3TLAA

Microcin c7 self immunity protein mccf in the wild type apo state
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
335
structure length
335
Chain Sequence
PLLAAPLAVGDTIGFFSSSAPATVTAKNRFFRGVEFLQRKGFKLVSGKLTGKTDFYRSGTIKERAQEFNELVYNPDITCIMSTIGGDNSNSLLPFLDYDAIIANPKIIIGYSDTTALLAGIYAKTGLITFYGPALIPSFGEHPPLVDITYESFIKILTRKQSGIYTYTLPEKWSDESINWNENKILRPKKLYKNNCAFYGSGKVEGRVIGGNLNTLTGIWGSEWMPEIRNGDILFIEDSRKSIATVERLFSMLKLNRVFDKVSAIILGKHELFDCAGSKRRPYEVLTEVLDGKQIPVLDGFDCSHTHPMLTLPLGVKLAIDFDNKNISITEQYLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of a serine carboxypeptidase adapted for degradation of the protein synthesis antibiotic microcin C7.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords MccF
total genus 115
structure length 335
sequence length 335
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02016 Peptidase_S66 LD-carboxypeptidase N-terminal domain
A PF17676 Peptidase_S66C LD-carboxypeptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Class I glutamine amidotransferase-like 3tlaA01
3.50.30.60 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 LD-carboxypeptidase A C-terminal domain-like 3tlaA02
4INJA 2AUMA 3TLYA 4IIYA 2AUNA 4MI1A 3TLGB 3T5MA 4JVOA 3TYXA 3G23A 3TLZA 5K99A 3TLGA 4IIXA 3GJZA 4H1HA 1ZL0A 4E94A 4E5SA 1ZRSA 3SR3A 5F1YA 3TLCA 5FD8A 4EYSA 3U1BA 5F9MA 4MJXA 5F5XA 3TLAA 3TLEA 3TLBA 5JYBA
chains in the Genus database with same CATH superfamily
2GTPA 2QRGA 4MNTA 5HX7A 3TK1A 1VL2A 4QYWA 3UJPA 1XSEA 2Q1SA 4Z2YA 2PL9A 3WMFA 1P81A 2ZXEA 3OE7A 1SQ0A 1T36B 4XOIA 5JJBA 5JOQA 2JCYA 1NM5C 3I9V1 3PK0A 3P9QA 2GCOB 4B3SB 1C2TA 1R6TA 1TLFA 3IFSA 4EUHA 5JJ5A 2ZUUA 3EHDA 1XLWA 4TT8A 4ADSG 5IT9A 2XQGA 1LV8A 3Q8LA 2WQ6A 2AZDA 3ND6A 1D6JA 1NFRA 2EF1A 2P11A 3KKOA 4GSKA 3TFOA 3L1KA 3RU3A 2IEYA 3UK1A 5TMDA 2IPOA 4CKXA 2C42A 4HOYA 1Q2UA 3L5OA 5BRAA 4M7RA 4J0CA 4IWXA 5LOVB 2I4IA 3EDQA 2D3TA 1LB1B 1XRMA 1CU1A 3DB1A 3JARA 1D0VA 1Y3DE 5JSUA 2E49A 3H05A 1IIRA 1TYEB 3LF2A 2VAVA 1PQWA 4ANFA 1AQNA 3KTOA 1QKKA 1RXEA 2X7HA 1KEKA 4O2AF 5H3LA 1NF2A 4CDJA 2C2OA 3PXUA 4JWTA 4OGFA 4ZVVA 5GOTA 3WWPA 1ACMA 2QPOA 4IVRA 2J9ZB 1RS0A 3WX0A 4B3MB 4WBSA 5F7ZA 1E20A 2V9CA 4RHEA 3WO1A 1TT5A 3TZBA 1X7ZA 1XLTC 1A9YA 5C5CA 2C77A 5JU6A 1DQRA 1E4YA 3EMDA 1P4GA 1I3NA 3EVNA 2FRVA 3Q98A 1C9YA 1QTRA 4KN8A 1QNLA 1XO1A 2H57A 4LHEA 4RJTA 2C5EA 2ZBEA 1GOTA 5GV8A 5AKZA 1ZD3A 4GE3A 4QUAA 2SICE 3EEOA 1KI7A 5B12A 3UJ6A 5KOIA 2P2CA 3MTAA 3F97A 4FS8A 3ZNNA 5DASA 4DTIA 5JXGA 5DYTA 1NQTA 1QPZA 4Q24A 4ZQIA 5GVSA 3MGKA 2DBRA 2EQBA 4QICA 5IBPA 2Y67A 3GUYA 4C4PA 2H00A 3B48A 3IAAA 4AFNA 1GV1A 1ZU4A 4CYMA 3PX7A 1KK0A 1LQ2A 3BSSA 3EF0A 3I6ZA 1X94A 3IOYA 4G65A 4LXIA 5HBRA 3RWMB 3WHIA 5AUOB 1TEXA 1ISJA 4ZEMA 3TNFA 4ENUA 3SYTA 1JEEA 5CVVA 4XEUA 2ZEJA 3HXOA 3SWWA 4WNIA 1U99A 1GCOA 1PJAA 3RT7A 4R98A 5E6UB 4PGMA 3TRIA 3WHLA 4ZXFA 4K6OA 4I6JA 2PKCA 2PGDA 4KXVA 2WSLA 1AKYA 3A1WA 3OT4A 4N0DA 5JH7F 3WZ2A 5A2GA 4MP8A 3BCRA 4E3ZA 1FYVA 3NC0C 4TTSA 3Q8XB 3ZXUB 1Z4JA 3TW8B 2JLWA 4AJHA 2XMZA 5IF3A 1J22A 2JA2A 3YASA 1KAOA 5B4TA 2W2PA 4MUIA 1TVEA 2HPAA 3FKQA 4LW8A 5CITA 5HWSA 1YRHA 4TMTA 5BOSB 4RV9A 3K6JA 1Y37A 3M33A 3K6KA 4WPGA 3MELA 3L7IA 3LP6A 1U8CB 3GG9A 3KLMX 2PKXA 2IPMA 2C4KA 3H8JA 3MGBA 3P96A 3T0IA 1MH1A 2BRUC 1NKVA 1O6FA 4PS1A 1YAHA 2IPAB 5A6SA 5L3QA 1TYBE 4B7AA 1QIFA 2WF8A 1WXFA 1Y42X 3BGWA 3LLVA 4LDNA 1OZGA 2FSVA 4JR0A 4S0XA 4AF6A 4F96A 2JS7A 5KNDA 1OWPA 5BUCA 1QGAA 3C3WA 3PD0A 2QE7D 3OECA 2R65A 5KWVA 5KMGA 5HKBA 1E5QA 1WNFA 2QQEA 4ZYZA 5FBRB 1GNSA 1RI3A 4F5ZA 2NG1A 4ALNA 3TQOA 1YUBA 2BW0A 3KWMA 4XVQA 3S2ZA 3SQXA 1T26A 4C88A 2PGAA 1TMOA 3Q72A 1KE2A 3H13A 1APBA 2AOWA 2WJWA 1YZ3A 1EHIA 1BH6A 2EHJA 3QU5A 4IGAA 4IXMA 4ZVPA 4DLZA 3MMZA 2Y1CA 1RFLA 4NOLA 4UUMA 1R3DA 4Q3CA 1EQUA 3V46A 4P22A 4BHTA 1P29A 2AFIB 5KOJB 4FEYA 1FTQA 5CAEA 2HIAA 5G4LA 3PQCA 2Z1DA 4PCUA 3PC6A 4PG7A 2OBFA 1XTVA 1MD9A 3IKTA 3MINB 4D4KA 4RFSA 1XA4A 4BZPA 3CGGA 1XQXA 2B0JA 2R1VB 1FK8A 1LEHA 4ZQGA 3H2KA 3Q8WA 4UNQA 2BGJA 2K87A 2C61A 2Z08A 1ECLA 3KOOA 4UNIA 3OMWA 1R4ZA 4ALJA 4RKEA 2FTKE 2JLQA 3C5HA 4K1LA 2PDAA 4JX9A 4BQEA 3K9CA 1KY4A 5EZ5A 4Q3OA 2NQ2C 5CA1F 1SEVA 3E05A 3QXHA 1ZN9A 1O96A 2QG6A 3D1LA 4LSWA 4IGKA 1N6OA 2Z2XA 1XVTA 4M9CA 4OBEA 5HYVA 3AL0C 1IBRA 2N1BA 3RSZA 4OH1A 5MGNA 2X15A 4KACA 1AHIA 3LO5A 5DGDA 3IURA 2B3TA 2HRQA 1EXMA 2UUPA 2W58A 3E4DA 3QVVA 4G0OA 1HM5A 2XCQA 1E3SA 3OEHD 4IJKA 4BNDA 4IJWA 4FFBB 4BFZA 2D1RA 1YZQA 2YWEA 2R4TA 1N6HA 3HU2A 4MYTA 2E55A 4HXEB 3DT6A 3WFIA 2MCFA 5THXA 2V6MA 1ZOPA 3HABA 4KDFA 4V0LA 5E95A 2EQ5A 3GXOA 1PEDA 4DLTA 5B1YA 3OHMA 2OILA 2UVPB 1YGPA 3QE4A 3V00A 4Q4HA 2H2FA 3GRUA 4FZJA 4OI0A 1ULHA 1IXKA 4UMFA 4B85A 5ECYA 5LXTB 1L5LA 4F1WA 3PUVA 4M1EA 5J9FA 4U9HS 4B6OA 1J2JA 3L7AA 1YRBA 4YROA 5FFNA 4ZGBA 5AW3A 1NVFA 2ORYA 4JLUA 4B45A 3WI7A 3D3QA 1M8JA 4D9IA 4F56A 4B4OA 3WICA 3BWMA 1DAPA 1LC0A 3N0VA 3KLBA 3V2IA 2BEUA 3JQFC 4NYIQ 4U5XA 4NGMA 2W93A 5FOXA 4BDTA 2JGEA 4GWKA 4Z0HO 4X7PA 1PD1A 1Q19A 5LMUB 3R3SA 4UHFA 1GPBA 3CW8X 5IUKC 4GC9A 1TU3A 4LRWA 3AOEA 3REQB 5ED4A 1Z5ZA 3UBTA 1JFSA 1LK0A 3NFRA 4GE0A 4MCSA 3NEAA 1MB2A 4Y1EA 5ICGA 3IR5A 3CRRA 3DO8A 3KC2A 