3TLBA

Microcin c7 self immunity protein mccf in complex aspartyl sulfamoyl adenosine
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
335
structure length
335
Chain Sequence
PLLAAPLAVGDTIGFFSSSAPATVTAKNRFFRGVEFLQRKGFKLVSGKLTGKTDFYRSGTIKERAQEFNELVYNPDITCIMSTIGGDNSNSLLPFLDYDAIIANPKIIIGYSDTTALLAGIYAKTGLITFYGPALIPSFGEHPPLVDITYESFIKILTRKQAGIYTYTLPEKWSDESINWNENKILRPKKLYKNNCAFYGSGKVEGRVIGGNLNTLTGIWGSEWMPEIRNGDILFIEDSRKSIATVERLFSMLKLNRVFDKVSAIILGKHELFDCAGSKRRPYEVLTEVLDGKQIPVLDGFDCSHTHPMLTLPLGVKLAIDFDNKNISITEQYLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of a serine carboxypeptidase adapted for degradation of the protein synthesis antibiotic microcin C7.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords MccF
total genus 117
structure length 335
sequence length 335
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02016 Peptidase_S66 LD-carboxypeptidase N-terminal domain
A PF17676 Peptidase_S66C LD-carboxypeptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Class I glutamine amidotransferase-like 3tlbA01
3.50.30.60 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 LD-carboxypeptidase A C-terminal domain-like 3tlbA02
5FD8A 4E5SA 3TLZA 3TYXA 1ZL0A 4IIYA 3G23A 3TLYA 4E94A 4MJXA 1ZRSA 4MI1A 5F9MA 4EYSA 3TLAA 5JYBA 2AUNA 3SR3A 3TLCA 3TLEA 2AUMA 5F5XA 5K99A 3T5MA 3GJZA 3TLGB 4H1HA 3TLGA 3TLBA 4JVOA 3U1BA 4IIXA 4INJA 5F1YA
chains in the Genus database with same CATH superfamily
5LB4A 1XAHA 4HADA 3VYVA 3MERA 1A9QA 2YHSA 2QRZA 1QBGA 3KOXA 2ZB2A 5CTJA 2MR5A 1QLWA 2OAGA 3VC2A 5ILOA 1HRDA 1YJXA 1THGA 2I3GA 1GTVA 4K3VA 4N6OA 5BUCA 3AY3A 1ZA2A 2IOQA 3CJQA 2OHIA 4CZ2A 3QM1A 4YN3A 3DDWA 2FMKA 4O3FA 4RPHA 5DV9A 1Q1QA 4J6EA 2ATCA 4QELA 4JLJA 2GAFA 2HIAA 3AP2A 3FCSB 3HXPA 3PGLA 4COKA 3AHHA 3DFFA 1KO5A 1UM8A 2JJMA 4XIJA 4UOEA 4ZVNA 3HDJA 3K2QA 1D2MA 1FDOA 4WFIA 1M0SA 1RRGA 2YWXA 4FMDB 4J0JA 4IIEA 1TCVA 4B32A 1G55A 5B55A 1QIMA 4TGLA 2UZ1A 3FYSA 2ZRFA 3TD9A 5LQCA 3I6SA 3DE1X 1E94E 1FFDA 4ILKA 5D8DA 3KOMA 3THYA 3E9YA 4NCNA 4JI8B 1UC9A 5LNK1 4YIHA 4DBZA 2JLSA 3QXSA 1B0ZA 2QRHA 4WH0A 5AJWA 2VHVA 4M22A 3S2FA 3IP8A 1FUEA 2I1QA 3FFAA 1LBTA 2CGEA 4GLLA 3WLKX 3RJ5A 3MHTA 1AURA 1VE1A 3SC2B 4LS3A 3DAFA 1REQA 1WW3A 2I6GA 1T1JA 2PKRA 4TJXA 4DV6B 4QPZA 1S96A 2CV2A 4OH7A 1HLGA 3MWGA 5J2UF 1KFCB 3CIFA 3L7NA 4OHPA 2QNRA 5LFAA 3IIBA 3PTLA 2Z2IA 3CUKA 4KO2S 4D9CA 3AJRA 4X7BA 3VV2A 3SJGA 2X9VA 3FCEA 3TLZA 3EPLA 2EF0A 5ELXA 4RXTA 2P9JA 2SICE 1RDFA 4CEJB 5TE9A 2QTFA 4PNZA 3SVLA 1L5WA 1NQTA 3H1EA 2A7QA 3KSZO 3BRSA 4M1SA 1XRLA 1QCCA 4INOA 1R6TA 5LOVB 2C4WA 4O59O 3KASA 4F11A 4D6PA 3C6MA 3SG0A 3KAPA 2BD0A 2QVLA 1KYTA 2I54A 3TECE 1A04A 3VYTB 2IH4A 1J4AA 3EWNA 3OIGA 1P72A 3JCZA 4WBNB 3QUTA 5K5EA 5AHOA 3VNVA 3IOEA 1FRVA 4OQPA 1ZK0A 1W36B 4Y1RB 4Z0HO 1TKRA 4UFOA 2JGAA 4YP5A 2OXIA 4DIKA 1SXPA 1SB9A 1BZYA 2Y2VA 3QFSA 1MNQA 3HHEA 3ZYZA 3MT0A 1MXFA 3AJAA 4UTPA 3B9PA 3JVIA 4EO7A 1CQZA 3M6IA 5KSPA 4A26A 5C3MA 1O2DA 1EGHA 1GFIA 4ND5A 3W2HA 3SXPA 2NNWB 2ZI5A 3PIIA 4AUNA 3KQUA 1WMEA 1QH9A 3I2YX 1T8YA 1ZGAA 5SYNA 4MXDA 4BO6A 4EMTA 1FVOA 1V3UA 3HWX1 4CN9A 1GKYA 4XIYA 4NQZA 1CHDA 2IYVA 2QRNA 2VHZA 5B1HA 4GWGA 5EZYF 3ZE0B 2IHVA 2ZQZA 5AVWA 3PXGA 4CF6A 2YJTA 1RPJA 3BOSA 2R8RA 3MTEA 2C7QA 1P4JA 5ITWA 1XWFA 2NPOA 4WZAA 3ZGLA 4QHTA 5H59A 4OJYA 3X1MA 2QZ4A 2DHCA 5IVIA 3STYA 1DL5A 4DCVA 2BR3A 2G1AA 2Q0QA 2VHYA 4J0FA 2CL7X 3C5EA 1F4LA 1Q22A 5I6DA 2J0EA 1MO3A 4MK4A 4MP8A 3IT2A 4Q7QA 3L7BA 1S9DA 2R8ZA 4JB2A 4HRAA 4D8TA 2B9VA 1KKMA 1H05A 2AFHB 2GSDA 2A7XA 3H9EO 3Q6IA 1U28C 3FPFA 1UEIA 3DCIA 4KH0A 1JHOA 3CNEA 5LR6A 3QF4A 2ZUSA 3GMTA 1DBWA 4XX0A 3DKRA 1NE7A 2SKDA 1V25A 2YWRA 4BVEA 1FYVA 1DO0A 2Q0XA 3Q1KA 2ACWA 2Q49A 4FD2A 3A04A 3EB9A 1PJ3A 2FA9A 1WVGA 1PR0A 3C8ZA 2VS1A 3A0UA 3AF3A 3TFOA 1P1FA 1NP6A 3LNTA 2BGJA 2IYTA 5J58A 3T38A 3SBEA 4FHGA 1QO0D 1X7YB 1KYIA 2GN0A 4PX9A 3ZQUA 1IVNA 3I64A 4IUCS 1FW8A 3HZOA 5KQMA 1P39A 4YRBA 1IJEA 4TN1A 3T94A 1D9ZA 2PWYA 4KC0A 4K9QA 2XKAA 4OSEA 3PWTA 4RWEA 2C83A 4TLCA 3CPHA 1C1XA 2NTNA 5DBGA 1X1RA 1E2BA 1A77A 3JARA 4FKMA 2XQVA 4JI1B 4MUFA 5H9VA 1I3CA 5H3LA 2Q8PA 4DCJA 4PTYA 1IMOA 3DNPA 5LWQA 4RTKA 1DOAA 3E22A 1ZMRA 3T1HB 1Z8DA 1KDOA 3OHMA 4W5RA 