3TLAA

Microcin c7 self immunity protein mccf in the wild type apo state
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
335
structure length
335
Chain Sequence
PLLAAPLAVGDTIGFFSSSAPATVTAKNRFFRGVEFLQRKGFKLVSGKLTGKTDFYRSGTIKERAQEFNELVYNPDITCIMSTIGGDNSNSLLPFLDYDAIIANPKIIIGYSDTTALLAGIYAKTGLITFYGPALIPSFGEHPPLVDITYESFIKILTRKQSGIYTYTLPEKWSDESINWNENKILRPKKLYKNNCAFYGSGKVEGRVIGGNLNTLTGIWGSEWMPEIRNGDILFIEDSRKSIATVERLFSMLKLNRVFDKVSAIILGKHELFDCAGSKRRPYEVLTEVLDGKQIPVLDGFDCSHTHPMLTLPLGVKLAIDFDNKNISITEQYLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of a serine carboxypeptidase adapted for degradation of the protein synthesis antibiotic microcin C7.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords MccF
total genus 115
structure length 335
sequence length 335
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02016 Peptidase_S66 LD-carboxypeptidase N-terminal domain
A PF17676 Peptidase_S66C LD-carboxypeptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Class I glutamine amidotransferase-like 3tlaA01
3.50.30.60 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 LD-carboxypeptidase A C-terminal domain-like 3tlaA02
3TLYA 4EYSA 4E94A 3TLBA 3U1BA 4INJA 2AUNA 3TYXA 4H1HA 3TLZA 5F1YA 4MJXA 4IIXA 4MI1A 3TLGB 5K99A 5F5XA 4IIYA 1ZL0A 3G23A 4E5SA 3GJZA 3TLAA 3SR3A 3TLGA 1ZRSA 3TLEA 4JVOA 5F9MA 2AUMA 3T5MA 5FD8A 3TLCA 5JYBA
chains in the Genus database with same CATH superfamily
3VRHA 2XSZD 4GXRA 2C9MA 4UBMA 4QBKA 4GMGA 4CTKA 3NB0A 2V8OA 3EOBI 2LW7A 2C58A 1LBEA 1VDZA 3I2HA 1C9KA 4R7ZA 3Q2IA 4G81A 1PFKA 2AQ8A 5C7IO 5H3HA 2OAP1 4AZ3A 2JIOA 3UENA 1JE1A 3LV8A 3L04A 1QIDA 1NT2A 3DYVA 1WMDA 3F7TA 2FOXA 3ENVA 1W4CA 2ONZA 3A8TA 3WRYA 3G2MA 3HU1A 3ORFA 2RAPA 4TXLA 4QLBA 1TT5B 4D8XA 2Y0DA 1P1KA 1YNOA 3DOEA 4IINA 3L7LA 4ECEA 3ZEIA 3FKSD 3I5AA 5F1KA 4YO7A 1N0IA 2WG1A 3ZY3A 1OKKA 4MK4A 3ZDEA 4KKXB 5KJEA 3WIBA 3EGXA 4NE7A 1G3MA 4G26A 3UKJA 3FCYA 1CY7A 1O5IA 2QRHA 2ZRAA 2IGBA 1LD3A 2OCDA 2JAUA 4OU4A 3FE2A 1NQVA 1QRSA 2NO6A 4IYJA 3A1CA 1H66A 3DW3X 4JB3A 4CV0A 5EJ4A 4W5QA 1E3TA 4JB0A 1HDOA 4EB6A 2DETA 1PTJA 1L5VA 3EFHA 3IVGA 5JAQA 3I4LA 4QGSA 1QAQA 3OH8A 2BHTA 4KNWA 3FPAA 4LOIA 1L1EA 5IMSA 4C2TA 4B3RB 1KC7A 2Y3IA 4MI9A 1RKVA 1DARA 1WCXA 4KTTE 5DO9A 3RJ9A 2ZIVB 2O7RA 4S1PA 1CUWA 1DJNA 4MWEA 2GZSA 2EJUA 4QU5A 2VIIA 2G9VA 4HADA 5D7NA 1YIDA 4G1EB 2VDOB 3PR2B 2DC1A 2G9QA 1OTHA 2W2NA 4NK4A 5EUMA 3GFPA 4C4AA 4WLUA 2QTZA 3QOYA 4LOJA 3FYUB 4MVJD 3TNFA 1KGDA 4BHTA 4E5VA 1WNFA 1X9IA 3ANTA 3DULA 3PJGA 4K6CA 4ZVMA 2IHYA 2WBLC 2Y0EA 5EVCA 1BGVA 4B8WA 1JTVA 3I45A 2DOKA 4GFDA 2FWMX 5FNVB 2DQSA 5HFNA 4KPEC 3LUBA 2H7XA 5IXYA 3DBHB 3BTSA 1GQOA 1YV9A 4LRWA 5TQVA 1YFJA 1TEVA 3DMGA 4ZCLA 1N3LA 1NVBA 5A6SB 2HLHA 1GG8A 2O2JA 2HMTA 5M29A 5CB0A 4Q02A 2Z2JA 3SICE 4Z4HA 4P5EA 4YUAA 1NN1A 4J0GA 3PRJA 1JZQA 3KEFA 1PHPA 4I9UA 1P33A 4FFWA 4UE2A 2FF5A 3TCNA 3GPBA 4A82A 1K0UA 3OOYA 3LA8A 4I4TB 4E1BA 1EFVB 4KIFA 1VSVA 5J43A 2CXRA 3C5HA 2EK9A 3M82A 3AI2A 2PRZA 1Q11A 3SIXA 4C4OA 4MVCA 1P9RA 1S3GA 1ZCAA 2WF7A 3CB2A 3OTWA 1LF5A 3PI7A 4GOKA 3HCFA 3U48A 5KNDA 4NGSA 3Q10A 4XGRA 1YR9A 4BECA 1IBKB 3DZDA 1TTPB 3G1WA 4MRVA 4Q21A 4N9WA 2WIJA 2O2DA 3HC7A 1LZLA 2R4QA 4Y2SA 4YT2A 5COAA 2Q7XA 3F4BA 3QHPA 4Y6LA 2PZFA 1XMVA 4R5MA 4BLPA 5HOEA 2GD6A 2CL7X 2I67A 2PZJA 1BG6A 2WINI 4Q05A 3TTUA 4M87A 4V0ME 3WLTA 2YINC 4II2A 1QH8B 1TNDA 2Q3JA 4NR0A 3ON5A 1ID8A 3V48A 2AKYA 1KP2A 5DLYA 1KFCB 1QH0A 2EBHX 1Q17A 2E82A 2Q3DA 4F1WA 5KS2A 4DLAA 1I5EA 2RHRA 1LDYA 4R1TA 3VMMA 2P8SA 3ZC3A 1BKYA 4N5LA 3KK0A 3PNBA 1KQNA 5GWXA 3I73A 3N5KA 2Q6VA 2ZTSA 4EM6A 3F74A 5L40A 5F09A 2QYOA 1Y4UA 3TG8A 2NTEA 3FDJA 5IDYA 5FPPA 5GVRA 3ILYA 3MJHA 2QU7A 4CEIB 4GLOA 5A5VA 1S01A 3G5TA 4RK1A 2HWWA 1JHXA 1XF9A 2EJBA 4WUTA 3HBMA 5IABA 1P1CA 3L7CA 4DC0A 3IQXA 1DDGA 1HOTA 3VU8A 3RRJA 521PA 4X8LA 3W9SA 2Y1GA 2QX6A 3AG5A 3BSSA 3CR7A 1E96A 3C5VA 3F3MA 3G9TA 1YB5A 2V7XA 2BGWA 3D1JA 1TO2E 2X58A 3EZYA 3E9QA 3M4NA 4OSPA 3K1AB 5E9QA 2G1PA 4RIEA 3V1LA 4KLCA 1XXLA 2YZKA 3MINA 4JLBA 2I4MA 1VL2A 2C9YA 4MUYA 1U65A 4F9FA 1N6OA 4QTYA 3KR2A 3N05A 4V1CA 4DCPA 5C80A 2RHLA 1V6CA 5DCLA 5BSEA 1ISPA 4OVKA 2BZGA 1RPZA 5HBRA 3BC1A 3WRVA 4HL6A 5FEUA 5EQDA 4RXTA 4D3ZA 4EYKA 2EWVA 2BDTA 2JK1A 4JOSA 4LEIA 3FF4A 1NPDA 4ZJYA 1DBSA 4GOJA 4KGVA 4XCXA 4ZQIA 3KJGA 4EKNB 1B8VA 4Q7JB 1Z8HA 4KQGA 4TGLA 3U19A 1N0UA 1ZGAA 4FYPA 1AN0A 1SH7A 4GC9A 2G40A 3AW8A 4ZEXA 4I1YA 4E2XA 1JEEA 3PI6A 1T25A 5IBQA 1RRKA 3WY9A 4V02A 3RI3A 3S7TA 1WETA 2M6LA 1Y3HA 3TSYA 4DTIA 1AHPA 3INRA 5K09A 1V1MA 2QVYX 4ASUA 1NKTA 3GGSA 3SYTA 1PK9A 1JH8A 1DWPA 3F6BX 1Z5WA 1OF1A 1Y37A 3T5GA 1MHTA 2EFDB 1H4SA 3TLAA 4UULA 5HKKD 1TZKA 1ZOOA 5KTOA 4DV0B 2PMFA 221PA 1GPBA 1PR3A 4GOLD 4J0KA 1I14A 2B6NA 4C01A 3OX1A 4B3CA 2HA5A 2PG3A 3TW8B 2W4MA 4LK2A 1EE9A 2GXUA 3UTCA 1AV6A 1IXSB 3I5UA 3CH6A 4MHSA 1N77A 4B73A 4YRBA 3BWCA 3E81A 1SVKA 2Q2WA 4NE2A 4YMWA 4GX2A 3OOHA 3TLBA 2RC6A 1AQYA 3UW1A 3HXQA 3DUFB 5CVDA 4GR5A 2KWIA 5DGTA 2BHSA 1Z45A 4UVHA 1H22A 1PG0A 3BE6A 4HNAA 3FOZA 3PS9A 2AFVA 3A2LA 4WZBB 1WHTB 2D7CA 4MUNA 1RC8A 1PU2A 2FPLA 4OAQA 2MU1A 5EERA 5JMTA 2C6CA 3IEKA 4G5GA 4ISCA 4A3SA 3ZWQA 