2OZVA 2D62A 2X2EA 1Z15A 2ZGVA 1GRCA 5EC8A 3LLUA 4QGAA 5L4NA 2E28A 1STOA 1EIZA 4P3KA 1OCEA 2QZ9A 2E4UA 2BE9A 4WFKA 2E3JA 1P3Y1 4NI5A 3WOHA 3V6LA 4BBPA 4F5DA 1FNCA 3M2TA 1ODLA 2ZUFA 4PSAA 2XSZD 2OV6A 1SBNE 3PGMA 1TJPB 3VR4D 4LTDA 5ECDA 3PGJA 2HJ9A 4WKPA 3X1WA 4Q4AA 2JFBA 1J00A 2JD2A 4ECEA 1LK5A 2RAFA 2XWBF 7MDHA 1E1RA 2REOA 3P52A 4R9UC 3NQ41 4HNTA 3GD7A 4K86A 5IYZB 1H2BA 1UFOA 1X15A 2VT3A 1W4ZA 3MGGA 1K1EA 1TA0A 1TJ5A 1XL0A 2I67A 3HYNA 4N40A 4Z86A 1TVMA 4J49A 1VKOA 2V8OA 4ARBA 5BSGA 2JBAB 3C4JA 3T5TA 3VZSA 4OATA 4HMOA 4KYTA 4D3FA 3BMNA 1CHDA 5FLYA 5SY9A 5D6OA 4YCSA 2NYVA 3DWFA 4DMGA 1AC5A 1UM8A 5IG2A 1XZQA 2YWJA 3GT4A 1KO8A 3EGEA 4UHHA 4CQMB 3DNPA 5KYKA 4HYEA 3G02A 2AG6A 1XTIA 4R7TA 2P69A 2H1CA 4UVDA 3AU9A 13PKA 4E7OA 3A6DA 4FXOA 4FJ1A 4D43A 2VJOA 1Y1LA 2OCYC 3VH3A 2C57A 3ZE1B 2MYPA 1EWKA 1ZN7A 1KO4A 1K5GA 3G17A 2HF8A 3RS9A 4LFBB 2F7SA 1A5AB 2ONZA 4AN4A 5BQ3A 2J5RA 4RHXA 4XXHA 2COUA 3RHSA 3U48A 3U19A 4F2HA 3CWQA 4XIFA 1RPTA 5GY7A 2YXBA 3AR5A 3GMTA 3HKBA 4PEVA 3NNDA 4D0NA 4BVKA 5LDDC 4QLOA 4OAQA 2PA3A 4L8FA 3AERA 4ZMRA 4FZ5A 3W06A 2P2LA 5CLLA 3RRZA 4BKPA 2Z5GA 4ZARA 3I9KA 3D4OA 5D3MB 5FI0B 4DC9A 3I2FA 2GD0A 5BN4B 4BNNA 2IZ0A 4EW3A 5FBVB 4MRMA 2WI8A 2EC5A 3CSSA 4E5UA 2FW8A 2HSZA 3M5PA 1JFVA 5CDTA 3D8BA 3KL2A 4QKQA 3BE8A 1NBME 2B8TA 2OL4A 3MJHA 5SYMA 4IVPA 1U02A 3OD1A 1P0IA 1VLHA 2FEXA 1A71A 1TA4A 2I2BA 3DCNA 4KI0A 4IO0A 3JQAB 3RUIA 3KEFA 1ZM2A 1KFCB 3H9BA 3AM5A 4O4LB 1MXFA 3AEYA 5GQSA 4ZYUA 4IRUB 4BRZA 1NL3A 1TKBA 2WE7A 4OMUA 1EWYA 2GZRA 1SK9A 3AKEA 3LNCA 1FE8A 4ZMSA 5CK5A 3E22A 4QFBA 1XN4A 2XGGA 3PITA 4MV0A 3BWVA 3M4JA 4YAWA 2ZRNA 4QBGB 2OV3A 4DEXA 5ALKA 5EGNA 3NHFA 1DRWA 1MO5A 4WLNA 5CVEA 2OCKA 2RK4A 5JUWA 2XLCA 3HHPA 4HUQB 3R3JA 1L7VC 3EVBA 1PJLA 3CWCA 3UMSA 3GUUA 1X7WA 3QA9A 4QPJC 1TZKA 3CJQA 1YV9A 3CN9A 5TQ2B 3ZUPA 4GICA 1YRWA 3T9BA 5E0OA 1JSZA 1VKZA 1RQPA 1WSBA 2X0KA 3KEGA 4U2FA 2GYUA 2GH1A 2XYRA 1T9GR 4RZIA 3HCAA 4YMIA 4ZQCB 3VBCA 1G8JA 2V0NA 4M8NE 4OHXA 5JAMA 3ZC3A 2ODEA 4R1NA 1OB5A 1U2EA 1MC8A 2PZAA 3DEHA 4GI1A 2I62A 1JEAA 4Y9TA 1ND5A 1LDYA 3ROEA 1VZ2A 1I3KA 5E8JA 4OD0A 3M1YA 1IN8A 3GLVA 1YFJA 3KQKA 3ASZA 5CAEB 2PR2A 1SC4A 3U1BA 3TCNA 2QZZA 4D3DA 2J08A 2GZDA 3HV0A 3MCAA 4OAOA 3ZE6A 4BFVA 3E82A 1VHJA 3WGUA 3M1LA 1NKTA 4ABTA 2Z6UA 3B3GA 3OE1A 1N5IA 2JJ2D 5M5BA 1P61B 1U11A 4G0NA 4GMGA 2V9PA 5E6SA 1YWGO 2IUTA 3LWDA 1XKXA 3ANTA 3MN1A 4W1PA 3WNBA 3DOOA 1R6AA 3HACA 2P5UA 4XB2A 3UYLA 2LD4A 3HCNA 5FKJA 4FYIA 1CJVC 3HXKA 1L8XA 1Z6ZA 5DHFA 1L5ZA 4BEVA 1NF9A 1OFUX 1RWWA 3L9XA 1AK9A 4ZHSA 2JD0A 3I72A 3GJZA 3CT4A 2ERCA 1VBGA 3PPIA 4R7ZA 1SVOA 3BZUA 3CKYA 3ZGZA 4DNQA 4G5GA 1I10A 3TLMA 3CNQS 4N18A 3KYDB 5FLXA 1THTA 4IV8A 1E59A 3DXYA 4L95C 4DA9A 5F5XA 4QDJA 1NYTA 1FSFA 3VOAA 1BKSB 4MA0A 2XYVA 3G8BA 1JKXA 4BO4A 1P2DA 2CJYA 4GR9A 5JVLA 4AZ3A 2IUFA 4C7JA 3WP0A 2WM2A 4JWKA 1OKKA 1TJ4A 1JA9A 1LZLA 1M66A 2ES4A 3H0CA 4HXGA 3HK2A 1F8FA 1E3DA 3AHFA 1R6BX 3ZN2A 4ESHA 3C74A 5A71A 4ZAYA 5T4FA 3LHKA 4KHPB 4L9WA 2LV8A 1QHHA 2REQA 2OGUA 1IHXA 3NKLA 4XGQA 2BFPA 3RVLA 4PZPA 1XZPA 1EQ2A 5DNAA 3LXRA 5BWMA 5I7VA 3MCWA 3HSYA 5LBUA 1K6XA 5GINE 4BMDA 1IPFA 4RVGA 5BR8B 4TS1A 1JL3A 3H2HA 3E9NA 2AN1A 2BHTA 3V1KA 1G20A 4MV6A 3IXQA 5DCWA 2OV2A 5TC4A 2R6HA 1CYEA 1X7YB 1KDRA 1CJSA 3CRNA 2E87A 4YHBA 5EZQA 1N2EA 2D1QA 3JYPA 1AKQA 2FWMX 4HQFA 3U3DA 4EY3A 5HIAA 4WADA 1T8UA 1Q77A 3U9TA 3ZU2A 5CJJA 5JDCA 1Z7BA 3IXLA 1IY1A 3B6EA 3DXFA 3RV3A 5LFAA 3RU7A 3VU1A 5HRCA 3T1YB 3QUTA 1MO6A 2OM6A 4RXMA 4JBXA 3RG8A 2VQDA 2JJMA 1RRFA 3TRHA 2FK7A 4PWZA 2FUNB 4R0VA 1K68A 2V6BA 4Z2AA 5C35A 5MFPA 1XTPA 5CDSA 1GXSB 1S7GA 1RJGA 1Q7EA 2Q2OA 4NBNA 4ENQA 2DEUA 1W48A 1Y6JA 3S9NA 1E3WA 4JNKA 1L4GA 1L5OA 3RRFA 4DV1B 4EB8A 1CV2A 4OHMA 4C3ZA 4XWKA 2YVQA 4I99A 5DNYB 3ERCA 4R1QA 3EQ6A 2ZJ4A 4BN4A 4TRRA 1LPSA 4FHZA 3IIKA 4B4DA 1UDBA 3KFXA 2NO5A 5DK4A 1THMA 2HWKA 1WXGA 1OHHD 2DZDA 3B1FA 3QEAZ 1J1UA 4B34A 5ILOA 2JD1A 5HKLA 2WQZA 3RROA 4BGVA 3N8NA 4N5NA 3M4ZA 4N12A 1S1CA 1IZZA 3RW9A 1IXZA 1FP6A 1NXWA 4J76A 2C54A 2FWBA 2WG0A 3ONNA 1OI4A 4OQLA 4YFVA 2HQ1A 4DJJA 4UZSA 1T4GA 3NEPX 1DPFA 1M2GA 4CE6A 5HUJA 4LVCA 4PCLA 4I4CA 3ZWOA 1P9RA 2I0FA 2BEVA 3MOGA 3NOVA 4OKNA 2QVZX 2GK7A 5EG5A 5FDFA 2HWWA 4F8JA 1NZFA 5KYWB 3J81k 1V7QA 2IC5A 3TAHA 4C2UA 4YCAA 3L8MA 5DHSA 3DQQA 5B1EA 2OD7A 2BTEA 1GGJA 3S9LA 4AB1A 4WZ6A 1BXZA 4FD3A 1TM2A 1JR3A 1AA6A 5T4HA 3TQIA 3DVRX 1KETA 4QSHA 5KINB 4TM7A 3T7TA 4CW7A 2YZGA 1H5QA 5F21A 4PO1A 1UCFA 3B6ZA 5IXJA 1GTVA 2H08A 5KI6A 4KO4S 2Z83A 4JENA 3R3UA 4IQ4A 3A0RB 4DIBA 3S0JA 3ICUA 4RPKA 3TR6A 3PFHA 4G4JA 2VSYA 4BBAA 1ZISA 4AURA 3GPCA 5LQJA 1KHTA 3QXSA 5T7BA 1FL9A 1GVHA 4RJKA 2ZT7A 2LKCA 4JUBA 3DQPA 3MRVA 4P7KA 3S6JA 4LKOA 4P4EA 4QYSA 3VGJA 1MA3A 5JWOA 2JPDA 2ZBRA 3B1JA 3GNLA 1GPWB 4NMMA 1XWWA 3OY7A 1YJ8A 1CY1A 3A10A 3I52A 5E6RB 1BEUB 3R5FA 1BDBA 3LQ1A 5H9WA 2WJZB 1JVBA 4MWEA 1CQJB 2OO5A 5DF1A 1MNQA 1O08A 1U8UA 1DO2A 4CCWA 1Y7IA 4DA7A 3DJFA 4YS6A 3TLBA 4ENVA 4CG3A 1XB2A 2CEKA 2DOKA 2QB5A 2VNAA 3ESQA 3JARB 3OEWA 3B9QA 5AP9A 1WMSA 3OO0A 2P27A 1WMDA 4ND2A 1SY7A 4MPJA 5IUJC 1FYWA 4AL4A 3KQLA 1Z2NX 1L0BA 2GKGA 1GZHB 3DTVD 3MFQA 1BGWA 1PSWA 4RZQA 5DBFA 1Q95A 3PRKE 