1KI1A 4JVMA 1J9GA 10MHA 1A7AA 1QO7A 3N76A 4L3WA 3N39C 4PIVA 3FKSA 1EVEA 2IXBA 1NBMD 1IG0A 3DMTA 3NBYC 1Y37A 1Z45A 2BKLA 1ZJZA 3FNFA 2FQXA 5ER9A 1BTOA 2R8BA 3Q2KA 4EMSA 5CA0B 2BSXA 2H8KA 3TOVA 3SICE 3DHVA 1HE1C 3VC7A 2VT7A 2XVYA 4G0NA 1DXYA 2WHPB 4TJVA 5C81A 2J0UB 3OQPA 2DWQA 2G04A 3PUXA 1COZA 2H4FA 3U48A 1JG2A 3TL2A 4Y8VA 2I7VA 5JNSA 2JAQA 1SD2A 3BWBA 4KLRA 3HLYA 3OUTA 7REQB 1NN0A 4EPRA 3HBFA 1K7YA 4OHMA 4ZVLA 4PN7A 1I2MA 1U4SA 1JGTA 2V6GA 3D3KA 3DTNA 4MQEB 2WLSA 4QJ5A 1QR6A 4WVFA 5JS6A 3PHJA 3C39A 4WACA 4Y2YA 3GP8A 1TD1A 8ABPA 2ZIXB 3I01M 4ECEA 1KK3A 4I19A 4X64B 3VJKA 1L5YA 2NVBA 4JYZA 2QBYA 2G0TA 3DO5A 4DQUA 1RYFA 1GZSA 4M1TA 1GFWA 2WUDA 1VLZA 3AUFA 1U8YA 4NYMR 2OQRA 3HJNA 2FOIA 3ULKA 3AWDA 3RG2A 3W7VA 3WRYC 4E21A 1M54A 3CVOA 1H85A 2JB9A 3TZKA 1JLMA 2FAXA 1FDSA 4JZKA 4WKNA 5DNAA 4K6GA 3MXTA 1PT6A 2VP2A 4RY8A 1NBWB 4PLFA 1YQUA 3GA0A 1LX6A 1A2BA 1UMDB 1E2JA 2OHJA 3A9TA 3MILA 2A5DA 1T5IA 3WIUA 4A8JA 1D4AA 2OUKA 2EG5A 2ZCUA 3CUSA 4ZXFA 1QYIA 2AXNA 2RI0A 3RK1A 5FTMA 3NW9A 4F72A 5M7EA 2AZDA 2II6A 1IUOA 4NAUA 4DUGA 4Q7LA 4F5WA 4KAJA 1ZDMA 4E5YA 3C3DA 3FPBA 2QE6A 3EYWA 5J4LA 5BN5A 1MEEA 4CM7A 2WTBA 3NBAA 2C6PA 1I7NA 1P75A 1XE3A 2HA5A 4MAMA 3BT7A 2CNLA 3HVHA 3TS1A 3HZRA 4CQMB 2PHZA 1YZVA 1D5CA 2YOFA 4REQB 1I13A 3NONA 1DGQA 4R1OA 3QYAA 4I3HA 3ZZ1A 4A2QA 2C2MA 3IDFA 5KTTA 3WMEA 4F93B 1J2TA 4M1ZA 4NMHA 3IUYA 1JIJA 1QRSA 1NXPA 1LH0A 4S1WA 5B58T 3UK7A 4O4HB 2JI6A 5DSXA 3DF9A 1CX9B 3NTLA 4Y1EA 4H3VA 1OVMA 4RF4A 3RUCA 4NHOA 2RI1A 4XX0B 4D74A 3KCNA 5JZMA 3HXKA 4EGAA 1Z2CA 4M83A 2ZRGA 3EAFA 2ZAOA 3NH6A 4RS4A 2J3QA 3UF0A 5ABPA 3O74A 1GFSA 4MCAA 2E4AA 2WVHA 3RJTA 3T07A 3O83A 4KQXA 2C3YA 4P3NA 3V1KA 5BR4A 4R7ZA 3JQ7A 3GV0A 5EC8A 1SBNE 2MYPA 2G40A 4FMCF 2PMBA 1SBCA 1YI1A 2JKYA 3DP7A 3ANYB 1UC5B 2ZVPX 3FZGA 2XGMA 1RAAA 2ZSJA 1WWKA 3M3HA 3OWHA 1L7BA 2H3EA 2F00A 1NM5A 3H5AA 2GUGA 4HPJB 4RTQA 3O84A 1W48A 3LT5A 4H7DA 4L57A 2QTZA 1HFWA 2FDXA 1L1QA 4M7RA 3P0RA 4GZ6A 4NGMA 4N0DA 5JTTA 2V3CC 1AO3A 1JDEA 4TVSA 4F4IA 1E63A 2DG2A 1QWOA 2WJ3A 3JZMA 4KPUB 4HYTA 1U7WA 1JDZA 3RBVA 2PN1A 2QD1A 3EGDB 2FUCA 1BHQ1 3A1TA 4RENA 4WHMA 4A73A 4BAZA 4B3MB 2J59A 2IBMA 2QENA 2A1UA 3RS0A 3VR6H 1XN4A 4AZSA 3RC7A 4KXYA 3I76A 5H3CA 5A4IS 1RRMA 3IE1A 4XPIA 1QF7A 2QL6A 1Y1LA 1CY7A 3OZCA 4C30A 3T9DA 3WWEA 5HRCA 4DYVA 2A6PA 2FW6A 3UK6A 4NMLA 4ZU6X 2R97A 1FFGA 2WHRA 5C18A 1ZOIA 1OFTA 1GJRA 2V9PA 4OUDA 4IOLA 4EH1A 2H7CA 4MMXB 1H5NA 3UCXA 1DAGA 4ZVOA 4AAYA 1GXSA 1TKBA 1ZGCA 4W5NA 1F17A 4R1LA 4MWZA 3KQKA 5FA6A 5BWOA 2DBZA 4PLWA 3AERA 1R15A 1E60A 3FHTA 3EFOB 1JMYA 5EHNA 4M7PA 5J40A 2MYUA 2QN1A 4U2KA 1DEKA 2NLOA 3ODPA 4JLWA 1QIIA 2Y93A 3GRZA 4HLUC 4IV5A 1U2ZA 2Y27A 1EK2A 4RD0A 4EG4A 2Q5CA 1ZBQA 1D0VA 2W6NA 2PSHA 4D8XA 2YIDA 3KHKA 1L9KA 4XYMA 5C32A 1O77A 2QBYB 4MKIA 1YZNA 4WL0A 1KEEB 1JSCA 3PZBA 4LRXA 3ILHA 4NZNA 5JFTA 1EEXB 4LJKA 1QCDA 4XWWA 4WIAA 3LGXA 2P78A 3BHMA 1PSZA 3GCGA 4M86A 3N6XA 3MNFA 1N5RA 4FBLA 2FUG6 4IAOA 5CU7A 5CT4A 5K3SA 2LWIA 3HBMA 2W2QA 1NVFA 3N0XA 4OQQA 3NTUA 5T6MA 3SIRA 3B1YA 4CCYA 4UEJA 2HGZA 1L4HA 5JAZA 1D4FA 1E9VA 1N2SA 4UARA 4ZZ3A 4IS2A 4U9HS 1FL9A 2H7VA 3ISJA 2R82A 1PNVA 2D1SA 5L3SA 1BEEA 1Z7GA 1DOHA 1GTZA 1RRFA 2BKAA 1EUZA 2ZE5A 1Z4NA 1H0SA 4IZ6A 1Z82A 3UWPA 3NDIA 5JD3A 5KPJA 1NY6A 2CLLB 5JQGF 1MVLA 1DO2A 5A62A 2G1UA 5EA2A 1S2OA 5JZ9A 2WABA 3PD7A 4N8EA 4UU7A 3AXTA 2M6LA 4D02A 3WV4A 4EGQA 1CZNA 4IOKA 1R6DA 1EQAA 2BEUA 2B7CA 1OX5A 1E6UA 1MXHA 3FIJA 4PAWA 5E7JA 1RQGA 1RXSA 3R3HA 5AJTA 4OV6B 2RCYA 1BXKA 3FTDA 4D2IA 2OMEA 3JQGB 2DKNA 3ZR4B 1M2JA 2P4SA 3Q87B 4G26A 4GLJA 1GPLA 1K6MA 4HSEA 2VTBA 1ZUD1 2PM8A 4EKGA 1T36B 4O63O 5BWLA 4GMFA 1VM6A 4HL6A 5FWYA 3JYLA 5EVJA 2Q4OA 3DONA 2XTAA 4B6PA 5HSGA 3OPNA 3N7TA 3OZUA 5J2TA 1EDEA 2YS7A 3C7AA 4TLMB 5K3FB 3QNMA 1DKLA 1FXWF 2V9ZA 4MOWA 3MCZA 3RWMB 4AK9A 1B6RA 1QLJA 4O2BF 4CNBA 5L4SA 5JSZA 5EKUA 1CJTC 2JFVA 5HCIA 4ND3A 2C2XA 2MSDB 1JJFA 4HEHA 3KSRA 3QEAZ 2Q1XA 3JD2A 3PUYA 3PS9A 3P27A 2Z3ZA 4ETNA 4ERNA 2YXLA 3NRJA 4R40A 3I5YA 4CKBA 2EZAA 1BVRA 4I55B 4L28A 1FLAA 4IGKA 3OIDA 3REFA 3G82C 3P45A 4PC6A 2X5NA 2OV3A 1WV0A 3WLHA 1L8LA 4YAOA 2HIHA 2B8JA 3GFVA 5EZSA 4C8UA 2VJPA 2BEJA 3GB9A 2VPWA 1OAOC 3IUEA 3VSBA 5CCXA 5ALIA 3ZU5A 1U1GA 