3TLAA

Microcin c7 self immunity protein mccf in the wild type apo state
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
335
structure length
335
Chain Sequence
PLLAAPLAVGDTIGFFSSSAPATVTAKNRFFRGVEFLQRKGFKLVSGKLTGKTDFYRSGTIKERAQEFNELVYNPDITCIMSTIGGDNSNSLLPFLDYDAIIANPKIIIGYSDTTALLAGIYAKTGLITFYGPALIPSFGEHPPLVDITYESFIKILTRKQSGIYTYTLPEKWSDESINWNENKILRPKKLYKNNCAFYGSGKVEGRVIGGNLNTLTGIWGSEWMPEIRNGDILFIEDSRKSIATVERLFSMLKLNRVFDKVSAIILGKHELFDCAGSKRRPYEVLTEVLDGKQIPVLDGFDCSHTHPMLTLPLGVKLAIDFDNKNISITEQYLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords MccF
publication title Structure and function of a serine carboxypeptidase adapted for degradation of the protein synthesis antibiotic microcin C7.
pubmed doi rcsb
source organism Escherichia coli
total genus 115
structure length 335
sequence length 335
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02016 Peptidase_S66 LD-carboxypeptidase N-terminal domain
A PF17676 Peptidase_S66C LD-carboxypeptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Class I glutamine amidotransferase-like 3tlaA01
3.50.30.60 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 LD-carboxypeptidase A C-terminal domain-like 3tlaA02
3SR3A 3TLAA 3TLYA 5JYBA 3U1BA 3TLBA 3T5MA 4E94A 1ZRSA 4INJA 4IIYA 4MI1A 4MJXA 2AUNA 3TYXA 2AUMA 3TLGA 4EYSA 5K99A 3TLZA 1ZL0A 3TLCA 4JVOA 4E5SA 3TLGB 3G23A 5F1YA 5F5XA 3GJZA 3TLEA 5FD8A 4H1HA 5F9MA 4IIXA
chains in the Genus database with same CATH superfamily
5M3BA 4Q3CA 4RVOA 4K8OA 1FBNA 5AD1A 1W2WB 5EKTA 2I62A 3RK1A 1JDTA 3L1VA 2A33A 2D4HA 3GA0A 3GA5A 4RH3A 4ZVLA 2VXBA 2X6RA 2AE1A 5F5NA 2W6ZA 1SOAA 2CUKA 1KJQA 1XVIA 3MTQA 1XZAA 5KIAA 4GWGA 1Y8RA 1W75A 1J1ZA 3W77A 4L0CA 2YWDA 1Y9JA 1B0UA 3KKLA 1X39A 3DF7A 3JS5A 4MGEA 2Q5OA 3REFA 5HZMA 3DLAA 5ES4B 5B6IA 5A7FA 4LVCA 3LQRA 4MH0R 3DXXA 1L7BA 2FSSA 2ZYSA 3EEQA 4K3UA 4XTRA 1PL6A 5J47A 4X6XA 5LQJA 4AY4A 2PEZA 4D6PA 2X19A 1PUXA 1TB4A 1EFTA 1WY5A 1ZGGA 2PZJA 2QORA 3ER6A 3EH2A 3GP3A 3E9YA 3FYUA 4XLLA 4Y30A 4BN5A 2F17A 1T0UA 2E6KA 3C3WA 5I5EA 4BNMA 2P67A 3L8YA 4P38A 4CCYB 2OB1A 1W5TA 3SJFA 4HADA 1O57A 4C8CA 2A9JA 2GYVA 5HR5A 3PXDA 1PFUA 3KRTA 4LISA 4OAPA 2BBTA 5D87A 1J0BA 1GTZA 1G7TA 3VYSB 1GA4A 2LIVA 2XOXA 4LRUA 2EBFX 4L6IA 1KC3A 5ADWA 5M29A 3UT5B 3HVKA 3UFBA 1NXSA 4EJ0A 1QQBA 1VLZA 4R1OA 3D02A 2QW1A 4OMFG 1ZU4A 1AURA 3WKAA 4PG4A 5CFNA 1VRCA 5BV7A 1J22A 2B5WA 1ORRA 1AGYA 1P9OA 2JCVA 4CUJA 1WTAA 3IPAA 3NIBA 3UOWA 3WJAA 1GL6A 4QARA 2XMCA 1SVNA 2I54A 1X7ZA 4RY2A 1A4XA 1PI3A 1SUDA 4LDRA 4QPNA 2ZRKA 5C3MA 4QSHA 4W1PA 1ZK4A 5C5DA 1VKRA 4OGKA 5JHHB 5HTKA 1QFMA 3VU3A 4YQYA 1IUKA 2QL7A 3ZCTA 5H7XA 3VA7A 3ZY5A 2ISSD 2FFBA 3I2FA 3L6DA 2ZRMA 1TQ2A 3CW8X 5EHGA 4A82A 3UJ9A 1LLQA 3LYAA 1YIDA 2G17A 4MKHA 3QVVA 2FWBA 1B3RA 3D3WA 1Y9DA 4NDNE 5F09A 4EGFA 4BRUA 4JLSA 3Q10A 1LQUA 2DBZA 2BISA 5DX8A 1WJGA 4B9AA 3TLAA 3OJCA 5D5HA 5T64A 2IYAA 5DGXA 4B3BA 1C7FA 1I6MA 2VSYA 3KXIA 3NOVA 2O1XA 1OH8A 3Q85A 1XMSA 4XJVA 5IJXA 2RKWA 3E53A 5JROA 4BLRA 4XSGA 3OWXA 2P27A 1MPTA 4AS2A 2HFKA 2A0UA 3HJGA 2QN7A 8LDHA 1HNNA 4YIKA 5ECYA 1IN8A 3AO0B 3L49A 1FXWA 1Z74A 3CSSA 4XSHA 4BE7B 4GQIA 3JVEA 4JZYA 4JKOA 4EATA 1Z16A 2X8JB 4DCTA 3U5TA 4FFNA 1RBMA 2M9MA 3IX7A 1F2DA 3NHAA 1DUVG 5DK4A 1XMPA 3RF7A 1YZNA 1GZ4A 3RIEA 1NBME 1TC2A 1UPAA 4KIUA 4TLLB 4DJAA 3PIRA 1A27A 4DUYB 1WXGA 1G20A 3PWKA 3P0FA 1N57A 3PQ8A 4UE3S 3QZUA 3RBZA 4WVFA 4PGHA 2UUAB 5IJ9B 5FL3A 4D46A 2XLCA 4O3MA 1LVGA 2J67A 3O0TA 4PLFA 3UB4A 1GPYA 4C2AA 4DA7A 5DLEA 5L95A 1Z5OA 4ALIA 4C07A 4C0HA 2ZT8A 1JDUA 3ANYB 4HWSA 3PSAA 5CLGA 1T2UA 3AFOA 5IVHA 2H7XA 1CCWA 2GEUA 1GGFA 3SJUA 3N0WA 3K1AA 3WK4A 1FJGB 2FV8A 3R41A 1V96A 4G4SP 1PT9A 3HVRA 2EQ5A 3SQDA 2ZRCA 4S1PA 5HHTA 2XECA 1G5HA 4UZSA 5KVAA 4LRXA 4JA2A 1YB1A 1G19A 4MWBA 4E5UA 1E7MA 3PX7A 2VTVA 2W2NA 3GMDA 5GJWC 4RKFA 4AG6A 2WSMA 1J2TA 3C97A 4BTVA 5TMEA 4ENRA 3ROGA 5CG1A 1LKZA 1Z8FA 2BTQB 1QZUA 3B3FA 1N3YA 4MNTA 4Q1CA 4DNPA 5JNVA 2OV8A 5K0EA 1GPMA 3E5RA 1EFVB 4MMXB 5B7GA 3BA6A 3EFOB 3K09A 3KAQA 3BSWA 2NT3A 1C81A 5CNKA 4MS1A 5JCJD 4M83A 1TVEA 4OC5A 5JAOA 3UHOA 3P26A 4H2DA 1EWRA 5JLAA 5LQCA 4ZT2A 1BFUA 3JQFA 1L5FA 1BDMA 1ZNWA 1A4RA 4WPGA 3HCCA 3Q5GA 4G4SO 3NVMB 1A7UA 2XMSA 4PEVA 4CCSA 5FYQA 4GIBA 4QICA 4X63A 4HZIA 4L5JA 4G9BA 4R98A 1D6MA 1KMIY 4IGFA 1TD1A 2DGDA 2KPOA 4NYJR 4I0WB 3A6GA 2RGCA 3IDSA 1U9IC 5KOIA 1DX9A 1RM3A 1QHHA 2FUEA 1Z0ZA 2GBLC 4W1SA 1YU9A 3OZSA 1ZD8A 4K88A 2ZUSA 1SCBA 3LKZA 1OBFO 2OOSA 2BZ1A 3D31A 1T91A 3JR3A 4QUAA 4BZZA 3WQQA 3ZHTA 5AKLA 5A03A 2QYTA 5JY6A 1XZBA 2OXEA 1EVEA 2YJTD 5BW4A 4L0QA 4YI3A 2JGFA 4HEA1 3DE3X 1NR1A 1OZHA 1XUOA 4FOTA 1WXEA 3VO2A 3PUZA 5I9IA 1PZHA 2AIRA 4FHZA 4XUCA 4Y1RB 1H5UA 2WHXA 3VV3A 4GOLD 4DLSA 5AM3A 2PM8A 2WVJA 5B1IA 5JQGB 1NG1A 4NYJQ 3EXEA 1ZP6A 4F2HA 1G63A 2CE2X 1R66A 4W9MC 5DX0A 3EA4A 1UBTS 3WDSA 5JW6A 1WB5A 3AHJA 4ZZ3A 4LJ4A 4YRTA 3VR4H 5F5XA 1ADFA 2EZ9A 4CQJA 1P1JA 4LGYA 1PL8A 1D07A 4Y7CA 5KYUA 1LFAA 1PZGA 4UHHA 5EIXA 1G5PA 1Z8NA 3IT2A 2C2OA 1XKXA 3PA6A 3FGOA 4O2BA 5DEIA 2GPSA 3ESRA 1OHHD 4K9QA 3B48A 3VUFA 4D57A 4Q3AA 3RFFA 4X41A 3LK6A 3RUAA 2J3EA 4IXNA 4BNJA 2VQSA 2CL5A 1QXSA 5H83A 3C5VA 4HUTA 