4NYJR 2G88A 4I4TB 4EKGA 2IHNA 1GYPA 2FX3A 3PHGA 1L4NA 4PZYA 4U7GA 2JIZD 5D3QA 1UWKA 1PO7A 2RBGA 3O8DA 3T34A 4DB4A 2I3ZA 3M5DA 3E8MA 1ZJZA 2A58A 3HDGA 2BGKA 3QFCA 4E6PA 4ESOA 3LKDA 1G2OA 3KYCB 3HBJA 3KLPX 1MRZA 1FFXA 3NNSA 1ENZA 4HGZA 3JWIA 3OX2A 4FX5A 1Q0HA 3PZRA 4A2WA 3ZDZB 2V7TA 3ETEA 3OJCA 4KWCA 3F7NA 4JLNA 3ZE2B 5EUMA 3Q3HA 3V9AA 2X0IA 1Z45A 3JRXA 1SHUX 4XJTA 5EP4A 1PFUA 4OHBA 1VLQA 3I0NA 2CBXA 3R0IA 4QOEA 421PA 4ZI7F 4BP1A 4CU5A 3UXHA 3HJFA 2NWQA 2JGLA 4DCNA 3UFXB 4P9NA 1S4QA 2A0WA 4LJ4A 4MLCA 5K01A 5GGYA 2Q6IA 4F71A 3KASA 1EM6A 4RZHA 2QG9A 2B2CA 3O4HA 4XVHA 4YA6A 4KQJA 3GA0A 1TNDA 1E7SA 3LPMA 1Y1PA 2POQX 3GLHE 3MTBA 1PE0A 2W2LA 4IHKA 1XZFA 4KQ2A 3OJ0A 3KT6A 1GUBA 5IABA 3PA6A 2PRIA 5EY5B 3HEBA 4JUDX 3N2KB 5DZSA 1XMPA 3CVVA 2UXCB 3N8KA 3EPJA 3ZJUA 1SRRA 3Q1LA 1HQDA 4ZO6A 3RTBA 2V7PA 2UVPA 3B2QA 4LCJA 1DSSG 4LA4A 4KO8A 4ZD6A 5JAZA 3M83A 1F6BA 1HNNA 2RD2A 2SNIE 2WJ4A 3NYRA 5CA1A 1MX1A 4CN8A 2VZ0A 1SCDA 3LSYA 1ZUHA 2IHBA 3WL5A 4HQLA 4WBNB 5KHLB 4B6FA 4X6XA 1XVLA 4IFIA 2DWUA 3BGDA 1XNHA 3G1TA 4RLSA 2D59A 2OFPA 2O19A 2QM8A 3WAJA 1JQKA 3QFFA 1A5TA 4XYGA 4K8OA 3VVBA 1EE1A 3A0UA 3M70A 3WMXA 3UMFA 3WO0A 4R8LA 5B55A 2G5PA 4RABA 1XJQA 4UNNA 4HNVA 1Q6ZA 2FLVA 1X8LA 2H0RA 1FEZA 5A9RA 1BS9A 5JANA 1T8TA 3IEMA 2W6JD 4A16A 3LXMA 4BFWA 1RWNA 1MV8A 2PTGA 4N65A 2FPWA 3I6IA 1CUYA 4I1UA 3AWDA 5HPYB 2BGRA 1F60A 3V7UA 2R8XA 3ZEAA 1XMSA 2YICA 2IYAA 3K31A 1QP7A 2NYAA 1ZK4A 4FW8A 1QZ3A 2XMDA 2GNOA 3GAFA 2PCNA 4DE5A 1ES9A 1ZRNA 2H51A 4UXHA 2FRDC 2GZHA 3DLTA 3OC0A 2OHVA 4PRLA 1QGZA 4X45A 1I32A 3SMVA 4IINA 1A69A 1N3BA 5F77A 2DJIA 3VKVA 5D6NA 1FSSA 3PRJA 1KJNA 2HV9A 2IV3A 5HVNA 2O8VA 3OZTA 2I55A 2WUGA 4KQCA 3WV5A 9ATCA 1PP4A 4JCCA 4LOLA 5EIEA 2OBLA 2VJMA 4HG2A 3OCYA 3PL1A 2ZSIA 4I3GA 1OLUB 3NCHA 4B2PA 4IUCS 4D8XA 1SM4A 1YS1X 3G9ZA 1F2TA 1CS0B 1UF9A 4DJ5X 3KO8A 2R00A 2JFUA 2XB8A 4OBWA 3F8SA 1Q0QA 1DO0A 1SCUA 4XI9A 4DEVA 4LJ7A 3ONEA 3BMCB 3ZU3A 5DTJA 5I7OA 1ILEA 1CQXA 4YX9A 5GJVC 1W0KD 1IN1A 1UK9A 1DIRA 4ZT4A 4JT9A 2OTCA 4HWRA 4R5MA 3GJ4A 1DQYA 4PAGA 2I4RA 2XKBA 5P21A 3VO9A 4QREA 4ZC8A 3A31A 5TQVA 1F17A 1T9AA 2RH4A 3FUVA 2CD9A 2O7VA 2Q46A 2WVGA 4V0KA 1JIVA 1BROA 4JGBA 4RK4A 3THYA 1T5TA 5IP5A 3KETA 4O33A 2HTEA 3Q15C 3EPPA 4CLRA 2M98A 4QQ8A 1Z0AA 1XCBA 4Z1MA 2OEPA 3TRKA 3QQ5A 1JKFA 1UKEA 3E9QA 4M21A 4B31A 3ZGNA 3NAZA 4EB0A 1IHYA 1JSXA 5D5HA 4YCNA 2IZ5A 5DX8A 3QKTA 4ND7A 4KCGA 1QU2A 4CCAA 2YKGA 3OESA 2B7BA 2JGFA 2R2AA 4D57A 2YHAA 4BV2A 2GBIA 1WCV1 4F8EA 2A3RA 2PO5A 1T0PA 3FH0A 5K03A 1QYWA 3OQPA 2ZB4A 3RK4A 4H1HA 1ZAKA 2FLKA 3JRWA 4MUMA 4CLXA 1GQ2A 3SR3A 1GR1A 2AD1A 1P4HA 3ZU4A 3OI7A 2PUGA 3R4VA 1ZMRA 2IU4A 1GGFA 3JQAD 2P35A 4IXWA 3GLGE 4ZFNA 4GRIA 1X7ZB 1NI4A 4IV0A 4EKNB 4ZDKA 4M87A 3NAGA 2GEDA 5ER6A 3WLIA 3VVLA 4MV7A 3HKCB 1PK9A 1RLOA 4B6PA 2VKQA 5CYOA 2QLMA 3PQ2A 3TQQA 4B5LA 1PGQA 2IKSA 2BM9A 2BBTA 1OOEA 1RYZA 3BD6A 1Z18A 1U0BB 3LX6A 3RFVA 2V6IA 2D5BA 1M6EX 1AG9A 5DM2A 4UBMA 3RYFB 5AVZA 3K0CC 4MJ7A 5I7HA 2MP0A 2WJ3A 1NOKA 1Z4KA 4AMYA 5EMNA 1U1GA 5LP6F 4UBKA 2VP6A 4U39A 1NI4B 1MZVA 4CF3A 4O4LA 3T3PB 3MYYA 3ZYZA 4B8YA 4HAZA 1HT0A 3ADPA 4R81A 3RIMA 4OM8A 1R5NA 4NBSA 2XA9A 4QUDA 1CRLA 4MP6A 4BE7B 2BUCA 1BHJA 1O0SA 2BGIA 4EBBA 2ORIA 1WR8A 2YX1A 2GF9A 3C8MA 1ZWKA 1M2EA 2A33A 4YTEA 4S1NA 5U1PA 2CNOA 4KLAA 3UTCA 4HK4A 1NUQA 4S12A 3VR6D 3LAWA 3GA5A 4CKCB 3R7WA 3SZOA 5FTJA 1NTRA 4FWBA 2QMOA 1VBHA 2R79A 5FUYA 2ZIFA 4QODA 5DGXA 2YXNA 4LJSA 1BX0A 2FWNA 4QA9A 4S04A 2GBLC 3MJDA 4GNKA 1JU9A 3T9DA 5JQWA 8MHTA 5CT9A 2F90A 4GXNA 2PYDA 3M82A 3AUKA 1JPNA 3QVGA 1JNYA 2HCFA 2OZLB 2QLNA 3G2JA 3PC4A 3PQ5A 4HMQA 2DBVO 2ZIXA 2WUFA 3CX4A 3IIIA 4L02A 2TYSB 1PR4A 3DUFA 4PYNA 3BXPA 4IDBA 1GFSA 4ES6A 2ZRBA 4WXYB 3RJ9A 2BKEA 1B00A 2ASEA 3FTPA 5JPCA 3FPJA 3D3KA 4HP8A 3V4VB 1PW5A 3E3OA 1DUVG 2YN0A 3M34A 4I5FA 4M0UA 1S8OA 3F46A 3HYTA 4G4GA 4RD3A 5H3HA 3H2YA 3OZAA 4PPGA 2HSGA 2JLAA 2EJBA 4IDQA 4US1R 5ES4B 1T0JB 2GHIA 2XY4A 5LUAA 1FFSA 1Z6YA 3GYGA 3OJLA 1KMIY 2PS1A 1BKYA 3KNZA 5AW2A 4PGGA 1B8PA 3OQHA 1GGEA 2BTQA 3HBFA 4M46A 4RF2A 3DCYA 1LUAA 4L5BA 2SKDA 4B6EA 2XTNA 2AOVA 2W8BA 5K99A 1M76A 2FFRA 3KVNA 4TLCA 4WOCA 1ABEA 1VLJA 2RH8A 5FF9A 3SDSA 2XX3A 1Z8NA 2P79A 3AR8A 4UFNA 2WABA 4TROA 2IV7A 3OEED 1R4MB 1A1SA 1V4NA 1YI1A 3AEKB 3DKKA 3OKFA 3J80A 2ZULA 3O9MA 4MIKA 2IKQA 3VR4H 4TWZA 4CNBA 1N1GA 5B37A 3SJ7A 3UAGA 1I33A 1FLAA 3HG7A 1ISRA 4ON9A 4PC1A 2PHZA 4U7FA 5ILGA 1K2WA 3TNLA 3NP9A 3ICCA 4HAOA 4DQKA 4ZIRB 4FHEA 1TMKA 2IY8A 3DULA 1JG4A 3PLRA 1C7ZA 3PTLA 1RWVA 2XDYA 2IXBA 3OQOA 3OG9A 2JFVA 4PONA 2E1PA 3CX6A 4TSRA 1I4WA 2Z56A 3QVKA 1QXSA 1ORIA 2QP9X 3B5EA 3MRXA 4EYOA 2DB3A 2FEMA 2WA2A 2K7ZA 3AIKA 3DVLA 4RQAA 4FM9A 4E2XA 1A50B 1CULC 1O97D 4D82A 4BB6A 4UHKA 1SUEA 5CW2A 3TPCA 5JNRA 4RVCA 2GAAA 2HY7A 3ZE9A 5LKAA 1A9OA 1XEAA 4QDZA 5CBKA 5EJFA 2F43B 3A6HA 4CLOA 2HYDA 1A7KA 1XVUA 4EVSA 4Q4CA 1BEZA 5ICMA 1GGKA 4RFVA 2NYRA 1VSTA 1SB8A 4A0RA 2F62A 1OZ0A 4BQPA 5KQPA 1UODA 1SXJE 4W1QA 2R47A 3DL2A 3SJGA 1FP2A 2WJ6A 2WWGA 3UT5A 5F76A 4KIJA 2K5UA 4RV4A 3RSCA 2WMNB 4ZJYA 3DDOA 3FIUA 2X22A 3HU3A 4LGYA 3RI3A 4DWVA 2JH9A 4P7FA 4ZI7B 1LK7A 1BOFA 2FUEA 1E0DA 1L4EA 2XUAA 2XI4A 3DBOB 5BORA 3LECA 