3G88A 3M9XA 2HBZA 4GBJA 4BQNA 4X63A 1GQOA 4KLCA 1Q2XA 2PH1A 5CVEA 1TK9A 3KLBA 1TZMA 2XADA 4GM0A 5DNWA 5LL6P 2JHCA 3TTTA 2QMHA 4FFSA 4LXQA 4XYBA 4M55A 3RIHA 1KEZA 1RYHA 1UBRS 2JKVA 2Q0HA 3TDNA 4IIJA 1NQXA 3EODA 3OZTA 3PENA 4FN4A 4Y6GB 1QG6A 4JI2B 4HZGA 2FKAA 1XCOA 2WBLC 2GJSA 1WP9A 4KXWA 1SHUX 4EA8A 3KZXA 3MGGA 5K0LA 5CFNA 5FBQB 1R8SA 2RE8A 3ZJUA 1NMXA 3FA2A 4HLNA 3UH1A 5KYTA 1UQRA 1L5HB 1RYEA 4ND8B 4OBEA 4CLEA 4LI0A 4KRGA 4PQGA 4U3JA 3TIVA 4D5EA 4OX9B 1B4DA 4AY6A 3ZTYA 1YU9A 4NARA 3O31A 1H4SA 3Q0EA 5LD2C 3QXXA 4V03A 5ED4A 3VHXA 1NXQA 4QFBA 3D1JA 4P58A 1L9XA 4EAQA 2OG2A 5JSQA 1QFZA 1Q16A 2CXOA 3DB2A 3OD1A 2WLTA 1PBNA 4FKBA 4YP1A 1OV6A 1N0IA 3UAXA 1OFVA 1W5SA 2EQ5A 2JIRA 2QMUA 3J81k 5IKXA 4QUKA 4KUEA 2C5LA 4HUQB 1YRYE 3AGQA 3CF0A 3U3OA 3DFIA 3B7PA 3P96A 1ACJA 3LY9A 1FFBA 3PICA 4CL0A 1J2RA 4P4EA 5IAAA 2AI3A 2W2KB 3VVCA 4Z2AA 4GR5A 2Q45A 1KGDA 3I9OA 3OZSA 3DVLA 4AECA 4KKVA 3OHSX 3A6PC 3GFPA 3WHIA 3S9LA 3U80A 1MHTA 1HV8A 3K70D 4C9VA 4URYR 1Z07A 3SSNA 3GLFB 1DV2A 2J1LA 1Y4UA 1N2JA 3V3TA 1MO4A 3KR1A 2GOYA 4JLKA 1UBKS 1Y3CE 1B8OA 3TJMA 3U5TA 1DKQA 4ZQCB 5T67A 5KOJA 1BX3A 1G1MA 1XTIA 4GYYA 3H9CA 5FRDA 4C4SA 2HQBA 1ZRMA 4DLVA 5JRDS 2VSNA 3TW8A 5AQ1A 3MHPA 1L8OA 4TN5A 3WC4A 2AH5A 2WTXA 3GC6A 3ND7A 2EWVA 3AQ4A 1YZHA 3HDHA 1S0UA 2A30A 4PM4A 1KORA 1NLMA 4Q9KA 1I3NA 4FLEA 1F4PA 4I3GA 1BQ3A 3LW7A 3O8OA 2Z09A 3FR7A 1A76A 2BMFA 2BI8A 1OWMA 3B5IA 3OF5A 4GE3A 4ER0A 2QX4A 2Z57A 1ENOA 1PG5A 3AEUB 2NZYA 4JKYA 4L9WA 4TXLA 4U0KA 4ZP1A 5DBFA 3T7DA 3TZCA 3TZHA 5C4MA 2VF7A 3AHDA 1OT3A 4YPFA 4V0RA 3HR4A 4CKCB 3DTVB 1Y98A 2JJQA 5I4CA 5KTRA 3NNDA 2GBIA 5AK4A 2ZRMA 5DLEA 2DY1A 3D9QX 3PJEA 1HOTA 4U63A 3T7SA 4BNFA 3UCEA 3V1UA 3E9MA 4PGGA 2J31A 3G0BA 1QVWA 5EJ4A 2EARA 1H2ZA 13PKA 1VLLA 1W47A 1ZPDA 2M98A 2W11A 3SS7X 2YXBA 4YACA 4BEBA 5JNRA 5KTMA 2O2JA 1AS2A 1YZKA 3NBKA 3BSWA 3AP1A 1WEKA 3OPYB 3BFJA 3I2IA 2Q7XA 4M8LA 3ONDA 4I14A 3BRWD 4ZI5A 3OTWA 2C3MA 1E3QA 2YL2A 2R00A 4RELA 1XD9A 5ELMA 1HEIA 5AXBA 1PNOA 1RQXA 3QA9A 1KI6A 3DHWC 1GCUA 4IZHA 3UJBA 1J97A 4N3BA 3SDBA 2CMGA 2QQEA 4X3OA 3K31A 1PUJA 3VZBA 4H27A 1ODJA 2HO5A 3DMFA 3DMYA 1PR1A 3M34A 4DA6A 1M2NA 4XEHA 4I66A 2YJNA 1FYXA 1QDEA 3F9IA 3ES9A 3LLVA 1W93A 3O9VA 4HNHA 4IHJB 4R0MA 1NJ1A 4MGIR 3ZGOA 2IOFK 2HXSA 4JSTA 3GFFA 3U3KA 3G1TA 1ZCAA 1NN3A 2M1XA 1DIGA 3CGGA 3D8SA 2UVPA 3CLSC 3QW2A 1PDOA 1EWQA 3M1LA 2PVVA 1RZVA 2PLAA 3UJDA 3DWFA 3FMPB 4YCLA 1Y9DA 3K6SA 1DAIA 2X5XA 1WUIS 1KAQA 4DA4A 1RMQA 3OKAA 4IHJA 3UFBA 4PINA 1WPQA 2NSJA 2BCJQ 3P4YA 1ULZA 5JO0A 1QYVA 1GDTA 1BEUB 2FE4A 3RHFA 2GK7A 1C8VB 3I6BA 1UKBA 1NSTA 2FR8A 1VG1A 4QBFA 5DP1A 4B6JA 1VFPA 2D0PA 3DMHA 2EGGA 4DIMA 4KDCA 3ZCQA 1ISIA 3W8NA 1ZGJA 2XQKA 2AUTA 3FZEA 1MAAA 2H5JA 2GYWA 1VJTA 4GOND 4P32A 4B3RB 2WRZA 1AF7A 3I58A 3X1ZA 1MOZA 1VG8A 5AI5A 5A03A 1KXJA 2QG4A 2JIBA 4JEIA 1KDRA 2ZIWB 4UD6A 2Q5OA 2B21A 3R44A 1K5HA 3DH0A 4KVGA 5AVOA 4DQDA 1CEYA 4GMGA 3HQ4O 2DSNA 3IURA 4HAYA 5KQPA 1F2DA 4MKFA 5ALKA 4MKRA 5HG0A 3HUDA 1QHHB 3QV1A 2IEIA 3QVJA 3T5MA 5CB4A 3Q8MA 1I6MA 1BXRA 3GRKA 5AOAA 2PMWB 3LDHA 1Y6GA 4Y0NA 1N6NA 3TUZC 1J90A 1Y8AA 3N74A 1M66A 3M4YA 4RX1A 4CDNA 5JXHA 1Q15A 2W2LD 3QNWA 2ASEA 4K2HA 5MN4A 2QM3A 5DX1A 3U0VA 2H65A 3NYRA 3ABOB 3V4FA 1B0AA 3C3YA 3QEMB 1NC3A 4WUTA 3RC9A 1Y8QB 3TSWA 3T1TA 3K4HA 4BB6A 2EKQA 3VI4B 4HDNA 2CXSA 4DV5B 1S2IA 4GG1A 1K8RA 4HD8A 5FPHA 1G5PA 2PLRA 3SJBA 1C3JA 1ADGA 1WD5A 3ZWDA 1JQBA 2I71A 3D3WB 1J23A 1A8QA 3C74A 3VAYA 3DE6X 3D4BA 2YRWA 4KTVE 4D9EA 2OE2A 1SVIA 4DMKA 4ENPA 1E4OA 4PG6A 4XQ0A 1KQ3A 2RJ3A 2WM8A 3T1VA 1RC1A 3VPBA 2PD6A 4BKOA 3K05A 4C5CA 1ZESA 2A0KA 3QKTA 3C98A 1U81A 4Z7QB 3FI0A 2N0SA 1H93A 4CKYA 1SUBA 4LECA 4U9IS 1OB5A 4P45A 3Q3VA 3SZUA 2HSJA 3R75A 8MHTA 3SF8B 3NKVA 4ONEA 5CJPA 2FZWA 2R6R1 4D0LB 5A4FS 4NBVA 1KY3A 4QYXA 2MINB 4CFYA 3M5CA 2WUGA 1E9AA 2ZSEA 2YCLA 3O2SB 3KDSE 4O8ZA 2XCTB 4OLAA 3PF9A 4G67A 4QU5A 4G1FA 4AP6A 4CT0A 2H4YA 1V7CA 2AX4A 3OLYA 4HN4B 4TL9A 4UBLA 3GLGE 1UOOA 4I3FA 2FSFA 2R3SA 1G0OA 2MTBA 5EJIA 3EASA 3SZGA 1O0SA 4EYQA 5D5PA 3SHQA 1SULA 1U8UA 3UEOA 1OZGA 2OR3A 2X7HA 3U9LA 1MO6A 1SIWA 2X7JA 3AJEA 3OZBA 3T9EA 1DC4A 1N8KA 3RFTA 3MW8A 1YH3A 3LHSA 3WWPA 4ATNA 1T5LA 4D8WA 1MKYA 5KSYA 3I32A 4UMEA 2K2QB 1O58A 