4GL4A 5AHWA 4DJEC 4A2QA 1SN7A 4WBSA 3QHAA 4YAGA 4KRYA 4G1MB 3D3JA 5J4VA 3VR4A 3ESYA 1ODSA 3VNUA 2VN8A 3EVFA 4PLHA 5JJ5A 3A1CA 4A6DA 2YY5A 5TQ2A 1IZ9A 2VVTA 3TG8A 1W1IA 2X2PA 1L7QA 3ZU6A 1BH6A 1L7DA 3NALA 5AJHA 4KXMA 3UXMA 3VJMA 3S44A 3VNAA 1JEAA 3KETA 2CEAA 2GAFA 3S70A 4WXPA 5CVDA 5G0UA 1WUIS 1G8SA 3NUQA 5DU2A 1AHHA 1KP3A 1CZRA 3KOXA 1H05A 4B75A 5CBPA 2VOJA 4NHOA 1FRZA 5E4YA 4F5YA 3LQQA 2P3QA 3GRVA 2R25B 3A1TA 3NATA 2FMUA 3FFWA 5LP1A 1IPEA 3F49S 4M0FA 4DOMA 3BGWA 3IXLA 3QX9A 4FCWA 2VHQA 5A0FA 4LE0A 3LX8A 2IV7A 2CB0A 2W83A 2OC9A 3FN4A 5AW4A 3T9DA 3C43A 1IZ7A 3EBLA 3MB5A 2EHJA 1XTSA 1KWGA 4JIMA 3U39A 1UPFA 3I9V6 2V1UA 2BGUA 5E4JA 3DDHA 4R9VA 4NDZA 1KPHA 4DV1B 1IY1A 5I8ZA 1PT5A 3CE9A 3QWBA 5H16A 4BN0A 2JGKA 2QAGA 1PDVA 3DZKA 3F6EX 2PNJA 4CDRA 2J9XB 3HLKA 2FR8C 3ORRA 2WEKA 4NX2A 2NP6A 1CKEA 4AJHA 3AUKA 4Q4HB 3NYQA 5F7JA 3AG5A 4V0MA 1RAEA 2ZVDA 3CLKA 5IJZA 1CZNA 3L8FA 1HZZA 4O8ZA 4DTCA 5C4GB 4NBUA 1U0EA 4UE2A 1N1GA 2G8NA 1II8A 1MFZA 2GKGA 5E6RA 3RDPA 2GN2A 1BC5A 3AIOA 3K6RA 3GA7A 1JH9A 3BDIA 1F2TA 3OJXA 4Q9AA 2HSEA 3V8QA 3VAZA 1FTNA 4MDYA 1T9CA 1L5WA 5A1TA 2P9EA 4I9NA 1RXWA 2R5FA 2C94A 4JBHA 2QXYA 4PTLA 3T61A 4JB0A 4YT8A 3VVBA 4KN6A 3WLRA 5JG7A 4FGLA 3OECA 3CF4A 3GIDA 2Y1XA 2YYYA 4M1SA 2G7MC 2X9VA 2A4MA 2C2BA 9LDBA 2W6ID 1L8QA 4UFPA 5BOSB 1SQGA 1ACLA 1GTVA 3N2IA 2OHJA 3G1TA 2VEOA 4MLCA 2AW3A 4XB2A 4Z9AA 3U6KA 3ZK8A 3KL4A 3TVYA 2WF6A 3PL1A 3USZA 3T0TA 5IYZF 1GGKA 5FWYA 1XKQA 2OBFA 3JVUA 1E1RD 3FCUB 2E89A 2QL5A 3FHCB 5CT8A 2CT8A 3NT2A 1P4SA 2HCTA 1UJ2A 1MW9X 3C8MA 4W82A 3HN7A 3G6WA 3GUVA 4HGPA 1NVEA 3CURA 3M6XA 1W88B 3CLTC 2JF0A 5CB6A 2FWRA 5CLJA 1N4AA 4MAAA 4GPAA 3SS8A 3U56A 2ZYHA 5IS2A 3PFGA 4QLAA 3TG2A 2WVAA 4UEQA 2KI5A 4GGPA 4NE7A 4CM9A 5IMBA 2ZIXB 5B58C 3EISA 4YT4A 1BDJA 2YUTA 1T4CA 1IATA 3NH9A 3WGJA 4F2DA 2WF7A 3VSEA 2F8SA 1QZTA 3SM9A 3FTNA 4IH9A 4JN6B 4YCAA 3OY2A 2A5FA 3VOTA 1OI7A 1AU9A 5HW0A 2JG3A 1TJNA 3G5TA 3RAEC 4ZC8A 4PAMA 3ML1A 5KX5B 2GT1A 4HYQA 4Q3OA 3ZLVA 1GCUA 4A2CA 1P39A 3AGQA 5NLLA 3S1AA 4BGVA 1QFYA 4QJ3A 2O7NA 2BFFA 3KHTA 2B6HA 3C3BA 4B6OA 2IXEA 3O4VA 1N9GB 4K2HA 1NXWA 4O2LA 5GOZA 3T9AA 4IX9A 4BASA 2IYEA 2I2XB 3Q9SA 1GP2A 4NBLA 2WUDA 4Y6SA 4ZI2A 4HMQA 5LDDC 1P6UA 4UPDA 3ECAA 4J8PA 3I34X 2IY9A 3PHIA 4XA8A 4ND3A 2FVYA 3FLBA 2LIPA 4YO7A 4R1PA 4MTCA 3CF4G 3A2LA 4MVJF 2X7XA 3EXHC 4OREX 2O8BA 4E08A 3P9IA 5B4VA 5BN5A 1J56A 3RVSA 4NG4A 3G1WA 4Q7QA 3OIWA 3DR3A 3FJOA 3HA7A 4EKYA 2YYSA 1YTLA 3KR1A 3PXBA 2W2LD 1EE9A 1GARA 2GZDA 3FLEA 4L8GA 1K3UB 1Z6AA 3PDUA 2GUWA 4TV9F 3S7TA 1XDDA 5B1DA 2MDTA 3LYHA 4HDMB 3PD0A 3P5SA 5FKJA 3UT6A 4D26A 3VI3B 5JCXA 2QN8A 2HSJA 4Y9TA 1T5BA 4B6FA 4D9KA 2BTEA 1LSOA 2ZT6A 2W2KA 3N2EA 5A5GA 4N0EA 5BT9A 1G8JA 1N2CA 5CTJA 1A76A 1JT9A 4QREA 3G7SA 4PX9A 4A6XA 4R41A 1E3JA 4JC5A 5LA6F 4U7DA 2XB6A 1M6YA 1T2AA 1DLIA 1ZPDA 1YB2A 1LPPA 2VJMA 2FEOA 3QOFA 1SIBE 4HX9A 4AKSA 4D42A 4JX8A 4ZMSA 2GDZA 3QF4A 4JSYA 4CTJA 4YC7A 5KOJB 1N75A 3U7RA 1U2QA 2NUPA 3I05A 3IODA 5JD3A 1J2YA 4WKCA 2YKGA 3WYEA 2UYHA 3FSGD 4TWRA 4ALKA 4BMCA 1XQWA 2Q7OE 1PGQA 2WQ6A 3TVDA 3M6AA 4NCKA 2YV5A 5SZKB 1XDSA 1SCNE 3BEDA 1VLVA 4Z1MA 3MLEA 4KR6A 2DCMA 3F1LA 2EYQA 4TV8B 3RRNA 5CLLA 3EJ6A 2DY1A 3IAM6 1ULHA 1CEXA 1YRBA 1RVV1 2XNSA 5LKAA 3JALB 3NNDA 1FEZA 1JKJB 3HGMA 3NW9A 4Q93A 3AF1A 4Q01A 5A5EA 3UT0A 1ZUD1 3I76A 1KDOA 1AB5A 1ZYUA 2YUIA 3O1LA 1PWEA 1U9ZA 1X9IA 2ZE8A 5KPDA 1AQJA 5LZ7A 4AP6A 4URWR 2EOAA 3LLCA 2JHPA 3EEFA 4P7JA 5JVLA 1IJEA 2QW0X 3OPMA 1KZHA 3AUJB 3HBLA 4NZNA 4EH1A 4W99A 3KTAB 1LV8A 3HZOA 4QTTB 4R2HA 3SICE 4YCLA 1KERA 1GPNA 2C59A 3DAFA 3G88A 4TTIA 4ZD6A 4MQEB 5CNJA 2HU2A 4L5IA 3FRIA 3O3OB 2A9OA 1U2GA 2BMWA 2HUPA 4N9WA 4WNAB 3EXG1 3MTDA 3S2GA 1UJ6A 3VYTB 4GI1A 3JQCA 1BVRA 2NZWA 4RZSA 1YQEA 3C7AA 2QZJA 3ZDZB 1SH7A 4BFLA 3C45A 2OZPA 3P9PA 2PX6A 3OWOA 3B51X 3JX9A 2ZKIA 1O5OA 2DFKB 3OFVA 3ZKWB 4Y2QA 4IG9A 2XLBA 2F3RA 4NV3A 2GP4A 1MIOB 4ER7A 3T5GA 1KAHA 4WOBA 1KH1A 4YO8A 2RGNA 2BL4A 1UF9A 4JUIA 4QDUA 2AN4A 2RHBA 2W43A 4QYIB 1C3LA 3UUEA 1KIMA 4NARA 3LQYA 2VA8A 2XW6A 5E3JA 1E3WB 2D6FA 2PGJA 3BXEA 4RKQA 4YJKA 2VTDA 2Z57A 2GFHA 4RK7A 1VJ5A 2WMOB 4MRAA 1UC5B 4F2PA 1XR3A 5L6LB 3ZGNA 5IVIA 3I9V1 5JMTA 5AW6A 4UUMA 4WWHA 2QTVB 3PZRA 5IWCA 4PHHA 5FV4A 1Y1SA 4NF2A 1NATA 2IZ6A 3H2ZA 1WDMA 1QH8A 2IUTA 3KSUA 3NAZA 3V4OA 3UMJA 2YHBA 3OLZA 2UUPA 4AJ4A 2PUGA 1LJ8A 2YHAA 1CDEA 2AOVA 1ZXXA 4DR7B 5FD8A 4ZA2A 5J2TA 2BKEA 3A6JA 3G2PA 3KZXA 5CB4B 4K2AA 3SE0A 3U7JA 3DE4X 1J49A 3KT0A 2GLXA 2R6DA 4IZIA 4ZI7F 2ZLBA 2GAIA 3GNLA 4FFLA 4JJKA 4NOJA 2B4TO 3HU3A 4LKRA 4OHCA 4KPFC 3V4FA 4AZVA 3HKDB 1J39A 4OSPA 1G18A 3ZCQA 3J81k 4O2AB 2YOGA 4B74A 5AESA 1E2DA 1G17A 5EJ9A 3DB1A 4HK4A 3B38A 2E4UA 4PPFA 1Z34A 1E2EA 2HA3A 4E30A 5DOZA 1X1DA 3GEMA 3TN7A 2W2OA 4YCNA 4XLTA 5LMZA 1XCGB 2RSLA 2V74B 3A2MA 4N8SA 4OM7A 4P3YA 4HTFA 4UDXX 3GP8A 4RD6A 5BPFA 5MN5A 1S7GA 3IO3A 4I4TB 5IF3A 2P78A 3PGMA 2XGMA 4NNOA 3ZS8A 2G06A 4D1YA 1E2UA 1GSOA 1IWOA 3ONDA 5K3FB 3RJTA 4PQFA 5J63A 1DKNA 1SQ6A 3O8OB 3BQNB 3H9UA 4K6HA 4F9GA 3TRFA 4KXYA 2OGSA 1UBCA 3ZDCA 1TZCA 2XNDA 3OOJA 4A1FA 3NOOA 3ZE1B 4IL5A 2JIPA 3GRPA 5H5JA 5AVXA 1VCHA 1VPWA 2HLDD 1YL7A 1G66A 1M2WA 2YWBA 3S2SA 2GI4A 