1KS9A 3P0RA 1XMPA 1A95A 4MS3B 4XGIA 1HDXA 3GUYA 4QM6A 4L0DA 3PDWA 1A27A 1GGHA 2R84A 2B36A 2QM7A 2NYAA 3JD3A 4HQFA 3GJTA 1V8FA 4WK4B 3GLHE 3L5KA 3RS2A 1Y9DA 4MR8A 5JQGF 2CVZA 1OROA 1KEEA 2WIKA 2WAMA 5GV8A 4L6IA 2IUEA 3MM4A 4FEAA 3JAKB 2FPMA 3GV0A 1F8YA 4ZZ3A 3R0IA 1TZJA 4ZXPA 4J07A 1BIFA 4JUIA 3KSUA 4RJJA 3BI0A 3B7PA 1Q74A 4CBVA 4KXXA 1ZINA 1YL5A 3LKDA 4FIDA 5TRTA 2PZMA 3TI7A 3C1TA 3TTYA 6AT1A 4AS1A 1LPMA 1T2NA 1ZBDA 2ONKA 3GLGA 4RF5A 2CK3A 1QHYA 2G0NA 1SHLA 4NU6A 5AXBA 4AZ3B 2D1RA 3BK1A 3HR7A 3KV1A 3U4IA 4URZR 3KSDO 2OV6A 1VL0A 3DKRA 3ESXA 4EKGA 4P4FA 2JAHA 5FFNA 4ALLA 3U7QB 2XE8A 5CVTA 1YUMA 4YJ2A 1MO4A 1X1BA 4TTTS 1QKJA 3OOWA 1V6SA 3I6IA 5JWHA 2R79A 4Y6OA 1RE0A 2TSYB 4BKMA 2GPJA 2HLPA 2E4AA 3HRIA 3JALB 4EK9A 4DGQA 5JLAA 1OB5A 4P7BA 5M04A 3D6NB 4L73A 4YXWA 4MB0A 2ZBUA 5ILOA 5AOBA 2PUAA 1MRSA 2AN1A 2TYSB 2E21A 1C8LA 4KYIB 3COVA 1MB3A 4YT5A 5DV9A 3ZHZA 5LYJF 3T7EA 3QA3E 2QT1A 4U39A 4LHXA 4AKSA 1U0TA 4IJ5A 1N2HA 1QVRA 2IF2A 4YAFA 1EGQA 4MTCA 3I39X 3WKDA 4EY3A 5IJXA 1ONOA 1UM9B 2J1LA 3VSAA 1V5WA 2AE1A 2J5QA 3B1FA 1XXHB 1GLVA 5AYVA 3UV6A 3IMEA 4BO3A 3UFXB 1HQYE 2JCXA 5BWCA 4WACA 1E3LA 3NHKA 1V37A 3F5QA 3NU1A 5JY1A 1S2IA 1T4GA 4ZAVA 4CI9A 3TD2A 5K0JA 2ZG6A 1GU1A 4B46A 5IDWA 2NWQA 3OHSX 5TQJA 3TS1A 2RSLA 5AJUA 4DNPA 1K63A 5DNCA 1KI7A 3GEMA 3EW7A 1R0YA 1WXQA 3M70A 4Z5XA 1M1ZA 3TJMA 5JDIA 3WJ1A 2ISCA 4RY0A 3CUKA 2XEIA 2PRYA 1CUBA 4PBTA 3BHMA 5EAIA 1Y63A 2ZUFA 3E1GA 2UZIR 4G9BA 3QXCA 2P75A 1D2HA 5SICE 1W4ZA 4BNZA 4YPVA 4W5TA 4OX9Y 2YTZA 4E03A 3ZBPA 5TS2A 3HDYA 4JIMA 1E1CB 1XZLA 4QJBA 4RA9B 2OY0A 2QN9A 3R41A 3GLSA 2QLLA 2YUTA 2YH2A 1X86B 2D54A 5T6BA 1IUOA 1V11A 2I2AA 1C7FA 4XYEA 4EVRA 5I9IA 3G0BA 5BMVA 3H5NA 3JQCA 4YP7A 3H0CA 5JAOA 1N0HA 1NF9A 2P6UA 5IDQA 1ZAKA 3B6KA 3FRJA 4PV7A 5LIPA 4TKLA 4X93A 1NASA 1P4GA 2B7BA 2YHUA 4NAVA 3KZ1E 1DKQA 1G9TA 3RK1A 3TI9A 3E53A 4W4TA 4W1RA 3VZDA 3K0EA 1LQUA 5EG5A 3W5DA 2DY0A 3D2BA 2XUPA 4JLOA 2ZKLA 1R5OA 4Q39A 1GTMA 3TCXB 2I6GA 3CCBA 3FCXA 3CURA 4Q7MB 4MITA 4C7XA 3RJ5A 2QG9A 5A7GA 1T5HX 3LT2A 4QUAA 3U1VA 5A4MS 3WLJA 1P9LA 1YF3A 3M6VA 2IUUA 5CDGA 2ZGVA 4GMDA 1DRVA 3PHIA 1A7UA 4MR7B 3TOSA 2BF7A 1L5ZA 3JAMA 1XTTA 2PFGA 4HBGA 1AGPA 3L46A 3FY4A 4IQFA 2H4XA 3D5TA 1T3TA 4MRRA 1Y8AA 1ZMRA 5C7OO 1R3DA 1ZD5A 4EYOA 5KWSA 3GARA 3PQCA 1XCGB 2G70A 2JHPA 4KU4A 5C1BA 2IS2A 5FNVA 3HLTA 1DO8A 2GAFA 3M4YA 2D62A 3RWBA 4QDUA 1IXKA 3A9VA 3SHTA 4DB4A 1Q5XA 1XPUA 2JLBA 3NORA 2WLSA 3RARA 5JFTA 2C4VA 2DXIA 1ZHOA 4FOSA 5K3SA 2AUMA 3U80A 4WBNF 4PLVA 1M2JA 4I1SA 3STUA 4B6JA 5ICCA 3AZPA 4Z9BA 2I33A 1AA6A 3WMWA 3NM5A 4F4UA 4V1CI 5FQNA 4L15A 3HNRA 5C32A 2ZSHA 2V6MA 1Q44A 1OAKA 2BMVA 3GL9A 4I4TF 5EC8A 4EGFA 3Q9NA 1GL6A 3TSCA 3N5CA 4EEKA 2D8MA 2HJSA 3HWSA 3RV3A 2EFYA 3HO8A 2F8TA 2VPWA 4O2LA 1RJDA 4DBLE 4BLQA 2REQB 1GGFA 3VPDA 4HNVA 4AMUA 3CIFA 2I4LA 2XZDA 3C3CA 2EFGA 3AVQA 3GRZA 1Y3BE 4N0EA 4PRYA 5DTIA 4LHYA 4RPLA 1KI8A 3AOGA 1CT9A 5IKPA 3PEFA 5IHPA 4ALJA 5JAPA 4PW0A 2J0UB 3VHRA 2DCMA 4UTNA 4A2QA 1ZO8A 4CLEA 3H5RA 3B70A 1CQWA 3KYDA 3L9WA 1L7BA 3A1VA 1GA1A 1FJ2A 1KRWA 4C9UA 3V00A 4JHLA 1CWUA 2AL7A 1HL3A 2HGSA 1CRPA 2YHBA 4OL9A 4CLXA 2JVKA 2F8SA 5FWNA 1Y7PA 2HRRA 4OYLA 1AXGA 3WR5A 4Q7QA 5C1OA 4G0UA 3A9UA 1ZYMA 3PJFA 5AJHA 3VR2D 1XZAA 5DXFA 5JZ9A 1J2RA 5HR5A 3OBBA 1RCTE 1RIIA 4NH0A 1W7AA 1ZLXA 3GA0A 5COQA 3BIOA 1BOFA 2DPMA 1EVLA 2W83A 3RF7A 4ZYYA 1V1MB 1W35A 1XA3A 3B9QA 3BS4A 3OZTA 4YRPA 1WZNA 3B8EA 4UUOA 3QUTA 1WQ1R 4LJ5A 5AJYA 2HAEA 1H8EA 4WKOA 3JRWA 3COWA 5DNVA 3KQWA 4N1AA 3FOWA 3V1TC 4AMGA 3U16A 3FOCA 5CDYA 2UYCA 1XVIA 2AXNA 4KQ6A 4QEDA 4RBNA 3GOHA 5J2UA 1UFVA 4MRPA 3PGVA 2FW7A 2R7MA 3CZ4A 5FO1A 5K8CA 3CVWA 1HEYA 3VAZA 1X19A 2HA2A 3CNHA 3NRBA 5DYNA 4ZHSA 1U9ZA 1TIPA 2Q1TA 4FEEA 3AUUA 4C2BA 4W9YA 4L1KA 3H9JA 1J2YA 1GOTA 4JD5A 4JI6B 1IUPA 1UBRS 2ZCVA 5TT0A 3S28A 3OZDA 4KYUA 3PXBA 2P6NA 3JTMA 4UEOA 3AIMA 5CVUA 2BVNA 1BQ3A 4EWLA 1P73A 3LHIA 4FZ5A 4F3TA 4PVDA 1F4VA 1WVIA 3PFFA 1Y8QA 4IHJF 4X91A 2PGDA 3LC1O 4DXDA 4E32A 2VNIA 3HJUA 4GPTA 2B3TA 3O8QA 2FEWB 1F20A 1VBGA 4MCIA 3KM0A 4IFIA 4YRTA 4OQMA 3BFPA 3R5KA 2WPDA 1VI4A 4FEGA 5FTKA 1T35A 1WF6A 1ABEA 3ROFA 4G65A 3ZJ4A 5FTWA 1FXWF 3L6BA 2I1QA 4JLDA 4NGRA 4QGFA 5IFKA 3LE8A 4IH1A 5L9AA 1ZXXA 1K97A 4DEYA 2VJCA 4E5SA 1QGUB 2B4KA 4KO4S 1FTWA 4B09A 4I8IA 2ZI5A 2ZYSA 2ZZKA 4DSTA 1XZHA 3ETEA 3DP9A 2HRQA 1EUCB 2WWRA 3MWEA 1NC3A 1NJFA 1TAHA 3EQ8A 3LT0A 3DB2A 3QENA 1PQ4A 4MA0A 3A6GA 3PVCA 1U94A 1B14A 1E5TA 3HJNA 3I4FA 4FDTA 4J9VA 3MPOA 3WG9A 4C14A 2F8LA 4FMPA 4NLLA 1CFJA 1H5UA 2R48A 1JDBC 3UGQA 2FJUA 1HWYA 1LI4A 1M0EA 1EFLA 1P1IA 1UIRA 2A30A 2A3NA 2JIBA 5EIEA 2O50A 1QYDA 2B7CA 2ZSFA 3BKXA 3AG6A 4KE6A 4UAJA 5BQOA 3JARB 3F73A 1J1UA 4F1KA 1EESA 4N48A 4Z1MD 4Q01A 2ET6A 3A9SA 2WHXA 4V03A 2RGGA 1D8AA 4YDQA 2AJDA 4C7OB 2R7LA 2VRNA 4RADA 4RJ2A 4OC1A 4FGWA 3NC1C 2ZJOA 5GMOA 1RKXA 5KQPA 2P4QA 1J25A 1YQUA 1IY8A 1PV1A 2QA5A 3ETCA 1MQSA 3A37A 3LUKA 3SNHA 1NBIA 3K92A 5KSPA 1JHAA 3H83A 2VTBB 3HABA 1HETA 3T54A 4EQZA 4U2EA 3O84A 2QL9A 4FYJA 4IF6A 1GTG1 4ETMA 2GEKA 1M6VA 1TVEA 2I8CA 1JHRA 4RSRA 5PGMA 2VH1A 4ZO8A 1JKFA 3W7VA 5J3JA 3BWVA 1PJLA 4C4XA 2FQXA 2I29A 3LPAA 4LQ4A 1L3BA 4L57A 3V2GA 