPDLCDAYPELVQVVEPMFSNFGGRDSFGGEIVTIKCFEDNSLVKEQVDKDGKGKVLVVDGGGSLRRALLGDMLAEKAAKNGWEGIVVYGCIRDVDVIAQTDLGVQALASHPLKTDKRGIGDLNVAVTFGGVTFRPGEFVYADNNGIIVSPQALKMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulator of ribonuclease activity A
publication title The Crystal Structure of RraA from PAO1
rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase regulator
total genus 47
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature ec 4.1.1.112: Oxaloacetate decarboxylase.
pdb deposition date 2008-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03737 RraA-like Aldolase/RraA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.40 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Ribonuclease E inhibitor RraA/RraA-like 3c8oA00
2YJTA 3K4IA 1VI4A 2YJVA 1J3LA 1NXJA 2PCNA 3C8OA 1Q5XA 3NOJA
chains in the Genus database with same CATH superfamily
5JVLA 4IIXA 3FEDA 1JDEA 4MI1A 3EIFA 4W9YA 3TLGB 4C8PA 2C6PA 2XEJA 4EYSA 4CZ1A 4C9RA 2R82A 4NGPA 3BI0A 4P44A 3S9LA 2C6GA 3KRVA 2FM4A 2PVVA 1NXJA 2EZBA 2HWGA 3BI1A 3I6SA 3I74A 4OC1A 4C9VA 1KBLA 4H1HA 4C84A 3D7GA 3IIBA 1A9XB 3D7HA 4YN3A 2EK9A 4OC5A 1BXRB 2B0AA 1C3OB 3SJEA 5JYBA 1CS0B 4C99A 1Q5XA 3VTAA 2XEFA 5IB9A 4M8DA 4CDJA 4P4FA 2XEGA 4IIYA 3S9NA 1NBWA 4MCPA 4C8CA 3SR3A 4OMEA 5F09A 2AUNA 1EZAA 1CX8A 2PVWA 3FEEA 4NGTA 4E5SA 4C8FA 3TLYA 1VBGA 3G23A 4CO9A 4C8UA 3NOJA 3TLBA 4KNGE 2DIKA 4MCQA 4JZ0A 5D29A 4LQGA 4C8TA 4INJA 2OOTA 2AUMA 3SJXA 2YJTA 1KC7A 5F9MA 4C86A 4C9UA 4MCSA 3T0TA 3TLCA 1DIKA 3U1BA 3IWWA 1ZYMA 1T36B 2EK8A 3FF3A 1WVMA 1Y9ZA 3KASA 4P4BA 5FD8A 3D7DA 4COGA 4C9AA 3TLEA 3T05A 2HROA 4NGMA 4JYWA 4NGNA 1ZL0A 3ICUA 5K99A 4NGQA 2JBJA 2JBKA 3SJFA 1EZBA 4OC3A 4NGSA 4COBA 3S9MA 1DE4C 1VI4A 2D0OA 3EZEA 4C85A 1JDBC 2OR4A 3GJZA 2EZCA 4OC0A 3TLAA 3C8OA 2X0SA 3TYXA 4OC2A 4P4EA 1Z8LA 2XEIA 2GP4A 3T07A 1ZRSA 1C30B 4P4IA 3SJGA 3BXMA 1J3LA 1V6CA 4MJXA 4P4DA 3EZBA 4JVOA 2HI6A 5ELYA 3RBUA 1M6VB 1CE8B 4P45A 4MCRA 2E28A 1VBHA 1GGOA 4TJVA 2D0PA 3T5MA 2C5QA 1R61A 3EZAA 4P4JA 4TWEA 4OC4A 2MP0A 5F1YA 4NGRA 4X3RA 4C8AA 4E94A 3TLZA 3K4IA 2CIJA 2OLSA 3TLGA 2C6CA 4J0NA 4TJXA 1KEEB 4C9EA 5F5XA 2YJVA 5IR2A 2PCNA 3D7FA 3K9TA 3BHXA 2EZAA 4CDKA 1XF1A 3FECA
chains in the Genus database with same CATH topology