4Q7JB 5DLYA 4P45A 1CF4A 3LTNC 2QPLA 4LOKA 4HXYA 1C0PA 4C7XA 3ND9A 3M1AA 4KAJA 1Y4DE 2E4ZA 4YPOA 1E92A 1KZ4A 2G6BA 2QX4A 3L7JA 4BNFA 5KYGA 3THSA 2X0EA 4BEWA 4Z8XA 5EXTA 2BFDA 1KQOA 3F3KA 3K9LA 3CKLA 4HAWA 1Q91A 4TWJA 4AY2A 1K68A 4JK3A 4AP9A 4ERNA 2O7RA 2BYTA 5E9QA 3LX4A 5FAXA 4MW2A 2IW3A 3QKRA 5A6SB 2IHKA 5J4HA 1FNMA 1JU4A 1QV6A 4S2UA 4CPDA 1AQYA 3D3QA 3GRRA 1EB8A 1U7OA 1OI3A 1XRNA 2HA2A 3ILXA 2EEZA 3JR7A 3G02A 2BKXA 3OF2A 1M2HA 4YJHA 4C0JA 3TIIA 4PLPA 5HZGA 4RCZA 2QA5A 5I7RA 1J0EA 4FOOA 5JZVA 3ADPA 3RSHA 2P9JA 3S8MA 2J0QA 2I91A 5EEGA 4C0SA 1M8FA 1OLUB 2KSQA 4W7HA 3IBTA 4ENUA 3A3OA 3S2FA 4NNPA 2CXHA 2HPAA 3LQ2A 3E18A 5KCMA 3W6ZA 3FEEA 1XZPA 3BF8A 1QHXA 3T34A 3VR5H 3W7VA 2CZCA 3WB2A 2Z8YM 3OLYA 5FLKA 1ZMBA 2GR9A 2D1YA 2PIAA 3BBLA 5DK6A 1I8TA 5KKAA 1FPMA 3OEED 2A94A 2QVLA 5CH5A 4EGAA 3ZU4A 4B7AA 3G0CA 1C7ZA 3F3YA 1V16B 1WLSA 1XA0A 1ZWLA 3KLMX 1KFJB 2O2EA 3PQ2A 1XTTA 4H6WA 4K9OA 1ITZA 3HEBA 1E63A 1ESNA 1BJTA 4QDJA 1D0IA 1JJBA 2GLTA 5FO1A 1TJ4A 2GOYA 1ZVQA 1RTKA 3L05A 4OXQA 4YDSA 2CLEB 3DOIA 2NXWA 3C6ZA 4FMBB 2P0EA 2IYVA 3AUTA 3HI6A 3R7LA 1VCIA 2G9QA 1ONSA 4O1HA 5ULLA 3QKSA 3EQ9A 4F60A 1WA5A 2FLKA 1XVLA 3QYAA 1RWBA 5DBHX 2GPAA 4UEKA 4ENPA 4Y9UA 1QZZA 4JU8A 4DLZA 1QF7A 2C7BA 3MRSA 3V34A 1PWHA 1EPUA 1MO6A 3R9IA 4BVEA 3O0DA 2GRJA 2CMGA 3LTEA 2B8JA 1DXYA 1T9AA 2OZKA 2BC9A 2PL3A 4U63A 1L8OA 2NNLD 2WAMA 3FMGA 4EW6A 4JBXA 1NUTA 3OP4A 3RS7A 3WV5A 4DIDA 4KXUA 4B7ZA 2H8KA 2P4UA 3I39X 1DUSA 5U4XA 3RM3A 1GO2A 1NVVR 2QHXA 4M7PA 4JVMA 5HG0A 1SBCA 1VKNA 3Q98A 4FS8A 1A2KC 3MQ2A 4F5DA 4ZK2A 5IT9A 4LYFA 1BD3A 1EP3B 2R47A 1D9XA 3TZLA 1ESEA 3GPCA 1FRFS 1U8UA 3BC1A 5AJVB 1C7RA 1VI2A 2A59A 2R9VA 1O0CA 4R1UA 5IARA 2YBDA 3WV4A 2VT6A 2C0CA 1XEWX 1RM5A 2WJ4A 3IAM1 1FXUA 2PMDA 1OB5A 1RYNA 2JD2A 4LIPD 1BYIA 3ZVNA 2RBGA 4AUEA 3CZ9A 4E3ZA 5IF9A 1HNZB 2HMUA 1F2UB 1ZHFA 5EN4A 1QBKC 3AM4A 2YW9A 5B6PA 5A4AA 1GZDA 1LFDB 3GCDA 1Y3FE 1P2BA 4FXPA 4MUXA 5HMLA 1W2GA 1VP9A 4KHZA 4WBNB 5BQXA 2V96A 4ONEA 1NVVQ 2ZRAA 5JH7F 1OR8A 1VGQA 4CHTA 2WWRA 4GPTA 2G1PA 5GQSA 4I5GA 3IQIX 5TLSA 2A9RA 3IXQA 1C1HA 2Q4TA 3H8VA 2CGEA 1BE1A 1EI9A 2NTYC 3L02A 3AC0A 3HA2A 1E9CA 1NUPA 2VDWA 3PFBA 4OBXA 2C0QA 4MQEA 1CIJA 2O50A 3NU1A 2QPAA 4JQYA 4QX6A 3RRFA 5KO2A 3LUBA 3HMQA 5LC1A 5BUZA 2AOUA 2PKRA 3QG1A 5JYDA 4H31A 4UFNA 2ZG6A 3QYPA 3D1VA 2Y1CA 4G4JA 1X1SA 4J0FA 3LZCA 1PEKE 4G89A 4RABA 1VA4A 3OFSA 3QE0A 4G85A 3ZXUB 1Q1QA 1JE0A 5EZYA 4BQIA 2UU9B 3JARB 1E20A 5FBRB 3C85A 3D8HA 4UAJA 2R66A 3PXGA 3A6LA 1G5RA 5KC9A 4CEIA 5GADl 3E9NA 4XGQA 4DUZB 2FG7C 3NBXX 1IEQA 3ZDYB 1N2ZA 3M5WA 2I2CA 3IJEB 1SXJC 3JQBC 1CULC 2HA5A 3ZK9A 5KNBH 1YZGA 1IUOA 2AG8A 3FXAA 1A2BA 5T5QA 5FX2A 4YDHB 1YKFA 1WCYA 2HHJA 2YWRA 4JUBA 5K8UA 1XZLA 5FLYA 1U7WA 3TQSA 4LPKA 2QM8A 4MS4B 4ZGWA 3KKKA 3PCRB 2F3TA 3PRYA 3R5XA 2E82A 5CX4A 3I42A 3UF0A 1L9XA 2CFCA 1K6MA 1RABA 3I04M 5IG2A 1H2RS 5CA0F 3RK4A 4QEDA 1P77A 4ZYVA 3MJTA 1LXCA 2UVPA 4GXNA 3MINB 4PAQA 5GOTA 1RAGA 2I33A 5KNBA 3IMFA 4OMEA 4Y1FA 4MICA 1JAHA 1Q0ZA 2BSXA 2OOTA 4DHWA 1T35A 3D4LA 3I3SR 5AVSA 4LSZA 4UUQA 3DL7A 1XNHA 4Z2YA 3I9LA 1XZDA 4CM8B 4HXGA 1Y6JA 2R751 5CFOA 3MMPA 2B0JA 3F0TA 1X8XA 2EJTA 1R6DA 3QFRA 4WXEA 5DEOA 2O5CA 5ESDA 5K45A 4TMXA 3M5DA 1PLLA 5KYYA 3SG0A 4BO7A 3CG4A 5EPEA 2WYIA 421PA 3LT2A 4IQFA 4PLGA 2VQDA 2YRFA 4B34A 4HAVA 4P4GA 3E9RA 2RMKA 2ZIZA 4D4MA 4ECEA 2OAEA 3CMMA 3HQ4O 3NC1C 3QE3A 3FSRA 3SMQA 3AZQA 2NG1A 1QG6A 1P4RA 1M72A 1X1EA 3L1HA 1RYHA 2GM3A 3MJHA 4R9SA 1FLVA 5LZ2A 4CQNA 4ATNA 4PRZA 4EMTA 4CFZA 4D0RA 3O4IA 2J59A 2VPIA 4Q4CA 1QGZA 4B3TB 1NFQA 4EI8A 2HM7A 5L7TA 4XVCA 3UQZA 1FQOA 4EG5A 2GD0A 4HBGA 2HBQA 4EOGA 2OEPA 4WOKA 3TZEA 1YR2A 4Q4JA 1E6EA 2FKNA 1G7CA 1RMTA 3FFTA 4A0HA 1NX9A 4DDWA 1ZR2A 3AX6A 1QOZA 2VPQA 4HLDA 1LBIA 1QC5B 3L0PA 4CTKA 4GVLA 2Q49A 4ARSA 3A14A 1V11B 1Y3HA 2HO4A 4UUNA 3S68A 3T3PB 2IV3A 3V8MA 1JLHA 3JQRA 2GKSA 3BGSA 4ARZA 2ZWVA 3GNSA 4QYTA 4EZEA 1VFPA 2JZCA 5HXAA 3CVVA 2HI0A 3RBVA 3CX8A 5C7LO 1EBBA 3KPYA 3KSZO 4BJ5A 1MJGM 3PL5A 3QBTA 5BYBA 1JRLA 2YIMA 3NCHA 1CF9A 3N2YA 1YJ8A 2V6MA 3LT5A 4WLEA 5ERGB 4LDQA 1ZJZA 4W6QA 3FR8A 3E03A 1TZBA 4DBVO 2I9KA 4PX5A 4LC0A 2W4IA 1GQOA 2C4UA 3MBIA 2HRCA 2PR2A 4KTTE 3DWIA 3C41J 1TFRA 4KDCA 3E2IA 3NHSA 2WTUA 1M6WA 2O0HA 2GBCA 3RC2A 2JCGA 1MEOA 3DTYA 3HYRA 2LR0A 3N8DA 3IKVA 4RJIA 3ROTA 1YDFA 2ZXUA 2H7VA 4QZVA 2D0OA 4L4XA 1II0A 3QPBA 2FUG6 2YZ7A 2HYDA 1BHSA 3VSBA 4J1NA 1ZEMA 4AWAA 5I48A 5K01A 3S99A 3HWX1 3RVPA 4M36A 2QD2A 1ZSNA 4W4TA 4Z9FA 5KAPA 1F1BA 3CZPA 2C0PA 5IPFA 1TYBE 1U0OC 2WMNB 2XCIA 3L7IA 3I12A 4FILA 4PN3A 3QEAZ 5EAIA 5ELXA 3IS3A 1EUYA 1SGWA 4JZ0A 2JLCA 2NIPA 4LUCA 1LF0A 5JFOA 1MJHA 1WMDA 5LQUA 3L4BC 3K0CC 4UBNA 3WG9A 1RM0A 4P1ZA 3WKBA 4CIWA 2IBTA 2F64A 2Q1XA 1X74A 1EAMA 2VH5R 3KJFA 4MLZA 4O4JA 1SO8A 2JH8A 5FNZA 4ZV9A 2PUDA 5DASA 3TQFA 4DWOA 1EFRA 4D79A 4JB8A 2MSWA 2GTPA 5J5VA 2O0LA 3DVAB 3BMQA 3KZCA 3NTLA 3ZXSA 5EGNA 3JRXA 1YTUA 5JAUA 1CQIA 1LA2A 2VWGA 3KWJA 3RS2A 5IKPA 1R0SA 3PNLA 4DV4B 1QS0A 4IOMA 4M6WB 3GUYA 2UVQA 4LXUA 4M0KA 1BJRE 1U1FA 4MCRA 3W90A 3ICUA 4M9RA 4MW7A 4ZPXA 3HVHA 3OZBA 5AW8A 2Q50A 3A26A 4AN4A 3KUDA 2EF1A 3ZR4B 1VCOA 3EVEA 4MMYB 3SBDA 1QU3A 2QTAA 3BZWA 3OZEA 1GKKA 