5CCXA 1QP7A 4I3FA 1GZUA 1S3FA 9MHTA 1QG2A 3C4JA 1BCSB 1HTTA 2A5YB 2E87A 3HHPA 3P2YA 5TGZA 3U7FB 3H4VA 2A0YA 4M1ZA 5T8KA 3F0TA 4NGTA 4OMDA 4A0HA 4NBSA 4OHMA 1DTEA 5DDIP 4I1PA 5ARBA 1QYXA 3EXAA 3I9V1 3QFFA 3RSSA 4D9HA 3V7WA 5IM4F 3WYBA 1YNSA 3ZYZA 1E4OA 1CLEA 1E99A 3CUWA 3K20A 3KTAB 4PIVA 3UT5B 1YWGO 3RQIA 2BPOA 3NM6B 4WL0A 4OM7A 4MPPA 1YD7A 5B2ZA 1UT8A 4XYMA 1FVXA 4TMVA 5AJWA 2FPUA 3RC2A 2V7EA 3PWTA 1R1DA 4COBA 3TCKA 4MKHA 5HS6A 3CQ9A 4X64B 4YFYA 3IDAA 1OQAA 2P9TA 4KWTA 1IEQA 2RGXA 4C4PA 4P0PB 4JJ7A 5C4IA 2GDZA 2P1DA 1WE2A 2GK4A 4R6XA 1EK2A 1NP7A 5F35A 3IAUA 4DRZA 3HU2A 1R6VA 1RIFA 1ATIA 1RQGA 5IN4A 2PBZA 4BO8A 4RLQA 2CXPA 2UZAA 3IHLA 4MCAA 1MX3A 2X1MA 4IJKA 5FTMA 4C22A 2Y68A 3MEQA 3UJDA 1G3QA 2YY7A 3AV3A 1JFVA 2NSLA 4HN2A 2D8AA 2CW5A 1KRHA 3IS3A 4MW9A 1V3UA 1ZA1A 4OHRA 7ADHA 2GXAA 4F60A 3GAZA 1E6WA 821PA 1YVDA 3TB4A 3WWEA 1ADGA 3KZNA 4XIFA 3GT7A 1CF9A 5HQTA 3GJ5A 4OKIA 2GAIA 3DE7X 4U7GA 1QQTA 5L3QA 1W88A 3H7IA 3LX6A 3P4UA 5DCWA 3UUGA 3KALA 5CLGA 3D64A 1GITA 3LVQE 2DHEA 3DVQX 3RW9A 1NBWB 2YZGA 3IP7A 1TUGA 1SVLA 3HJAA 1EZZA 1C8VB 1QNLA 3HYSA 4UTVA 1M7GA 1SJ9A 1GQRA 1CERA 3H2IA 1EYZA 4POAA 5AI4A 3TXYA 2HA4A 3D43A 5KQGA 4LXUA 3HLKA 5E9AA 1XD8A 1VGQA 5FR1A 3VR0A 3ZHBA 1I4EB 2PWPA 4TMYA 3AUSA 2GASA 3QOWA 3X2EA 4NH4A 4BJ6A 1U3UA 3RAFC 5EMNA 1XLTC 4WX2B 1A8UA 2QUIA 3H5AA 3PC2A 4YMGA 2XT9A 4K8RB 1MC4A 2QN1A 4C0HA 1QGOA 4IIEA 1LBHA 2EFJA 3IGFA 5FUQA 4PGFA 3O8DA 2ZJ3A 1M1XB 1V8DA 2YJNA 2XYGA 1AX9A 1T2UA 4V3CA 4H60A 4NYMR 2PUFA 5A6SA 2BN4A 5DRYA 1I3NA 3A14A 4KE7A 1W6UA 3PXCX 1SC6A 4FI3C 5J5CA 3S2EA 4LDNA 4U00A 4Q24A 1H2ZA 1IJBA 2R7AA 3V8VA 4BGUA 2FP3A 4FYVA 1EUDA 4RVDA 4U7JA 1QH9A 5E4TA 5C52B 3DG9A 2ZYHA 4HD8A 1PNOA 4JKOA 4RIFA 3QMWA 4FYKA 3DD5A 4RCYA 3CH5A 4CM8A 2XUGA 4DPKA 1R3UA 3D7DA 4NENB 3TLGB 1QAMA 4D97A 3G17A 3IOBA 2QRMA 4DBLC 2PH5A 3HN7A 3PUHA 4B43A 3SQOA 5K0EA 4HLNA 4Y2PA 1ESCA 3OKCA 4PC6A 3R7FA 3WQHA 4IQGA 1XO1A 4BQQA 4YMHA 1TA0A 5F5NA 5LM3A 1L5OA 3ANLA 4ZOLF 4KREA 3V8RA 2BGGA 2Q4BA 3PGA1 2BFDB 5BNWA 2WG2A 2WUFA 2Z5VA 3NFRA 3VR3A 4FSHA 4JOCA 2FR1A 3VTKA 1DIGA 5FFFA 1GA4A 2G6TA 4RANA 1U3FA 4XUDA 4A91A 5EIXA 2W90A 5LKRA 3FGNA 5BNZA 1AT1A 2JFUA 4PC2A 4RS3A 3BKWA 2GBFA 4WNYA 1YBMA 4BZZA 4PAGA 4J1NA 2YJVA 1QR2A 4HDSA 4ZVKA 1TZCA 1XSEA 2AFHB 4YRQA 4AYXA 5I7EA 3G59A 3WMXA 1L5HB 2Y4OA 2H2FA 2ZXFA 4G0NA 5D3MB 3SZUA 4NBTA 2W6ZA 2WZQA 4XQGA 5TNXA 5KTNA 5AM4A 1Q1NA 2V7TA 3INYA 5AFSA 5KNCA 1IQRA 1J8MF 1E0KA 2FZCA 3ZU4A 2X9NA 3RIXA 4QAQA 5EP2A 4ZKEA 4L0CA 3OUZA 1I3KA 1L4NA 3KZMA 4F45A 3THXB 1QHEA 2H85A 4GDMA 1EVQA 3KPWA 1XV5A 1TVCA 4IH9A 5KSYA 4FMDB 1JNYA 2YYSA 3W9UA 4NXMB 1JEOA 4BO9A 2P6PA 3QWBA 3SM9A 4YRLA 4F72A 1N2OA 4YCLA 4KSBA 1N6KA 1A9SA 1ABFA 4PRZA 3EBPA 4RPGA 4TQUS 1T6ZA 1W2HA 1NJSA 1Z28A 2PWBA 3AY7A 4PN7A 1PV4A 1ZX1A 3EF3A 4YV0A 3QE9Y 3H1BA 3JQFC 1JE0A 4FFOA 4X1OA 3DZGA 3A4NA 3W6OA 5KYGA 1JB1A 4EI8A 2V7QA 2MSKA 3VX4A 2VN8A 2FP4A 2NZXA 4E09A 1AU9A 5IEBA 1J1ZA 3PCTA 1E2KA 1Z8FA 1P31A 1A9YA 2E5FA 4XIJA 4CWAA 5HX7A 1QYIA 2QMEA 6PFKA 5C37A 3P71T 2VDPB 5TJ9A 2PKRA 4I66A 1XTRA 2BONA 3LKVA 4N01A 4AJNA 5TY0A 5G4LA 5IUNC 3VYUB 4NBRA 1KJIA 3CSUA 4ID3A 2DZDA 3OCCA 4JVMA 4YCAA 4ERXA 4GIBA 5T57A 1XMJA 1QZUA 5LFAA 3V1KA 3AF4A 2JFGA 4RYDA 3WL7A 4NXNB 2QL7A 2PEZA 1J0EA 3GCDA 4JI4B 5ECDA 2EP8A 3SKVA 1P0CA 1A4UA 3PC8C 2CJXA 2FN8A 3U3MA 3B12A 2E85A 5EIBC 3U6KA 4V38A 3RDPA 4CEJB 1KI3A 1Z15A 2FQYA 2QTLA 1VXOA 1XHFA 1U0BB 1JR3E 1P7CA 3IFSA 3SJZA 1T5DX 4FW9A 1N3BA 1YU9A 2BEJA 3R8CA 4Z8XA 2OV1A 5DEIA 3IOCA 3IUPA 1BRMA 1X9GA 5DXJA 2C8JA 3H04A 3HKCA 3N2ZB 3OT1A 4ZQHA 1MOPA 5TPWB 2J08A 5JMOA 1P2VA 1BE8A 2VA9A 1AQNA 1LY1A 4IUCS 3IPYA 4MUXA 3U2QA 2QP3A 3X1MA 4E3ZA 1TKAA 1EVEA 4DDMA 2AC2A 1KKMA 3MWLA 5IVDA 5JZSA 5C4GB 1G2QA 3W8DA 4ZO9A 4H6VA 3PXGA 3VFDA 2BGUA 9LDTA 2VSFA 3WK4A 5L4NA 4YWJA 3H2ZA 1DX9A 1GYQA 1FS6A 5FRDA 1MC5A 2JGKA 2G76A 5A9TA 2QS9A 4B83A 4DV6B 1EP2B 4TN5A 4ZYXA 5KC8A 5GJWC 5DU2A 1RYYA 2GN8A 4ND5A 4ZQCB 3TM4A 2QR3A 1P19A 3ZWOA 3ZD6A 4UVGA 4DR6B 2PZBA 3WWZA 4OQQA 3L06A 3ETDA 1VBNA 2YRFA 4QUEA 2PKCA 4K9OA 5DHAA 3RRFA 4O3FA 3ZHQA 4BN5A 1FTNA 5EJAA 3OPMA 4BO7A 3PSAA 2I3AA 4NYMQ 2IYTA 1XTJA 2NAFA 4O4IB 4R31A 4P45A 3QW4B 1YFLA 3CCCA 3NHBA 4BLTA 4HI0E 3PJRA 2BH9A 4E2FA 4C4YA 3UT5A 1QMGA 4JL6A 5ESWA 3P5BA 4CQLB 2HSWA 2ZYTX 5ADUS 1FBNA 1PGJA 4Y2YA 3ZGYA 5KTSA 1F38A 5MN4A 4J4BA 4MYSA 4YP6A 3FDIA 3U37A 2A0UA 4CIAA 1J39A 2RH4A 2YJ5A 4HUJA 4MKFA 3T12A 1KI9A 3LOQA 5JCOC 4KAAA 2PT6A 3PLRA 1ADFA 2JAOA 1U8AA 2R60A 5MFZA 1KZ7B 3PRKE 5IVPA 3EIHA 4CMGA 3IHTA 1DAFA 4NEHB 3E1SA 1EFUA 1RDFA 1WXXA 2Q3FA 2VP2A 1NPTO 2B7LA 2DSTA 2VPYA 4HZUB 4P93A 4YAGA 3JASB 1ORRA 3M8KA 4JEUA 4ZANA 2YICA 2GT1A 4LWQA 5THKA 1E59A 2DT8A 2HA0A 3EAFA 3ZY6A 5A62A 2VTBA 1FXUA 3TQFA 2HT1A 2HMUA 5I7OA 2OWDA 4TRRA 1M9NA 4R1MA 1EJBA 3E2IA 1FPMA 5AM2A 5HZMA 4ARCA 4CT0A 2H07A 1PG2A 2JBHA 3UCEA 5AKHA 3PKZA 3OCUA 3QHQA 3FVQA 2QXTA 3QE4A 4RD3A 3QSGA 1A1SA 2VF4X 3M81A 2CXSA 3FYUA 5MFPA 1XVUA 4BFTA 2FMTA 2R7KA 4TXJA 4MGKR 1Y6JA 4DV7B 2HHAA 2NXCA 2PV0A 4ARUA 4E3WA 1NQ5A 4CQJA 1WUKS 2BJVA 3NJRA 4RD4A 4CIVA 5DN6A 1E2PA 2YJ4A 5JJLA 1A96A 2OM2A 3IMCA 4OKSA 1H9CA 1CPYA 4MV9A 5IARA 4BMOB 