3C8OA

The crystal structure of rraa from pao1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
160
structure length
160
Chain Sequence
HYVTPDLCDAYPELVQVVEPMFSNFGGRDSFGGEIVTIKCFEDNSLVKEQVDKDGKGKVLVVDGGGSLRRALLGDMLAEKAAKNGWEGIVVYGCIRDVDVIAQTDLGVQALASHPLKTDKRGIGDLNVAVTFGGVTFRPGEFVYADNNGIIVSPQALKMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulator of ribonuclease activity A
publication title The Crystal Structure of RraA from PAO1
rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase regulator
total genus 47
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature ec 4.1.1.112: Oxaloacetate decarboxylase.
pdb deposition date 2008-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03737 RraA-like Aldolase/RraA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.40 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Ribonuclease E inhibitor RraA/RraA-like 3c8oA00
3C8OA 2YJTA 1NXJA 3K4IA 1VI4A 2YJVA 3NOJA 1Q5XA 1J3LA 2PCNA
chains in the Genus database with same CATH superfamily
3TYXA 4P4JA 4TWEA 5JYBA 2XEGA 2XEJA 3BI1A 5F9MA 2HROA 3EIFA 5F1YA 5F09A 1XF1A 4OC1A 2AUMA 4C84A 4P4EA 3SJGA 5F5XA 3G23A 3SJFA 3TLCA 5IR2A 3C8OA 4IIYA 4INJA 4P4BA 3FEDA 2JBJA 4MCRA 3TLAA 2EZAA 4JVOA 1NBWA 1ZRSA 4NGQA 4P4FA 4EYSA 1CS0B 1VBGA 3EZEA 4OC5A 2E28A 2C6GA 1BXRB 1CX8A 4OC0A 4C8FA 1DE4C 3IWWA 2EZBA 1GGOA 2PCNA 4LQGA 1Y9ZA 3I74A 4C9EA 4MCQA 1NXJA 3BHXA 4TJXA 5ELYA 4C8TA 2PVWA 3T07A 4KNGE 3TLGA 4P4IA 4NGNA 3KRVA 2HWGA 3D7HA 1WVMA 3TLEA 2C5QA 1C30B 4MJXA 4OC4A 3SJEA 2OOTA 2FM4A 3D7FA 4C8PA 1J3LA 2C6CA 1V6CA 4C8UA 4COGA 3VTAA 1KC7A 2AUNA 3BXMA 1VI4A 3T05A 2EK9A 1VBHA 1KEEB 2XEFA 2YJVA 4P45A 2B0AA 3SJXA 3KASA 2CIJA 3T5MA 1EZAA 1DIKA 1CE8B 4NGPA 1KBLA 3TLBA 2EK8A 5D29A 4E5SA 3S9NA 3U1BA 2DIKA 4C85A 3SR3A 5FD8A 3FF3A 4C9VA 2MP0A 4MCPA 1JDBC 4CDKA 3K4IA 2JBKA 2EZCA 3I6SA 3ICUA 1ZYMA 4JYWA 4MI1A 1Q5XA 1A9XB 4P4DA 1ZL0A 1R61A 4COBA 4C8AA 5IB9A 4OMEA 4CDJA 4C99A 2OR4A 3IIBA 5K99A 4M8DA 4E94A 1EZBA 4CZ1A 4J0NA 4NGTA 2D0PA 2C6PA 2X0SA 3FECA 4IIXA 2D0OA 1Z8LA 3TLZA 3EZAA 3K9TA 1M6VB 2XEIA 3D7DA 3EZBA 4YN3A 4H1HA 4X3RA 1JDEA 4NGRA 4C8CA 4CO9A 4W9YA 2PVVA 4TJVA 1T36B 4NGSA 4P44A 4C9AA 4C9UA 4C9RA 3S9MA 4JZ0A 2HI6A 3NOJA 2GP4A 3S9LA 3D7GA 3FEEA 3TLGB 4NGMA 2YJTA 5JVLA 4MCSA 4OC3A 2R82A 3GJZA 4OC2A 4C86A 3T0TA 3TLYA 2OLSA 1C3OB 3RBUA 3BI0A
chains in the Genus database with same CATH topology