1GRCA 4EYQA 3N8IA 4LZNA 4N18A 3WLLA 2EP8A 3RSOA 3VGJA 1W88A 3IKLA 3VPDA 5KDOA 1JJ7A 3C8UA 4QJ5A 1DG9A 2L17A 4G63A 4J4HA 1V1MB 2QTWB 3B5JA 1FTGA 4LWPA 4JYAB 1Y1KE 2AVNA 2RHWA 3BK7A 4R5HA 3W6OA 4V0RA 3OJFA 4M3NA 4NYMR 4YY3B 3EPKA 1U0SY 2QLTA 3X1MA 2RJNA 1Y9EA 1K2WA 3ITKA 3JZIA 3LUJA 4IDEA 4R51A 5DCYA 1GTL1 3IHWA 5F64A 3RHZA 4CF6A 5JAIA 4G23A 1WTCA 3FJ1A 3WLOA 5IZCC 2WVHA 1Z4IA 5DMHA 3U4IA 2YHIB 3I9MA 1XHLA 3M89A 4MUIA 1WUHS 4Y8VA 5HS4A 5CFRA 3ER9A 3D0KA 4TZ6A 1JHRA 4DC9A 2NSHA 1WHSA 3AXSA 4F4IA 4ZZ1A 2GZ1A 3FPEA 3KJNA 1V9LA 4RE6A 3HCNA 3AL3A 4O63O 1L7RA 2FP4A 4OHXA 4P4NA 3AP1A 2ZYIA 1G9XA 3PTZA 5I51A 2GJ9A 5D8DA 4B3RB 4MZDA 4WH0A 2YJ3A 3VUEA 4H60A 4Y18A 3SQXA 4YB8A 1ND5A 3EODA 4YMUA 4C6TB 2TECE 3KQWA 5CA1B 2YJTA 4A16A 2B21A 2ZDHA 4J29A 1Q1AA 2AL7A 3U0VA 4NYMQ 4EGSA 1DKPA 1CNMA 4X5OA 3ASZA 4KQCA 4WZBA 6GPBA 4D8WA 4JR1A 2X9QA 3CEAA 2EGGA 3FWHA 2VUUA 1WB6A 1VRWA 1DAHA 3PUKA 3WTBA 3DEJA 3QVXA 3ZUGA 3UWKA 1YASA 4Z3OA 4W8HA 3VU9A 5DTQA 3L7AA 4QBHA 4YGYA 2X5KO 1HT1E 4ZZIA 3LDUA 3LT0A 5LYJF 3AL2A 1PWYE 3FTPA 4GRDA 1KQGA 2JAHA 4HYTA 4R1QA 3U40A 2OCKA 4Z2AA 3DG9A 4MHTA 2G09A 3KPWA 2FDRA 1D03A 2WFMA 3K16A 3NHYA 3A6PC 1EX6A 3UYLA 1VI6A 1MRNA 3LYLA 3NM4A 3V7YA 3LL4A 2NO5A 4XH9B 3UV3A 4TS4A 3EOBI 4HVAA 4V0SA 2PMFA 1E59A 1QIJA 2EJWA 5IW8A 4ESVA 5EUCA 3GOHA 2WP0A 3GNQA 4LFBB 1QVVA 1E0AA 3DPUA 3DMRA 1P0MA 1UC4B 2I8AA 4G0XA 2PWZA 3OQHA 4EIWA 3ZGVA 4UTNA 4LZWA 1R74A 1QB8A 1DHRA 2JLBA 2C4MA 1CS0A 3A05A 3KS9A 4LQLA 4FHDA 4RGQA 1PNOA 4D4KA 1OXSC 1OYWA 1TQ6A 2WYHA 1CY0A 4ASUA 1F0NA 1P45A 3IBSA 5KYNA 3GELA 3HWWA 2VNSA 1E94E 3LPAA 4D81A 1KSJA 2IYPA 2VJQA 2QF7A 4AXBA 1R0ZA 1RIIA 1LK5A 1T2DA 1I7PA 1OIXA 2C3UA 1QVWA 1YRHA 5HK8A 1R0XA 4C87A 3L46A 1FMLA 1P0CA 1LSUA 2VCYA 4FMPA 3HM2A 2D2XA 2YH2A 3DMYA 3OFJA 1QDLB 3N7UA 2VWQA 4BO8A 1EVQA 1V35A 1WY7A 1YQQA 1F0KA 2PD3A 1MOQA 2XDQA 3ON5A 4TV8A 2E28A 1NW9B 2WYUA 3SEZA 3SVZA 5KQSA 1A9YA 3O1HB 4MSUA 1GPKA 3G0DA 5TT0A 4D8YA 2ACEA 2IS6A 4F93B 3W79A 1JJFA 4UASA 5AOAA 1O6FA 4GEGA 5CPBA 4OXIA 1V5IA 2Z3VA 3D5QA 1WXWA 1GXSA 3AJEA 1LTKA 1QE0A 3WFZA 3U48A 3WQSB 4ZCMA 4OAOA 5JS6A 2WNIA 4X6UA 5TPZD 1HXHA 4ZAXA 1W581 1HYQA 1U3DA 3W4KA 5IN5A 4UUOA 2DMRA 3MERA 3VPSA 1GCIA 2WWVD 2X3FA 1CUSA 4JELA 4BLTA 1OX5A 3I3OA 4RMJA 1H6AA 4OUDA 2ZS7A 3B5EA 1K92A 4XIYA 4C7OA 1U8TA 3QIVA 1XRMA 4NY1A 3WB1A 4LHZA 5ENDA 4BVKA 3FLAA 2FEAA 3NAQA 2V4ZA 4MO2A 4GO1A 3ZZMA 5I4CA 1GNRA 2WKSA 3D6MA 3W0LB 2DXIA 4GSKA 3HBMA 1JG6A 3Q8LA 3G7UA 1M6EX 4QUIA 1ORVA 4QODA 4C4RA 1R16A 1NNLA 1TYDE 3REQA 4ZOLA 3T94A 1WW3A 2NVWA 3FTQA 3ITNA 1ORDA 1QGYA 2ZTUA 3WB9A 2HJWA 4G5QA 3IT1A 2O8FB 3V2IA 5AUPB 3UW1A 3RYIB 1J21A 2YV1A 1EGAA 4PXSA 2E9SA 1E3WA 3FHLA 1IONA 4HG2A 1ECJA 3BHIA 5FNVA 3LW7A 3KYCB 3O8BA 3QELB 4YMVA 3AY3A 3EEYA 2FUG1 1IVSA 2ZIGA 1W5FA 4N3AA 4DJDC 2QSJA 2VDKB 1P6XA 3R5FA 5ALXA 4FB4A 4J7CA 2OO3A 4JT4A 5KNLA 5HGJA 1JW9B 4BNDA 1LPNA 1U98A 3H5LA 2HWUA 3AF6A 2BGRA 4W5RA 4BNXA 1IXZA 2DC1A 3SFZA 3TCKA 5FLEX 3SC2B 3UEOA 4QQKA 1T8YA 2O8EB 3TTWA 1HT2E 3KSMA 3PFWO 4HFMA 1P73A 4ETWA 3U44A 4HXEB 4P44A 1ZD2P 1QGUA 4EVIA 2QI9C 3ZE0B 2V4UA 4N6GA 4BNVA 3ISVA 1Y48E 3Q7EA 3EUWA 2BONA 3LY7A 4ZJPA 4HDAA 2AN5A 3RE1A 3KXLA 4H0FA 1JXAA 1JQEA 2Z4TA 3ECSA 4B4VA 5A4KA 3SQNA 3ZLJA 4NATA 3VPGA 3BF7A 3TW6A 3B3QA 3TNDA 4GPD1 2CCGA 2DX7A 1K6XA 1YS6A 4O4IB 3DCIA 1XLTC 5L40A 1UOEA 2ZRGA 2DERA 2O52A 3G6KA 4MP8A 4MPDA 1MDBA 3VPFA 3TRDA 1YQWA 3A58B 3QPWA 4JXJA 4EQ6A 3COYA 4BS9A 4KMOA 4Q18A 3ZCPA 5IC4A 3V00A 3TGPA 3U60B 1HMPA 1LLCA 4AKGA 3PITA 1SU6A 1QIHA 1XWFA 4WKOA 1AKUA 4X54A 3KSAC 1OAAA 3WIEA 1Z26A 4OJNA 3AEXA 4PGAA 4Y9RA 1YOBA 3P52A 1FOEB 3SQOA 1T0HB 3MJSA 4OXKA 4D80A 1X87A 3AW8A 2RHJA 2GWRA 2W6JA 1C1YA 4JOQA 1OT5A 1CP3A 3TZQA 2ZRJA 2CFSA 3ZCXA 4B1FA 1NXXA 4HL6A 5IKXA 2R6CA 4RDIA 5ALOA 4BVHA 2ATVA 2FOXA 3DNPA 3I6YA 2QG6A 2AQIA 4JYZA 3ONVA 3EQZA 5E9WA 1HGXA 1PD0A 2QUJA 4DG5A 4PYKA 1CUUA 3TZHA 1P5JA 1BCRA 3OQBA 2XDYA 4UOZA 5B7NA 3EWIA 1NSTA 3E3NA 3H65A 1FMCA 3WLHA 4IFBA 1ZN9A 2A92A 4BNHA 3FEDA 2GM4A 4CDGA 1XK7A 2VNIA 4E2XA 2BMDA 4QGHA 1XXHA 5DRTA 4CBVA 1B14A 1G8GA 1J00A 3RUIA 4CKCA 2PX0A 1VSTA 1VM6A 8GPBA 4NQZA 4BCBA 4BLVA 1SQ5A 2Q4BA 1CD5A 4ND1A 4XWWA 1XZIA 2JIRA 1XL0A 1H2BA 1F8GA 4QBGB 4Y67A 4X7MA 2PRZA 1O5TA 2BMFA 1KFCB 3ICVA 5AM1A 1MT3A 3OT1A 4E14A 2C42A 3GQBA 4DLXA 1ZQ9A 5FAKA 4JYBA 3JASA 3TNFA 2L82A 1OLUA 4QD3A 3C5EA 5CYFA 1OLXB 1XQVA 3RC3A 2RK6A 3LPMA 2MJLA 3I9FA 1JN0A 3Q0TA 5JSZA 5EIOA 3A6EA 3I4CA 3D5TA 4M1YA 1FLAA 4AKTA 5K0TA 3VKFA 1ML4A 2K2WA 3BXFA 1F51E 1TFUA 2VEDA 3H84A 1HTWA 3N2GB 1F5SA 2Y0BA 2ZSDA 3ORFA 2VO1A 5DYNA 1Y1TA 1PYOA 5AXAA 1YA6A 1KRHA 5HQJA 5JC8A 1Z6QA 4X1IB 3HBAA 4ME6A 4UATA 1HQDA 1R4NB 2HTEA 2NU6A 3QKIA 5KTMA 1JFVA 3W5DA 3EVZA 3O2QB 4HO1X 4PQEA 1NSYA 1FFCA 2RAUA 1Y34E 3ELUA 3H2KA 4UOQA 5FA5A 2X14A 3NS7A 1GNSA 1SIOA 2Y8EA 1TQDA 3THXB 1N2XA 1SC4A 5HMMA 2CLFB 2HJHA 3ZHSA 5DYTA 3EARA 2WM2A 3GZNA 2NO1A 2GXAA 2IP2A 2ORIA 2Q9UA 3DAYA 3QNUA 5NULA 3T4PA 3U3JA 4C3ZA 1X1QA 2MSNA 3BDAA 2OD9A 5AI9A 4RD1A 4OHWA 3AR5A 5GM2A 8ADHA 1C1XB 3H9CA 3IQWA 4OI2A 5ICSA 5FPQA 4DDMA 3B1JA 4F6RB 1REQB 1XVTA 1T6YA 2DJ5A 2EJUA 4YX9A 4LE1A 2I3GA 1LC0A 1NXTA 2P40A 1NFFA 