3S1AA 1YD7A 3I9JA 3QQPA 4MVJG 3G68A 1CR2A 4OHUA 4X6UA 4RWEA 1FZTA 4DA6A 1OI7A 2IHYA 3WQBA 2EKZA 3NMUF 2QW0X 2Z1NA 3EMKA 3RYIB 3AKCA 4HZGA 1Z4IA 3TSCA 3EPLA 1QPBA 3ANXA 3REGA 3K2EA 1NSFA 2PL3A 3ESZA 3FOZA 1LW6E 2LKDA 4FT4A 3WDSA 4XUGB 2HMUA 1NXXA 3FNRA 3JQ8B 4OQPA 3KKLA 1K27A 1P39A 3OOJA 5TMEA 2WSIA 3C41J 1Y6RA 5FXMA 3EB9A 3UHAA 4ALKA 4TSFA 4A6DA 1L7PA 4Q7LA 3OJWA 5B2EA 1MRSA 4EFMA 5KNDH 4LJAA 4NK4A 2W2KA 3BWEA 1TLLA 1QPGA 3D2AA 3LT2A 3X2FA 3H3XA 1OBHA 4MS1A 2WPDD 3CH5A 2P2NA 1DI0A 1JPVA 4JLKA 1DG3A 4BMVA 4CMBA 4M8LA 5CCXA 1KAHA 1UMKA 2SBTA 4TXHA 1H9CA 1R88A 4MW7A 3TIFA 5B58C 5F9FA 4MO2A 5FWAA 4PZ9A 2VIIA 1MB4A 2C1XA 2BMDA 2ISSD 2YWDA 3SJZA 3WHPA 4HYQA 3DE0X 5JATA 5HCIA 5BN5A 4ZRMA 2WWYA 4AX4A 4WV3A 3GRRA 3JVVA 5IDWA 1EWTA 4I5GA 1J8VA 4ILKA 4KUHA 1OYOA 1E1RD 2Z4SA 4OHYA 3BTUA 3JZAA 1F51E 4IF4A 4B9EA 1CZLA 3KCNA 2ZYWX 2VF2A 3CE9A 4Q9JA 5AHXA 4BO1A 3IBFA 1L6RA 3F2IA 2IYNA 2QTNA 2ZYUX 1UMDB 3L7OA 4KB5A 2G71A 4AP6A 5HOEA 2AI2A 1E1MA 2WU0A 4P82A 3U2QA 1XNRB 2A9OA 1WVMA 1U7WA 5E38A 3RDPA 3WNDA 2PUFA 1IXRC 4KFRA 1G8SA 4G6ZA 2CK3D 1Z2CA 1HKHA 1QLJA 1LFAA 3E35A 4PQEA 2ECPA 5ITVA 2FW0A 3PE4A 1RC1A 5T67A 2WD9A 4UM8B 3DVAB 3QIVA 1CZNA 4BNWA 2CXNA 4B48A 1YR6A 1PN3A 2ODTX 1FFYA 3DOEA 3IA7A 2VJMB 4HZIA 4L3VA 5CG2A 2GEUA 3QOXA 4J4HA 4OI4A 4F6RA 4DA8A 1D6MA 3BYZA 1MG5A 1VPWA 2QBYB 1OBVA 2FN7A 1QRUA 3A4VA 2BFFA 3NWEA 3AL2A 1SXGA 4YIKA 1AXRA 1IDN1 4TTQA 4MGHA 5SICE 4U0KA 5BQFA 1H2ZA 1QUEA 1WDLA 5LP6C 3BXFA 2BEJA 1VE7A 2SHKA 2C9MA 3ADCA 2R8OA 3I5YA 5KJFA 2V6JA 1PL6A 3HRHA 4RL6A 2WHPA 4JIGA 4PINA 1I30A 2ZBUA 3GJQA 3BD8A 5EFOA 5LPNA 2JFHA 4W5HA 4HLQB 3TSZA 3WGLA 3THRA 4CQLA 3NKFA 2FUG1 1GITA 2QHXA 4H17A 3W34A 4M6WB 4DCPA 4B44A 2GX6A 3V2UA 4LF9B 3I9FA 5DSTA 4L0DA 4KPUA 3P97A 3MTQA 3V4OA 3E81A 2G17A 4Q16A 3UOWA 4JVSB 3EOZA 4DWWA 2OAEA 4PNZA 3RASA 1CZKA 3VR1A 3LCMA 3UJ8A 4BX9A 4NU0A 4GXQA 1N2ZA 2XOKD 3SX0A 2R4QA 4D6PA 2Z4RA 2EOAA 2E21A 1KAEA 2FV8A 2KMLA 2V55B 2YYSA 3I6YA 2NLOA 3AR4A 3MQ4A 3N58A 4KUEA 4Y6LA 2HHHB 3KBOA 3V4LA 2WLSA 4G56A 1M9NA 4FS3A 3FFWA 4RY9A 3A6PC 1VI4A 4C99A 3D7SA 1KYIA 2JVKA 2QDKA 4MWSA 4YGXB 4A26A 5T41A 1HBJA 2PS3A 5BT9A 1ZSVA 4H7DA 2G9ZA 1WE2A 2YZMA 4IUBS 3IOCA 4B2LA 2XZPA 4G8BA 2ZSEA 3STWA 3L6EA 1EXDA 1GZUA 3D64A 4RMIA 3CKKA 2CMDA 3SVZA 5C18A 1TM7E 2CXXA 2NU6B 1JA1A 1NXOA 1SXJA 3KR2A 4CG1A 2WJJA 5C32A 5FLEX 1WZ2A 2ZPTX 3CRW1 1SKUA 1N5MA 3T5BA 3UJ9A 5L40A 5CCBA 3ZKWB 1H4QA 2VYQA 2CE7A 2PJDA 4ZZIA 4DQXA 4OJNA 4DUPA 2B78A 4DGQA 1V8BA 1XEXB 1UL1X 1B0ZA 2D7JA 4KTTE 4N7JA 2WWVD 4DIKA 4A0HA 5J2TA 1M67A 4WLFA 2GFQA 2PX3A 4KYUA 5B57C 3L7YA 2Z2IA 2ZYVX 3PNVA 3RH0A 2DUMA 2GZ3A 4AJ2A 4IR7A 4B74A 4AMGA 2ILVA 1W4RA 2IEGA 2XUFA 4DJDC 4ZOBA 2K2WA 3P2YA 2JGJA 1MKYA 2Z0MA 1MJGM 1N2CB 2R7NA 3TMKA 3LZCA 5I9LA 1GRNA 3ENZA 4YREA 4N3GA 1DIGA 5DYNA 3SZLA 3TLYA 4G0UA 4ZO7A 1GU0A 2L82A 2IPLA 4QEZA 3HP4A 1Z88A 3Q7SA 4ND1A 4W4TA 1DBPA 3HR4A 4WUVA 4D81A 3T1OA 2D13A 1M2VA 5SZHB 4QUBA 3WYDA 3EE6A 1A96A 1QG6A 2DFLA 5ELLA 1K4YA 5AVVA 1VLLA 2J31A 3VAZA 5BUZA 4B75A 1WF3A 2QMQA 4BV3A 5HS4A 2IZ1A 1OFGA 3U3XA 2G1JA 3O95A 4OQXA 4M55A 5F7JA 4G5YA 1XMOB 3R6WA 1KSHA 1VLVA 2FDCA 4DMFA 4YGYA 1JJFA 1NJ2A 1S89A 3COVA 3G9UA 3L8FA 4M89A 4BMSA 4BEWA 4LCBA 4P3YA 5CFPA 3LWNA 2J3KA 3IEXA 4CBVA 1AU9A 1CS4C 3E23A 3WTCA 1UXOA 1WZNA 5A3VA 4DDHA 4ETNA 1N25A 4PLCA 2F9FA 3G23A 3JVEA 1PR2A 1Y3FE 3K1AA 4M9ZA 4Q7MB 1UXIA 3IIEA 4QAJA 1I2MA 4RD1A 5IKPA 1FUUA 1ODIA 4UXJA 4UNPA 1Y4AE 3KYDA 1AO0A 4PZZA 3DLHA 4I81A 1MUUA 2WYIA 3B60A 1W93A 1M5RA 1HE4A 1ZJ6A 2C8JA 2RHOA 4PZEA 1NDQA 2Q3MA 4N7MA 5CYPA 1EEXB 3BKWA 4ZU3A 2ZRFA 3OO1A 4NKRA 4OK3A 3OEEA 1W44A 2EX0A 2IF0A 2YXDA 1P73A 2IYYA 1DEXA 1Q7RA 3GJ5A 4REQB 1YBVA 4WW0A 4Q34A 5K8LA 4ZEXA 1PHPA 4YYEA 2HMAA 4LZJA 4IYJA 5HFNA 2WIGA 1LBHA 3JYOA 4UARA 1FFHA 5IAOA 4I50A 3ONFA 4MEBA 2QRNA 1JIJA 2GARA 2G28A 3A9TA 3F78A 3IJPA 3UG6A 3JWJA 1K6JA 5D00A 2M1XA 1LLQA 1E66A 1NTOA 2OQRA 2KE5A 2I71A 2GAFA 4ZO8A 5E4JA 2Q1UA 3VDXA 3W3AD 4AG6A 3GROA 1IBSA 4CL2A 3JAKA 4QO8A 1XRPA 1NN1A 2PT9A 5CTJA 5BQOA 2JJ1A 2ZTLA 4JROA 4UHEA 5M7EA 3TGPA 1SXJC 2WTAA 3I4FA 4MS1B 2PN1A 4IGEA 1DCKA 2GEVA 4FSHA 4JUAA 5E1OA 6YASA 4GMFA 1ZVVA 1B3BA 3R74A 3KEOA 1TDJA 1QH1A 1IWBB 4M22A 3EXEA 5JZ9A 4CR7A 4R2XA 3GY0A 2C2GA 2R85A 2ZS9A 4NCJA 4WACA 2H4JA 3UO8B 1P4JA 4CQMD 1P4RA 1TT5B 2FG7C 3DE5X 4AX8A 7REQB 4H7FA 4LX8A 4JYAB 4JBYA 3EUAA 1NXTA 4L4XA 3G0GA 3D2CA 1HSOA 2FQYA 2ZJZA 4FGJA 3N0WA 5FULA 2FR0A 1NXSA 3QUSA 1PLJA 5DNWA 1E3EA 1ODJA 1X1QA 3ZJYA 4LBZA 2R6GA 1YHNA 4OQMA 3EGXA 2P9FA 2ACEA 1DVRA 1Y81A 1Y5IA 3ED1A 5ER9A 4HVAA 2VUTA 2XR1A 1Y0BA 1IOZA 4M7OA 4UHDA 4XVCA 1YCFA 4LC9A 3I1IA 4KVAA 4PXSA 3N7TA 1G7TA 4KQFA 3GJRA 1X1EA 4EG1A 5HXAA 4YUZA 5CYGA 1Q1ZA 3PXCX 2WHRA 3H8SA 4OBXA 4Q1DA 1L8QA 3PQ4A 3GMDA 1TIBA 1CT9A 1DMRA 1KHHA 1LPOA 2H8GA 2R97A 3N8IA 3O4RA 4EHHA 3L7MA 4AS3A 2Q5CA 1ML4A 1D2CA 4AY2A 4XKJA 3R9IA 2O23A 4P7GA 4WWHA 4A1OA 3CN7A 3HA3A 3LH5A 3OM9A 2C04A 4HDQB 4B3XA 4OSPA 1NN0A 1G4UR 2GILA 3FTCA 3E6AA 3I92A 3BE6A 3OCCA 3PEUA 4KYIB 4R69A 1XZ8A 4E13A 3BXMA 1NOIA 2AIRA 1LNSA 2ZSJA 1T2FA 1FC0A 4FGKA 3W9SA 3AI7A 3SQOA 4JODA 5BXQC 2FN4A 5B3KA 2VF5X 5K8JB 2BEVB 2WMOB 