3G8CA 1GCOA 1U98A 3KJQA 4Z9AA 4FT2A 3F5SA 1B0AA 3TLZA 3HCWA 3N39C 2ZIWB 4RFLA 2HH9A 1F0YA 2ZANA 3PXDA 5I7VA 5F98A 4AJPA 2VF7A 2K87A 1TAGA 3JQQA 4Z54A 4CV2A 1Y6ZA 2SKCA 4C0JA 3C7CB 1RAGA 4AO6A 1R6UA 2RG1A 5CLFA 2WEKA 3IQZA 3SK0A 3ETLA 2EXXA 4IS3A 1RU3A 1WABA 4B1FA 5JASA 1XXHA 3PLAE 1QHGA 2C1ZA 2BI4A 4IGIA 2IYUA 1JMYA 2JGLA 4ZAFA 4D8YA 1XVAA 3DNMA 3DXXA 3PVZA 3TTWA 4MX8A 1MLDA 5EMLA 4KR7A 1N78A 4AL4A 4URVR 3IQHX 2V4ZA 4JLAA 3RUIA 2UZ4A 1LA2A 3N3BC 4QRDA 1F2UB 2QYTA 3HCDA 3NZEA 1HV8A 3JY6A 2CLLB 1MMFB 1NT4A 1FMFA 1W8IA 4PLCA 2F43B 3KUUA 3W5SA 1W2WB 2PFSA 3OZWA 2DH6A 5D1NA 4OCZA 1G6KA 1QGZA 2UUAB 2GZ2A 2QM3A 1GQYA 2GA8A 3E15A 3MWDA 2GS9A 3BGVA 3NOJA 5B64A 1ES9A 4XFDA 3OQ6A 1AZWA 1SPXA 1ORHA 5JZVA 2NYRA 3K4HA 3NHJA 4M49A 4NCNA 2OKCA 3VR4A 3CZQA 1EU1A 4Y18A 3BD6A 3P9ZA 1DU4A 4BVBA 2V7WA 2P1RA 3EK2A 3GJQA 4JC5A 4GRAA 4JJ6A 1L8QA 4XUGB 3NT4A 1TPYA 4JODA 1ETHA 2ZUEA 1IVNA 3F6CA 1WMFA 2ZS8A 5REQB 3VYRB 1XAIA 1XAGA 4Q3CA 2WG0A 4CM3A 1T9KA 1MU0A 2CDRA 2JFZA 2Q5JA 4MB6A 4C29A 5AVQA 1MPTA 4RK5A 2Z9BA 4AWXA 4UHJA 3FUUA 1AIPA 5C1PA 1CR4A 1RLOA 2YN4A 2FOLA 3PBKA 4U2BA 5FAXA 1EX1A 3VMFA 4DDKA 2Q1WA 1DRJA 2B37A 1KS2A 4C5BA 2FPSA 2MSWA 4S24A 1IBMB 1PBTA 4FYXA 4PG7A 3GRRA 1FZQA 2C07A 4QU9A 1BE6A 3BG5A 4GZMA 4QRHA 3VO1A 1EEXB 4YAJA 1O95D 1R4MB 4MW2A 3KD3A 1U9YA 2CSUA 4QVGA 2JIDA 1YJ8A 5LMCA 3FCEA 3K32A 1GPKA 1L4MA 4JJ8A 3ROQA 1OH8A 1ST3A 4ALKA 1R0SA 2Z1NA 4ITVA 4NZZA 1JG1A 4ZDKA 4XX0B 1DL5A 1DUIA 1MQAA 1QIIA 1L8LA 4RMIA 2GFIA 4XUCA 5I51A 4DCJA 5HRCA 4I0WB 4K7JA 5G0WA 1RLIA 2P2SA 2A92A 3WGLA 1MJGA 3STVA 3BIXA 2NU7B 3AR5A 3KDSE 4V0NA 1NUSA 4ITUA 1HYBA 4TQAA 4S0ZA 2A9KA 4R9UC 1QIEA 3SOZA 1D2GA 1UK7A 4CF4A 5C2JB 5G4KA 2XZTA 3E9EA 4I8XA 1AO0A 2XNKA 1PR5A 2ZYIA 2FFAA 2ZATA 2V9ZA 4G37A 2GILA 3GROA 3P9IA 5F4ZA 2C1EA 3F3KA 4M7WA 5ALKA 5AM5A 4BX9A 4EW6A 1OR8A 3OJ0A 2UVQA 4RPHA 4CIBA 4B4DA 3PNYA 2PEYA 3KAQA 3LPLA 1XU4A 4O4IF 4YPFA 5FTLA 2C88A 3F9IA 2ZUTA 3WICA 4A1FA 4LN1A 4FGKA 1SB8A 4TTIA 1IHDA 3W2TA 3K09A 3JATA 4JNCA 1PLKA 4F3NA 2H5LA 2CB0A 2PRKA 2D1QA 1VKJA 4C6TB 4JK3A 3A6EA 1GKLA 1Y1KE 5LQCA 3LT1A 1JJAA 5GJVC 3NDJA 4HDRA 3H7AA 4BKRA 8GPBA 3HN2A 2QPLA 3FOBA 3VISA 1LX6A 3PGJA 5BN4A 1V25A 1UPCA 3UPUA 1OI2A 3C6ZA 5GOZA 1GRNA 3O8OA 5JECA 1P1FA 1THZA 3AX6A 5J4LA 3ND9A 1ZGHA 1FL9A 2G36A 5ESDA 2EWMA 2GRJA 2P3SA 2FW9A 4ZXFA 5AJXA 3OM9A 4URWR 4F4HA 1PHRA 2B61A 2OO7A 2D7DA 1BJRE 3OG9A 1M6VB 3FHJA 1YQDA 1Z6YA 4GNRA 3WLMA 3HB5X 1TCVA 2F67A 2DUMA 2EYQA 4BNIA 3UCXA 2RHMA 1E9FA 2V1XA 2VRCD 3LQRA 3KWJA 2BCJQ 3AFNA 3DE3X 4WJLA 4PVCA 3ZW9A 1A76A 4O4LA 4N12A 4PPYA 4RL6A 2XXBA 2H1IA 2DQ4A 4XPZA 3QSYA 5EMKA 2OCBA 3EHEA 3HE3A 2XRMA 3DEZA 3EH1A 2IY8A 1Z7BA 3OZVA 3WGNA 1OYWA 4YJ2B 4FM9A 2Q6TA 2XBUA 4CV3A 4DOMA 2OXCA 3DEJA 3RS8A 3MBOA 1LI5A 5J1TB 3FCSB 3SSNA 3ZHCA 2Z2IA 3KR1A 4F1JA 3IA7A 4EECA 5FB3A 3OHPA 2FFQA 4CVNA 1J7JA 1XA4A 1QSGA 2ZEJA 3IVCA 5JSFA 1G4AE 3MJFA 1NVVR 2VNKA 2AX3A 3OIVA 2C7RA 4KR3A 4Y98A 4M3NA 2ZJ8A 2BV3A 1EUCA 1LI7A 2PVWA 1S2NA 4X00A 5KDLA 1M0WA 2F8MA 4ANFA 6Q21A 4IO1A 3ASZA 4JYAB 3B2EA 1JIVA 3WXBA 1JP7A 2VKQA 2WU8A 1KF0A 1LK7A 3CEAA 1RADA 1I1NA 1ICEA 2O7QA 3KZCA 4JZKA 3SSMA 4CIDA 5KWEA 1TFRA 3NRCA 1XC7A 4CKWA 3VYWA 4F5ZA 5JO9A 2O0MA 3MAAC 1FDUA 1NYRA 2H4YA 2NW6A 2PSJA 1V5GA 2QX8A 1B3BA 1X1TA 2XITA 4AC9A 3WAGA 2PLWA 3FHTA 1A04A 4ENUA 2VQSA 2ODNA 1Y81A 1NY6A 1XQXA 1P4SA 2BMAA 1TK3A 2GM9A 3L3BA 5K0LA 1D0IA 3JTEA 3ZS8A 2HIHA 2J09A 3CKMA 4OPMA 4NSNA 3V46A 4AAYA 4Z53A 4HR7A 4KNYA 3L40A 3FBGA 2JIZA 1FQWA 3TYXA 4B6PA 1QNFA 4TXHA 1Q6YA 2WE8A 4HTFB 3RFUA 4J3FA 3UATA 3GLGE 1PCXA 1XKLA 2HXGA 5IHXA 4GKKB 1X7ZA 2Y8EA 3CC8A 4IOJA 3OUTA 4MVJA 4OLAA 1DTWA 2FE4A 1E1CA 1N2ZA 3PZRA 2QTRA 5DLDA 1LJLA 3C3KA 3SZ3A 3U4QA 3OOEA 1TZ2A 3ZQ4A 4EZIA 2WHPB 5CM8B 3P4XA 2UUBB 3V1NA 5KZMB 5IT5A 5B37A 1EFAA 1NI4B 3JQRA 2C61A 3NW9A 4A0FA 2AKEA 1IBSA 2R8BA 5JCXA 1B15A 5L4SA 1P8AA 2PX5A 1B23P 3RODA 1ADJA 3LX4A 4RTKA 1I2ZA 4XD7D 1D6MA 4A7PA 2O2CA 1C1HA 4YCJA 5LLSA 3ZHUA 3LQKA 3FJOA 4JKIA 4NZOA 5HQJA 3ZR4B 3NDIA 4MV5A 3K9NA 5ABPA 2GXSA 2P65A 2PRIA 2R1VA 4Y0NA 3T9CA 2VDRB 1DKNA 2WDZA 1R27A 4AJOA 5DISB 3VU3A 1YZTA 4FS8A 2A9OA 4AN4A 5BUSA 2TRSB 2OQIA 2I6UA 4HMQA 1ZR2A 1C7EA 1UBNA 1PJQA 3GYGA 1ODCA 1R9GA 5JSUA 2NYUA 4WZBA 2GPTA 3WVNA 4XYBA 1AKMA 1PQWA 3N2YA 3JD4A 1O95A 2Z4RA 2JH9A 3B78A 3PUJA 3QW2A 1G64A 4QQFA 5F4BA 1DB3A 1N2SA 4PSAA 4EELA 4QWMA 4XM1A 3ICCA 2YKGA 3ESDA 4QYMA 4BFVA 3CIOA 1F6BA 4BO0A 4FBMA 4Y6PA 1T9HA 3S9LA 4IRMA 4EO4A 4HX2A 2BKUA 4DMFA 2PX4A 5ALJA 4ZWNA 3RTGA 1AKUA 3TZLA 4MGHA 1BGXT 3SS7X 1UBFA 4D9IA 3HY4A 4J1QA 3I92A 4OEHA 4Q3NA 1YS4A 4G0WA 4OSEA 1MGPA 1Q7RA 5LD2B 5E9WA 1BVHA 1P6XA 1NFQA 2I80A 4CMJA 1Y7TA 2Y6UA 3OM8A 4E31A 1CZRA 1SBCA 1DXOA 2YIJA 2H3HA 1R6XA 4E4RA 1OXSC 2JFVA 1Q7BA 5HNKA 5JT1A 4B7XA 3U3ZA 5JH7A 3V9AA 1FP6A 3KB1A 4IXNA 5BWLA 5H82A 1SCQA 4N5IX 2C9BA 4QXMA 3WMRA 3UHOA 1E9BA 3N2EA 2DECA 4PR3A 1K75A 2QAJA 4KQ2A 1YZFA 1AMOA 1VGRA 2E37A 1L5HA 4AP6A 3RRMA 5CYPA 5D3MA 4C8TA 2DWUA 3MS2A 1EFCA 2GCPA 4OL0A 4TT3A 2OO3A 3DFMA 4UCWA 1CVLA 1OIVA 1OWMA 1H0KA 5KX5B 1HSOA 4BQNA 1WMSA 2Q5IA 1SNYA 2X86A 4IXDA 4N5HX 3SYNA 1NPYA 1ZIYA 1YKFA 1N6NA 1UZMA 3NUZA 