3OQVA 4C89A 4A5SA 3IIIA 2IOQA 4MLDA 5K0NA 4EO9A 5BO5A 3BCUA 3BH0A 5DNEA 3D0OA 3STVA 3MJRA 4FGZA 5BMOA 4KAFA 5DNWA 4EM6A 5IBRA 4EAAA 1DC6A 2C4HA 2RH5A 4BRSA 4EI7A 2OCYC 4FLEA 1PYDA 4AWXA 1VXOA 2C29D 2HJ9A 3MWDB 5IDXA 4OYHA 1Z7WA 4R54A 3DL2A 1Z4JA 4RMHA 3ETNA 1OU4A 2BR5A 3USES 1XZJA 2YXLA 4RETA 2XSZD 3K2IA 3WLTA 1J7JA 3VM6A 1PGOA 1TM5E 5ALGA 1CB7A 2G5CA 2HIHA 2VDJA 3NHZA 1V9CA 4I7EA 5L4LA 5T7BA 4PFKA 1Z29A 5CIYA 4ZTZB 2WFAA 2HMVA 2WJPA 3PCXA 1MGPA 1E0KA 3AGPA 4P54A 2VDPB 1RZRA 2I67A 4NMXB 2BSQA 2ZXEA 1CC1S 3ELBA 3P19A 1N8SA 1Z6PA 2C58A 3L0ZA 4CJXA 5ITWA 2HCJB 3TEMA 2Q7XA 4Q7MB 3D0QA 2I6GA 4OQLA 3RIGA 1WHTB 4A8HA 4JVSB 1TLLA 4BKMA 4EG3A 5ALIA 3WNDA 3UN1A 1E7RA 2PGLA 2WV7A 3NM6B 2IX3A 4A15A 1X8JA 3GLHE 1C0KA 3DBOB 3PNBA 4GMXA 1E6KA 4F96A 1I7SB 2HGZA 1A8QA 2Q5JA 3F46A 4OK3A 5EERA 4GICA 4HKTA 3OIYA 3IMKA 4LNUB 4PYMA 3PFCA 4RZQA 2ZJ8A 1FLNA 1MP0A 3D1LA 3KKEA 4M37A 5ENVA 3WGGA 4YWHA 1KVQA 1JPNA 3OOEA 3H8SA 4KWHA 1NLZA 2BEVB 2HKIA 4KMRA 2ZB3A 4M0CA 2PNFA 2RB4A 3L82B 4Q05A 3NEAA 4QT0A 4I1PA 5K3EA 5G41A 2X0JA 5DTEA 2XCQA 5A1JA 4BWYA 5LCXA 3I2HA 4KQFA 4DMKA 3K6SB 4JP2A 1WAMA 3DYVA 4CEJB 3QPUA 3WS7A 2R8ZA 3ZQ4A 3FPSA 2ZYDA 1NQWA 2FMFA 1KMMA 2FRVA 1Z7GA 2ILTA 3CGWA 4Z4GA 1EBUA 3JYNA 3IT3A 3BMOA 5E2AA 3GFPA 4Q4DA 3CV3A 2BN4A 3FB4A 4LN1A 2I9PA 4F4JA 1B8UA 1MD9A 5AHKA 4P32A 4IRUB 1YUBA 4AO7A 1JF8A 4JNKA 3BTVA 5D3MB 3UMGA 4BX2A 1OC2A 1IM8A 1ARZA 1ETHA 3AY6A 5EHIA 4RVGA 2FZWA 1EBFA 3R5JA 3OU7A 1XJ0A 2JLUA 5IFLA 1GGVA 2ZZKA 4J1TC 1PKEA 3ENZA 2QTZA 4YJFA 4NGPA 2CZGA 1MB4A 3QMWA 5JU6A 4C2TA 2YXNA 5A3QA 3ZJYA 2ET6A 1RR6A 3CUWA 1VL6A 4QXAA 1L5KA 2XUAA 3M3DA 3PC3A 1ECLA 5FOQA 2HYIC 3EG5A 2B7BA 4TTQA 4CQLA 1S3SA 4KNVA 1NURA 1CJBA 2Q5FA 4KQ2A 2H31A 4ZJZA 3CA8A 2EAUA 1XU4A 2JGJA 4ZCLA 3DBRA 3STWA 4J2HA 3CJQA 4N48A 2ILVA 1N3IA 3WKEA 1GZVA 1H4SA 1YT5A 3REGA 4B6SA 4DAOA 3GVHA 1N34B 2G72A 1FVFA 2C31A 4KIWA 4EP1A 3UJNA 1DWPA 1ZAKA 2IZ5A 4EA7A 2VTBA 2EJVA 1W46A 1YQ9A 4D4HA 2X9GA 3NWBA 3IL2A 1DHTA 1QYWA 1N9ZA 4KPUB 1S96A 4B7UA 3R44A 1KTVA 1YB5A 3TTXA 4ZFNA 4YMGA 3U4MA 5KWVA 3D7KA 4WOPA 2PUFA 2YJVA 4WCFB 4G5YA 5C8YB 4BMSA 2R0QC 1DO0A 2EL7A 5F5LA 1DSSG 2PAFA 3K8YA 4FDVA 5EC8A 3RUPA 2JJ1D 4BCCA 4BOYA 3QEOA 5FPKA 2ORWA 2HSGA 1Q0TA 4P7KA 1NR7A 2D3TA 4H7KA 4IHKA 2ISQA 3HZHA 1NNUA 2IEGA 4JLKA 2YRXA 3ROEA 4M55A 4HAIA 2AHRA 2BAGA 1CUWA 3U4AA 4XDYA 3HV0A 4X3RA 2WYWA 3CUTA 3AFIA 2HJSA 3MD0A 4M1MA 3W8RA 4A5OA 4ND6A 5C1BA 3HFSA 1NQAO 4OIMA 3ZWPA 3LC7O 1SUIA 1HETA 4COGA 1ONNA 1YNSA 4PHTA 3WLSA 4HMOA 1WW8A 5J3JA 1NWHA 4ALLA 1M2VA 1UDXA 4ZCIA 2GAAA 2WSSD 3LLVA 2HRDA 3QBEA 4BGEA 5BSFA 1AX9A 4X8LA 2MINA 4I6JA 2QE7D 3HVJA 2IUYA 4FE3A 1X1TA 2DOKA 2VJCA 4MWOA 1MR3F 4PTYA 5JMWA 1UJBA 1KC7A 3H4MA 3FJYA 4NZMA 2AI3A 3PNYA 3RTAA 1JG3A 1MF7A 1Z06A 1JYEA 3I2JA 4KXXA 1BVUA 3T1NA 3PU6A 3HCOA 3X1WA 3ZW8A 4JHLA 1TJYA 1IN5A 1KJNA 2E85A 2I3AA 2JGDA 2XCUA 4FC6A 5CT9A 1IBLB 5LNK6 1O58A 2XD9A 4QU5A 3HDTA 3D2AA 3F4BA 3O74A 2O57A 3KUKA 4UNSA 3H3JA 4V0OA 1ZITA 2C20A 1T2FA 4EF4A 5LMNB 1N2EA 3D9QX 5LOVA 4HLCA 3RI3A 3ENVA 3PF9A 2YJNA 4J43A 3FDIA 3RNOA 3Q6NA 2DULA 5A9RA 3EYWA 1UIMA 1FB5A 5DLDA 3L40A 1UBOS 4KLZA 5EXDA 2FSGA 1NXOA 1S2NA 5DHTA 1ZS9A 4AJOA 2QYHA 4WKNA 3EGXB 3CBGA 3V2UA 3GP5A 2XX3A 3GCXA 4L15A 1E9FA 4J4TA 4DW8A 1DCTA 3QVWA 4YLYA 1TXGA 3SYMA 3KALA 1J8FA 2C4KA 1KOJA 2JHAA 1XLUA 1T2VA 2H4YA 2OT3B 3P9XA 5JNUA 4WK6A 3GLSA 1ABEA 3JPWA 3UJBA 1W1WA 5AI0A 3RARA 2V55B 1URPA 3KQTA 1KK1A 2F9FA 4ERXA 1RQNA 2OLKA 2IWRA 5IVKA 1V2GA 4FW9A 3WBBA 2C5GA 1W29A 1X7YA 2A3NA 2G67A 2W5UA 4TUYB 3DF9A 3UHFA 2VNKA 1MMFB 4DLVA 1XN4A 1Q14A 4C85A 1C3OA 1KJ9A 2G71A 3PEUA 1PZXA 4M8IA 4D43A 1A5BB 1YKSA 2FN4A 2CVPA 1L8XA 3OBIA 2A1TS 3SBEA 1MA3A 2P6PA 2E2WA 3I6QA 5EIEA 1BVHA 1RYFA 1SOWA 1SCQA 1EFAA 3DEYX 3KEGA 5KVVA 4ZXPA 4WK2B 5A5DA 3ZHRA 2FFRA 1DDIA 4XR9A 4NNJA 2E55A 2AOWA 3DMPA 1T3HA 4BV8A 3BRQA 2C6PA 3ZV6A 4Z1OA 4IUYA 3M8KA 1AZWA 3IE0A 3N5KA 5HZKA 1H1LA 1CEQA 1UBHS 1USVA 1GTG1 3V7FA 2B37A 3PS9A 2WUGA 4KODA 1NY6A 2ERXA 1S1MA 1AQIA 4KN5A 3FDZB 1WG8A 1YBAA 5E1BA 2PZAA 5I9MA 1BWSA 1Z07A 5ITZB 5JECA 3ZZUA 1YE3A 4IOJA 3LY9A 1G8FA 2JEZA 2O3SA 2Q1YA 1EGVB 3EW9A 4DLTA 1N0HA 4IV5A 5GJVC 1QYRA 3WMEA 1SXJA 4WERA 4B5LA 2VDMB 5CLIA 1YZYA 3G2NA 4L8VA 2P3OA 3G8CA 3I09A 4KPGA 5DM0A 4EFDA 3ACDA 3RYCB 1LX7A 4HDQB 3RGGA 1JEJA 4EL0A 3T1QA 2W8BA 3CNLA 1G3QA 2Q99A 4KEAA 4NOLA 1YFKA 3KU4A 3BRWD 1O9GA 4MUKA 2O19A 1R3DA 1EZ1A 1KI9A 2MMGA 3MWEB 3EAFA 5ERYA 1XTPA 1G59A 4KTVE 1NMSA 3QOXA 2R1VB 1GVNB 1L1FA 1XZEA 3V4ZA 1YOVA 2E4WA 2G36A 4I1SA 5G2OA 1VIYA 4E22A 2A86A 2Q8QA 1HX7A 1E4OA 2WUWE 3GU3A 4RH0A 4DLUA 3VPBA 1QQAA 2I2FA 3QE4A 1JHAA 5MDHA 3OTIA 4JJ4A 3I61A 3BWYA 4YREA 1KDZA 4NJEA 3ODPA 4RF3A 4UHKA 2ZAMA 2Z56A 3DULA 3IEIA 2WJ3A 4C3UA 1V8OA 3RB8A 1X15A 2ZBRA 5G3YA 4YRLA 5AVJA 3O92A 1QYCA 5TMPA 5HEKA 1N1EA 3KOUA 3MPOA 4FLFA 5K6RA 1IUNA 2QQGA 1Y5LA 1ZUHA 4IJVA 4CN8A 5KNCH 1RLOA 1G3IA 2J3DA 4MR8B 2FH5B 2OTCA 4UEJA 3GH3A 4INZA 4N9QA 4KZKA 4BRZA 1U4NA 3LGAA 3OFKA 3PC2A 3NAMA 3DDOA 3PDCA 4ML3A 4ZVTA 3U3XA 1GGHA 1M2KA 5K3OA 2YWJA 3NOQA 4EY6A 5LZ9A 3Q3HA 5CFZA 4NBNA 3B6ZA 3QVKA 2WTEA 2VT3A 3UUGA 1O97C 2GYUA 3I5MA 4L4SA 3W04A 1HRDA 2PZEA 