5H02A 1L4UA 4CKCA 1Q44A 1M0WA 1USUA 3OAAD 1PWYE 1ZOLA 1I6WA 2VPWA 3FRIA 3PFFA 2DPYA 2EIHA 3E5NA 2MU1A 2RHTA 4NSNA 4MK4A 5F51A 5GJCA 1KH1A 3DVSX 4NYMQ 4HYTA 1Q0SA 1QH8A 4P53A 5IC5A 5CA0B 2XCSB 3OQ6A 3CF4A 5DH9A 1Z7YA 3WLLA 4BO0A 4C0SA 4QTZA 1EXWA 1OYVA 4E5DA 1J0EA 4LDPA 1CB7A 3V4FA 1Z6AA 2XIQA 3WLEA 2PZFA 4Y1FA 4FFSA 1ZR4A 2AN5A 2JKYA 4RY2A 1AGRA 1P7ZA 3JQDA 4H60A 3SSMA 4NNOA 1VI2A 1YU9A 1NY5A 4KAFA 1BDMA 3TQHA 3PDUA 5IUNC 2XE7A 2O20A 2QL9A 3AXSA 2CV0A 4L7VA 1DAEA 3VOTA 4RULA 1KYXA 1P60A 3AGQA 1Q7TA 3EXFA 1HNZB 4MVJA 3QF7A 4GI3A 2P41A 1PWHA 3WGQA 1ISIA 1OPRA 4EB6A 4EKYA 3L93A 1QZZA 4YWHA 2B98A 2FR8C 4ZXPA 1GPMA 4NGQA 4NX2A 1SCBA 2DX7A 1JDBB 1DFHA 4GHWA 5G4KA 3WDLA 1EP2B 4GYWA 3UMJA 3C48A 1KNXA 4HZUB 5G3ZA 1IN4A 1HLDA 2GN9A 4Z7OB 1F3OA 2YYAA 3VC2A 1XAHA 5BPHA 4Y1RA 2PQ0A 1E6LA 4PPNA 4FDTA 2O0JA 4YBZA 2JLVA 4OKIA 1M2VB 4QGSA 1JG1A 5IB9A 4PNEA 1MT0A 2XOEA 2JHGA 2YN4A 1RQXA 4MS4A 4AP5A 1ZZGA 3TSAA 4HH3C 4J3NA 2FW9A 5AIAA 4UQLA 4NGRA 1ZZEA 3MUOA 4MVYA 3OZRA 2O8EB 3ICEA 2KSQA 1YE5A 2OY0A 2I80A 1LSOA 2Q0XA 2ZWPA 1C3JA 3RC9A 3WGMA 2JEZA 5A4JA 5A03A 3RSHA 3EVAA 4WGFA 2ZR0A 2XF2A 4J90A 2OXEA 4KJXA 1S2IA 3N6VA 3RB8A 3O3NB 3TEMA 1C3EA 2QY6A 4DZZA 4ZYLA 2H6EA 3WJAA 5CD9A 3X1MA 3QPVA 5IHPA 4BCDA 4EY4A 3QZUA 1LTKA 4YYZA 3COJA 2WT8A 1E6WA 2NU9B 3V7NA 3CW2A 3K09C 3KWLA 3DQZA 4NEGA 1L5WA 4GO1A 1VBMA 3TM4A 3H8WA 1A72A 4A73A 2J6BA 5FI3A 5LQCA 3ROPA 2VPXA 3IIBA 3ZHQA 2VR1A 3Q1KA 4F5WA 3DBLB 4QXAA 3RVJA 5JNSA 2FEAA 4YCJA 5C4GB 3EC7A 4MUGA 1H2EA 1UOEA 3O1JC 1CEEA 1U2SA 2FF5A 3E03A 4GH5A 4XWWA 3UCFA 1KVRA 3P4XA 4EA6A 4DAEA 3BRWD 5CDYA 4WK6A 2H5IA 2EJTA 2OHIA 1C0IA 5DHQA 4YN3A 3RIGA 4TJVA 1AGPA 1ZK2A 2QUJA 4I4NA 2QSUA 3D8RA 3DL4A 3KK0A 4Q4HB 1FVXA 1PS8A 1VJCA 3EVDA 4GT1A 2PBFA 3DOHA 1UEXC 2YJGA 3L84A 4UBLA 1DMSA 5DSXA 3F71A 4W9RA 3FOBA 5JO9A 3FZYA 3P9CA 3QX3A 1YTUA 4L50A 1FF9A 1DDGA 2Y71A 3TQRA 4PY2A 5FPQA 5LR6A 3C7CB 4HX2A 3SZGA 1IQRA 1ONPA 1X1RA 2R1UA 2Y1GA 4R5HA 2FLWA 4YK7A 3ELUA 4Z3KA 1OWLA 1SUPA 1XYVA 4DR3B 2A7QA 2P0AA 1AV7A 1HE2A 4WLVA 3DG9A 3FZQA 1SIOA 4GPD1 4CM4B 1RMYA 3C5CA 1KTIA 2O5RA 1J2RA 1FS5A 4N8DA 2CV2A 2O8DA 2H48A 1VJGA 4A23A 2O9JA 4YT5A 4FNOA 1G5PA 3JVUA 3D7NA 5B7NA 3LQFA 3B1KA 3BFJA 4IDHA 2Z30A 1NQAO 1U28C 4CCSA 1DBWA 4DMHA 4G1EB 4EK9A 3HBMA 3R7FA 1XCPA 4N5MA 5F09A 1C9JA 2I3BA 1AQUA 3KOZA 5H68A 1V5IA 2WRZA 1R37A 1CLEA 1CR0A 3LDGA 5HKAA 2QVXX 3H5AA 4N39A 4EPWA 3IAXA 4G1VA 2G0NA 3ND7A 3OIYA 2XVMA 4E4RA 3LMKA 3DC7A 2Z98A 4FIDA 4YQFA 4FOOA 4XUEA 4X93A 3T3MB 2J32A 4MUJA 3T4UA 4IZHA 1E9BA 4Z4GA 3AFGA 1YDWA 3RSFA 5CH8A 4G8DA 1P4SA 5E4TA 3UJCA 1EFRA 4GPIB 3SHOA 4UM9D 4M86A 1CJUC 1GM5A 1R74A 1W30A 3LD9A 2DPLA 3S2IA 2XNDA 2NSDA 3KSAC 1N2GA 2O7SA 1ZXXA 3QLTA 1YHZA 4YDSA 2OA0A 4F12A 4GAEA 3TQSA 3NT4A 3NU1A 5CHEA 2XEJA 1KO7A 3GJ6A 1R27A 2RGNC 3CPEA 1C4XA 1GPNA 3K4HA 3NHWA 4BNTA 1XV5A 2W7TA 5FYQA 4TKVA 2VJLA 1M1YA 3U44A 3IKJA 4AY4A 2XBUA 3CZPA 4ZOLF 5AOAA 3V32A 3BBPA 3IP3A 8OHMA 1FFWA 5CFNA 1Z63A 2YJVA 4C7OA 2B1IA 4M9XA 2JGIA 3A3OA 1H2YA 5B2ZA 1Q6YA 3GJ0A 2QXTA 1YVEI 3PV0A 3TG2A 1UOQA 2OMKA 3TBFA 1L7BA 1HE5A 2GHQA 3EZNA 3FHJA 1PZHA 1KZGB 1VMDA 4RTJA 3OX4A 2IYWA 1KXJA 4CLRB 4YR9A 3CINA 5AQEA 1DCMA 3KE9A 1SBTA 5EEHA 3NHZA 1YR1A 5T3UA 3R6GA 4ZI7A 5BSWA 5J5AA 2QM7A 3O1IC 1XX6A 5JZOA 3MTJA 1XD2B 1UZNA 2RH9B 2KQUA 5G0WA 4JI8B 1KGDA 1VFPA 2Y1LA 3PXAA 2GAIA 3H5OA 4AWBA 2XRZA 1KDYA 2J3IA 3VTAA 2VDNB 3H19A 4UZFA 3NG1A 3Q3JB 1OLSB 2CXRA 3DYBA 4PLTA 4QHYA 4XJSA 1XTQA 2OLEA 3C7AA 5TARA 4AN0A 2I5PO 4B3HA 3OZBA 5L7TA 3FN4A 5LQDA 4KVZA 3HBAA 4UVIA 3QNUA 4I9NA 3TF5A 3KSBC 1GFZA 4N0QA 1VSVA 3GFPA 2EXXA 2B69A 1BXRB 5C8ZA 3W4JA 2B8EA 2H17A 4TLEA 2ENWA 1SHZA 2P9GA 4ZDIA 1AUVA 2YW2A 1R0BA 1SXIA 4RK7A 4UVHA 2O3JA 5JXJA 4K2AA 1WXIA 3DEIA 1U28A 3NP7A 1ZYUA 5K20A 121PA 4E4YA 1MBZA 3ZIAA 4PFKA 2C83A 1AH2A 4LYAA 4ML3A 2XQKA 2IWHA 4D9KA 2G5GX 1GGMA 1OJLA 1MA0A 6ABPA 2BV3A 4X90A 2QQFA 4JMPA 4PQFA 3T95A 4GP7A 3THXA 1CP2A 4P7BA 4AZSA 2YOGA 1I4EB 2Z9CA 2ZKLA 4OJQA 1RCFA 3VYVA 1CJCA 4PV7A 5A5EA 1LBQA 4DNFA 3AYZB 4DPKA 4FMDF 4MPPA 1UM9B 5AYVA 2Q4TA 3ZWCA 1YZTA 4CIBA 3HVUA 3H99A 5J23A 2P6RA 4RTRA 4HDKB 1P2FA 2AI1A 3WKDA 3VTFA 2ZROA 4NCBA 1VE5A 4ZZ2A 2ZTUA 2NU8A 2Z8ZA 1EFRD 5EPEA 4U1RA 2GVZC 3BIFA 4NZPA 3WGVA 1ABBA 4NZYA 3R4CA 4HDRA 4Q00A 4Y2XA 1SIBE 2BCEA 1HT3A 5AKXA 4YCLA 1N5KA 3VU8A 1CRWG 1IBLB 1W581 2LNDA 4X1KA 3LY7A 3ZCQA 1R9MA 3DUFB 1XMQB 4QPCA 3FHLA 5C1BA 2CLEB 1J49A 2JGDB 4ISBA 1H8ED 2X8JA 2BMEA 4Q3BA 3WQSB 3T1TA 4R41A 3A8TA 1JEJA 2EARA 4BLQA 2D4HA 2VXCA 3EIFA 3QGMA 1Z6TA 4N47A 5JARA 4C7MA 1UBMS 5JMOA 4TRNA 4KKVA 1ZC3A 5EJGA 2K6GA 2FETA 1KKLA 4J1SA 1E3LA 4GZMA 4L85A 4HUTA 1AUQA 2DU8A 4L74A 5FBLB 4J7AA 4UFOA 1GUDA 3ROXA 4CKBA 4CV3A 1DBVO 1S96A 1UDXA 2NXEA 3NGXA 3RBUA 4KE9A 2WV7A 2QUHA 4E07A 3KDPA 3COZA 3O8NA 1JR3E 1DG9A 4L8GA 4MDHA 3LM8A 1FXUA 2V7GA 1KEUA 2D0OB 3ETGA 5DCLA 3TOZA 5B4VA 3VJRA 2GXUA 1TO6A 2XMSA 3SE0A 1XJ0A 3N2ZB 3U4GA 5HILA 2BVNA 3TTVA 4EITA 1QHIA 3WB1A 3R76A 4UTOA 5C34B 2HT1A 1RKBA 5DNUA 4D6XA 2CFOA 1Y1TA 3QPAA 2DHCA 4B3TB 3UUWA 1EQAA 3W5JA 5ALHA 1R9GA 4AKEA 1CERA 3HR7A 3P9SA 4H4CA 5GOZA 3SF8A 1ESEA 1P2UA 1AKMA 3ANNA 1KQ3A 3F9CA 4RLQA 