5HYVA 3NC4A 2FUNB 5FA5A 2OXTA 2YS6A 4HWKA 1XQWA 1U1DA 2C3MA 4YUXA 3QFRA 2O1WA 1R4MA 3HSSA 5H9VA 1OX6A 1SU8A 2G9UA 1OI3A 2A14A 2HLNA 3E7DA 4MLCA 4AU1A 4MYUA 4DTCA 2DWPA 5A7FA 2QX4A 1EAYA 3PITA 4DR4B 1L5LA 4YJ2F 5A9RA 4J6EA 3QZUA 1DAHA 1PNTA 2GPYA 3F7MA 1ILEA 3STYA 1H2BA 5BWBA 3THOA 3OQIA 2OGUA 4Z51A 4DIKA 1DJLA 1JYEA 4OFZA 2JLAA 4UNPA 4UJ3A 2QE7A 3UMCA 1P9OA 2R87A 1X1DA 1U2GA 1IOLA 5TPZA 1JKJA 1OBFO 4ZAYA 2C5GA 5CM2Z 2XMGA 1G2PA 3DVLA 2ZRNA 1JPUA 1T2VA 2PPVA 3TJRA 4LF5B 2AN5A 3FDFA 4MQEB 3T07A 4ZTZB 3LFUA 4UHHA 3KNZA 3RM3A 3AUJB 1BEEA 2CMGA 3T38A 2GN9A 4CCSA 3QVGB 4RMNA 5KCMA 2RGCA 2QLBA 1QBGA 2F9MA 1IY0A 4EUNA 3ANMA 1OUMA 2PGLA 3F1LA 1I10A 4PE5B 4ER0A 1I7NA 1GQFA 3B48A 2DX7A 3M6FA 4QL3A 1GKIA 2QMZA 2VK2A 4REQA 1A9XB 1QUFA 3MCVA 4N0MA 4D98A 3TH5A 2QNRA 3ZE8A 4HEA1 4UBNA 2NP6A 4DSZA 3NWBA 2A4KA 5COBA 5EWLB 5BYKA 2FSVC 3ENKA 2Z30A 2P2NA 3OEWA 1L7XA 2ILVA 1TUIA 4LF9B 4IUYA 2A6PA 5C3MA 4OC5A 4JP8A 3FFTA 1XNGA 1PZFA 4MJLA 4NQRA 1JA0A 3FRIA 4QO8A 2XMBA 4GKBA 5BSMA 3T7SA 2CD7A 2DTXA 4MWZA 4R84A 4WFJA 2IEGA 5EIHA 2C00A 3AUAA 3F4KA 5TMBA 4CM6A 2JAPA 2JJMA 2ZT6A 3ZX4A 4CL3A 3QVLA 3ELDA 1PNVA 1V47A 4OHXA 4RH3A 4E12A 2BTQA 1SCNE 3RPEA 3ER9A 4DUYB 3ZE7A 5IC5A 3OE5A 1ZM9A 4P4SB 5YASA 4ZVPA 5JVDB 3TX2A 1M5UA 1C1XB 2XKKA 2X40A 5IM5A 2Y1EA 5ALIA 5A2QA 5KYUA 2ZIFA 3DBLB 3KVOA 1CIJA 2C2MA 2H1WA 4AJEA 2N1MA 3M4JA 1XA0A 3H2GA 4IJQA 3X2FA 5AI6A 2QD2A 4XIGS 2FMUA 1NX6A 5LDHA 5EZYB 1NJ2A 2OV2A 1PVVA 2QROA 3IPAA 4TJVA 3G1UA 1KA9H 1OHHD 1V3QE 3BJEA 3IXQA 5CA0B 3MC1A 1CUAA 3L6UA 3RVLA 3MWKA 2D2XA 1PJ3A 1VHQA 4M9QA 2HBRA 1HKHA 3P0EA 1V7PC 2DPGA 4IVNA 5DGXA 3URMA 2PMWB 1FDVA 3T9DA 4UUQA 1AS2A 1RE1A 4INAA 4DCGA 1O3YA 1GTZA 1K7YA 3KVNA 5CLQA 3U56A 1O89A 1RBZA 3RVSA 3E9CA 2WZDA 4RMJA 3QY9A 2IEIA 4FNAA 3SE0A 2PZ8A 3JATB 3TFWA 4AVYA 4MJ7A 2FEKA 4IGEA 3WLHA 3AJ9A 4ES6A 4I1VA 5KWJA 5KYWA 3H4IA 3DT9A 3A4LA 3ABSB 1AGRA 4O25A 3E0QA 4KKVA 2JLSA 2R5FA 1KI4A 5E3IA 4GRIA 3TE7A 3EQZA 3K0CA 3T95A 3LUPA 1AV7A 1HXHA 1MV8A 3CLKA 3FWKA 3H6KA 2Q4OA 4LFCB 4ESOA 5HRUA 4YA6A 4EKYA 4YN3A 1QP0A 3TQRA 5JTTA 3C8ZA 2PX8A 1EXWA 2AUTA 2V6FA 2ZJAA 3AT1A 2Z5LA 3ZDZB 1NV9A 5FBVB 3AUKA 4Q93A 3L8CA 4QZVA 3VV3A 5CDUA 1WU7A 3DTVA 1WR8A 3SR4A 1QH8A 4JASB 3DTNA 3WRXC 1YR3A 1LBTA 3HKCB 3OT1B 4P35A 5EJIA 1DOZA 1S89A 4II3A 1LDGA 5DKFA 3T7KA 1ZRHA 4C0QC 2RGRA 2QUKA 1UMBB 1JIIA 1VPVA 2QBYA 1WKBA 1VSBA 3PNSA 2R97A 1TJYA 2NO9A 1BVRA 3I23A 5EP3A 4HFMA 2IV3A 4CN8A 2EJTA 1Y42X 1GA6A 4E6EA 2O8DA 1Z8LA 4LZWA 4P08A 1C3VA 2ZUVA 3AP2A 1W5EA 2FFJA 1TU3A 4IQ4A 3IUBA 4J4HA 2LUOA 5K3FB 1QHIA 1SUIA 2CUNA 2C4UA 4TROA 5ECWA 2ZBEA 1NUPA 4CMKA 3QPWA 2BGTA 1ESEA 1RAAA 2PSSA 2E49A 4O8ZA 2WA1A 1ENZA 3EXEB 4QE3A 5B1YA 5HMLA 2FDCA 2FCRA 4Q4HB 3G2PA 4PZEA 1PS8A 4L9RA 4TS1A 1IULA 1HE8B 1XKQA 1NVMB 1IM2A 4J0QA 2C2ZA 2NX2A 3ZE9A 3E1KA 3EEOA 3P7MA 5CXXA 3MWGA 1GP2A 1R0ZA 2OC4A 3CRNA 1NE7A 4C9BA 2I9PA 1U0LA 4TT3D 5A1TA 1WX1A 3MGAA 3V97A 3PR3A 2B5OA 3GBPA 4V1CB 4LJ6A 3FX2A 5DNUA 4HQKA 4FOOA 4N03A 1MG0A 4ZI7A 2C97A 4G0QA 3ND8A 4PFSA 1NXXA 1YBFA 2FJ0A 4YHBA 3U9LA 3WL5A 2DPHA 3BXPA 4YV2A 1JR2A 5CFRA 2CHFA 2JD0A 3DD1A 4FOLA 1SFRA 5BN1A 2IZZA 2KHZA 5E0OA 2X5XA 3D0KA 1I0IA 2G1JA 1RZVA 3IKVA 3Q40A 4LHSA 4Z86A 3WI7A 1HOXA 1Z6GA 1ZYUA 3PCXA 4TL9A 1L7AA 2BFEA 2CE7A 3DEFA 3OJXA 3HVIA 4O0LA 4EFKA 2X8JB 3NCHA 3G9ZA 4XPIB 1XCPA 4XRGA 3SHOA 5MGBA 4NDZA 3ITNA 4JLKA 4QKQA 4ER3A 3KTAA 5KNLA 4LZPA 4WK0B 4E21A 3SPXA 1XWFA 1VSTA 2MT9A 4YRRA 5TPZD 2CE2X 1ZGGA 3ZWYA 3UJ3X 4I8DA 1Y4DE 3LBIA 4FS3A 5EESA 3SEAA 1C3LA 1CK4A 1LPPA 1GAEO 1BC5A 1NJ6A 2FGKA 2C42A 1BS1A 4INOA 4YJ3F 3VNAA 4WK6A 3WGVA 4ZYTA 5JD6A 3BIWA 4WK2B 4FE4A 4TPKA 3Q41A 1SUSA 1U4SA 1VKRA 1JR4A 3E9DA 3HP7A 4GYKA 3UWOA 3TTTA 3MCTA 2D0PB 5HQ3B 1RYBA 3VVBA 5JD5A 3VJKA 1KWGA 1ZN2A 2BGKA 2LV8A 1JQDA 2WNSA 1Z2PX 1DC4A 3ZXXA 4QQNA 3Q5GA 1D2AA 4RQBA 4TWBA 1EZAA 1RJ9B 2R0QC 1T5IA 4LRUA 1TEHA 2NTNA 3CWQA 4BWVA 4L5CA 1DSSG 4DSAA 4ENRA 2BFOA 2HREA 1O8BA 2XOEA 3FPEA 1XRPA 3ZN2A 1EWKA 3CBGA 1UC4B 5KSOA 5CW2A 1Y6RA 2H1OA 3DDWA 1G291 1YBAA 4JB2A 1SIWA 1ISRA 3WB9A 1I4WA 2O4UX 1B6SA 2OHGA 4AXXA 3O0TA 3W3ZB 1IBLB 3F46A 4ZRMA 1H2EA 1HYHA 1KR5A 1WPQA 4JITA 1M83A 4Q3KA 3WQBA 4AYTA 3DO5A 3FNEA 4BB5A 5IYZB 1CXZA 1YQTA 4OIFA 4TMFA 4WBXC 1UKBA 2XQVA 2FRXA 2ZIEA 3UC5A 2VUTA 1NJGA 4GP9A 4JJKA 2VT7A 1C7RA 1II0A 1ZESA 2IEDA 3K09C 3ZIAA 4C86A 1M1NA 2OEPA 4X6XA 2QRJA 2H0AA 3NVMB 3UT6A 2PD3A 5BN3B 5LA6F 4J6FA 3HFRA 2PNFA 4CW7A 5JSQA 3FB4A 1OU0A 2VJKA 4P7JA 3UXHA 4E6PA 3AHGA 3QLVA 5BNFA 1Q7GA 5IKEA 2R8EA 1ONBA 3Q5DA 4CCYB 3THWB 5HUJA 2ZRCA 3O75A 1LTHR 1NVUQ 3USZA 3I05A 2BM8A 4PAOA 5KTRA 1SUAA 1EQAA 2FH5B 2M6RA 2X13A 1MA3A 2ZBDA 3CYFA 3GBSA 3R6LA 4GR4A 2HCTA 3H5OA 3IEUA 4MDYA 3KBBA 4JJFA 4OATA 2YRXA 3HVHA 4N6NA 4W6QA 1BWPA 3SC4A 3C0KA 2X76A 3UVEA 4O4LF 1U8CB 5LXTB 1QM5A 1BCRB 3N8KA 2J48A 3REQB 4TKZA 1SKYE 2JI4A 5JNWA 4KFCA 4BMPB 3OZGA 3GJ3A 1U8XX 4BNXA 4KN5A 1U7ZA 1AQIA 3RYCB 2G83A 3IQWA 4WH0A 4RU1A 2DBQA 2CFIA 4RYLA 4M2LA 3MFQA 4U2FA 2WTXA 4J49A 5L3SA 2YYZA 2HL6A 3U44B 1O58A 3A6KA 1QC5A 3FPSA 1C3JA 2H4ZA 4URHA 5LZ5A 1CZLA 4YRMA 1E58A 2H5JA 4HN4B 4PC1A 3MQFA 4KJXA 4J94A 2FEPA 4B79A 3H2JA 2O3UA 4H0FA 