1M6YA 3FRHA 3IVMA 4OL9A 3RT7A 5KTNA 3L1JA 3NTOA 2MSWA 2FSVA 1IY2A 2GZRA 2W43A 2ZJBA 4GU5A 5BP7A 1GGNA 4DIEA 4C7OB 4H7JA 5CM9C 3AY6A 1J0XO 2WIKA 1KJWA 4CDRA 3HJGA 5K2OA 3EEOA 1P18A 1U6KA 1GGFA 1NMZA 4ER6A 1KI9A 1RWOA 2CLHB 2C5GA 3EMKA 3M6XA 1HNNA 2HN9A 2VDQB 5FL3A 4DT1A 2H2DA 2J9FA 5JH7A 3I09A 4BFTA 3IAM1 4BFXA 1NVXQ 2A58A 1QE5A 1BW9B 3FPLA 1PW5A 2BMJA 5F2NA 3KQYA 4B7CA 1N2ZA 4LY3A 3C4QA 4ZJZA 1L7DA 5IT9A 3O91A 1TO1E 3SHFA 4ITVA 1M6VA 3CUEF 3RJMA 5FX2A 5JANA 2VNKA 3LZDA 1FNNA 1I5RA 4DT1B 1YT5A 4DV2B 3BCSA 3PR3A 5BRJA 3NHJA 2OO3A 1XIVA 4RMJA 3ZNOA 5KNDD 1L7RA 3KJFA 5EMKA 2BBOA 4NZMA 4X45A 3VXKA 3FDIA 4DC9A 4HB2A 1M1YE 4N5MA 3ACCA 2B8WA 3RC3A 3U7IA 1F6WA 1GA6A 2YFKA 3NKLA 4CLOB 4F8JA 4DSNA 2I6QA 1GD1O 3NIGB 4RQUA 2VN8A 4IICA 1E18A 2QV0A 2XA2A 1XDDA 2GH1A 3C87A 4PGMA 1L5KA 3IVRA 4GRDA 2JARA 5DF1A 4JASB 3A6LA 3GUCA 4KK3A 3AFOA 1A82A 3A11A 5DULA 1QHHA 4BJHB 4JLOA 1BFDA 4X92A 3M6LA 4EHAA 4EY5A 1W2WB 1B73A 1AHPA 3OQ6A 2BFEB 3I5AA 5E38A 1PL0A 1TE2A 4XSVA 2P5TB 4TT8A 4HNQA 2QJRA 4QGHA 5LVAA 1NR1A 3F6YA 4KWTA 4Q3AA 2PBRA 5G3ZA 3EDCA 3UKOA 3EWAA 2YOHA 1VZ3A 3UGTA 1X80B 3LGAA 4L73A 4O2BA 1RBQA 4P35A 4MHTA 3KJXA 1IAQA 5A5VA 4PSAA 4EZEA 3ZHZA 2A8YA 2F1JA 3OQNA 3NKFA 2P4HX 4YCBA 5IUKC 4C4PA 3W5AA 3SHTA 2JBAA 5JDIA 3AL3A 1WU8A 2VPIA 1EG2A 1TAHA 2HREA 2RHHA 4M21A 3SC6A 5E9JA 2O8NA 3U13A 2XVXA 2RGXA 4QDUA 3RS8A 2ZJ8A 1KKLA 2PKEA 3OECA 4DLTA 3AVVA 4DIOA 2ATEA 3I9MA 1OX4B 5KINB 4DOMA 4O02B 4M1QA 4BQRA 5J4YA 1IPHA 5DW3A 2COKA 2DCUA 3KQVA 1U7DA 4GSLA 4UHEA 1TUBA 2ZB8A 3V4PB 1QOQB 4YRFA 4CF3A 1DT3A 1QWSA 4I5GA 4U9UA 4JZ0A 1QH0A 2QQ5A 3TTVA 1Z56C 3CB2A 5GM2A 2XUGA 3IC5A 4K03A 4KU4A 3DGEC 1LDYA 2D06A 2YJTD 2BJWA 3DUWA 5CT5A 2NVOA 5G3YA 4WLVA 4XDYA 2OHVA 2WSSD 3QZUA 5T3UA 3CRRA 4R9UC 4YA6A 1FFAA 3KPUA 1Q91A 1THTA 2Y99A 1ZMOA 3ZCRA 4LRSB 2F3TA 2O7SA 3PRKE 4N8DA 2R7AA 3B6EA 2ID7A 3C1OA 3DEAA 2FFHA 2RHLA 3FTQA 4GLFA 2Q7OE 3RWBA 4B9AA 4DFDA 1L4YA 2LPMA 3HBAA 5IASA 2VHCA 1MX5A 1QKKA 2IUTA 5LDHA 2DECA 2GTIA 3HFSA 1RWBA 5DWQA 5L7TA 4GEGA 4RTOA 3WGMA 3O93A 3NIBA 1T15A 1VDMA 1VI2A 2IP2A 3KXKA 3L93A 4LMPA 2GBLA 4MW0A 3GFRA 5A3SA 3F3MA 4KVZA 3TIIA 4LJAA 1GU1A 1HKUA 3CUUA 4P9NA 4MQ6A 3RAPR 1NYTA 3ZJYA 5DFAA 3FZQA 5HZGA 1MJ5A 2Y8EA 3BWCA 1E6LA 3AKYA 3W2TA 1Y82A 4KIJA 5I7EA 4TTSA 2HR1A 1A4IA 4C08A 2ADMA 1JQDA 2ERXA 3LKZA 4L8WB 3THOA 3WJAA 4BNGA 2FN7A 1E89A 1UK9A 2NV2B 4Z4EA 2WD8A 3BGWA 2W4MA 4WA7A 2O2IA 5F35A 2Y0PA 4K46A 1L7AA 3BC1A 3H1FA 1EWRA 3FNRA 4UNRA 2HNBA 1AB6A 2CEAA 1L5HA 5HS6A 3JXEA 4LKRA 4WJLA 1SKAA 2H7XA 4IDNA 2XI4A 2Q3BA 3CNNA 1QIEA 1PHPA 1XSEA 5IZ4A 1R9NA 2HTFA 3HLKA 3UJ8A 4BBPA 5DM70 1FS5A 4Z49A 3VHXB 1PUIA 4YO8A 3DDHA 2GBPA 1BX1A 4BLRA 1RXYA 3A7EA 1E62A 5DN9A 2FW1A 5F5LA 2QJOA 5ARCA 2ZRHA 4LY9A 4UUMA 4RW0A 5E7IA 1O1YA 1H5UA 1GGMA 1MV5A 2NO7A 1ND6A 1T8UA 3FUTA 2QIOA 4U8HA 1QC5A 3PXEA 1U0RA 1HZJA 4WZZA 5CAEA 3BRWA 4MR8B 4LMBA 5HM8A 3CZ4A 1QAQA 2XE6A 3JQBC 4ER5A 2O20A 2ZYGA 4X44A 4U4AA 4FNMA 3E8MA 4MWDA 2AXEA 1LUAA 3N2YA 1XEAA 2AMYA 3HN2A 4XDHA 2W98A 5KMGB 1X0XA 1R4NB 4PGHA 3I4CA 2C9MA 2V7QA 3MWEA 3RSOA 3E35A 1L1EA 3PK0A 3QV2A 1US8A 2PCNA 4Q9HA 3ZDZB 4UE3S 2JFYA 4UZEA 1ZSYA 2CVQA 1IJKA 5ITZB 2XA9A 1SC6A 2JKZA 2PGNA 1E3MA 2E1PA 3UBMA 4EB0A 1ZHHA 3D7NA 3IBCA 4HRYA 2WYWA 4UFNA 4FR0A 1I3LA 3PE6A 4I9NA 1GSIA 3FJOA 1TIBA 1BDMA 4UNSA 2Q07A 3EUWA 4BFUA 4EG0A 2H2WA 1OC4A 4XAQA 2O4CA 3H9GA 3U09A 3HB5X 1T0HB 1DUVG 2WTMA 2A3NA 1KVRA 2VHXA 4OXQA 1Q7GA 4CQJA 4F6CA 1Y9ZA 1FFWA 3CNHA 3LC0A 5IK2A 1Y1KE 1L4BA 2VJNA 4WOCA 2ZM5A 1EDDA 4H7PA 3GGCA 1NLYA 3G9QA 1TLFA 4MJ3A 4YQEA 2V58A 1NJSA 3L6RA 2RGYA 4PGAA 3ROEA 2C03A 1GQ2A 5BSKA 2RHTA 5CXUA 1CY8A 3EZYA 1RFGE 4I50A 4IQ0A 4JZYA 4M9RA 3ZI7A 1JAXA 5J4HA 1KIAA 5CG2A 3WIOA 1YFJA 5JC1A 3BMOA 4J3FA 2CLSA 3O2QB 4MLDA 2MMGA 3F5FA 1K08A 3QMMA 1MEJA 5TS3A 1JFRA 5IANA 3LT4A 1K6JA 3KZVA 3O8QA 1OLSA 2IXGA 2IEYA 1SKMA 5G0TA 3DLTA 3KT8A 3RYCA 2P27A 1HA3A 4GUDA 4QD3A 5IYZF 4TV9B 1E2HA 4RPJA 1YS6A 4CFSA 4ZAXA 4EDHA 2OV1A 1JG4A 2R6HA 1GITA 3ICOA 4RNDB 4BKMA 1PGNA 2CMFA 2Z4TA 2X2FA 2O5VA 3EVNA 4IIVA 1YASA 4PR3A 1YB2A 4PWYA 2GZ2A 3FPCA 3MGAA 4C43A 2XB6A 4QJ3A 1C8KA 3D0OA 3A06A 3EY4A 2ZT5A 5BQXA 4RLHA 3H2GA 3GRRA 3FR8A 1YJQA 2HZBA 3ONFA 4XD7D 1E96A 