2X1VA 1V7ZA 1YC5A 3COWA 3E27A 5DCUA 2GASA 4UBLA 1IY9A 2WPDA 3OPQA 1GCAA 1P2SA 1SHLA 5KNCA 3IP1A 2XGGA 2CE7A 5EUMA 5I9NA 1V43A 3SM3A 4OFWA 3WQRA 1R0KA 2G88A 2RHTA 4WL0A 3IBYA 3ULKA 2QG9A 4Q1DA 3TOSA 3W5CA 1UXOA 4G07A 1L3BA 5KDLA 2D2IA 3CUVA 5H59A 4G8JA 3IV6A 3TQCA 1IRIA 3KDSE 4GYJA 2YBEA 4MVYA 3E4CA 4U6QA 4Q16A 3UUFA 4YQFA 3ER8A 3WRXC 5EWLB 2CXSA 4RCVA 1RI4A 1VGVA 3Q5DA 5AUOB 1C9NA 1PQUA 2QQEA 1YS1X 2OD7A 4AO6A 1ZK1A 5DB4A 2AJCA 2OV3A 3KWFA 1QIGA 3ZV3A 4UHBA 3VC3A 1SMKA 4EJ2A 3OTOB 4WVLA 1OVGA 1OX4A 1T9BA 5BSTA 1LQ2A 1W1UA 4MUYA 2QUHA 5AOVA 1FU8A 2X76A 4TVBA 3ZNOA 4PC7A 1OGYA 3OICA 4D8VA 3T7RA 1IJFA 1QHEA 4DIEA 1X1RA 4NCAA 1LU9A 1GJRA 2RIPA 4AKHA 2IUSA 2AFHE 3IPCA 3W2IA 4MITA 1V4VA 2MYNA 2XKBA 3FR7A 3DO6A 4UEWA 1NI4B 3OUZA 2UV8A 4UEOA 4ZZ2A 4JLAA 4OLAA 1IOLA 3GIWA 1P18A 3L7MA 4ND8B 2H92A 4Q82A 4RPIA 2BV3A 4TYNA 2Z2ZA 3QLTA 1PTKA 4IH4A 2R48A 3SD7A 1Y7LA 3JZDA 4XIFA 4YJ3F 4RH1A 1E1YA 3HO6A 1YJXA 2XITA 3GN2A 3NHWA 5B64A 1CLEA 3RSGA 2R96A 2XMZA 4IV8A 3HSYA 1US8B 2X86A 3GRKA 4IH1A 4ZO7A 1E1MA 2PLAA 3M4NA 5JASA 2X13A 4TQGA 1F9EA 4PRYA 1LPMA 1X7XB 1B1CA 3EZFA 3P0JA 4OLHA 4CT5A 4CM4B 3NWOA 2BP7A 2Z8XA 2HA4A 2H85A 2IPNA 1C80A 2PXCA 3CLTD 2AW5A 1YR3A 4KBYA 3MMSA 4Q4AB 1JZTA 1RJWA 1ZMOA 4KCGA 4TYWA 5I7SA 3DP7A 3QW2A 3AOGA 4ANFA 2L18A 2C2WA 1WMBA 3IP6A 1MZVA 3T1HB 1WB9A 1OH5A 1QMGA 5D3QA 4M88A 2HROA 1VBFA 1FFYA 1U3CA 3OZDA 2X4LA 2AFHB 2BUCA 4HGYA 1FZQA 4UREA 1S01A 1UMDA 3FCXA 1TM7E 4RF4A 3KLNA 4C9EA 4LC1A 1Y3CE 2NWQA 1E64A 1N9KA 1W5SA 4WUVA 1XZHA 5EKUA 5LNK1 4IO1A 3AVXA 1DIAA 1XEXA 4YCCA 3DHVA 3RVMA 1CRQA 3HSKA 4DR2B 2CHQA 1XHEA 1P5ZB 2CYAA 2VF5X 4WZZA 1TGYA 2ZI5A 4OP2A 3U9SA 2G4CA 2K2QB 4II2A 5C9ZA 1GM5A 4H18A 2NTJA 3MMXA 2Y66A 4J6EA 1LLDA 3A04A 4UHJA 1RHUA 2M6RA 2XXJA 1FF9A 1VBMA 3D0RA 3JD1A 4DVJA 1D2AA 2B3DA 1V6AA 3R0JA 1G8AA 3PKZA 4HDOB 4EYKA 3Q8KA 4LJ9A 2ZU6A 1VDMA 1FK8A 2AEEA 2QTGA 3ICOA 2AFIE 3R3HA 4IWNA 1N0WA 3JQ7B 4Q21A 4RJ2A 4JMLA 2BM0A 1R1DA 1OD6A 1RIFA 2OL4A 3DLCA 3MB8A 3MT8A 1W9MA 4HQKA 3H42B 1DAFA 5TQJA 4YJ2A 2O54A 1CERA 2J5XA 1KMCA 1U7XA 2BH9A 3ZY4A 1XCOA 3THRA 2D74A 2C4TA 3R0IA 4OOEA 3WK6A 2XXAB 2HF9A 2CEKA 5D00A 1O9HA 1MPXA 3P8ZA 2BGJA 2XWJI 5B1YA 2CN1A 3UNXA 1NC1A 1ORWA 3L7YA 3OU6A 1PS0A 3KOMA 4RMIA 4BKRA 4DCJA 5IZCA 3R9XA 4JMPA 5EQDA 4AN1A 4XYEA 4B47A 1WZ2A 4R8KA 4X3OA 5FL7A 4MS3A 3B3AA 5CCBA 2RKOA 2FY8A 1HF3A 2ZRBA 4BN4A 3MNFA 4Z0NA 2WM3A 2DZDA 1EUQA 3VNSA 5DMXA 2HJGA 1BX0A 2VP2A 4KB5A 3RSSA 1CRLA 4MWDA 2VSOA 3ISJA 1R4MB 3K70C 1T8WA 3D64A 2YVUA 4NZZA 1UADA 1PJ3A 1TEVA 5FBQB 3RWOA 4F5EA 1GZHB 2JCBA 4M1ZA 2GPJA 4ZARA 2PD4A 1U3GA 1KSGA 2AEJA 1ZN7A 4CFSA 1QV7A 2EKZA 1YXMA 2AFIB 2CNWD 2P9FA 3Q7RA 3QNMA 5BWOA 3BKXA 1NRWA 4OCZA 5BNZA 1GZ5A 4NU5A 3QX3A 1IHOA 1ZNYA 3IAEA 1EWQA 1SNYA 1S02A 3DE2X 1Q1BA 4LE2A 1LCIA 1SOVA 1PT7A 2JGRA 3KOOA 2XB8A 2R7MA 3S2IA 4K0RA 7REQA 1QYVA 4DIKA 3ROFA 3NB0A 3T0IA 3UBMA 2FW6A 1TPZA 5BN4A 5IULC 1EDOA 2WT4A 1ESDA 5DT9A 1L5QA 2ZS9A 5DULA 1PZEA 5TE9A 2HI6A 4CE6A 4YXWD 1SXPA 1GPWB 4C2BA 4AMVA 1Y33E 1D8AA 1E9BA 2CK3A 4L22A 3T5TA 4ZIRA 4E2WA 5A4FS 4XEUA 1XTVA 5B58T 5CAEA 3KE9A 3EQ6A 4FBLA 1KEUA 1HEUA 4AMBA 1PQPA 1YE5A 4EX6A 2ENWA 4U3JA 4GH5A 4A7PA 3BIFA 4YRKA 2H2AA 1UT6A 2PZLA 3WIOA 4LPSA 3UENA 3H4VA 1JFTA 2C04A 3OOYA 1EP2B 1OKKD 3GUUA 3IYLW 4GVXA 4A9AA 2H18A 4KBFA 3ITDA 3I01A 3BXOA 5AI6A 1GWNA 4FUTA 4H15A 1KGSA 1WF3A 4RJJA 3WWZA 4EI9A 1DAKA 3MJFA 1MEEA 4PO1A 5BN3B 5JBIA 3TFWA 4D99A 1NNI1 4DE5A 1AF7A 4UQLA 2OR3A 3IIMA 4ZO9A 1RBQA 3Q3VA 2GAJA 2ZM6B 3GZTB 2I55A 1OV4A 2EVWX 5AJYA 2C9BA 2XR1A 3DOHA 1H8EA 1O94C 3DCYA 2ZU0C 3QXHA 3TL3A 4IF6A 1CHNA 3LQ4A 4HDSB 1DQNA 1A2QA 4IV0A 4LSGA 4Y2XA 2WTMA 2Z09A 5DBGA 4KMMA 1RXVA 2IXTA 2VNJA 1U2DC 3ESBA 3CH5A 1DG3A 4F2GA 1YGPA 1SKQA 4HZUA 1KORA 2PBZA 3VISA 3HC7A 4Q1AA 3C8OA 2DWQA 3HTXA 1N3BA 1U0RA 3WYGA 2DFDA 3EG9B 2B99A 1FU4A 5JBNA 2N46A 4NENA 5BNFA 4O1MA 5HGXA 5CX1A 5AKIA 4JBWA 4YMIA 2XHEA 4LGCA 3X44A 3IP7A 3LRPA 1XRLA 4F3TA 1MHPA 2RGGA 2XKJE 1PJ4A 3B7GA 3I5YA 3C1OA 2HEIA 2WM9B 3T7EA 4B0PA 1QCZA 2CMHA 1B26A 2C92A 2FJPA 2KHZA 3WBKA 1E79A 3UMRA 3HACA 1IHYA 3KQOA 2Z2JA 4QXMA 4EHJA 4FQ8A 3DDWA 3HB1A 4F6LA 4GKBA 2AT1A 2Y1DA 2B92A 3PIIA 4KV9A 2HOQA 1RZVA 2V7EA 1GAWA 4ZRMA 4E2ZA 4HMPA 1EYZA 1P74A 5JR3A 1BS9A 2WWYA 4FYJA 4OP3A 1NN3A 3W5AA 4I6EA 2RHLA 2V97A 3G8AA 2O8CB 5CT6A 2FPUA 3LXUX 4BMPB 4BNKA 1FTSA 2GLUA 3SC3A 2R7LA 3CKYA 5SYNA 2VRWA 5B7PA 3A3YA 2XOKA 3CR7A 3C6KA 3TBFA 2A9VA 2FJ0A 1Y37A 3U7EB 4C0XA 2MR6A 3FG9A 5DXAA 1UC8A 4KNWA 4P4FA 1J5XA 1LW7A 3LHKA 4ZO8A 1M3SA 2NP7A 4L4YA 4YCJA 5THKA 2FM4A 4L57A 5BNWA 4MVJD 4YRPA 2X3UA 5HE9A 5BN1A 2H4FA 4KYVA 1KI6B 5U1PA 1ZC4A 2A5YB 4R1MA 3OIUA 4QM6A 1P75A 1QORA 1XA4A 3BH7A 4M7OA 3GZJA 1G7SA 1WLYA 2PV7A 3BX1A 1X3LA 5I7EA 5F51A 1JQDA 2P2GA 2BBOA 2RKBA 3DQPA 5CFLA 5HK9A 1V8BA 4Q3BA 3EX7C 4LCJA 3HCEA 3EZAA 1ML3A 1O4WA 3FNGA 5H82A 3UG7A 2E21A 3BE8A 3FETA 3EXHB 3TRJA 4GOKA 5EE3A 4FDLA 2QYSA 621PA 4ZICA 2FW0A 3E3LA 3OIFA 4ZWNA 4MARA 4J76A 1QHGA 5DNAA 2C4WA 3M3PA 5J5AA 1P9RA 4B4DA 1PFQA 2ZYWX 2J6IA 3FZNA 3DLBA 2DHQA 1A95A 4O0LA 3LRXA 4G5OA 5F7ZA 3IKTA 4JI2B 4AY3A 1WR8A 4JOBA 5LMCA 1Z2AA 2YJ5A 1J8MF 4XWKA 2QMUA 1GCOA 