3O1LA 2OO7A 2OC4A 5DJ5A 4QTUB 1M6VB 1R5BA 2JJ8A 1R8QA 1XZKA 2YJ4A 6Q21A 2A9JA 3WL3A 3W6PA 2VPYA 3I76A 5LP6B 2AHOA 4TV8F 1FVHA 3M6MD 3S5UA 2AQIA 5JZBA 3W5CA 521PA 5LB2A 2YNMD 3QVTA 5J2UA 1TTQB 5TDHA 3I6SA 3ISTA 5ALWA 3LYUA 1X7YA 2W42A 1A4RA 1C1HA 2FXIA 1I2AA 3K8QA 3LBAA 4Y2UA 1N0HA 5H59A 4CG0A 4KUGA 1U2TA 3G7NA 1YUNA 4ZHQF 2ZU6A 4LEIA 1PNQA 1M5TA 3HCCA 5TGZA 1R64A 3E61A 5CJPA 1WBJB 3L7BA 3RV4A 1I4OA 1N36B 1VPTA 1V8FA 3ITDA 4IDAA 4U8HA 1UJ5A 5CLQA 4BMNA 4LJRA 2AEEA 1UEIA 2J1LA 2HUPA 3QE2A 2MSKA 4TKVB 4OC1A 4WOBA 3PHJA 1QZUA 1EX9A 1N4DA 2EHDA 2JVIA 3EIEA 3E3LA 4OSEA 1S4MA 4RE6A 4B87A 4FW9A 5DOZA 1L4BA 1JJVA 2QX9A 4CR6A 4E5KA 5AIBA 4OMDA 4Y98A 1WHSA 1ZI8A 4YC7A 1J3LA 3HSKA 4OVKA 3AW9A 1K8ZB 4L5IA 4ND3A 3ZOKA 3OOYA 5FBKA 4TQGA 4N6GA 1E2LA 4RH3A 4DUZB 3V1YA 2AE2A 1R00A 3W2HA 3CY6A 4LHXA 1W5TA 2Z5FA 5KTSA 1DAMA 1QLHA 2EKBA 3ZWNA 1Z08A 4XYBA 3S5JA 2C84A 4GBJA 1H85A 5HG0A 3KQNA 4RA6A 3GP5A 4CMHA 1QAOA 4YAJA 2YUIA 1D6NA 1WPQA 2OZKA 4MJLA 3CZAA 4NEQA 1B1AA 1RADA 1Z35A 1W88B 4Q48A 5AVQA 4JJ8A 4RVDA 3BERA 4MVXA 2EFEB 2H3EA 4RENA 4R1OA 2PSHA 1PR0A 3AINA 3HFSA 3LU1A 1Z0IA 1S7CA 2F00A 4I55B 4MUNA 3K0HA 3TLGB 1FPMA 3EZYA 1N6PA 1GNRA 4I4LA 4UOZA 5A9SB 3G2HA 1RPZA 2A1UB 4PNHA 4R8RA 4BMPB 1TUBB 1LY1A 4KSYA 2QTVB 2W6IA 3MBIA 1U2DC 1EGMB 3DMRA 1DC3A 3QOYA 3P0JA 3TI9A 4FX2A 2X6RA 1BW9B 4E08A 2HDHA 3ER9A 3FNIA 3W5DA 4RH1A 1T5BA 2VCHA 2QE7A 4YFYA 1IHUA 3LUHA 1REQB 1G7CA 1IHPA 2ST1A 1JEOA 4PM4A 1QHHB 1E99A 2REQB 3FSJX 2Y9PB 3HB5X 4F4FA 1F48A 1XP5A 3CVOA 4MYRA 2Q3DA 2UV8A 3V9PA 3T4XA 4C6SA 2P6NA 2XGJA 4TXJA 2JZOA 3SYMA 1E6CA 2AUNA 3ESCA 1YUMA 4QPNA 4D9HA 4AUEA 3MUNA 1M0EA 1N9GB 1VIMA 4KR0A 5G2OA 2Q1TA 5FI1B 1Z0FA 2ZU0C 3HLKA 4ACAA 3IDZA 2CVZA 4IIFA 4QHTA 3EJ6A 2Q5IA 2NZWA 2W6NA 4RJLA 3PHCA 4BO3A 5DLEA 4JP3A 2XW6A 4JR1A 2BI7A 5AKHA 5HQJA 3UJHA 4E0BA 4Z1MD 2OCXA 2HR1A 1BJKA 1I1HA 1O6GA 1P75A 2HF2A 4HDKA 1NM5A 1S2GA 2I2WA 4EZIA 3CUEF 4DLWA 5HRUA 3DMGA 2CDNA 1PCXA 3R3VA 3SSAA 3UAXA 4EGSA 1PJTA 4IIEA 1EK6A 3RBXA 3UIEA 3KZVA 1CRPA 1WB6A 3K4IA 1US8B 1H4VB 5M2QA 1DDIA 2EV9A 3CISA 4YO8A 3U7QA 3BXZA 4JS0A 3SYLA 2W8ZA 3BFXA 4BO2A 4UATA 1EZBA 3HLYA 2H4YA 3QXXA 4GPBA 1RZVA 4B81A 3LUCA 1SOMA 4GG1A 4UUNA 4V0OA 2DH5A 1YS9A 2Q8PA 1L5GB 2NVUB 3TUJC 1QYVA 2YL2A 4D3SA 1LS6A 4OHKA 1E2HA 2JI4A 2QI9F 2JGDA 1PI3A 5F9MA 4P4DA 1LNQA 2C2MA 3LCVB 3GWZA 4QUKA 3Q2IA 1OR8A 4PICA 2O7QA 5KOHB 1NUHA 3R9WA 4NE9A 1XZHA 5JAIA 5EE3A 5I9BA 2F8SA 2WUVA 3WE7A 4BWYA 3Q3VA 4IG9A 3DTYA 3VSDA 2RIRA 2QZ4A 1E7YA 1OH7A 4CQNA 2WICA 3KJIA 1T5IA 2HXSA 3AFNA 3D2LA 3IJ5A 3KYCA 5ECWA 2ZBDA 2ENUA 1M1UA 1OE0A 4N49A 3C3YA 1O1YA 2RB5A 4RPHA 4QPZA 2Z2YA 3AB3A 4BJHB 4K6HA 2SCUB 5KYYA 2AN9A 1NDHA 2ISQA 4DA4A 2UYOA 1XC7A 2WV9A 3ISVA 4NCIA 3R75A 1GGVA 3C3CA 1RJFA 4UM9B 2QY9A 3GNTA 5JMWA 3VPSA 4URYR 2ZT6A 3COPA 1JP7A 3S2SA 5J43A 2HMWA 3ONDA 3ZQUA 4RVFA 2ZUSA 4X1OA 2CDAA 2GK6A 3M5WA 5EIBC 1RDFA 2V5UA 3SM9A 3ESRA 5TEWA 4ER5A 2ZWVA 2CJXA 3QW4B 4IEEA 5AUPB 1G8GA 3UHFA 1QQ6A 5ALVA 5A5GA 3R1IA 4OGWA 4OQNA 4NEHB 4OY3A 2HNBA 4OOFA 4A2PA 4FMBB 1ODSA 3AOGA 4D46A 1B7GO 3NX4A 2PX5A 2QGNA 3ZVLA 4V0QA 2X0SA 3IKLA 1ZHOA 4I3FA 1YKGA 1BMFD 2O8FB 4RIHA 3RYTC 1JMVA 2AXQA 4TL7A 2RC5A 3EZ6A 3FHOA 4B1FA 1JX6A 5KNCH 3DMYA 1BCSA 4F11A 4LXTA 4P81A 4DB2A 1J33A 2PX4A 5BURA 1M6YA 1WUHS 2OGWA 2QUKA 3RRBA 2X1LA 2VWPA 2H1FA 1R0KA 3KUKA 1NOJA 3KXLA 3UAWA 4BXOB 4OLAA 5LA6B 1PFGA 1PJCA 2ZUEA 7MHTA 5KYGA 4NBWA 5BO5A 1P1KA 2AFVA 5BWLA 4UHBA 3RS4A 2XZLA 1ZVQA 2BH9A 3QI2A 3TFWA 3GX1A 3IBSA 4GGOA 4RXUA 1CE8B 5CXUA 2V97A 4GOXA 4FVTA 2PMFA 1GPLA 2OD9A 1L4MA 3ZBQA 1WDWB 2E82A 1E2UA 1XOIA 1PGJA 2ZIVB 5SZKB 1DAOA 4DLLA 4AS1A 3N74A 5KYXA 3N7AA 5AHKA 4JKYA 3AH8A 1UWVA 2I4MA 4OK6A 4ZVUA 5AKLA 1HH4A 1TU0A 2EFJA 5GGXA 5REQA 5TQ2A 4C4XA 2C9YA 1S3FA 2NUTB 1MQAA 2XEDA 1HFEL 3QW2A 4L0MA 4BO9A 1YQWA 3OM1A 3VX4A 2NVBA 3K0FB 4JJIA 3AM4A 3U4QA 2GP4A 4DLNA 1SXHA 3ENQA 5KWJA 5F3WB 1VIAA 2G70A 2FWIA 1CUDA 1A5ZA 1ZU5A 4EGCB 5JBNA 4M1SA 4A8PA 4BGUA 5HQTA 2JLUA 1M2JA 3PPYA 1P1IA 3LGXA 1N7JA 3ND5A 4HEA6 1MJNA 4M0MA 4GEGA 4PTLA 1U1CA 1KDVA 3RIEA 4D8WA 2ZM5A 4NAVA 4JZ0A 3MZ0A 4UAGA 2J48A 1JE1A 1RLIA 4FCCA 2JGAA 1R5JA 4S35A 1ZAYA 1WW3A 4EJSA 3MJEA 3ORFA 4C9VA 2FI1A 4RMHA 5FA6A 2PY6A 1PR6A 1WU8A 3ME5A 4R2KA 3MOIA 2JCVA 1XK6A 1N5RA 3IULA 2HQOA 4GL4A 3QVMA 4ASUA 2CMHA 4MDEA 3KOMA 1BE6A 5CG1A 4BJ6A 2BLLA 4HLUC 1KJIA 1WIWA 4JKIA 2BMJA 3JALB 4WFQA 1OKKD 3IAM6 4PZAA 4RD0A 4PG4A 3UGJA 5I45A 3JZDA 4C8FA 1R10A 3OUUA 2RGRA 4C0WA 1GZ4A 1UPXA 2OFOA 5JJIA 2R1VA 1YZKA 1UK8A 2RBEA 2IVFA 1MGOA 2W5UA 2Q4BA 5A7GA 2TRSB 4BX3A 1M7BA 1ZIPA 6AT1A 2FPXA 1VA4A 5KNBD 3ZDRA 3VZCA 4PHGA 1ODKA 2D2IA 3EOBI 4JXZA 5DEIA 1LBIA 5TQ0B 1OI2A 4ER3A 2G82A 3WGIA 2BMAA 1N4AA 3W77A 5JAPA 4I5IA 1UC4B 5LYJA 4RHFA 4EBFA 4Z3OA 4BY9E 2F17A 1II9A 3DFMA 3QKRA 5EZYA 4II3A 2R87A 3G2PA 1CEYA 3U39A 2DVMA 5LIRA 5THQA 1R0XA 2C0QA 4N3NA 2P0YA 4F97A 4P45A 2JGNA 4D0LB 2X3UA 5AOCA 5KX5B 1T2EA 1XD2A 2LTAA 4B35A 1KJWA 3R23A 3RFCA 2JIBA 3W9UA 3RJTA 4IVNA 1X14A 3I64A 5ESXA 3NR2A 1HL3A 3V1UA 4IJ5A 1Z56C 1ITZA 4YRIA 1XZIA 3BE5A 2OG2A 3PXGA 2BL4A 2VNSA 4LGCA 5A2QA 1C3VA 2KB0A 4C9AA 4LRTB 1X7WB 3EEYA 4UMEA 5TT1A 3URKA 