2AFHA 2Z5VA 3QWFA 4UTVA 4UBJA 2GK4A 2IIBA 4Z4IA 4F3TA 3K1ZA 3UZUA 1N6LA 1YNOA 1V5FA 3B85A 4UXIA 4CGZA 2ORIA 4G65A 3R0VA 4NE7A 5KU1A 3NGXA 2QRJA 5AP9A 2UYYA 2JFFA 5EMHA 4C14A 3FZYA 4HFNA 4LOKA 4LRTB 5EZQA 5G0WA 3L84A 5F9FA 4HN2A 3L0PA 3ON5A 4BO9A 4JENA 2AF3C 4C1BA 4MV0A 2CLKB 1KVUA 2PRIA 1D09A 2QX9A 2VHWA 3HSYA 1NW5A 3PDWA 4D9NA 1J8MF 1PR6A 2QXUA 4AP9A 4TTAA 3CRVA 2BGWA 3LLUA 1Z26A 2P6UA 2Z9CA 4N54A 1GRVA 4HDRA 3V48A 2A0XA 4C4XA 2ZR8A 3S70A 1W25A 4P38A 2YN0A 5FBVB 1TT5A 1SUSA 4G0PA 2EZUA 1FP2A 2DQZA 2JLRA 5HRUA 3PGXA 5B3KA 2Q4EA 4DM4A 4JGBA 1ZN8A 1DB3A 1H0HA 1SG9A 4F1KA 5DYNA 1BN6A 4NI5A 5DHTA 1N36B 3QE2A 5DZSA 3B1ZA 4HDRB 4YFVA 3IDOA 1H4VB 1RBMA 2G6BA 3VOAA 3UB2A 1MMFB 4CV0A 1H23A 1Z4LA 2H07A 2IEBA 4BIMA 3CZPA 1O96B 4HYYA 1N8NA 4JFAA 1XDZA 4JXKA 1LJ8A 1WF3A 1I2ZA 4MHSA 2GRJA 3DE0X 2LNDA 2A94A 2PL1A 1T4GA 4E5SA 1JT9A 1KJYA 2LUOA 2VRWA 4C03A 4S04A 4DEXA 2QT0A 2ZJZA 3A27A 2Y1XA 3DKPA 5DT9A 2PSFA 2KM1A 4XYGA 1DWQA 2QN6A 1XGKA 2Z2KA 4K87A 2AN9A 3RSGA 4YNBA 4PQYA 3TNFA 4DQ0A 3CLRC 4FS8A 2K4MA 1L6RA 4AZ0A 1OHHA 3BRCA 1TEXA 3EDRA 2C4HA 2FETA 3KQQA 2G9QA 1WMAA 2FN8A 4Y98A 2J09A 2DYKA 5BV1A 1ESEA 2WJVA 3DBVO 4O25A 2B8EA 1GCIA 5ALGA 1RJWA 7AT1A 2X8JA 4I4IA 1D03A 1OLXB 4TZKA 1T24A 1QPGA 4Q9JA 4LDAA 5DX8A 3LBNA 1OW3B 1O89A 2POCA 3KR2A 5C0OE 3ME5A 1G7CA 3LWBA 3K5IA 4NV3A 5JNUA 3HVJA 4KHPB 3U7GA 2B4YA 5GVSA 3UHOA 1DE0A 3C3KA 4V38A 4ZALA 3S5UA 2X0SA 3OZGA 1PW7A 3MZ0A 1G1AA 4MVYA 4ZXPA 2O0MA 2YVKA 3D7MA 1SXJC 4M6WA 2QRVB 2HWYA 2VDWA 1GFZA 4HNAA 1W2GA 5FFNA 3IFSA 1G8KA 3VAAA 3W3AH 4L08A 2D5IA 5KOJB 3BMCB 1JEQB 2EBWA 2BHRA 4ICIA 4DIBA 5E0KB 4CM8B 3HP4A 3OM9A 1O95D 2OTCA 3EDQA 3KC2A 4GXTA 5CYOA 5KOHB 3TCKA 3ST7A 1OH8A 5I9TA 1CRLA 5HS4A 1U94A 2X1HA 1TYBE 3K72B 4GBMA 3QPUA 1FU7A 4IVRA 5EIEA 3GT0A 3WLFA 2P79A 4JJEA 1A27A 1JR3E 3CVYA 3IKTA 2H92A 1HFEL 2QRUA 3QG5A 4KAFA 1P29A 3L5OA 4KXQA 4WD3A 1C4OA 2IU6A 1R37A 3V55A 2FOXA 5JWOA 1N5IA 2I7DA 2HSEA 5KNDH 3FTFA 5DB4A 1E98A 4YASA 4CW7A 2YR0A 3SLGA 1NW9B 4TXMA 2I2BA 5ALJA 2GDJA 3N5CA 2HCRA 1XJQA 1OAKA 1XT6A 3OZRA 2C4MA 2ODNA 5AM4A 4BZWA 4EGCB 2DPXA 4PZLA 3IAS1 4F12A 3EXG2 5IK2D 4OMCA 1V8PA 3UJCA 3HP7A 3INGA 2HK9A 4ROTA 5B53A 3RFFA 2C5QA 2Q3CA 4K9SA 2YHIA 3I4FA 4OAQA 4YJKA 3TSOA 2YNMD 2XQIA 4LWPA 3P26A 3R3VA 1F2TB 1ZVMA 1M6NA 4BVBA 2RGWA 1JYEA 3LWDA 1KPGA 5HKOA 2Y4NA 5EPUA 1GLVA 2GO7A 3KQTA 4ZPXA 2H0QA 3TINA 5CVTA 2UZIR 1U9YA 3GJTA 2HF7A 5KYGA 1VE3A 2UZ1B 4CIVA 3HXMA 3EF1A 3JQAA 4H3KB 3Q9LA 3VGPA 4JI4B 2IS4A 5FI5A 4CLRA 3EZAA 2FSPA 3BERA 4P3XA 5EN4A 1EBFA 3E22B 4WLNA 5EUBA 1G3IA 1WDMA 3I6IA 4KSBA 1KI2A 3IEIA 5CK4A 4I99A 1Y7IA 3E03A 2RONA 4QG3A 5JMOA 3KEFA 3TUIC 5A6SA 4H08A 1JEYA 2O07A 3BG5A 5CFOA 1HYGA 5DM2A 3ODGA 1DDOA 1IPEA 4YP0A 2BFPA 2CFRA 2B4TO 1H6CA 3PGA1 1ZD3A 3WNVA 2X9GA 4FMDF 1C9DB 4EFMA 3BULA 3DEKA 2QR3A 2QN2A 2RGNA 4FD3A 4G63A 5IH3A 2XT9A 4KN9S 1EU1A 3E4DA 3EZNA 1T9BA 1TM4E 4U00A 1TLLA 1TF2A 1V1RA 2CDAA 2QAGA 4PS0A 4W5HA 2EBHX 3MJRA 5E1OA 1UJNA 5THKA 4C6SA 1ML4A 4G5HA 2MHCA 2VFAA 3DM5A 4U6NA 4EMBA 3AR6A 4TKVA 4EJFA 3RU3A 1M67A 4M88A 4C7XA 2Z2YA 3IT3A 4Q19A 5HK9A 4E5UA 2AJBA 2W5UA 3T99A 3W8RA 3ZK9A 2VT6A 4ZV4A 1E9CA 5BVHA 4C05A 1ZRHA 3DULA 4Q4JA 1ISGA 3HZZA 5FT9A 5KTPA 4AJEA 2IT1A 2WMNB 2QTNA 4IUYA 2VHTA 1FTNA 1XZQA 3QBVA 4RJKA 4TLLB 5TQ2B 1IWBB 4B17A 1XCJA 1ONOA 2P2NA 2ZP1A 1PK7A 1T6BY 4G23A 1J49A 5I9BA 4OQDA 3V8NA 1R5OA 3FSRA 3IHWA 2CVFA 4LFAB 5ALPA 4B3GA 2BY4A 1UDRA 3DOCA 3TO5A 4AJPA 1TI7A 2I0FA 3ED1A 4OXYA 4L22A 4CN8A 1EAYA 2AGVA 3JD1A 2AV6A 4KNVA 1I9CA 1ZI9A 4BATA 2H11A 4BVLA 5THQA 3Q9NA 4ASUA 2ZDGA 3V7FA 3RCBA 4K88A 5F98A 4I50F 4PNHA 5DMXA 3UT5A 4UZSA 3MEQA 1SMKA 1UJBA 4GXNA 4K0RA 2C9DA 3TZLA 3UFXB 1MC8A 5BQOA 4LF9B 3Q7SA 1KO4A 3ZZMA 2PSSA 1EJ0A 3UV3A 5IBQA 2QAGC 4QUJA 3K30A 5LP1A 4GNKA 3WWCA 3L7DA 5E6RB 4A2WA 1YRQA 2IBSA 3QELB 1PZFA 4FHFA 4UHKA 5CYFA 1GAEO 4BO1A 3QXCA 3G3EA 1SC1A 1E0AA 1AXRA 3DG9A 1M8JA 2H17A 3GJ6A 5P8WA 1DTEA 3IEPA 4BV8A 2YDXA 5LLDA 1N7IA 3COPA 1VCMA 5K7SA 1M5UA 3PRHA 5TVGA 3QY9A 5JZSA 4YAWA 2FPIB 1V3VA 5LQDA 1QHSA 3GJSA 4G5QA 1WXEA 2GBFA 1Q3TA 2AL7A 1G66A 1DE4C 2IFTA 5JC8A 3N0WA 1GZ3A 1N2BA 3QFTA 2AD5A 2FGKA 2IDJA 2ZYVX 3FGOA 3HCFA 3JQ6A 2VSFA 2PRYA 2AFIA 2YWDA 3G2HA 