4MW7A 4B7AA 1RP1A 2GWRA 3BM5A 3LC2O 1UKZA 1DO0A 4IUDS 2H00A 2BELA 3M49A 4KXQA 2JGDB 4ENVA 4LQGA 3STXA 4E4TA 3Q3VA 3T7AA 4BFUA 4C9RA 5AVTA 1UPTA 1WW8A 4FLEA 4J2OA 4L27A 5GZ6A 3SS8A 3F8WA 2X77A 1ISIA 3TIXB 4QXQA 3BUSA 1C30B 2OCGA 4B4VA 2ZIZA 4Q4DA 2WHRA 4MUGA 4QJ5A 1IATA 1KQ3A 2BHRA 2IEAA 3HXTA 4Y1GA 1NBAA 5DBEX 5A5FA 2JGMA 5KINB 4M0CA 3HUDA 2QTTA 2I1VB 4G2NA 2ZSEA 2HXYA 1NUTA 1TRKA 3K16A 2Q27A 4Q00A 3ROPA 5K0NA 1LBQA 1KQOA 1M7HA 3FVTA 1GPYA 4RZHA 4B75A 4W9MC 5JS1A 1DWOA 3OFSA 3CGWA 2CLMB 1QFXA 2VP6A 1IN5A 1HRDA 4JENA 4OOEA 1A9XA 3QF4B 4P4IA 2VPZA 5A4FS 1JSXA 3F71A 3MBIA 1VKHA 4G8BA 3Q7TA 4II7A 2QR2A 5EA2A 2WWWA 2P9CA 3EVAA 3SVZA 1UFQA 3LBAA 1E7YA 2P3QA 3EZXA 5AI9A 2HJWA 4GP6A 4Y1EA 4X66B 1RTTA 4EPWA 4RVHA 4US0R 1MKYA 3QMVA 4RF3A 3BB4A 3RIHA 1QK5A 2AQHA 5F64A 1OBHA 5B1IA 4Q82A 4X41A 3W7BA 1UC8A 1Z5ZA 1LC0A 1WDWB 3I9JA 3RS3A 5D5QA 1TMKA 1NM5A 2AOTA 1JWBB 3BGIA 3BL8A 4N49A 4PR0A 3VSCA 3PPIA 3ZWVA 5B4UA 4OXYA 1OI7A 1Q5PA 4NBLA 2VP4A 1LV7A 4P4SA 3B38A 5G1OA 2EBWA 4A0QA 4D6XA 4V0KA 3TSZA 4MYTA 2WKWA 3LHSA 1PL6A 1Q83A 2RKWA 1G0NA 2ECKA 3MWFA 5FUWA 2PTGA 4KQJA 2PS1A 3ASYA 4NU0A 4QUIA 3PC3A 3U9TA 3P0IA 1RRGA 2IIVA 3NHPA 5K3EA 3C5EA 1EX6A 2C7GA 2C9OA 2ON6A 1U0EA 4TUYA 1MB9A 1XQVA 3LCMA 4O2RA 3NTVA 3PFHA 4KG7A 4DGSA 1CQIB 2CNDA 3EXIB 2VCEA 5EQJB 5KYXB 2XYRA 2WD8A 3A6FA 1LS1A 3VJRA 2I6QA 2LCFA 4D3DA 3GRCA 1SM4A 3GUHA 3L4JA 2XB8A 2X22A 4F71A 3SLKA 2WABA 1NG1A 5CXUA 5CT8A 2AOUB 3N8DA 1X0VA 2XKBA 3TGWA 3GLIA 2QAIA 1HNXB 1XFDA 1OFUA 4HDQB 4U9HS 2Q0XA 1QLWA 1TT7A 5CX4A 4AB1A 1EVKA 5A4DA 2PUBA 2GVDC 3QVTA 4FX5A 4O4JA 4OX9B 4PO1A 3ZHVA 4CIXA 3G7UA 1CY6A 3O47A 3MT0A 2OXFA 3GU3A 4TWEA 1FNCA 1L5WA 5B3LA 1SUEA 3OQJA 1Y5LA 1B76A 2OFXA 1W2GA 1NMXA 3NUGA 4WDRA 3H16A 4HT3B 1R4AA 1TM5E 3QA9A 4I5GA 1S2DA 1BH6A 2I3BA 3ERCA 4P44A 3C3JA 4C84A 1Q57A 3TMYA 1FVHA 3LWDA 3DEKA 3AGQA 3TKYA 1RQ2A 1CY8A 4ER6A 1IEXA 5FO0A 5JXJA 3PX7A 5DYTA 3QVUA 4QGAA 1OILA 2QG4A 3MB5A 4PAMA 4B3XA 4KR0A 2ZJZA 3IT2A 2VAMA 3BCSA 3M7IA 2ZJ4A 3DJFA 3QUQA 1LEHA 1XNJA 2Q3HA 2GZAA 4WNCA 3TR0A 3BERA 1T8SA 1BW9A 3GGCA 2PUCA 2Q9UA 3MUFA 4YRZA 3B1KA 4DG9A 1V35A 3GMTA 4M22A 5HWSA 3O2JA 5LLDA 4F2GA 1JDEA 1V26A 3A4IA 1Z36A 4IDEA 1A5ZA 2GAJA 4D82A 1SRRA 3ZCXA 2C2YA 5FAKA 4KXYA 1K7XB 2O2YA 1PL8A 5T4FA 2CMHA 3UMJA 5DIZA 2I4RA 1BROA 2F1KA 2MSEB 3C41J 3PDIB 4PPFA 1K3UB 3AB7A 3A4YA 3G8YA 3QWHA 5CVCA 1W9MA 3EGCA 4NHOA 1NMEA 1CVRA 4UBLA 3THRA 3PXUA 3HFJA 3VO2A 4OV6B 2PH1A 3DLPX 2Z4TA 1LCIA 4MW0A 3VHLB 3I4CA 2NU9A 1VCMA 3GH1A 4FJ1A 3AOEC 2EP5A 4W9NA 4F91B 2XCQA 1YI0A 1WB9A 1VPLA 2V0GA 3TPCA 3B5JA 3PEYA 4LGMA 3U81A 4EKIA 4DILA 3DWIA 3KELA 3G02A 3R7DA 1P0MA 2W42A 3LZDA 3UNXA 5BSFA 5AK4A 1VBHA 2GRAA 3MW8A 2CXQA 1LK5A 3D7SA 1K06A 3FSGA 4UFOA 5K5EA 4J75A 4PQYA 5DGHA 2ZBFA 1CQJB 3SYKA 4TV8F 3RS4A 4C4SA 5ANRB 4FXOA 5CX1B 5CTJA 2W0MA 3EVBA 1OVGA 3PV0A 1JQ5A 3UA3A 5CLIA 1J90A 2GK6A 2IUYA 4JN6B 5I7AA 4MICA 1G55A 2YIMA 1QX3A 3G3EA 4EB6B 5GP1A 2ZZMA 4BLSA 3LLSA 3GQBA 3HVUA 3T3HA 2OPHA 1MXFA 1LSUA 4ZOBA 3ZZMA 3NVKI 1DIOB 2EGHA 3WJ2A 3NDBB 3NAMA 3AF0A 4YMSA 5FLKA 5LNK6 3HZZA 3JPWA 4JYWA 3K1ZA 3NBKA 1RJEA 2A8YA 3ZNPA 1G8MA 4BRUA 2O8EB 1ENYA 2ENUA 3OQOA 3Q8MA 4YQZA 2BKVA 3A7DA 3GH3A 1T1GA 1GZ5A 3FCCA 4BAZA 3ZH9B 3RUEA 5IJ0B 4B7UA 1LB1B 1NI4A 1FMCA 1G66A 3VR3D 2ZRBA 1IPFA 2ZTHA 2WHYA 1CULC 4C7VA 1VYTA 5KSWB 1PN3A 4JT9A 1KAQA 5EWJB 3TPZA 3VO9A 5KYYA 1G9XA 1ZUWA 3ZZNA 4CMEC 3QIAA 1Z4JA 4RV4A 3S2YA 5K4GA 1US8A 2WRZA 5CVVA 2Y4NA 1U7XA 3DJYA 5TF4A 2IXTA 5IR2A 3A2MA 1U7UA 3OO1A 1NV8A 2WFLA 3GYBA 3DPIA 4L8FA 2H4HA 2H4FA 1FMTA 1WDTA 2ZT5A 1WEHA 3OZIA 5F3DA 1RW4A 4W5WA 4WRRA 3ZZTA 1L5QA 1G8SA 1BS9A 1T5TA 3B3JA 1IB6A 1R4NB 2QGNA 4ZHQF 1PT8A 1T4DA 5JJ5A 5KVAA 1KFKB 5DNEA 4M8NE 5JPCA 5U9CA 1PFWA 3UJPA 4YRGA 2G08A 4KXMA 4PCLA 2F3PA 2BFFA 3IURA 2RKOA 2VJMA 3FWHA 4ARAA 1Y5NA 2R6R1 4AZ0B 4KTVE 4WE3A 1VKZA 1R0RE 4BOYA 5JEEA 1NJ8A 1PQPA 1IM8A 1BX0A 3L8ZA 3KB6A 3LHKA 1KY2A 4UTZA 4RD6A 4ZJPA 3CF4G 1GNPA 3EXHA 2PVPA 4Z7QB 2ROQA 3LPCA 4GZ3A 4XVRA 1PT6A 1KVTA 4FMDF 1FK8A 3KQSA 4NU8X 4XDGA 4UPEA 5BR8B 4YECA 2R5NA 2Q4TA 1NW6A 4Y9TA 2VLIA 4ESEA 1W85A 4WMLA 1T2EA 2AFHE 2O7NA 3HCPA 9ABPA 1D7OA 4ESVA 2HU2A 2C59A 1EBFA 2F3UA 2OLEA 3BGWA 1Q19A 2VJYA 4I14A 1LDEA 4B3HA 1HDCA 1DS6A 4IV5A 3OJEA 1T9GS 4DR5B 4Q9NA 1R18A 1G8AA 1E4VA 3THWA 5LWQA 4TZ0A 1KVRA 3FHLA 4QBHA 3MJSA 1Z4MA 4M99A 1VIAA 4ARSA 3JQ8A 4ENWA 4WOJA 3EGDB 3FG9A 1VJCA 4IG9A 4OMFG 3HB4X 1MO5A 4W5JA 1WCV1 4KE9A 3KPVA 4RY9A 1QIMA 3BBPA 2I66A 3ACBA 4ZJZA 2NV0A 3GMDA 3HKBA 3PUIA 1AQUA 1QG6A 1YB4A 3LXUX 3MTDA 1LWOA 1OWLA 4P3XA 1XVVA 4PPQA 1G7TA 2BFFB 8ABPA 4XQEA 3K94A 3TIFA 1U9IA 3BDIA 4INJA 4LCBA 3UYLA 2D5LA 2GHRA 3NNDA 2OFFA 3ER8A 3LKBA 5FUVA 1Y3IA 5BXQC 3G0IA 2BDEA 3ILVA 1Q1GA 3LECA 1X14A 4HQ6A 4JXKA 4MPRA 5B36A 3ZVNA 4JX8A 3KKOA 1NU8A 2PGJA 2QRGA 1K7CA 2O8NA 2GJ8A 1V0JA 4H31A 4L0MA 2G77B 2YV1A 5LP6C 10MHA 3SR3A 3QUCA 2M1ZA 3D4BA 3PF9A 2C1XA 2H7YA 1A88A 1ZK1A 2X7XA 3I9FA 3IPLA 3JYPA 3SJ7A 1RHRA 2C3OA 4FHGA 1CR6A 3A28A 2O8FA 1MB0A 2IKSA 2OFPA 2Q3EA 4GOOD 4NZPA 4LUCA 1BHJA 1KAMA 1JQAA 2P91A 2V54A 1UKEA 3BXXA 3I8OA 1OU4A 3LPMA 4KRXA 4X1IA 1JLMA 1K6JA 1XVLA 5HF6A 2OFWA 1GDHA 