3KXPA 2BPOA 3M4XA 3HL4A 3UKDA 3WLJA 3JQ6A 2E9SA 3RIXA 3IE2A 1AGYA 1U94A 3U81A 3SMQA 3TEFA 1X1CA 3DBHB 3LP5A 1E4EA 2HBQA 1OU4A 3ZD6A 1K5HA 3L43A 3K4QA 4YCMA 1JYEA 1ZMBA 2P4QA 1KA9H 4LY9A 5EMHA 1A8HA 4CDMA 2O59A 1EBUA 2GPAA 4GEKA 1I9CA 3TKYA 3B9BA 3MTEA 4Q47A 2JRCA 2NAPA 5G0VA 2PMWB 3HXLA 3DE4X 3HWX1 1SOWA 4KL8S 4PLWA 3SAJA 2C8KA 4Q3LA 1NVGA 1TYAE 2RAPA 1PKEA 2JI9A 5AJZA 1PZMA 3RU9A 5ITZB 1SBIA 1K06A 2ADMA 4MAFA 5ESDA 3ZLUA 4A10A 1P7YA 1CZHA 5FJJA 1O95D 4AYTA 3V8RA 5BYAA 3AVPA 2EW1A 1X9IA 4DKJA 3MUFA 4UEJA 4UVGA 3P7MA 3NZEA 1Z6QA 2GHRA 2I8AA 4R4JA 4FJ2A 4YAOA 5KOJA 5BPFA 4MKHA 1YSCA 4K0RA 4QQRA 2RDMA 4JXJA 2PUTA 2H8KA 3RVDA 1TM1E 1KEPA 5DXAA 3EAQA 2C5SA 4MYDA 5EJ4A 2ORED 1GADO 2X8WA 2AF3C 3EOAI 4X62B 3OMLA 2PZEA 1O0BA 2DFDA 1UXHA 1C30A 1SU7A 2L18A 5HDBB 3ZV7A 5TR9A 1SVUA 2QMZA 5LXTA 4DMRA 2NM0A 1YTLA 2IS4A 4DCUA 3EVFA 3MXOA 2Y2VA 2AZTA 2IT1A 3CU5A 1M1YB 1OYWA 3D3WB 3NASA 1L5MA 4KE8A 4MSUA 1I2ZA 4TMZA 4Z54A 2DR2A 3A4LA 1ZITA 3G59A 1L1EA 4BB5A 2ACKA 4MWCA 5T57A 4BIMA 2ODPA 2V7QA 3ADDA 1AKTA 3KZOA 3NV9A 1N0IA 1UBNA 3RF7A 3IMGA 2L0XA 5DM4A 2UYGA 4QOSA 4U7WA 4FQ5A 4O8ZA 5DM0A 4EHAA 1QNFA 1XN1A 5C1IA 3V4RA 4OFXA 4AU1A 2CVQA 4X3CA 1ZGZA 3ULKA 3W8EA 4LHWA 4Y0VA 2C7PA 4CG2A 4UUAA 2H06A 3A2NA 5G41A 2G1KA 5FP0A 4QAQA 3IBGA 4KQXA 3VYTB 4UHJA 2UVDA 5IBRA 2QEQA 1K89A 4EJ0A 4W5TA 3HH8A 3DOJA 3SBDA 1XK7A 3M9XA 2AEJA 4DCGA 3CO0S 3WWOA 3AESB 4EMBA 3O9VA 3H9JA 2C5LA 2QQGA 4W8GA 4PCVA 4NENB 1IG0A 2BP7A 3WNCA 1H23A 1QCCA 1XRLA 3SHQA 4C20A 2FYTA 1UDRA 2ZXUA 3BZWA 1FMFA 4Z0NA 1VKHA 1NE2A 3NH9A 4LNUB 2CEAA 4FYKA 5F5NA 2XUJA 3EZGA 4IFBA 1T1GA 2XCUA 1Q16A 4JDPA 4NFHA 4WESB 3OZVA 4KXWA 1M1NB 2UZ1B 1PJQA 4TVSA 4FOLA 1M72A 2R3SA 5CU7A 3MVEA 1ZCZA 5K6AA 4G1FA 2X13A 4HHEA 3C3BA 3EQ9A 3O1HB 4JLPA 2GAJA 4R3WA 5C31A 4DQ0A 2GRUA 1AY0A 4BTLA 4EPTA 3T7IA 4DCMA 2R8RA 1KFJB 1QGUB 4O4IA 1SQGA 4H7HA 1IJBA 5AVSA 3LE8A 3MWDA 4H1WA 3ZHZA 2FPOA 5LMZA 1VHWA 1RW4A 1ZIXA 2GD1O 2C31A 4KQWA 2IV2X 3TKLA 2XNHA 4XASA 5JVDF 3K9TA 1F5SA 1CY2A 1P2TA 4DLKA 3RHZA 1WXEA 4IOLA 3TIIA 3BWCA 4EUNA 4XEHA 3U17A 1R9NA 2A0KA 2C94A 2EW8A 2Q6VA 1D1TA 1MABB 3D31A 3O93A 3QX7A 4ZA2A 4IEFB 4EKDA 1MC5A 3MS7A 2GVNA 4GM0A 4AMBA 1N75A 1LPMA 1UWLA 1XVVA 2AZ4A 4ZZ0A 5KAPA 1BVHA 4L9AA 3IT1A 1ICIA 1CF4A 1JBEA 1G7RA 4NV0A 5HJ2A 3SSNA 3UJNA 3DF7A 3D5EA 3B3JA 4GUAA 3VAAA 1NC3A 1C8KA 1TJ3A 2H5EA 1YR7A 4A8JA 2E5LB 4RA9A 1U2DA 1C80A 4X6LA 1NJFA 1PBNA 2AYXA 1UC5B 4XARA 5AVKA 5CA1B 1H5UA 4HB0A 5ALGA 1IH8A 3G6KA 3HB1A 4MRNA 1V1MB 4YT2A 5C7OO 2HZ7A 4RF4A 3E9YA 3MMPA 4DL9A 1L8AA 1MQ8B 3AVQA 3L7NA 1XQ1A 3T61A 5EFZA 3UWKA 5L6LB 1KPGA 1OX6A 1UMBA 3TJMA 1ZD5A 4UTPA 1RACA 2EZ8A 2HB6A 1T9HA 3IEKA 3HJRA 3TINA 5E9QA 1ISHA 2DSNA 2VSFA 4JC5A 1HLFA 1JDPA 5E3IA 4DYDA 2LP4Y 5MGBA 4ERXA 2NNLD 1ZK1A 1Z8DA 1I2DA 3C1UA 3H7IA 4HNAA 4OO3A 4TQAA 5LOVF 1WG8A 3EMBA 2WB2A 2CYAA 4HI0E 2HCRA 5ENZA 2C5HA 2J3QA 3KIPA 1XU9A 2C29D 4Z4CA 2QRLA 1PZXA 3SC6A 4MB6A 1HYEA 5L4LA 5FB3A 3L4JA 4CGYA 4M3NA 4J4BA 1YVPA 1OBCA 2DBYA 2C00A 2PH3A 4TLMB 3AHHA 4RTSA 3BJMA 3H2GA 4UULA 3CEPB 4X8LA 5FI5A 4TZKA 4K6MA 2ZW9A 2XD4A 4IKOA 5KB3A 5DISB 4ZYXA 2OV4A 4DR4B 1MJ5A 1JDUA 1SVNA 1I80A 1X80A 2IXFA 4DIMA 5K0BA 5KUTA 3NEJA 3DUWA 1UK6A 1ZEMA 2IYXA 3PEEA 4B84A 1ODTC 2QD4A 4YRFA 2NPFA 3OTGA 4E22A 5HZMA 2EU8A 1P4AA 1BDHA 3QY9A 1FJXA 1K75A 1N6LA 3S68A 3D5TA 1P44A 1C9EA 1EUCB 3S2EA 3SHFA 2N46A 2WA1A 4DLUA 1RKUA 4U2BA 1EFLA 4QXOA 2Y0CA 3AL3A 2Q3JA 3DZIA 3O38A 1I7NA 3KKNA 4TGLA 4NESA 3VX3A 5HOQA 2HK9A 2ZRJA 4EKEA 2JF0A 2GCIA 4XQEA 4AMZA 5LKRA 3ESBA 2IE0A 4WGGA 1JG7A 4WK0B 2WKWA 2ZWOA 1FYEA 3UB4A 4EQ6A 1QTNA 1JHUA 3RSGA 3I3OA 4NQZA 2FPLA 3N2IA 1VKNA 2WWHA 2Q2VA 5A02A 1G55A 4HN9A 1XNGA 3HUEA 3SIPA 4LXUA 3LTEA 4IYRA 2Z8XA 2C9ZA 2QT0A 1L8OA 1J0BA 3IPCA 5KC8A 4LTMA 3GMSA 3UC9A 1OXBB 2DLCX 1AQLA 3VM6A 4CQJA 3ORYA 2F3UA 3NOXA 4BJ5A 2BZ1A 2VQ6A 3EBPA 1BD4A 3LWBA 4OI2A 2ZR7A 5JISA 1QHGA 4EI7A 2F1OA 5J4HA 1XZGA 3ZJTA 4RANA 1RLJA 4M38A 3D1VA 4P84A 1W0CA 1GPKA 2XQJA 2WWTA 2Q7OE 3O3CA 3KQSA 3KTFA 4KLCA 1A97A 4RA9B 2WSSD 5KZMB 4NBVA 1Q7GA 1N3YA 1YE3A 1Z3CA 2E6UX 2I2XB 2PIAA 3K1TA 4L4ZA 2AFHA 1NRXA 4AZ3B 2EEZA 3H16A 5IANA 3GP8A 3E7DA 2AQHA 2BZSA 5K0ZA 1COWA 4EGFA 3ZWWA 3P2OA 1P91A 4H6VA 1ZNQO 2PMDA 4F3TA 5BV0A 4Z4FA 4TL6A 3P0HA 1Z37A 3UMMA 4JEMA 4XSVA 1A8PA 1ZKMA 5TB5A 3K8OE 1WETA 3CW9A 1T1JA 1CFJA 4G5SA 4P08A 3WSTA 2EK9A 2VQFB 3FUTA 1ESNA 4WQMA 1E3QA 3BCHA 1E2PA 3V8PA 5KQSA 5L3VA 5GADl 2IXTA 4DLVA 1QFZA 4NVRA 1J5PA 1RHQA 3VJMA 3DKRA 4POOA 4IH9A 1M1YE 5F1KA 5F2KA 2VQSA 5DXJA 4MPRA 4E30A 4LN1A 3CNNA 3HVIA 3BAZA 3G2KA 4RDHA 1V6SA 2QGFA 5AI9A 3TIVA 1TZMA 5B36A 5HF5A 3EISA 3UVEA 3QFRA 5DI9A 1M2WA 3HB4X 4FKBA 3K0SA 4NABA 5GMOA 4R2HA 3KKZA 1EVIA 3PA8A 3SYKA 4OBBA 1CF2O 4J0IA 2FN9A 1WF6A 1KH3A 1T3SA 5DCUA 2QYOA 5C9ZA 2PVWA 2O0KA 4WASA 5B1HA 4KO3S 2VBCA 4M6WA 4MXDA 2P2DA 3H9QA 4BNFA 3MYRA 2O0MA 1QOZA 3UJAA 3MM4A 3AESA 2XEFA 5K6TA 4N3AA 3VYRB 5JASA 5DDIP 1SVSA 1QTQA 1EFVA 2H1WA 2NW6A 2P77A 3A2MA 1L5RA 3NBMA 3OQBA 1EUZA 2NTYC 3W6OA 3TW6A 3QOFA 1VG8A 2FX5A 3QE3A 4IW3B 4C9BA 4DCVA 4AECA 5IRCD 4PPFA 1FXSA 1S8NA 2XMPA 4LF7B 1ECJA 4IJUA 3DLIA 1W8DA 3FWPA 2AOTB 3HPRA 2VUHB 