2YIDA 2QYOA 5EKDA 4YN3A 3I72A 3TXYA 2GHRA 4EO7A 1Z0FA 5DPMA 4ABYA 2EZAA 3C6XA 2G40A 1HI9A 1G16A 3DEIA 3NORA 2X7HA 4LI3X 5BWMA 3GLHA 3UVEA 3LY8A 1X1AA 2HIAA 1QR2A 2MR5A 4Y6OA 4X1YA 1NVFA 4HNAB 2EP7A 5BUQA 1DXQA 2HY7A 4V1CB 3SZ3A 4UAGA 1AM4D 4TKMA 5C1OA 1GQ2A 4TLCA 2IZ0A 1V47A 4DLWA 5EIHA 2JKZA 4FHCA 1XDWA 2WIJA 5E8RA 2ID7A 1I4DD 2IS1A 1IOVA 1H6BA 3PXXA 1A9ZA 2WLSA 1G41A 2FMHA 1VHQA 3I04A 3R3WA 1EWYA 4RANA 2FPGB 3ZU2A 3C3PA 1BJKA 3RVNA 3VU1A 4OQNA 5B3JC 4MDFA 1JSRA 1J3LA 2Q1SA 4C4YA 2IKQA 2XNHA 2WU1A 3RJ5A 2VYVA 2B1IA 3L8EA 3RR2A 1CVLA 4XOIA 2G70A 2YNMC 1AS2A 4H3HB 1GN8A 4NAUA 1V45E 2YVLA 3VMFA 3W34A 1RMYA 1F8XA 1R12A 1T5LA 3BK2A 4YRRA 2QX9A 4QVIA 5CEFA 4UJ3A 4KO8A 5IHXA 2PVVA 1VRVA 2H5IA 5BNTA 2SKDA 1MA0A 2HA0A 2DQ4A 2RGXA 3M70A 4M0UA 1Q1NA 1Z35A 1JG4A 1KHTA 2DU8A 4J07A 5FTWA 2X0FA 3TLCA 3WLJA 1NW6A 2O23A 4K6FA 4M9SA 5AVKA 2RBKA 3NT4A 5JXJA 1JWLA 1VHJA 2Y4OA 4HH4A 1BCSA 4YJGB 2QTHA 1EFLA 4ZQBA 3AL0C 2BFOA 2CXXA 3ZGYA 2QGFA 2A1TR 4R5MA 1LLUA 1EM8B 3AIMA 3VZBA 3IESA 3IPRA 1K3TA 1USWA 1VP3A 1V6SA 4I8IA 1WETA 3NIWA 1RKVA 4A92A 3KZOA 2JGNA 3C6YA 4QJIA 1I3KA 3A4YA 4MW5A 3HJHA 5JYCA 1T34A 5EFOA 3DPSA 3OQNA 1J33A 2IU4A 2O3QA 2BEWA 1GTMA 2EJBA 3I0NA 5IYZB 3OD1A 1M2OA 1JSLA 3GFBA 1AA6A 3GPLA 3CWCA 5CT5A 1SHKA 4FR0A 4H6PA 4EVQA 5ALRA 1QM5A 2VOEA 1OW3B 4XPZA 1S5PA 2ZSFA 4IYJA 4P5DA 5IUKC 2ES4A 3MXOA 5LMUB 1GUDA 2EW8A 4DNOA 3T1OA 3PG5A 4MVJE 3LX6A 1HDCA 4V2UA 2B20A 3TEJA 3UHPA 3C8DA 2HMSA 2IRWA 3OZFA 5EEHA 1MJGA 1Q22A 1U11A 4ZANA 4KGXA 3B89A 1BSVA 2PD6A 3OC0A 1XDZA 2PBRA 3OSUA 4CHGA 1YVDA 3AEQB 4S24A 5DBFA 4C30A 2VUIB 5DNDA 4Q1EA 1QVZA 3KTOA 3NETA 1RHQA 5DM2A 3DM5A 1C41A 5JALA 1GRNA 3M6UA 1R3UA 3MT0A 4RQTA 3TI9A 4C9UA 4CGZA 4M1TA 1VKJA 2Q9AA 4NKRA 4JDPA 3NXKA 3TJMA 1WQ4A 2PSDA 4U5XA 1Q7RA 3OCZA 4XDGA 1JIVA 4OSOA 2ZTHA 3CZAA 3KR9A 1KJIA 4NESA 1W5BA 3VZCA 3ICQB 2XCLA 4G8CA 4RHUA 2ZRLA 1PN3A 2IS4A 4LRYA 3QV1A 2CCKA 5HOEA 1JZQA 1K6JA 4ZPJA 4NCBA 5JAMA 2B36A 4ER6A 1DCFA 1BW9A 1ESMA 1ESCA 1TE2A 1ULUA 1VJ0A 1J90A 1KEZA 3M0EA 3IHKA 1U5AA 4QM7A 2XJ9A 2DUNA 5ABPA 2LDBA 4BEVA 2OORA 5HIKA 5ILQA 1YUMA 4M9ZA 2YW2A 5KU7A 3H5NA 4I5EA 2YY7A 1G5FA 3AIKA 5LP6F 1EWKA 2HQRA 2AN9A 4IDAA 2RHHA 4NEHB 4OHVA 1UBSB 3MF4A 2J4FA 3TFOA 4F5WA 3DW1X 3OZUA 1JAXA 4LHWA 3T3IA 5J4LA 1EUDB 3VDQA 4TV9B 1FPQA 4YBZA 4Z0TA 5FJIA 2VPWA 4AW9A 3IIJA 4LOIA 4X7BA 4OXXA 3UMCA 4QKQA 2PANA 3V1YA 3B85A 2NO9A 2R00C 4GZMA 1TEZA 4IEEA 1ZBDA 4A8JC 1N7HA 2AJDA 4BAGA 1L5SA 2ZJ1A 3OM9A 1P2TA 5E3IA 3SNKA 4QLBA 5AVWA 3ZY2A 3AVVA 1RRKA 3QVTA 3R3UA 2UZ1B 4TWAA 4CM6A 4D44A 4H7HA 2G9ZA 3BFVA 4QNNA 2NVUB 1E9EA 4ER0A 1L4MA 1DS6A 2IIVA 1IBKB 4JP1A 2QLFA 2Q0QA 4KGDA 1H0SA 2CNKA 5LA6B 2PH5A 4CV2A 1E5VA 3NTUA 1NVGA 5EWMB 1E7SA 3IJPA 1F20A 4XYMA 2NUTA 3JSXA 1QKKA 1QWSA 1ZL0A 2ZYRA 2IU0A 4BXOA 2QBYA 1J09A 4TVSA 3AERB 1SXHA 4ZOQI 1UKYA 1XRJA 3ZWMA 1K86A 2Q0SA 2C8LA 4HQ0A 1UODA 4BQNA 1B6TA 3G8DA 2YIJA 2GEVA 3H86A 4FYMA 2N1MA 4GMFA 4GWKA 3DQQA 4HPWA 3GAAA 4JJGA 5ITZA 4IHJF 5CPFA 5A2QA 3S8YA 1WPRA 4GG1A 2FUCA 2XNJA 1RAHA 1EFPB 1EHYA 1G8KA 1A7AA 5H3LA 2B7LA 4XDZA 1UZAA 3ZIAA 1FYFA 4RGVA 1EHCA 1PNTA 4QIHA 3KHSA 5IH3A 1VMKA 3WYDA 2DFLA 3SHVA 4D9GA 3CUEF 1W36C 3CQ9A 3ICCA 2P0YA 1DVRA 3AZPA 5DO9A 4ZI3A 3ZTWA 2J09A 3A32A 2ASVA 3JSAA 3AUFA 4AF6A 5INTA 1JEYA 2PZFA 5KWJA 3MSXA 3O73A 4MI6A 2JCSA 2JFOA 1VB5A 1ZOIA 3DL4A 2BHLA 4MQBA 1UBMS 4P08A 1PEYA 5EL0A 1RQXA 2YJZA 4MQ5A 4GBGA 1NPTO 5TS3A 3VDMA 3OZRA 2C7QA 3L7NA 3P27A 1UWCA 2XT6A 1M6HA 2CLDX 5ETJA 1CZUA 1BOFA 1DI0A 1C3EA 2OZLA 3HJNA 3G5UA 1CUAA 3K9NA 1NP6A 4D25A 2C4NA 4I55A 4CZ1A 2HNAA 2C2XA 3UAOA 4EJ6A 1PW5A 4AZ0B 3K9WA 2AEFA 1BXKA 4IDQA 4MI9A 2IPXA 2WU8A 4PANA 3ROQA 1KJZA 1XAJA 4GI7A 4MR9B 2X77A 3NDJA 4HRVA 2E7ZA 3UQYS 3MCAA 3NKLA 1DT5A 1WXXA 2I7CA 5AKEA 5BYKA 4CLOA 3O7MA 4AECA 3WYBA 2C9CA 2FW8A 4UXJA 3H5IA 2Z3WA 3ET4A 4KSCA 1CLUA 1O96B 1EGQA 1PU2A 2P2CA 1WPQA 1P5FA 4IRMA 4JAVC 4EPWA 3Q15C 4GKVA 3IP3A 4R6XA 4ZP1A 4B4WA 7ABPA 3BBPA 3O90A 4YONB 2JRCA 4GLBA 1JMYA 1MO2A 4HGRA 4I8XA 1D7AA 2PJRA 4O4HF 2Z6VA 5JWHA 1ORTA 1RRGA 4YT5A 4ZKEA 3SZRA 1GR0A 1ZXBA 4J0KA 3GT7A 1T10A 2QY6A 2GCNA 2RJOA 1E2KA 3FMOB 4BZWA 3VTAA 5E6UB 4KIFA 3SZMA 2J3MA 1ISSA 1N0IA 3WXMA 2WAAA 3DWGA 3P2OA 1OBOA 1UJNA 3IR5A 4MHSA 1GGNA 1ZK0A 1MB9A 1UH5A 3ABRB 5AKYA 4CL8A 5IDWA 3E05A 4I9FA 3OEHA 4W6ZA 2C2ZA 4OMUA 2IW1A 5G3ZA 1K66A 2DBQA 2EJCA 3IA7A 1I7DA 1RKUA 5BWBA 1VL2A 4P9NA 1N2IA 4FD3A 1TLFA 3N7AA 1EGMB 4UAVA 2WJWA 1XMXA 2XCRB 3FNFA 2FHSA 2JI7A 4Z99A 1TT5A 4N82A 1GPBA 1SUEA 3VR5D 2F1OA 2ODQA 1EDDA 2Y1FA 3IJRA 1CQJB 2CHFA 4YEDA 4V1CI 5E1MA 4ZI7B 1U4OA 1BDIA 3PYLA 3VYWA 3ZDEA 4IJMA 4F4CA 1OYYA 3P2IA 4CQMA 4F9TA 5LWHA 2BGNA 4HUQB 2FSVC 2ZIVB 2IXFA 2KX7A 1GPDG 1G8HA 2SCUA 4DDKA 4RFSA 2FVXA 3V1TC 4BEBA 1YRQA 1JDBB 3PEYA 4ZVNA 1L5OA 1JG2A 5JPIA 5KNDD 2PUVA 3WSVA 3W3AD 5B5SA 1LI4A 2DHCA 3LKBA 4MV0A 2F43A 1VPLA 3VPAA 3D7HA 3RHFA 3QENA 1LPAB 4CMCA 1SHZA 1LWNA 2P9QA 2ZB4A 5A4IS 4AC9A 3C3AA 2ZUDA 1WCIB 5KSPA 2WWWA 4UQPA 4QO8A 4CKYA 2V0GA 2Y0DA 5BY2A 3RVDA 3G9ZA 1QE3A 2CVZA 4WNCA 3PXCX 5IAGA 3CJRA 4J2TA 2WDZA 4C76A 5K8TA 1WCV1 3A9TA 4QOHA 2WJVA 2IE8A 4EY8A 1K6IA 1DKRA 2NZYA 4KJZA 3H2JA 4JYPA 