2YJTA 3K4IA 1VI4A 2YJVA 1J3LA 1NXJA 2PCNA 3C8OA 1Q5XA 3NOJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YJT A;  3K4I A;  1VI4 A;  2YJV A;  1J3L A;  1NXJ A;  2PCN A;  3C8O A;  1Q5X A;  3NOJ A; 
#chains in the Genus database with same CATH topology
 5JVL A;  4IIX A;  3FED A;  1JDE A;  4MI1 A;  3EIF A;  4W9Y A;  3TLG B;  4C8P A;  2C6P A;  2XEJ A;  4EYS A;  4CZ1 A;  4C9R A;  2R82 A;  4NGP A;  3BI0 A;  4P44 A;  3S9L A;  2C6G A;  3KRV A;  2FM4 A;  2PVV A;  1NXJ A;  2EZB A;  2HWG A;  3BI1 A;  3I6S A;  3I74 A;  4OC1 A;  4C9V A;  1KBL A;  4H1H A;  4C84 A;  3D7G A;  3IIB A;  1A9X B;  3D7H A;  4YN3 A;  2EK9 A;  4OC5 A;  1BXR B;  2B0A A;  1C3O B;  3SJE A;  5JYB A;  1CS0 B;  4C99 A;  1Q5X A;  3VTA A;  2XEF A;  5IB9 A;  4M8D A;  4CDJ A;  4P4F A;  2XEG A;  4IIY A;  3S9N A;  1NBW A;  4MCP A;  4C8C A;  3SR3 A;  4OME A;  5F09 A;  2AUN A;  1EZA A;  1CX8 A;  2PVW A;  3FEE A;  4NGT A;  4E5S A;  4C8F A;  3TLY A;  1VBG A;  3G23 A;  4CO9 A;  4C8U A;  3NOJ A;  3TLB A;  4KNG E;  2DIK A;  4MCQ A;  4JZ0 A;  5D29 A;  4LQG A;  4C8T A;  4INJ A;  2OOT A;  2AUM A;  3SJX A;  2YJT A;  1KC7 A;  5F9M A;  4C86 A;  4C9U A;  4MCS A;  3T0T A;  3TLC A;  1DIK A;  3U1B A;  3IWW A;  1ZYM A;  1T36 B;  2EK8 A;  3FF3 A;  1WVM A;  1Y9Z A;  3KAS A;  4P4B A;  5FD8 A;  3D7D A;  4COG A;  4C9A A;  3TLE A;  3T05 A;  2HRO A;  4NGM A;  4JYW A;  4NGN A;  1ZL0 A;  3ICU A;  5K99 A;  4NGQ A;  2JBJ A;  2JBK A;  3SJF A;  1EZB A;  4OC3 A;  4NGS A;  4COB A;  3S9M A;  1DE4 C;  1VI4 A;  2D0O A;  3EZE A;  4C85 A;  1JDB C;  2OR4 A;  3GJZ A;  2EZC A;  4OC0 A;  3TLA A;  3C8O A;  2X0S A;  3TYX A;  4OC2 A;  4P4E A;  1Z8L A;  2XEI A;  2GP4 A;  3T07 A;  1ZRS A;  1C30 B;  4P4I A;  3SJG A;  3BXM A;  1J3L A;  1V6C A;  4MJX A;  4P4D A;  3EZB A;  4JVO A;  2HI6 A;  5ELY A;  3RBU A;  1M6V B;  1CE8 B;  4P45 A;  4MCR A;  2E28 A;  1VBH A;  1GGO A;  4TJV A;  2D0P A;  3T5M A;  2C5Q A;  1R61 A;  3EZA A;  4P4J A;  4TWE A;  4OC4 A;  2MP0 A;  5F1Y A;  4NGR A;  4X3R A;  4C8A A;  4E94 A;  3TLZ A;  3K4I A;  2CIJ A;  2OLS A;  3TLG A;  2C6C A;  4J0N A;  4TJX A;  1KEE B;  4C9E A;  5F5X A;  2YJV A;  5IR2 A;  2PCN A;  3D7F A;  3K9T A;  3BHX A;  2EZA A;  4CDK A;  1XF1 A;  3FEC A; 
#chains in the Genus database with same CATH homology
 2YJT A;  3K4I A;  1VI4 A;  2YJV A;  1J3L A;  1NXJ A;  2PCN A;  3C8O A;  1Q5X A;  3NOJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...