1Y5MA 3VU3A 5TRTA 1N6RA 3FGPA 4NULA 1H3NA 3G1UA 3C3EA 121PA 4PN3A 2NO4A 5B6IA 3E2MA 3GEGA 3OPVA 2IHBA 2FKNA 7MDHA 4HEQA 2GFHA 4MS3B 4ARSA 3NUZA 2H1RA 4JL6A 2JCGA 5EZYB 2E4WA 1E9EA 1Q2UA 3ED5A 1D2EA 2QP4A 1DQNA 1LFDB 4QOIA 5CB8A 3WSVA 5JCOC 2XYHA 4NVRA 1OOEA 2P9GA 3P9YA 3LBAA 1X7WB 2Q1TA 1DC5A 2BGKA 5LYYA 1GVNB 5F5XA 5AKLA 2VSQA 3C43A 4L15A 1VIDA 2RJOA 3W9YA 4D3YA 3IQZA 3MIIA 5SY9A 2IELA 2C2OA 3MBKA 1QAOA 1C7IA 2GWRA 2X13A 3JRXA 3UMVA 1UPXA 4C04A 4B09A 1EX9A 4L6IA 4OYYA 1XJWA 3LG2A 4PRKA 1HURA 2F17A 2KW5A 1IBLB 2DLDA 4V24A 1B23P 2ASVA 2X8WA 4OJMX 1SCBA 2A14A 2YJ4A 1BFUA 4L85A 1P5HA 3NAZA 1PUXA 1M34B 3IEXA 2Q6TA 2VDLB 3L1IA 1BA2A 4IIXA 4QE3A 1CUIA 2RGEA 4DLSA 3WKEA 4D80A 4DTCA 2ZUVA 3F67A 4XPIB 3VISA 1PF7E 2I8CA 2PKWA 5DI3B 3BMNB 1XQVA 4XVUA 4WXEA 2P35A 3CEPB 1DX9A 3K8YA 4NWIA 4UATA 4CF4A 3MCVA 1NL3A 1KRWA 3VZPA 1AU9A 4AXXA 2ZTUA 4J94A 3ZCUA 1FNSA 5BWNA 4B7ZA 3A31A 1UBOS 1KJ8A 3NJRA 4QPDA 4XXHA 1F8UA 4HGOA 4CIXA 2I99A 4OAPA 4GFDA 4PX2A 3FJYA 5AXAA 1U3FA 5ULLA 2C2WA 3L0IB 3MLBA 3DW3X 2IYPA 1KMCA 5ICGA 1UMKA 1BD3A 4LISA 1PV4A 5T6BA 3WB9A 4J4HA 6Q21A 2HPVA 3GW8A 1JFTA 1VL0A 3A6ZA 4HN9A 3CC8A 4OSOA 2BZSA 4W1RA 2BFFB 5JDCC 3B2EA 1S8OA 1FTYA 3FCOA 2XE7A 3BE4A 2D54A 3FYUB 4F4FA 2FEAA 2WP0A 2YIJA 4LDZA 5HR5A 2C00A 4RPKA 4N5HX 1XKTA 2EGHA 2H06A 1M5RA 2Z2JA 1NURA 3QUQA 5BURA 5D3KA 2JGRA 4L7QA 4CM6A 3PD1A 3FFXA 5FCDA 2JIDA 3ISVA 4N6GA 3ZIAD 2D13A 1MW8X 2FSSA 1G8JA 2F64A 4X60A 3I34X 4FDAA 2AQ8A 1J0DA 1TQDA 3W5CA 1ZGGA 4M4SA 2O2XA 1JZSA 1WSWA 2XH8A 3PT9A 1EFCA 4DY6A 1H0RA 3U7RA 2NGRA 2CMKA 5L95A 4J0DA 2XNJA 3IBYA 5KKNB 4G36A 1GNLA 3H2ZA 3R5TA 4Q1BA 2NZUG 2RH8A 4HVAA 4YEDA 4B2IA 3D6FA 1HR0B 4I6JA 1VXOA 2QE7D 3JR3A 4D79A 2QVBA 3RYTC 4JJ6A 3D81A 5BYJA 1B3RA 5BNWA 3R0JA 4L1KA 2R87A 2HWGA 4BIIA 2Q3EA 3QKIA 4PYNA 4AICA 2IH2A 5HZHA 4YR7A 3V1NA 5JTUA 1C2TA 3CPEA 2AMFA 2QU7A 2ID8A 1QYWA 2WB2A 5JY6A 1JHVA 3GI1A 1J33A 1K8YB 5EG5A 3VKFA 1BXGA 2HNKA 5I47A 1YOVB 2OXCA 2YBDA 1QFJA 3D8TA 1IQ0A 3ONNA 1DQYA 3ONWA 4L74A 5CH5A 3KJEA 5A5DA 4GR4A 3ICQB 2F1IA 3V4ZA 1IN4A 1ODFA 2ALJA 3A4VA 3W34A 4MPJA 3KYCB 1KZ6A 1P9RA 1VIMA 2IGTA 3B8EA 1XCBA 3NHAA 3IB6A 2AG5A 2MR6A 2PVPA 2ZJ4A 2G63A 2GWHA 3NGMA 1BDJA 3O8QB 4K86A 3DNFA 4LZWA 4E31A 1J1ZA 1YB7A 4PW0A 3EGWA 5JAQA 3THSA 3F3YA 2DSTA 2F1RA 2VH2A 3C45A 1O6GA 2I2WA 4FJ2A 4MS3A 2JGLA 1YBVA 3LK7A 3OURA 2NUPA 5KC9A 1WUHS 4AN1A 2NZ2A 2YZKA 1ZN7A 1N0WA 1T9AA 1UK8A 3K92A 1K88A 2AW3A 2HQ1A 4UQPA 1TYAE 3LX4A 4IIHA 2JLYA 3VHQA 3SEQA 3T3MB 1SK8A 1XLTA 3VPXA 1N5KA 3DHYA 3GYGA 4E2XA 1SIOA 3W79A 1T6NA 4NCBA 1AV7A 1KNQA 2ZTLA 3H11B 5A3VA 4FFRA 4UPVA 1UXKA 3ICVA 2B4QA 5AQEA 3ZWXA 3PWSA 3C8MA 1TEZA 1M8KA 1NN1A 9MHTA 4LPSA 2PT5A 3DO6A 4CVNA 1V45E 4RVDA 5C7IO 4YJ3A 3GOQA 3ZXIA 3IP7A 4LE0A 2FRVA 1R9GA 3QJGA 4GMHA 4HDKA 5TQJA 3LPCA 4FOSA 3QPAA 1D04A 1R6UA 3QW4B 2OAEA 4UW9A 2M1ZA 5K6TA 1M83A 4EA7A 4OA8A 3GCXA 4B3CA 3UMYA 1MH1A 1Z5WA 4EG5A 2QW0X 3CX7A 2FZGA 2A0UA 1T5BA 3LY8A 1YQDA 4R7GA 3PFNA 3WFJA 1TO6A 1ZVQA 2XZTA 3DOIA 3IMCA 3SDZA 4NE9A 1H6BA 2XOKA 3E3AA 1JB1A 3LOPA 2G9NA 3ZV5A 3EG9B 3GHHA 2FE1A 1SXHA 2O0KA 3HU2A 3ILXA 3K73O 3RRMA 3X44A 2BMWA 4OC1A 5DCWA 4WT7A 3MJEA 5EMMA 5C53B 1U2RA 3AIIA 3UICA 2QOEA 4PZCA 1N6HA 4LHEA 4UVGA 2VYVA 1LWOA 5DPMA 4WX2B 1ISPA 1ZM4A 4J4TA 3BE6A 3M1IA 1B3BA 2OPBA 2D1FA 4GH5A 4HXGA 5HK8A 4FM9A 2F8TA 2VJMB 4MVJE 3U1BA 1BQ4A 2QF7A 3IQHX 2BGRA 3L3BA 1CS4C 3HCNA 2PEZA 2F8SA 3OOSA 3FF4A 2C88A 2FYTA 4HP8A 1Q77A 1XVTA 3CLKA 3PJDA 1CP3A 4WOBA 3OJFA 4DDUA 4FDTA 2D4HA 2PWAA 3O8NA 3RSSA 1DIAA 2R86A 3ESDA 1JU9A 4D4MA 3MINB 1M8PA 2ZATA 3WBJA 4AY5A 1P5ZB 1Z28A 1L5LA 1CETA 1Q1AA 3QPBA 1KQFA 1JLSA 3WGVA 1IM2A 4MRMB 2FMFA 2NNLD 3SQWA 4I2NA 1E0KA 4FR2A 1ORIA 2X8JB 1Y34E 2QRQA 5GADl 1ABFA 1HDIA 1OBHA 2A4KA 2L17A 2Y71A 3HCAA 5LBIA 3VTFA 4DV3B 4YV2A 1E7YA 2ZRPA 4JCCA 4IRXA 1RMYA 4TKUA 2Q50A 4ODIA 3IAAA 3RADC 1ZL2A 3VJMA 1NT4A 2B94A 1K7EB 2ZWAA 3H17A 4LF5B 1FFXB 1WF6A 4D9MA 3H9BA 1YMVA 2OHXA 1W36C 1C0LA 5E2AA 1EFPB 3VBEA 4BHTA 2K2WA 1OKKA 1GUBA 1H2WA 1CZRA 2JGKA 4L8LA 3OUUA 3ZXUB 1XZPA 3L05A 1R0CA 1ESMA 1F0YA 3B52X 4OOFA 4RVNA 1GM5A 1Z7YA 3KKEA 4ENTA 1C7ZA 3JQ8B 5CA1B 1ZX1A 4UBOA 1M8GA 2NU8B 4IQFA 3P8ZA 3R2JA 5BXQC 4G1BA 4Q37A 2EBUA 