1G8JA 3ZD8A 3TBHA 3FPFA 4OLBA 1QK4A 4P92A 2ZYAA 4S1WA 4WLFA 3PTAA 1ACJA 1KDPA 3V55A 2XB2A 1QGAA 1UADA 3RC1A 1UPAA 3R0JA 1N8TA 3KKMA 5DGDA 1ZC4A 4PNZA 2IYOA 3P4YA 3RH0A 2B4RO 3DMTA 4AUMA 5KI6A 3LBNA 3O73A 4M7OA 1GSIA 4Z6KA 3BWXA 4G1UC 4PLGA 4R8VA 4I7EA 4G5RA 1L6RA 2BP7A 5DBFA 1SU4A 4G5YA 2WVHA 1GEGA 1YOVB 3B1ZA 1IK4A 1M2FA 1M76A 4HB2A 5IZCC 3FOAA 1KMHB 4GC5A 4DMMA 1K8XB 5IVHA 1MEEA 1B1CA 1BVYF 5U1PA 2YJTD 2QVGA 4ZAXA 2FPGB 3RT1A 3TO5A 3QY0A 1WCYA 3IWWA 3B9BA 4O5OA 4JA0A 4B85A 5LOVF 3GFFA 3R3VA 4IDBA 4X54A 5ELLA 2IYAA 2J85A 1IOVA 1P72A 3LXRA 4PYMA 1Q0RA 4AKGA 2I4TA 2OHFA 3VBCA 2XCLA 5AK3A 2OXRA 1YZUA 2G06A 4TMXA 3V7UA 2RCYA 2J3HA 5E9JA 3LUAA 1IB0A 2IQ5A 1QDLB 4TTQA 2GM3A 3MIIA 3KKLA 4Y2GA 3T3IA 3Q11A 3C7AA 4HSEA 1AXEA 5SZKB 1VL1A 1X3LA 4BUCA 3ABIA 1ZH0A 4RKWA 3W6PA 2NTYC 3SZMA 1D04A 4CM8B 4Q3LA 1FSFA 4I81A 3SSOA 1KIAA 3P94A 1P0FA 4UCQA 3QK7A 4R1OA 4AIRA 3SXUA 1O87A 5HW0A 2EV9A 3SC6A 1GZDA 4MWGA 1VLVA 2O2HA 5FHRA 2Z9DA 1M5TA 3NEJA 2IEBA 2A0XA 3HVJA 1Q22A 1ZDMA 1J2EA 2H8KA 1YIAA 3AW9A 4R68A 4MYDA 3RNOA 3Q3EA 1PWEA 3SG0A 2CWDA 3KXDA 2VP5A 3C3XA 3TQSA 3NM4A 4Z9FA 4R8SA 2FWPA 4KVZA 2IWRA 4Z9XA 4FFNA 4CMAA 1O97C 3RYHA 5A3VA 1AOXA 1BWRA 3MT9A 5KJ1A 1AUPA 4PZZA 3RBZA 5JJBA 1B0ZA 3R3ZA 1C9NA 1HY3A 4OXQA 5HIMA 2X8LA 3BH0A 4HDAA 1MZPA 3HJFA 2O8BB 3AY3A 3O0DA 3VU1A 2VF5X 1MX9A 1C9EA 2H2GA 2B9VA 3G88A 3PIIA 4YXWD 2PXHA 4WUVA 4KPYA 1ODJA 1VLLA 1W0JA 1Y3FE 3CR3C 1WZIA 1X9HA 2YZMA 2JCGA 4OJQA 1RZRA 1VCIA 3ZOZA 2DHRA 4RE5A 3A26A 3QEJA 4KLNA 3DM5A 3IP9A 2YXBA 3D6JA 1DIBA 1I32A 3GRAA 1XK6A 3SLRA 5JNLA 2GTPA 3IP6A 1L8AA 3I01M 4ZD6A 4NCAA 1S2LA 2XCTB 4IGKA 3U7IA 2GI4A 4S3MA 5CIYA 5EL0A 4A03A 3AI3A 4QNMA 4K28A 5TVGA 5JR3A 4Z4FA 3TNDA 3OF2A 3N0VA 4GWLA 4CV1A 5K8LA 4J76A 3H5WA 1DIKA 3NHRA 2II6A 2LCQA 3R76A 4NOJA 4P7FA 3OPYB 4PYLA 4XM0A 2VYVA 1QH1B 4XSVA 1PW7A 3GFQA 3LI2A 1U3DA 1ZVQA 4OY3A 1CUVA 2PK3A 2JFOA 2KBFA 3D4PA 4TRMA 5BYJA 1L7VC 2V65A 3T6KA 1V7ZA 4GUAA 3DE1X 3PENA 4QC2A 4YK7A 4F4FA 2F1RA 2GNAA 3DM9B 2ZKIA 1T4CB 3NHUA 4NZYA 4Q4AB 4AZWA 4BC0A 5BXYA 4O5AA 4B76A 4GR9A 3SJBA 1NF3A 4JLPA 4LXIA 1W4AA 4YGYA 5BT8A 5JRDS 1XNQB 3DH0A 4BIIA 3CR8A 1B73A 1NLYA 4IZ6A 1M1YB 1ZNXA 2HOQA 2UDPA 3O82A 4RQAA 1RYFA 1MX1A 4K9KA 1W94A 4RLSA 3HKEA 1FQKA 3HA3A 2IOFK 3JQAB 2O2IA 1G2OA 2GN4A 1U99A 2WJPA 3EGWA 4MUBA 1RXVA 1E6CA 4GQAA 4I2VA 5ICGA 3H2YA 2R1VB 5HIJA 1Z6XA 4CM1A 3ITDA 1NNI1 4NY1A 3LGSA 3V8EA 4BO4A 5G1NA 2BGNA 2I0FA 2Z57A 1N1DA 3J81k 4P3PA 1PFVA 4N6OA 5DBGA 2GPBA 1DRWA 4WN9B 1JEQB 1Y8RA 1QQBA 3CBQA 4J1SA 4OFWA 4WXMA 2IH4A 2XUJA 4A27A 4OFBA 4AWBA 1EUYA 3WNDA 4X7RA 3KOOA 4XPIA 3SDZA 4O6VA 1E2IA 2R68A 1Z33A 4BB0A 5CIWA 1IWBB 4OYRA 1YJXA 3WADA 5E7MA 3M9LA 1PX2A 2RBKA 2QPAA 4D9GA 1WBDA 2BW0A 3I6MA 5DI3A 4KBGA 3ZXYA 3P9PA 1UINA 4A5SA 4E94A 2XE4A 3D7GA 1OT5A 2QGZA 3ZVLA 4UCXA 5H80A 2E48A 4DLBA 1AH2A 5G3YA 4M55A 1U0JA 2HCJB 4D4HA 1XTPA 1QGED 5ADHA 5G2OA 4GMKA 3I04A 2BDUA 2WQZA 1F2VA 1P17A 1K6EA 1T34A 4B80A 4FZJA 2AYXA 1KEPA 2H11A 1DKMA 2QSYA 4HDNB 4OQDA 3HTXA 1F4PA 1OD6A 3IBGA 4MIOA 4RTRA 1GARA 3IP8A 3L02A 3GEBA 2FR8A 2IE0A 3Q9LA 4TTPA 4CM9A 1P29A 2OP1A 4DIOA 5EZYF 3EVDA 1SQFA 2QXUA 3PYXA 3ZLTA 4NECA 3WC4A 2OA0A 1TM3E 2C9ZA 3CEPB 3QVXA 1E9DA 3MB8A 3SF0A 4KGXA 3GFOA 1P7PA 1JVSA 2HU8A 2WPNA 3L8DA 5HGJA 5T4BA 4EPRA 4A36A 1CJBA 1J97A 3RTBA 5K3CA 1OXXK 3SJUA 3QKWA 3FHOA 4LXTA 1LLCA 1NR5A 1U8ZA 5TJHA 4FZ3A 4X9XA 2PVVA 5M5BA 5D3ZA 2TECE 3ZXUB 4V3BA 4LJYA 2QEQA 4Y67A 4JBYA 2ANCA 2JRCA 2AR0A 5CNKA 1R50A 5KU7A 3N6RA 1DZIA 2NXNA 4S2UA 5EZQA 1RXUA 1TQ2A 4PFKA 3ITEA 1NZJA 2X5KO 4I19A 4JP5A 2XNHA 4UJ5A 3H8SA 3RJMA 2R1UA 1LW6E 3BMNA 1SA0A 1KMCA 4L5JA 4UZEA 1SIOA 4B17A 3VGJA 3IEVA 1EVIA 1N34B 3OZBA 4UDOA 3M3DA 4RVUA 1XMOB 3MERA 2GAAA 3RBVA 4BWFB 4FC6A 4JT8A 1QS0A 4TV9B 4E88A 4M86A 5FR2A 1G8KA 1N5IA 1OA0A 2PNJA 3ROKA 4CRWB 1MJNA 1KOGA 1R00A 2CYBA 2ZW9A 2XVMA 4NRDA 1KL7A 2RGNA 4XYLA 5I45A 3K6SA 4GVXA 2I7VA 3L7KA 4G36A 1NBWA 3OAAD 1T0PA 1X2EA 2BI8A 3RO7A 4EB8A 4CMHA 2YRWA 1O96A 5CFLA 1N8SA 3T7JA 3CJQA 1GD1O 1AKEA 2QJFA 2Y1FA 3MTGA 3TAXA 3RC9A 1DIRA 4H4DA 2GESA 4X5OA 4UXIA 2LD4A 4U8HA 1O6CA 4ML3A 2ECOA 2H54A 1PKXA 2BR4A 2H4JA 2XMRA 4GMHA 5E3JA 4JVNA 2PX3A 1GG9A 4MUAA 3TXXA 1L7EA 1UZLA 3S1SA 2M6SA 4BEWA 3ZWXA 2YV3A 2B5VA 2AA3A 4S0XA 5JS6A 1JHUA 5EJ9A 2R47A 4PYOA 1I6MA 2AMJA 1NWCA 3ZI0A 4BQIA 3WJ7A 3ZBQA 1KXJA 2QYSA 3C8HA 4DR3B 4R9RA 3F2VA 2E4WA 1EJ2A 2YW9A 3D4IA 3RTDA 3A4MA 5C5DA 2R6CA 3DE5X 3PXAA 4M0KA 4AUKA 7ABPA 2Q5CA 2YIDA 3EIUA 3CF0A 4HK4A 1T9CA 1RRMA 3DTVB 1EI9A 1YRBA 3PFGA 3Q85A 4GW3A 3OHMA 3PTZA 4D8WA 2P62A 4E14A 3UC9A 1QVWA 3K1TA 3A6LA 1EDOA 5G4KB 1SO8A 5KQRA 4P6VF 1GNTA 1RVDA 3AIKA 3A1NA 4XE5A 4PN3A 3K9WA 1XDWA 2ZAOA 2QVLA 2I1LA 4CF6A 5DN6D 3IBCA 2C8LA 4JJIA 2JJ2A 2IYYA 3NX4A 4EJMA 1TLFA 4KQCA 3ADKA 2RARA 4R16A 5K20A 2PQ0A 3M6UA 5J23A 1RQPA 1SHJA 1BEZA 1U28C 2X2PA 4YBZA 2AOWA 2ERCA 1ZCBA 2F00A 2IKQA 3MJVA 1BN7A 3D7KA 1MVLA 4RZIA 1PQUA 3U4AA 1J8QA 1J2UA 1EMDA 4D6PA 4B33A 4OHBA 2EARA 3COYA 4IOLA 3Q9UA 1N32B 1KDZA 1FDTA 4RKEA 3U40A 2C5LA 2QN6A 1U11A 3GRYA 2ZXUA 2NV2B 3TTXA 2Y9MB 1OKKD 1JIQA 2OB1A 1Z08A 2P4UA 1EM6A 1NAHA 3BZUA 3V42A 4BNHA 1YDFA 1NI3A 