3L4KA 4R8MA 2GKSA 2ZVQX 5A62A 2P6MA 4HX9A 2ZE7A 4NMXB 1FJGB 3RYHB 2XNDD 1BDIA 5JSHA 3H4IA 3FYHA 1UBTS 3K9NA 5FO1A 5FWNA 1IXYA 4FZ3A 4H3KB 3FJYA 3KKMA 2GN8A 3HDVA 2VXBA 1TFRA 1N2BA 3ILHA 4ME6A 2V7QD 2IP4A 4DNXA 2X9QA 4RESA 2GJ8A 3GRAA 3LHFA 1EI9A 4TTJA 4ZRNA 5FPKA 4HLUA 5JZSA 2DHDA 4ROSA 3A1CA 3KZMA 2HJWA 3LYHA 4X41A 4ZPJA 3ZKWA 4C1BA 4FFMA 4MTCA 2DM6A 1Q3KA 4TPKA 3H5RA 1GP2A 4JLAA 4L08A 4JI0B 1V7CA 3E1GA 4NHOA 5BN4A 2I7CA 3AEQA 1T13A 4YDHB 5BVHA 4K9RA 1A7UA 1E9SA 2YY6A 3ONWA 4KZPA 1FFCA 5K51A 2FRXA 3H1PA 1UADA 1UIRA 3H1BA 4WCFA 1W87A 1WO8A 2B99A 4G8JA 4C21A 4DILA 1J8YF 3TTTA 5KWIA 5LQMA 1KI2A 4DRXA 3T7JA 1Q5PA 2J0UB 1UC9A 3ABOB 3H4VA 2C6GA 4LNUA 2MINA 1J5XA 2J9FB 1O77A 1SUAA 4JB3A 3NTRA 1ZSNA 4ITRC 2VTEA 1JNXX 2YC4C 3VHLB 3FCOA 4AXXA 1WSDA 2C78A 1MIHA 3QYAA 2BZ0A 3M9WA 1ZQ1A 3EZFA 3RSQA 3VPCA 4YMWA 4E1BA 4P3NA 4FNMA 3G5AA 3RAGA 2A8YA 4MQFB 1C41A 3QU2A 3GEBA 4INJA 1BN6A 3JQQA 3ZW7A 3QLVA 1S1MA 2I76A 4JASB 4MCIA 4TWIA 4ZVOA 1QS0A 1ULUA 2HMSA 3LI2A 2FQXA 3FPAA 3MHPA 1G4AE 3LVRE 1E1CB 4I08A 4RSRA 2WJYA 3PWSA 1K92A 4PYRA 2YNMC 5AM1A 1OSNA 2FF7A 5I7AA 1GZ6A 1POXA 4JQZA 3TDKA 1ARZA 3TL2A 3F8WA 4FUQA 3FNEA 4DV0B 2RGEA 1K3UB 1KGSA 4OXKA 3ZIDA 3D8SA 3IP9A 2OHOA 3OSZA 4HATA 1LDGA 3LC1O 3I01M 4LV6A 1N1MA 2MSWA 4JYWA 2ASVA 3E5MA 4QEKA 3TEJA 3RADC 2ZSKA 3INNA 3OPYA 2H4HA 5AVRA 3AHGA 4YDQA 4G5FA 4XQ0A 2V4ZA 3P5BA 3AB8A 4YMTA 2XCTB 1PGOA 4ROTA 1VIYA 3HRIA 3FKSD 3MJSA 4PLFA 5GM1A 1GNPA 2HZBA 1QRTA 4JI1B 4NDAA 2GBGA 3ORRA 5L51A 1L5VA 2XSZA 3EXHB 2QX7A 2GLXA 2ADFA 4L5YA 2Z58A 3SNKA 2DJ5A 3KVOA 1C3OB 2IITA 2J45A 2PD3A 1XA0A 5E6SB 2AFIE 1X74A 3CZ9A 4C43A 4L7QA 3OFJA 4E7PA 5INTA 3KM0A 5ED0A 4NZNA 5IZ4A 2DHQA 1UBGA 1JEQB 2Y66A 1WZEA 3CIFA 3FWHA 1NVVR 3T3IA 4POAA 1NLFA 2YV4A 3B82A 2FWPA 3A1VA 2PV7A 4BLTA 1Y9JA 5JWRA 2BDUA 4JFAA 1OA1A 1T9CA 4ZAZA 1NFQA 1FNBA 2J59A 4X24A 4CUZA 4MHTA 2WAOA 2WWRA 2AG0A 1BKDR 3C70A 4X1YB 3P0RA 4XDHA 2LXNA 5BVGB 4ITVA 2XZOA 2P3QA 2Q2NA 3KJGA 2HROA 3BIXA 2WAYA 3T7AA 1VJ5A 2DKNA 3BFVA 3P2JA 2A5GA 4NFSA 3ESYA 2CL0X 4FWIB 5T5QA 2FMTA 4XIYA 1H2HA 1Y7TA 2JIOA 1E6EA 4PLPA 1RQ2A 2IS6A 4X7BA 4CMIA 5BYBA 2AC4A 5AVOA 4Y6QA 2I6TA 1U9ZA 3R9KA 3HU1A 3SQMA 4ENWA 2VDKB 3E70C 2CK3A 2WD7B 2H85A 2AR9A 4NOKA 5DO9A 1CXZA 3PYXA 1L7DA 2PQ6A 2WWIA 1J06A 1EHYA 4MPTA 4Q7JB 1E9RA 3SQDA 5KREA 3NDBB 3OBIA 2XRYA 4YMVA 2V4MA 4C8TA 2I3DA 2Y6UA 1Z5UA 2JAHA 5IVDA 3VPDA 1ZWLA 4ZVLA 4D0RA 2AF4C 1IZYA 3KDAA 3NIWA 4D3YA 4TJXA 1GQOA 1NW7A 2PLFA 3DYVA 2BWJA 3H9UA 3U4AA 3EBLA 3O26A 4PF1A 5D5QA 4WK4B 5CB8A 3PFKA 4KRXA 5JI2E 1TD9A 2P6OA 1W36D 5IPFA 4QXMA 3UM9A 2BE7A 2W83A 1VSBA 2O48X 3B3FA 3I58A 3GLTA 1KY3A 5K0EA 1DFIA 4JHLA 1YNSA 2D4AA 3VBEA 1AKEA 3RKSA 2EZ9A 2Z3WA 2RGCA 4JK3A 4W1RA 5GVRA 5IVPA 4YJFA 1DT5A 4TWRA 3VQTA 4B32A 3AKZA 2OXCA 3HPQA 4OEHA 2A35A 1KBQA 4NE2A 4N48A 4DS3A 4CEJB 4GS5A 2FMUA 3JATB 2NT4A 3P8ZA 2QD2A 4CRWB 2D8AA 4KVGA 1SFRA 4C3UA 5CDFE 5KC9A 2G80A 4IIJF 3CHYA 2WD8A 2HWGA 3DE2X 5JS7A 2OC9A 1RQNA 3DL7A 4EW1A 4FHFA 4EAAA 1IC6A 1ZD4A 5DP2A 3BA1A 1TM4E 3UKJA 4FJ0A 5E7IA 4YRJA 1OFHA 3BHIA 3KOWA 1FY2A 2CL7X 4JJ6A 5F3DA 3W1VA 3ZXSA 5C2JB 3H4TA 4UVEA 2HNKA 1W46A 2IEAA 4YP9A 3WNZA 2ZVJA 3LKBA 3BJZA 1M8GA 3WK5A 5EIAA 2AG8A 3QLEA 2FKAA 3DTVB 4PANA 2JJ2A 2Y77A 4D4JA 4JXXA 4Q9AA 1KH2A 1YZVA 1H66A 2XMBA 1G66A 4AO6A 1P17A 2BP7B 3ICOA 4BNIA 1P7VA 5DYWA 2AMFA 4XYMA 3LDUA 5CXQA 1DJMA 1FQKA 3QG1A 5BSMA 2OCIA 2JBWA 3IUJA 5HSGA 4PYLA 2LWIA 4BFUA 1YI8A 2GZAA 3HJUA 1QYIA 4MVJI 3HA7A 1SWVA 2ODWA 5FIUA 5I6DA 1OWNA 5JCZA 2C2HA 1FU8A 1LDBA 2JIMA 2A59A 1SG6A 1T9DA 1NNEA 5HGXA 2GNPA 2H5LA 2J07A 4DZTA 3HXTA 4KGDA 5E4FA 4A8HA 3I8XA 1T8RA 3OTWA 2JCXA 3K7EA 4JYZA 4GGMX 1P1JA 3HNPA 5B6PA 3ZLVA 4HNHA 4O4HA 3WYFA 1EBFA 1FDTA 1M10A 1PZFA 2BHSA 2ZBFA 3U4DA 1D4OA 3GUHA 5F2NA 3PB3A 5HQ3B 1K0UA 3CTPA 1L5HA 4YRGA 4F3KA 1MJGA 4LKRA 1RCUA 4L6AA 2GK3A 1GT6A 4BATA 1SBZA 2X4IA 1S8FA 2ZRLA 2NO0A 3FMOB 2JCGA 3V2GA 4ARCA 5T6MA 3LXXA 5CVDA 1RYYA 2HMVA 3NRCA 3RU2A 2DT5A 2CLOB 4BPBA 1ECBA 1E2JA 2Z8YM 1AHPA 4I8IA 2EW2A 3OLQA 2F2TA 1ESZA 4GMXA 4L2IA 4MA4A 3T9CA 3PNOA 2GN4A 5B2FA 2KW5A 3OPMA 3LA8A 5EP3A 1Z29A 5EINA 1ZCJA 2X1HA 2G63A 2JI7A 3DTTA 3O8LA 4MWTA 1JKJA 3D43A 2UUAB 4CGZA 1W36B 3AIMA 1HEIA 1OX4A 1YBHA 2RGUA 3PIRA 3QF4B 1B8UA 1TUBA 4DRXB 2EZUA 1HRDA 4TMWA 1R0CA 5BP7A 5G1NA 4MKRA 5L8VA 2YQ4A 2C5AA 4F91B 4L2IB 1T1IA 1E9AA 4KDEA 1F3LA 3MT7A 3FDXA 1ODFA 1Y4UA 1WUYA 3VDNB 2Z5VA 2WF6A 3JTEA 1ZJWA 1FTGA 2GCEA 1WZCA 2RJOA 4KRYA 1V35A 3PNMA 4NENA 2HRCA 1K6IA 3AEKA 1KMHA 1OVMA 1J0CA 4IIXA 4IRMA 3I2JA 1UJ4A 3R20A 2OSVA 5JCXA 1TZ2A 3D6JA 3E84A 4HZUA 1JHYA 3PGLA 1N2OA 3NKVA 1N0WA 3DH0A 4GOMD 1VPLA 3E3MA 5F73A 1RIFA 5J1TB 2DQYA 3LV8A 3WIBA 4I8XA 1NVXQ 3I2KA 5JJCA 2V1UA 4YY3B 1RJ9B 3I45A 5KPJA 2R7AA 3PX2A 1R0RE 1WUKS 4BNUA 1KY5A 1FU7A 3RYFA 3QY0A 1M8PA 2HFJA 3U31A 1XD8A 4KK3A 3SFVA 3B52X 4L8LA 4LMAA 1UFVA 4RGQA 4HGRA 3CX7A 4HRAA 2XGOA 4NJMA 3WKAA 4BNLA 5AUNB 3AVTA 1ZNXA 1AKWA 1NW9B 4KEAA 5AXAA 3VOBA 1WCIA 2HRRA 4LZLA 5A4FS 1MZPA 2OLSA 4U00A 3EUFA 4F4JA 2HW8A 5CK4A 4YIHA 3ADBA 4JLBA 2IYVA 1U8YA 5I7EA 1V9CA 3NHAA 1O9HA 1EWQA 1AZTA 2QSZA 4LQCA 4EYSA 3R0JA 2JAWA 2PT6A 4GDFA 2KPOA 3L2OB