3I74A 3EA5A 4C01A 5IC4A 3IQWA 2NADA 3Q7PA 4RGVA 4MTLA 1TL7C 2VNAA 4CMCA 4OGGA 1TM1E 4YPVA 5DHUA 2D6FA 2CXUA 2XYPA 2XCSB 4RXUA 2E4VA 2NZJA 4F4UA 4NENA 3H19A 1YKSA 1V3TA 2IOYA 2BFMA 4I1YA 3RPEA 1CRWG 4L8YA 2TRSB 4RZHA 1V7ZA 2PYDA 2RH4A 4G6ZA 5HBRA 3ZDQA 1ZIYA 3PQ2A 5EJ5A 1R6BX 1S4MA 3VO8A 1X7ZB 4OMUA 2C3UA 2QPTA 3B78A 3A1WA 4DSUA 3AVOA 4KN5A 3THWA 3DYIA 1X7HA 1E7WA 1WW2A 1YCHA 2C59A 3IQGX 3IUJA 3R77A 2EL7A 1P8JA 4IDOA 1ZGZA 4FE3A 4Z4HA 3E58A 3H4VA 1V8ZA 1OWPA 4LHYA 4UC0A 3NEAA 3U44B 2QSYA 3HDYA 5A1JA 5THXA 4FFLA 4M99A 3C6XA 5L51A 3IUQA 4YAFA 5EESA 1QORA 2UUBB 1ADFA 1SM4A 2DFKB 3PHGA 3U1VA 1TTHA 1NOIA 4QEZA 5E95A 3QE3A 4UUOA 4ND4A 3WGKA 5F7OA 3A1SA 4DV1B 4KGXA 5LZ5A 1FDIA 3JQFA 2QGNA 4XB2A 3O4VA 3WISA 3D8UA 2NXWA 3CX8A 4XOIA 3TNLA 3UKDA 4A91A 5AUOB 3JU3A 2MSLA 4D82A 1MJHA 1BHSA 1DAMA 1EWVA 3IV9A 4E09A 3RS4A 4PZ9A 4RO0A 1XVIA 1TT5B 2Z43A 3INYA 1JILA 1LDBA 1QS0A 1U7OA 3TQHA 4XX1A 5ALTA 4ZI7B 3LAWA 3I2GA 3ER9A 1G20E 1ZJWA 1OXUA 2BC9A 2GHIA 2R8EA 1LV8A 3ELWA 4UASA 4Z99A 1PP4A 1FSGA 1ZMBA 3ETGA 3ELYA 1Y1SA 3GIDA 4U6SA 3TRIA 1MAHA 3CNQS 3M6VA 4YRGA 4BO8A 1DAKA 2XEXA 5BRAA 2R00C 3DPSA 1QTNA 2YHAA 4HGPA 2J4DA 3EPJA 2H29A 1X87A 3USES 1UAAA 4ZCMA 1DRWA 4GAEA 3EHDA 4XQEA 1AKQA 4Y6RA 3SXUA 3ZHOA 2W71A 3RDPA 2O2HA 1T5SA 4WAUA 4L2IB 5KHOC 4OQZA 4YJGA 4ZVVA 2CUZA 2I1WA 3P9SA 4HGNA 3T3EA 3D5QA 3ZVKA 4F2GA 4F2WA 5E1DA 4L6AA 3A28A 1W8DA 5CNJA 1Z0DA 4N3CA 3U62A 3R3YA 4KSYA 4F38A 2AYZA 3QQPA 5IDQA 1MJGA 1FSZA 3NBXX 3M3DA 2W8BA 4Y6SA 1TIPA 2HU5A 4D4HA 2EJVA 4DG5A 5F7XA 5HW0A 1K97A 4LZPA 4NCHA 1LB1B 4ZQIA 1UMBB 5K6AA 3GLTA 1P1JA 1YL6A 4WEQA 1WR8A 3L5KA 1FFXA 4A3SA 1YDMA 2FMTA 2VHJA 4QPJC 3TW6A 1GL7A 3ZCTA 4YQYA 3HABA 3ZV7A 3NXKA 1R9MA 3E70C 4AB1A 1RZUA 1DIHA 3HN7A 1YBAA 2AN1A 4MO2A 2M2IA 5K6RA 2C7RA 1OZHA 2XUHA 5K3DA 3WL7A 1N7GA 1UMBA 1X2BA 2WICA 3M5WA 3ZLTA 4MAFA 5DYYA 4F1WA 3EGVA 4YRJA 2ZUFA 2FEPA 2C9BA 1Z25A 2PSJA 4JA0A 4JBYA 5AH0A 4HEA1 3J7AC 1HETA 4ZRMA 1K6XA 4JT8A 2ABWA 2W93A 1KBLA 3EAGA 5IHPA 3WNQA 2R5FA 3Q7EA 1WB4A 2I34A 3WL6A 4CKWA 4QUEA 5FI1B 1NQOA 4MQUA 3ZQ4A 1G5QA 1RKUA 2HF9A 2YDYA 3BIOA 1RAGA 4CUJA 5JLJA 1MX1A 3U1TA 3PQ3A 3PI7A 2P68A 4O5AA 2ISCA 3KYBA 2Z5GA 4ARIA 4G4SP 3KB2A 5GIOE 4G1EB 3L7KA 5LMCA 5GV8A 2Y1WA 1B8NA 1JHMA 3BGDA 3BZWA 3P5BA 4C7OA 4J2TA 3G8AA 4V0LA 1ISRA 3R7BA 2REOA 3PHIA 3GAZA 2OCBA 4BAGA 2HMAA 2OYCA 4IDFA 5ESXA 2I6UA 3A36A 4BDSA 5F23A 3CVXA 1SXJD 1N2IA 1NDHA 3IESA 1BC5A 2C9ZA 2NVUB 5B7QA 3D1VA 2R1ZA 1N3IA 3RTEA 5IT0A 4JOQA 1ZAYA 2G88A 1E2FA 4OQLA 5BSHA 2EHJA 2CHQA 3VMMA 4RTPA 1MO2A 4HCJA 2LD4A 4X8OA 5C8YA 4LQCA 4AWAA 1M0TA 2BJVA 1JHRA 2RHJA 2WWRA 3LHFA 2ANCA 4M0PA 3FVQA 2PJRA 2OBYA 3Q3HA 1PKXA 5F2KA 1UZMA 3V7WA 1DU4A 2VLIA 3ELUA 4TMFA 2AG8A 2CC2A 2SHKA 3TJRA 4UOZA 2P9EA 4DBVO 3QYPA 5AKZA 1WMBA 4Y2TA 3I83A 4XUCA 4TV8F 5HF8A 8OHMA 2PKQO 4L02A 5JS2A 1PR9A 1Q0QA 4BMVA 1QP4A 2C2HA 3RFCA 2P62A 4YECA 3RE1A 1Y7PA 2X19A 4TTQA 1YFKA 2MOKA 1OB2A 5B6PA 4E30A 3KYJB 5CITA 4INPA 5JASA 1QS0B 3EE6A 1LY1A 1XV5A 1RPAA 3B89A 1E9SA 1HMYA 3V4LA 3B8HA 4WSOA 5GJCA 2BDUA 1T1GA 3L8CA 1G6Q1 2QTLA 4ABTA 1UPFA 5JMPA 2PMCA 4II7A 1XPJA 5LQKA 2R7KA 3UMBA 3HPQA 3QLTA 2I7CA 4U5XA 1CU1A 1SIUA 1ZYUA 1DRVA 3ETCA 1BXRB 4S1OA 4DWVA 4X3PA 1I8TA 3R0ZA 4JXJA 4R8LA 1IZ7A 2ADOA 2J0VA 2YMMA 3KDPA 2P30A 3U7FB 1S8NA 2G1JA 2OXTA 1QIGA 3WS7A 3GLIB 4GKJB 2QPOA 3IIEA 3PXXA 4D4LA 1JI0A 4Y0AA 3MS7A 2AKEA 1XDUA 3DTVD 2BEVA 2PS3A 4MUGA 5L3SB 3MTAA 3HRKA 4YMHA 3MBIA 4URXR 5IN4A 4I8DA 4HPWA 5KYXA 4E3WA 4O2AF 1Q14A 3JQ9A 2DJ5A 4OFWA 4Q9AA 2ZIVB 4BVAA 5B30A 1J56A 5L7YA 1PR5A 3KYDB 4QREA 3TQTA 1M7BA 5AM1A 5CEJA 2E82A 1DCFA 2IZOA 2N42A 2YASA 3KALA 5FBZA 3DE4X 4FONA 1G5TA 4OXNA 3EZBA 2OBNA 1V5EA 4LCJA 3KOWA 1CUCA 5IJAA 1SKBA 2JIOA 5I4IA 4M8SA 4YAGA 3HL4A 2K87A 4FI3C 4I9UA 3NFRA 1OXMA 3L92A 1TDJA 4HK4A 2PS1A 1VKRA 1B76A 5JZVA 1BA3A 3C6KA 1PIWA 3LA6A 4DQVA 1DEXA 2DH5A 2O0JA 3DQZA 5A1TA 2PKYX 1KC3A 2BM8A 4G85A 4HHEA 4FJ0A 1E7SA 3MWYW 1OXBB 5JI3E 3LM8A 2ERCA 4ZDKA 2FW7A 5C52B 1CBUA 2PX0A 3E23A 3QUAA 4R9SA 1I4WA 1QH8A 3HCWA 3V5NA 3GU3A 1EZZA 5IT5A 3UJNA 2Q9CA 3CMCO 3O26A 1P2BA 1UC8A 2A5YB 1SBHA 2XPCA 4J75A 3RF7A 1FP4A 2P4QA 2XNCA 1GZ6A 2Q6KA 2L69A 5IU6A 2NMVA 2J3HA 3KTOA 1V2HE 4KBFA 