3N8HA 3ZWNA 2WG2A 4WXMA 1NJFA 4LJYA 1VG1A 1E2NA 2GS9A 3X1JA 2NZVG 2QRGA 2O2CA 4AX4A 3IAUA 2QZSA 4TGLA 5EMHA 4HR7A 1THZA 4AJ2A 1RHRA 4BJ3A 5I9TA 5TPWB 1LI5A 4DCNA 1U5BB 4YA6A 3MIIA 5FI1B 2Q2OA 3UHAA 3W9BA 2QU7A 4JS0A 5A05A 1R18A 3PPYA 4IMPA 2EFYA 2G77B 5LM3A 1TJ3A 1FTYA 4C06A 1K8ZB 3KL2A 5HCUA 4JY7A 3ECCA 2DR3A 2V8BA 3SN6A 3TSWA 5EFZA 3LUCA 3CVXA 3E1GA 2JLVA 3QPVA 1E1QD 1EK0A 1OV6A 4CMAA 3ZG6A 4IVNA 1Z5GA 2R6FA 4GOMD 4MCIA 4FGWA 5EQTA 4F7WA 3OFND 3GLIE 4NK4A 5LN1A 2AMFA 3BULA 1KYTA 5I3CA 3IAFA 1UUFA 3KXDA 1I1QB 1ZN8A 1AVTA 3BB4A 3SP1A 1DAGA 4B83A 4DXDA 5A4JA 4EHLA 1RQ2A 4RKYA 2ZSBA 4HQOA 3CR8A 3MJVA 3TS1A 4LF4B 2D0PA 1QHYA 1V7PC 4YHBA 1M1XB 3KQQA 4HZGA 3NZEA 3ZD6A 2WUVA 3TW4A 1I0ZA 1YJAA 4KKXB 1E1CA 3LM8A 1FSFA 1N5RA 1WQ3A 5EJEA 3FYSA 3PGXA 1ECGA 5TF4A 5DGTA 2EX1A 3PC8C 2VQFB 4O29A 1WCXA 1V3VA 5LZ4A 4JSTA 2ZI9A 4JJAA 1B16A 1DEHA 1AKMA 1DEKA 2RCNA 3SK0A 4Q0MA 4PGGA 4Z4QA 3FTCA 4LAFA 2BFEB 2HU7A 4PNPA 2YV2A 3S0JA 3GLIB 4TS9A 1UEIA 4X1KB 2GAOA 3T35A 1C7QA 3P0HA 5HJ7A 5DOVA 3BIXA 1D04A 3E84A 2OXIA 4HQFA 3TQTA 3V8BA 2BHTA 3WI7A 3FOFC 4W5JA 3TLXA 5F52A 3X1DA 5JZ9A 2G9RA 4QDOA 3OQOA 1W9HA 4WLFA 1C1DA 4JBIA 4EY4A 3TDMA 2WJGA 3EC2A 1FP7A 2QVZX 3JAWB 4IVQA 4RHXA 1Y3IA 2H1RA 1BXRB 3F98A 3E48A 3O94A 4ZXFA 1D09A 1U9YA 4CI0B 2AYYA 3BMXA 1SRQA 1XQ6A 4OQDA 3R3ZA 1R9NA 4Q1FA 5KTNA 4U9IS 3SR3A 3RVJA 2GZMA 1FX0B 1EJ2A 1HYEA 2INGX 2O2DA 4JZKA 4UBJA 4E4TA 2IA5A 4G67A 2VHXA 2A6PA 5K7SA 1T8RA 1VLJA 4UHCA 3UIEA 4XVUA 3DXZA 4ZT4A 3HXMA 2EZBA 3VH2A 3LCVB 4DR4B 4PPNA 1XCPA 1X7WB 1ZH2A 2Z8ZA 2NXCA 2ZJFA 2IZZA 4RTRA 4GBMA 2NUAB 3P1JA 1UDRA 4PRKA 3NOJA 4M9CA 2B25A 2IXDA 2GETA 5E8JA 4PO8A 2C84A 1CPYA 3FZGA 3FWNA 3KYIB 1XP8A 4EG4A 4EZIA 5JH7B 1ZESA 5FP0A 3CFYA 4TTSA 5F1KA 2QRLA 2DLCX 2ZIWB 2UYCA 4MR7B 3LVQE 1E1DA 2ZULA 3IH5A 3PR1A 3RVRA 4LMRA 4AD8A 1NMZA 2NQ8A 4Z1MD 3JZFA 4J94A 1G6Q1 4IPTA 1U2SA 5KSYA 2GF2A 4M0DA 3KNZA 2RI0A 1GUYA 4ZVQA 1E1KA 4PLTA 4MB2A 3GEDA 3L4EA 1ECCA 1T9HA 1TF2A 2XMDA 3KQUA 1B2LA 4OEHA 4I4LA 5HWSA 4NWIA 1ANKA 4L02A 3MOSA 3PGLA 2HXYA 2F2TA 2CLLB 3NH6A 3RVOA 1KWKA 1C0EA 4RV5A 3NHRA 2ZWAA 1UQRA 3QOYA 3FE2A 3K1JA 3Q3JB 4MA5A 4REQA 1DFIA 1K06A 1NLFA 1E6MA 1V8FA 1JLKA 2C9YA 2JIDA 2R2GA 3L7BA 3MGGA 2LUOA 4FX5A 4L73A 4PCUA 4KV7A 3EPRA 2A0WA 3ADDA 1NMXA 1ZOPA 1EH5A 1KBLA 4DLNA 1X6VA 5BSGA 5HX7A 1F6BA 1U90A 5C8ZA 1NVTA 1BMFD 3TX2A 4B8ZA 4AYWA 2AMLA 5BRAA 4EDHA 4GAEA 4PXAA 5CA0B 2GCGA 4IDFA 1DINA 3QUAA 3CVOA 1HDYA 3AESB 4XCVA 2FTKE 5BMVF 3R3SA 2E1PA 4Y0AA 1FXWF 1NBWA 4O8CA 2AZTA 2DTDA 3U2QA 2GBIA 5G4KA 3CZQA 3A9RA 4FFRA 4J75A 4PIPA 3LF2A 4BJ1A 4CLRA 3UKOA 4GMDA 5TJHA 2G1KA 4ZEOA 5HF8A 4B48A 5L7WA 3K9TA 2J5QA 2VKTA 4GWLA 4PFSA 2ZSUA 3RS3A 4IIJA 3O47A 3HGQA 3PTLA 3PTAA 2HMYB 2L2QA 2XNKA 3VNRA 4DQLA 1NXVA 3BQMB 3BMCA 3FUTA 4JA0A 4IM7A 3BSFA 3S1LA 5IFKA 2OAP1 1WSDA 3CWZA 1GZUA 2J30A 2BH2A 4YTEA 1LK0A 2DCUA 5E7MA 1TRHA 1G8PA 1KNQA 3RIHA 4D9JA 2PRKA 4L95C 1BYUA 4BQPA 4DAEA 5HTOA 4CMEA 1PBTA 1OX6A 4QUDA 1N7JA 1LTQA 2A5JA 4DG9A 3BL5A 2R79A 2Y1GA 3LBNA 3RVBA 1C29B 3T9FA 1T9DA 1JIKA 1GAEO 2X2OA 4G1FA 5LLDA 4BGIA 1Y5IA 4G0NA 1MAUA 1LDYA 1CY4A 2YOFA 4H08A 2WFLB 1H0KA 4PNZA 1UMCA 2VBIA 2WT9A 3E9CA 4RLHA 4TXJA 4TXHA 5AM4A 3T3GA 4ZZ0A 5KB3A 1DEOA 4FU0A 1C9EA 1ZHHA 2SKCA 3DDCA 3DE7X 4XGRA 4MCPA 2ST1A 4HDNA 3GF4A 1DPFA 3JTMA 3W8NA 4M21A 2OCLA 1E60A 2JHCA 1E2QA 3T4UA 3W2HA 2GA8A 2FYTA 1XELA 1ZVJA 2IYRA 1E5XA 2QE6A 3IQEA 2W0SA 3B2EA 3QQPA 4FQ5A 3OHSX 4OO3A 1UWVA 4RY9A 5AJWA 4TKVA 4DR5B 3DAGA 1WBJB 1N36B 4LNHA 1G21A 1RVDA 3U0BA 5BSMA 4Z3KA 4DV7B 3SZOA 3AY0A 3CKMA 4KQMA 2PMKA 1GDHA 4M8LA 3RRMA 1XALA 5JUWA 2JW5A 1BKSB 1G2OA 1NW8A 4EYGA 2NW6A 3BMNB 1IULA 1DKLA 4KXLA 4B7CA 2MHCA 4RIEA 3CZ4A 3ZDQA 2Q1UA 4MWCA 3CRQA 4K6OA 4ND7A 3DFZA 3H9QA 1NT2A 4DBZA 3EZ9A 4P35A 1JKXA 4GOND 1P0IA 2O3UA 3L6CA 4LDAA 1YK1A 1E5DA 4Q34A 1JEQB 4AZWA 4DADA 2RARA 3FYUC 4R0MA 1QIDA 2HLHA 4NIMA 3V42A 2Q3HA 4C5AA 5C34B 5D1NA 5H1YA 3DHYA 4GVPA 1IVYA 3RAGA 4I9GA 3IHLA 2GNAA 4TMWA 1FP4A 2WV9A 2HB6A 3KKOA 5TARA 5JNTA 3Q0IA 4HB4A 3HKBA 1T5IA 3LBAA 1Z6YA 5JVDB 5K8JB 2I99A 3VYRB 4PZDA 2JZNA 3T15A 2FG5A 1IMJA 2DG2A 5BSEA 3KQKA 4N03A 3L04A 4CIXA 2EZTA 5HJ5A 2XB4A 4HQLA 3B53X 4RZ3A 2J5BA 1GRVA 5EZSA 1QRRA 1QJ4A 2RAPA 4QDZA 4YUWA 2C7OA 5DFAA 2PAAA 1LV7A 3KJQA 4F46A 4C8FA 2FLWA 3ZGLA 2Z1DA 2YWGA 3VXKA 4C99A 1SULA 1ISFA 2UXBB 5C4MA 2GWHA 4EENA 3ZX4A 3QV2A 4EY5A 1PDOA 2F55A 4LOHA 3CLSD 4ZCRA 4NVRA 5FCDA 1JH8A 1ENPA 4F56A 3HO8A 4E70A 4FFMA 3DBIA 3ETEA 4TTPA 4CEHB 3JQAD 3H1AA 4FYIA 3FHOA 3ENQA 4L3WA 3JQ8A 4UBKA 4XEHA 1W44A 3STXA 2ICAA 5KYXA 3DUFB 4RVFA 3EZEA 4YP5A 3CT4A 4YAEA 1NY5A 2FE4A 1FBTA 2NU7B 4IY1A 1LBQA 3RSCA 1USIA 1ZNXA 2NPIA 4F8EA 1FXSA 1NVMB 1LRKA 2GN0A 3PDIB 1U1GA 4KQ6A 2H7YA 4O2BF 2PGOA 4UUBA 4C0AC 2CCJA 2BKAA 4TKUA 3WA6A 2Q0HA 3W2GA 1CTQA 4E46A 4FYYA 4EG0A 1JQBA 3OCYA 3WMWA 4H1WA 3FBTA 3IOCA 2XUOA 2R8PA 2ATXA 3AB8A 3V1MA 2GQ0A 3TTUA 3TR6A 2P4EA 2XTZA 3HV2A 3LK7A 5CDFE 3FCSB 4LGMA 1QKJA 1U3UA 1JB9A 4Q47A 4P3KA 3GVIA 4JR2A 4U0JA 1SUAA 4YAKA 4B79A 4ZYTA 4P4SB 4GDMA 3BD8A 4QU9A 3DFFA 2VAMA 3OZ7A 4LHXA 1Z8DA 2P90A 2PN1A 1QO7A 2VYNA 3LJKA 3OQJA 3IBGA 4TLEA 3V6MA 1WIWA 4ZEVA 2RAVA 1DELA