4OUDB 2ZT7A 4PX2A 4IDCA 5ERGB 2OZEA 3GJYA 4V0LA 1WLSA 3D4OA 1KY4A 1ESNA 2WSMA 3PA6A 4RM2A 1KFBB 2HY7A 5E4FA 4QYIB 2VBGA 4CZ1A 4EY4A 3U60B 1K4MA 2FLVA 5AI5A 5C9ZA 1R15A 1ZOIA 1Y4SA 4BJ1A 2AHRA 4BMZA 1HL7A 3GLIB 3STTA 5AM1A 1Z2AA 1AK1A 1SURA 3BQ9A 1KJYA 3AL2A 2QRNA 1AQLA 3D9QX 2QWXA 3Q7PA 1XLWA 4L76A 4PBRA 4PSCA 1KO7A 4UFPA 3NYRA 1Z0JA 1ZI9A 3IV7A 3TLCA 5EYPB 2QKYA 1WLYA 1OXTA 3FJ1A 4R1SA 2YL2A 2MOKA 2M9MA 1YR2A 2OPBA 5CIQA 1AE1A 3WFZA 4KXUA 4M38A 5LPNA 1DE0A 4L16A 5IC6A 3OIWA 1TQ4A 4L8YA 1YC5A 3DDSA 5E6RA 2W70A 2J0EA 3OJWA 5CAEA 2RAVA 5CG2A 4UVEA 1X1SA 3RAJA 2OORA 1N3YA 2CXTA 2XA1A 3MRXA 5FNZA 5BY2A 3IX7A 5FUXA 1KMIY 3URKA 1P3Y1 1UT6A 4HDCA 4UEQA 4YMTA 1MENA 5FL7D 3C8DA 3NFYA 2G4LA 2V6GA 2AVNA 4I4TA 2H4WA 3WQRA 1ZHFA 2FZEA 1ZEJA 3N0XA 1S4QA 4GOMD 1P4HA 3ZI4A 4CM9D 1JEYA 2B25A 1B2LA 3FN4A 3JR3A 3NLLA 3S68A 3ZWCA 5IMBA 1U8UA 3A36A 3I2KA 1F6DA 2ZRMA 4KXWA 2Z09A 4QD3A 1XCLA 3S6JA 4D4IA 2E0IA 2XD4A 4EJ6A 3N9IA 1X7WB 3B5IA 1SG6A 4N7RA 3RS9A 1DXQA 4ZIRA 2XECA 1ZJYA 4YACA 1U9JA 3PFKA 4UHFA 2O6LA 1ODLA 5CJ2A 3T0GA 1ULZA 4JEMA 4NQZA 3SE7A 2XCUA 4P84A 1F8UA 1OPXA 1GV0A 2OM6A 1SK9A 3AR2A 2WJZB 3O5AA 2AQIA 3IB6A 4C21A 1J0CA 1NC1A 3ZJ5A 2MYPA 1WA5A 2Z04A 2CF6A 1ODKA 4OGFA 2AIRA 4LQLA 1GVNB 3IERA 2XLBA 3MELA 5DSXA 5EYPA 2QHXA 2JEZA 2B8JA 5TXGA 1GCGA 4IKPA 1QQ5A 1UBEA 3WLAA 1IQ0A 4HLUA 4RTMA 1Z62A 4ETWA 4B8ZA 1CDOA 4EFNA 1J0AA 2RCNA 5LUBA 1EVYA 3QLUA 3BPSA 3ZQUA 2YWRA 2Z9CA 3L1IA 3CT4A 4GX5A 1OBCA 2AC7A 2VJLA 2VHYA 2QRKA 1F06A 4Y8VA 4QELA 3GMIA 4FUTA 1IWPB 1KVSA 7REQB 1IQPA 1QFMA 5LP6A 3DZFA 3M33A 1I6WA 1YZLA 1RFGE 2NOAA 3AR9A 3KLBA 3I9KA 4FMCB 4W7IA 1SOWA 2J5BA 1AURA 2G7MC 1BX3A 4IXMA 4KXLA 3TN7A 4OB7A 4WNAA 5B6IA 3GFRA 3FZQA 3NAQA 4MVJF 4IVQA 4HDSB 4YRAA 5JBNA 4G0VA 1F1JA 3EH2A 3OM1A 3KDAA 3GLVA 1O1YA 1C2TA 1I0ZA 1FNMA 1EP9A 1VM6A 1EB9A 3OTOB 3RKUA 1PVDA 1HNZB 5TGTA 1DEKA 5A4KA 1A9QA 4QO7A 1CS0A 5CA1A 2I55A 2REXB 5G40A 4PLWA 5K45A 4X97A 2IOYA 2IU4A 4ZZIA 5IDVA 3VNUA 1STOA 3D4LA 2QD1A 4QVKA 2ID7A 1I3OA 1S3SA 1KDRA 1TYBE 1UBGA 3VV2A 4EX7A 5HS4A 4PQRA 2AG5A 2OVFA 1Y1QA 4OQXA 1A4IA 4WXRA 3G2JA 4OHZA 2Y1DA 5BW5A 5JOQA 1A7AA 4B82A 4EA9A 4RULA 2H2DA 2WWVD 3C6XA 3CW9A 4RH1A 1KI6B 3LBYA 1JDSA 3WFJA 4DYDA 2YQ4A 1B7GO 1FVFA 5ADWA 3REFA 2YFQA 3QV1A 3EA0A 3OIUA 2GTIA 3QPVA 4B3TB 3K9LA 4J0FA 2EW8A 2BGRA 3HY3A 3LQ1A 3FTCA 4HGRA 1BTOA 3NOQA 2HSJA 3U31A 1EH5A 4EARA 4MWCA 4PXSA 1R8YA 3QQ5A 1A8HA 1R9JA 2GEJA 4ERNA 1R4NA 4NABA 4Q7KA 4D8TA 1J2TA 1D4OA 1L4LA 2VTEA 3OZEA 2L0XA 4YALA 4B84A 1GN8A 2DKNA 3E0XA 1YCGA 3B5EA 1YS6A 4LYGA 4M83A 2GEBA 1A2KC 1GJRA 2BFPA 1Z2CA 1J20A 1SUBA 3OU6A 1HLFA 4QUBA 5GIPE 3LTEA 1I7DA 3ZZ0A 1R12A 5MN6A 2MDTA 3C6QA 4WAUA 5H1YA 1JG4A 1JXMA 1M10A 3G9XA 1T8RA 1T5BA 3HHEA 3RQSA 1JU9A 1Q0HA 4G5FA 1H0SA 4RVOA 3LYAA 2F3TA 5D01A 1HPLA 1RNLA 1YBVA 3QJGA 4PGHA 2HK7A 1Q14A 1W19A 1CB7A 1DWUA 3L0YA 4D44A 5LXTA 3A4TA 2Z3ZA 3UCFA 2EZTA 2E1PA 1TK9A 4FZRA 4XDYA 1XYGA 5LDGA 3GXOA 3N2IA 2H2HA 1LQTA 1SR8A 4HRVA 1VSQA 2CZCA 3HXKA 3ESYA 1JMKC 3P5SA 2AFHA 4LGYA 3H4MA 5HIIA 5CFQA 1ZD8A 2XDWA 3TZ6A 3NIWA 3SX2A 4YJGB 1T5OA 2C0CA 4P8RA 1E6MA 1ECPA 3BRSA 4DUGA 1FDIA 2AEFA 4M8SA 1RXSA 1X1CA 3O7MA 3DOIA 4ATNA 1Z38A 2IYSA 4JGIA 2JKYA 1M33A 2NXWA 3GB9A 4W1PA 1ECGA 5FEMA 4OXRA 4GLBA 5HZGA 1EXDA 5JC8A 1ZQ9A 3ANXA 3FUXA 4A8JA 4GL2A 2IS6A 1B26A 2VP3A 3N74A 2GKGA 3N7UA 2B1QA 5KO2A 5ALGA 2HTEA 2QN2A 5TSDA 3TQTA 1OCEA 2YCBA 1Q95A 1M74A 4A10A 2IUTA 4UCFA 3PLNA 3ABOB 4Y2HA 2DR0A 2B98A 5FULA 2G9NA 4RA6A 3WDKA 4ZCTA 1HT1E 4ZVOA 3FMPB 5AR1A 3CSDA 4MARA 4MWOA 2O5CA 4FDLA 3ZDXB 3WAJA 4YMVA 2HO4A 5H3CA 4H16A 1CD5A 1R74A 2GDJA 4IIFA 2AW3A 4G4SP 4P82A 2DFPA 3LA6A 3H1AA 4X45A 1E61A 3W3AD 2E89A 4JBGA 5IFLA 1O96B 3MMXA 4LNHA 3VNSA 4FHCA 1G42A 5AOAA 4BNGA 2N46A 3OCYA 1KKUA 1KZ4A 2C6GA 2YHAA 5CD9A 1X8KA 2OBXA 1I8TA 1N1EA 2RKBA 3MIZA 5AW4A 4UPVA 1SWWA 2MSLA 4W1QA 5REQA 3CH4B 5DXAA 1EG7A 4P4BA 1UQTA 1KDTA 3FGZA 3OY7A 1YI1A 3HI4A 4DMGA 2V8BA 1JR6A 4LQCA 4R8LA 4AS3A 3BXZA 3ET4A 1E2JA 1FOEB 2B4QA 4R0NA 4D43A 4EY8A 5KX5A 2W2XA 1ELOA 6YASA 4QPDA 3R7AA 1Q1EA 4H7PA 1E2EA 3W6NA 4OSOA 4BFZA 1N2CA 1RC0A 1YE3A 5GGXA 3QITA 5HE9A 4N8DA 4TVOA 3FCAA 4N39A 1XD2A 1NMYA 2B1JA 1ABBA 1BYIA 1RD4A 4RHFA 1LK0A 2W6IA 4J0EA 1TA4A 2X15A 4BNLA 4BE4A 3AEXA 2HB6A 2I5PO 3NANA 4PS1A 4QQKA 4UE3S 4UU8A 3X3HA 4BS9A 4GPIB 4OQZA 1LJUA 1QF7A 1HTWA 2A5FA 3BULA 1RYNA 3HM2A 4HX9A 3R3HA 5BVHB 3G7SA 4JWKA 4PM4A 3UJBA 4JL5A 3M83A 1W1UA 5FPHA 4YCBA 3FZEA 2DTEA 4B48A 1OFUX 5KOYA 3L49A 4TTRA 1ZSNA 4G85A 3M1AA 3KUKA 3R23A 2VPTA 1K86A 5SZHB 3W9BA 2X4GA 5C0OE 1TKCA 2D59A 4DDTA 4IPTA 3CEHA 3EMVA 8MHTA 1NYTA 1ZS9A 1DINA 3BWMA 3TG2A 4FC7A 4WNIA 1JHQA 1OFGA 2GKSA 1USGA 1OZ0A 1XCBA 1TAQA 3ICPA 4KYVA 4W9NC 2HI6A 2GBPA 1XQ1A 5SZJA 2WIDA 2OESA 1U63A 1V71A 4F5DA 1RLJA 2CKMA 1WUYA 4H7EA 3WBFA 2AK3A 2JZOA 2IPAB 2HF8A 4MJXA 2H7CA 3R5TA 3S3TA 5AHXA 4Q1FA 3WP1B 4EEZA 4LZAA 4A8JC 5BOSB 2JCBA 1EJ0A 1TVMA 2OBFA 3D6HA 1AUQA 4HF7A 4I55A 4MYRA 3UB2A 2O3QA 2WI8A 2GN0A 1TXGA 3SF8B 1ZZGA 1P4AA 2HRZA 3OD1A 3BWYA 1RJFA 4LCEA 4XLTA 3TAUA 1XELA 4NNOA 3WAKA 4P83A 3GLRA 2PPLA 3VYTB 4OHYA 4CT5A 2OGTA 4GM0A 4WLOA 4XD2A 3V4ZA 1Q2UA 1AHHA 4B3BA