3C8OA 2YJTA 1NXJA 3K4IA 1VI4A 2YJVA 3NOJA 1Q5XA 1J3LA 2PCNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C8O A;  2YJT A;  1NXJ A;  3K4I A;  1VI4 A;  2YJV A;  3NOJ A;  1Q5X A;  1J3L A;  2PCN A; 
#chains in the Genus database with same CATH topology
 3TYX A;  4P4J A;  4TWE A;  5JYB A;  2XEG A;  2XEJ A;  3BI1 A;  5F9M A;  2HRO A;  3EIF A;  5F1Y A;  5F09 A;  1XF1 A;  4OC1 A;  2AUM A;  4C84 A;  4P4E A;  3SJG A;  5F5X A;  3G23 A;  3SJF A;  3TLC A;  5IR2 A;  3C8O A;  4IIY A;  4INJ A;  4P4B A;  3FED A;  2JBJ A;  4MCR A;  3TLA A;  2EZA A;  4JVO A;  1NBW A;  1ZRS A;  4NGQ A;  4P4F A;  4EYS A;  1CS0 B;  1VBG A;  3EZE A;  4OC5 A;  2E28 A;  2C6G A;  1BXR B;  1CX8 A;  4OC0 A;  4C8F A;  1DE4 C;  3IWW A;  2EZB A;  1GGO A;  2PCN A;  4LQG A;  1Y9Z A;  3I74 A;  4C9E A;  4MCQ A;  1NXJ A;  3BHX A;  4TJX A;  5ELY A;  4C8T A;  2PVW A;  3T07 A;  4KNG E;  3TLG A;  4P4I A;  4NGN A;  3KRV A;  2HWG A;  3D7H A;  1WVM A;  3TLE A;  2C5Q A;  1C30 B;  4MJX A;  4OC4 A;  3SJE A;  2OOT A;  2FM4 A;  3D7F A;  4C8P A;  1J3L A;  2C6C A;  1V6C A;  4C8U A;  4COG A;  3VTA A;  1KC7 A;  2AUN A;  3BXM A;  1VI4 A;  3T05 A;  2EK9 A;  1VBH A;  1KEE B;  2XEF A;  2YJV A;  4P45 A;  2B0A A;  3SJX A;  3KAS A;  2CIJ A;  3T5M A;  1EZA A;  1DIK A;  1CE8 B;  4NGP A;  1KBL A;  3TLB A;  2EK8 A;  5D29 A;  4E5S A;  3S9N A;  3U1B A;  2DIK A;  4C85 A;  3SR3 A;  5FD8 A;  3FF3 A;  4C9V A;  2MP0 A;  4MCP A;  1JDB C;  4CDK A;  3K4I A;  2JBK A;  2EZC A;  3I6S A;  3ICU A;  1ZYM A;  4JYW A;  4MI1 A;  1Q5X A;  1A9X B;  4P4D A;  1ZL0 A;  1R61 A;  4COB A;  4C8A A;  5IB9 A;  4OME A;  4CDJ A;  4C99 A;  2OR4 A;  3IIB A;  5K99 A;  4M8D A;  4E94 A;  1EZB A;  4CZ1 A;  4J0N A;  4NGT A;  2D0P A;  2C6P A;  2X0S A;  3FEC A;  4IIX A;  2D0O A;  1Z8L A;  3TLZ A;  3EZA A;  3K9T A;  1M6V B;  2XEI A;  3D7D A;  3EZB A;  4YN3 A;  4H1H A;  4X3R A;  1JDE A;  4NGR A;  4C8C A;  4CO9 A;  4W9Y A;  2PVV A;  4TJV A;  1T36 B;  4NGS A;  4P44 A;  4C9A A;  4C9U A;  4C9R A;  3S9M A;  4JZ0 A;  2HI6 A;  3NOJ A;  2GP4 A;  3S9L A;  3D7G A;  3FEE A;  3TLG B;  4NGM A;  2YJT A;  5JVL A;  4MCS A;  4OC3 A;  2R82 A;  3GJZ A;  4OC2 A;  4C86 A;  3T0T A;  3TLY A;  2OLS A;  1C3O B;  3RBU A;  3BI0 A; 
#chains in the Genus database with same CATH homology
 3C8O A;  2YJT A;  1NXJ A;  3K4I A;  1VI4 A;  2YJV A;  3NOJ A;  1Q5X A;  1J3L A;  2PCN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...