3C8OA

The crystal structure of rraa from pao1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
160
structure length
160
Chain Sequence
HYVTPDLCDAYPELVQVVEPMFSNFGGRDSFGGEIVTIKCFEDNSLVKEQVDKDGKGKVLVVDGGGSLRRALLGDMLAEKAAKNGWEGIVVYGCIRDVDVIAQTDLGVQALASHPLKTDKRGIGDLNVAVTFGGVTFRPGEFVYADNNGIIVSPQALKMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase regulator
molecule keywords Regulator of ribonuclease activity A
publication title The Crystal Structure of RraA from PAO1
rcsb
source organism Pseudomonas aeruginosa
total genus 47
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature ec 4.1.1.112: Oxaloacetate decarboxylase.
pdb deposition date 2008-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03737 RraA-like Aldolase/RraA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.40 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Ribonuclease E inhibitor RraA/RraA-like 3c8oA00
1Q5XA 3K4IA 1VI4A 3NOJA 1NXJA 2PCNA 2YJTA 1J3LA 2YJVA 3C8OA
chains in the Genus database with same CATH superfamily
1DIKA 3BI1A 3FEEA 4C9EA 4YN3A 3SJXA 2YJTA 2C6CA 4CDJA 4OC4A 1ZRSA 3T5MA 3EZBA 1CS0B 2PVVA 2GP4A 4C84A 1Z8LA 3TLAA 2FM4A 3K9TA 3I74A 5D29A 2OLSA 1T36B 3BHXA 4OC3A 4MCRA 3K4IA 3S9NA 4NGTA 4NGSA 4NGRA 4MI1A 5IB9A 3SJFA 4NGPA 1DE4C 4P4EA 2EZAA 4M8DA 4IIYA 3T05A 4C99A 1CX8A 4COGA 2XEIA 4C86A 2JBJA 4TJXA 4H1HA 4E94A 4LQGA 4NGMA 4C85A 3C8OA 5K99A 3RBUA 3TLEA 2EZBA 2HI6A 1VI4A 4X3RA 4C9UA 3SJGA 4NGNA 1ZL0A 2AUMA 2XEFA 3KASA 4IIXA 1KBLA 4COBA 3FF3A 1J3LA 1CE8B 1M6VB 2AUNA 4MCQA 3KRVA 3S9LA 2CIJA 5ELYA 5IR2A 5JYBA 3D7HA 2PCNA 3TLZA 1ZYMA 2D0OA 4MJXA 2X0SA 3GJZA 4C8TA 3IWWA 3T0TA 1JDBC 4C8CA 4C9RA 1KEEB 2PVWA 4OC2A 4OC5A 2E28A 3ICUA 1NXJA 3U1BA 4JVOA 4C8FA 4P4FA 5JVLA 3D7GA 3FEDA 4C8AA 1VBGA 4TWEA 1V6CA 5F09A 2HROA 3VTAA 2EZCA 3G23A 3SR3A 1R61A 3TLGA 3BI0A 3EZAA 5F9MA 4C9AA 4P4DA 2OR4A 2C6GA 5F1YA 2YJVA 3D7FA 2R82A 2DIKA 2D0PA 1WVMA 4JZ0A 4INJA 2JBKA 4J0NA 4P44A 5F5XA 3T07A 4C8UA 1EZBA 3BXMA 4P45A 2C5QA 4KNGE 4W9YA 1EZAA 2HWGA 4OC1A 1NBWA 4CO9A 3S9MA 4CZ1A 4MCPA 4TJVA 5FD8A 3TLYA 2MP0A 3TLCA 4EYSA 4MCSA 1GGOA 3TLGB 3TYXA 4NGQA 3NOJA 4P4BA 1BXRB 1C3OB 3D7DA 1C30B 3EZEA 4C8PA 4JYWA 3IIBA 4CDKA 1KC7A 1A9XB 2EK9A 4P4JA 2OOTA 1JDEA 4OMEA 2B0AA 2EK8A 1Q5XA 2XEJA 2XEGA 3FECA 4C9VA 3I6SA 3EIFA 3TLBA 4P4IA 4E5SA 3SJEA 1Y9ZA 1VBHA 4OC0A 1XF1A 2C6PA
chains in the Genus database with same CATH topology
1Q5XA 3K4IA 1VI4A 3NOJA 1NXJA 2PCNA 2YJTA 1J3LA 2YJVA 3C8OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q5X A;  3K4I A;  1VI4 A;  3NOJ A;  1NXJ A;  2PCN A;  2YJT A;  1J3L A;  2YJV A;  3C8O A; 
#chains in the Genus database with same CATH topology
 1DIK A;  3BI1 A;  3FEE A;  4C9E A;  4YN3 A;  3SJX A;  2YJT A;  2C6C A;  4CDJ A;  4OC4 A;  1ZRS A;  3T5M A;  3EZB A;  1CS0 B;  2PVV A;  2GP4 A;  4C84 A;  1Z8L A;  3TLA A;  2FM4 A;  3K9T A;  3I74 A;  5D29 A;  2OLS A;  1T36 B;  3BHX A;  4OC3 A;  4MCR A;  3K4I A;  3S9N A;  4NGT A;  4NGS A;  4NGR A;  4MI1 A;  5IB9 A;  3SJF A;  4NGP A;  1DE4 C;  4P4E A;  2EZA A;  4M8D A;  4IIY A;  3T05 A;  4C99 A;  1CX8 A;  4COG A;  2XEI A;  4C86 A;  2JBJ A;  4TJX A;  4H1H A;  4E94 A;  4LQG A;  4NGM A;  4C85 A;  3C8O A;  5K99 A;  3RBU A;  3TLE A;  2EZB A;  2HI6 A;  1VI4 A;  4X3R A;  4C9U A;  3SJG A;  4NGN A;  1ZL0 A;  2AUM A;  2XEF A;  3KAS A;  4IIX A;  1KBL A;  4COB A;  3FF3 A;  1J3L A;  1CE8 B;  1M6V B;  2AUN A;  4MCQ A;  3KRV A;  3S9L A;  2CIJ A;  5ELY A;  5IR2 A;  5JYB A;  3D7H A;  2PCN A;  3TLZ A;  1ZYM A;  2D0O A;  4MJX A;  2X0S A;  3GJZ A;  4C8T A;  3IWW A;  3T0T A;  1JDB C;  4C8C A;  4C9R A;  1KEE B;  2PVW A;  4OC2 A;  4OC5 A;  2E28 A;  3ICU A;  1NXJ A;  3U1B A;  4JVO A;  4C8F A;  4P4F A;  5JVL A;  3D7G A;  3FED A;  4C8A A;  1VBG A;  4TWE A;  1V6C A;  5F09 A;  2HRO A;  3VTA A;  2EZC A;  3G23 A;  3SR3 A;  1R61 A;  3TLG A;  3BI0 A;  3EZA A;  5F9M A;  4C9A A;  4P4D A;  2OR4 A;  2C6G A;  5F1Y A;  2YJV A;  3D7F A;  2R82 A;  2DIK A;  2D0P A;  1WVM A;  4JZ0 A;  4INJ A;  2JBK A;  4J0N A;  4P44 A;  5F5X A;  3T07 A;  4C8U A;  1EZB A;  3BXM A;  4P45 A;  2C5Q A;  4KNG E;  4W9Y A;  1EZA A;  2HWG A;  4OC1 A;  1NBW A;  4CO9 A;  3S9M A;  4CZ1 A;  4MCP A;  4TJV A;  5FD8 A;  3TLY A;  2MP0 A;  3TLC A;  4EYS A;  4MCS A;  1GGO A;  3TLG B;  3TYX A;  4NGQ A;  3NOJ A;  4P4B A;  1BXR B;  1C3O B;  3D7D A;  1C30 B;  3EZE A;  4C8P A;  4JYW A;  3IIB A;  4CDK A;  1KC7 A;  1A9X B;  2EK9 A;  4P4J A;  2OOT A;  1JDE A;  4OME A;  2B0A A;  2EK8 A;  1Q5X A;  2XEJ A;  2XEG A;  3FEC A;  4C9V A;  3I6S A;  3EIF A;  3TLB A;  4P4I A;  4E5S A;  3SJE A;  1Y9Z A;  1VBH A;  4OC0 A;  1XF1 A;  2C6P A; 
#chains in the Genus database with same CATH homology
 1Q5X A;  3K4I A;  1VI4 A;  3NOJ A;  1NXJ A;  2PCN A;  2YJT A;  1J3L A;  2YJV A;  3C8O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...