5IJZA 4I9HA 2NZWA 3VTKA 2CYAA 2FF5A 1KQGA 2PBLA 4NYJR 5E6SB 1N1GA 5TX7A 4RL6A 3MJHA 2PBZA 5AKJA 2Z5LA 3ZTWA 3R7FA 2QTCA 1KP3A 4BNIA 5B2FA 1G4UR 2FQ1A 3C8DA 2I22A 1AN9A 1VG9B 1C8BA 5DGCA 4CQMA 1EK6A 3IIKA 3S0JA 4UXHA 3F97A 4MPRA 3M82A 1R8JA 4MLCA 3NBQA 3R6GA 3QNUA 1AKWA 3L4SO 5B12A 3DL7A 4KR3A 3JWHA 4JQCA 2GCGA 1M76A 1XWWA 2JGEA 4J49A 4Q9DA 2AN5A 3GELA 2HA3A 4Q9NA 3AEKB 3NDPA 4JWTA 3G23A 1COWA 1FDVA 5EJ2A 2WINI 3KT3A 3MSXA 4U8GA 3PUVA 5TB5A 3LFTA 5EWJB 3H2YA 4E46A 1E6MA 4LPKA 4ROSA 3ZHYA 4XCQA 3ZBTA 3DTTA 2EW2A 1S9HA 3ZU3A 1YVDA 3BFVA 4F3CA 1C41A 1PZXA 2ZTVA 1MOPA 3L8EA 2RKBA 4KV7A 1OI2A 1MVNA 2H4JA 2R84A 2XDQA 4Q39A 4MCQA 1IIBA 1Z6ZA 2E7ZA 1JLKA 1GNRA 1HI9A 3ASVA 3NRCA 1DCTA 2AEJA 5F12A 3U60B 1YQQA 1E2MA 4TS1A 4KQ1A 2YVQA 4RD1A 4D7AA 4JJ4A 1OYYA 2WMOB 3ADKA 4RC9A 2XE4A 5LNK6 5BN1A 2ZRKA 3B3QA 3SYRA 5K0JA 4IIJB 5D3MB 2FN3A 2ZFUA 4DA9A 4Q82A 5KOYA 1UDXA 1Z0AA 2FPWA 4AZ3B 5L53A 5ALSA 3GDHA 4K8RB 1N57A 1LWNA 2B78A 1FPQA 5FUYA 1OZ0A 4XGRA 1VLHA 4B82A 1P60A 1J20A 3EC1A 3SLRA 1TM3E 4DN6A 2O8FA 1NPYA 4OHCA 4MWGA 4JLDA 3VOTA 3VPSA 4RTSA 1V47A 1DJLA 4BUJA 1E9FA 4L16A 4RDCA 4P82A 2C96A 3MM4A 3NH9A 1CZLA 5AM5A 8ATCA 1UKYA 2AOTA 2VCYA 2ZSIA 2IXDA 2REBA 3HY4A 1ZINA 3BXGA 3CCBA 1G21B 5JS1A 4ZVPA 4OQEA 1IE3A 3O1IC 4U0JA 4WNYA 5ES4B 1NUPA 4X6LA 4HGRA 3TSYA 4LZZA 2R8YA 3FCYA 3GZNA 4B7XA 3ADPA 2VJAA 1WXXA 2FUNB 3C5CA 3Q72A 4INJA 3WYCA 2H48A 3R3JA 1Z0UA 4HJXA 3SSMA 1MOQA 3ZY3A 3SLKA 1YIDA 1DDGA 4RDXA 4MGEA 4Q7MB 4LXIA 2XLCA 2BHNA 5HA5A 1T4DA 5ALZA 5KYXB 1AKTA 4HV4A 5A4DA 4Q4AB 2SKCA 3FWYA 1XKQA 4EUEA 1CUGA 1CDDA 3I37X 2Q4BA 1JE0A 3LXRA 3NTRA 2XVMA 4FGUA 4NJEA 3NHWA 4WJZA 5IM5A 1NAIA 3B13B 2VK2A 1KOJA 3AK4A 3MJDA 3T7RA 1WB9A 2OAQ1 2B20A 3ILSA 2OFOA 3ZIUA 1CUXA 1DEOA 5DBOA 1QANA 4MVJP 4EI2A 4YJFA 4AULA 5ADUS 1IEXA 1BKSB 3PI6A 3LKVA 4TXJA 3A1FA 4R9NA 1SCJA 4YCAA 1JU4A 4XKJA 2CYBA 1S2LA 2WUVA 2Y9MB 2PNJA 2YVAA 4XWOA 1B6TA 1XYYA 4JLVA 4EF4A 1SOVA 3Q3EA 3VNBA 1H8ED 2C82A 3KE8A 1YE5A 3KL2A 5LZ7A 2NU8A 3F5MA 1PK9A 4UXJA 1OBVA 1G3MA 3RREA 3IHKA 4A82A 1TGVA 4B4KA 4C88A 2V0NA 3B2QA 4DE5A 1EP1B 4YCDA 1M34E 1OCEA 2IPAB 1ECLA 3DA8A 3AUYA 4N4AA 3K09A 4Q4DA 3W2IA 1EUYA 1ZCFA 1XEFA 1YC5A 2AR7A 3BQNB 2G70A 4I4NA 2V7BA 2JS7A 3JYOA 4KIFA 4EKYA 3GUYA 1MT3A 1E4EA 1ZKDA 2BMAA 2PGIA 2NUTB 2CCGA 4F6RA 2DGDA 1XZCA 4WZAB 4DWOA 3WNDA 3PGMA 2DU8A 3NVKI 5EJMA 1YOVA 3AESB 1TF5A 4LWZA 3TOCA 1KJ9A 1EFTA 3B38A 3NAQA 3PX3A 3BTVA 1PE0A 1OGYA 5BQ5A 5U1PA 4JBHA 1KHHA 5HZMA 4YBRA 1RXVA 3HU5A 4HAWA 4JNKA 4M1WA 4TMWA 4LMRA 2C5FA 3Q7IA 4L8FA 4RKFA 5HDQA 3TMKA 1W4BA 3K5HA 1NQUA 1Q44A 1T36A 2IWRA 4A0SA 2FG6C 2X0JA 2AK3A 2G08A 3PKJA 4IIBA 4G5SA 4MTCA 4UHFA 3DCJA 5E4TA 3BCHA 4CQLA 4FFMA 4OB8A 4KMMA 3N7UA 2UZ0A 3AM1A 2PKQP 3MLAA 2YHIB 2B4RO 5ALHA 1ZQ9A 2IRWA 1KU6A 1OXTA 4EVSA 5EUCA 1CE8B 1RQPA 1UXJA 1XQYA 2IPMA 3H97A 1U7HA 2VH5R 5YASA 1Y9AA 1KK1A 2X7XA 2VAVA 3MRSA 4FEGA 1E20A 1QUFA 2DM6A 2V7QD 3FHJA 4KE8A 3RVPA 3CSSA 3EUFA 1OQAA 3WHLA 2AXQA 1ADCA 1YU6A 5HDBB 2BGUA 3U3JA 2M32A 2NYRA 5JYBA 4XARA 1K8QA 1XZEA 2Q3LA 3OJWA 5JNLA 5KO2A 4B75A 1K5GA 4XI9A 3JARB 4H4DA 3T3HA 2XOXA 4C7JA 2ZJOA 1ZVKA 5F76A 2IPLA 4A10A 3LIIA 1A9XB 1GV0A 2P2ZA 3P7MA 4HWKA 2AC4A 3STWA 4BMNA 1PCXA 1KQPA 1P1BA 3TLGB 1T13A 3E1SA 3SBOA 4CDKA 3DV2A 7ABPA 1M72A 4EG6A 4US0R 2J07A 4NCAA 3KXDA 1GSAA 3HJHA 2F1KA 1I4TD 3GDWA 3EGOA 4AU1A 3K0CC 4HEA6 3GJQA 4X61A 3E82A 1C9MA 4R2KA 3MVEA 4A8PA 5AW4A 1MEOA 2IHZA 1EH5A 1QGDA 4CDGA 2H9YA 4LVNA 3GRYA 3O4JA 2VP0A 1WRBA 1QF6A 2JGDA 4EATA 3N87A 3UT6A 4NG5A 3K5PA 5B3JA 1RI3A 2NW6A 1LDGA 3ND9A 5JH7F 4IMJB 2Z8ZA 3IAM6 4ZRNA 2JBJA 3ENNA 1XTVA 3HO6A 4PC2A 4HLUA 5I01A 4GW3A 3T9FA 3IIJA 1CG6A 3NBFA 1EG7A 1JA0A 4U2CA 3WL5A 4DR2B 3OQIA 2DE0X 1EM6A 1OE0A 3ESZA 3E9NA 5EQDA 5DGTA 1BWSA 2BP7A 4LOIA 1KE2A 5FL7A 1Y6ZA 2NO9A 5JMWA 1NPDA 3HJTA 4RORA 1EXWA 3CRW1 2VYQA 3KZMA 3S8EA 1JDSA 2WYVA 5LD2B 5KX5B 5TGTA 3WYGA 3CSUA 3N70A 3MRVA 4FCCA 2HEIA 2CBZA 3ZH9B 2GM9A 1WPXA 3L7MA 3PTZA 1SC3A 4QTZA 5IZCC 1S8AA 3SSAA 2C0PA 5DSTA 1BDHA 4UUQA 2V7WA 1Q0RA 2PQ6A 1SH7A 3V4RA 4QOSA 4BPRA 3GMSA 3G2JA 5BSGA 2W2VA 5A3RA 3DOEA 2WJWA 4DSZA 4GNRA 2DULA 3KQMA 4DMLA 1RYBA 4ZIRB 2FK7A 2I29A 5J59A 3FFBA 2X2PA 1DKUA 3EGEA 1AB5A 2QW8A 5JJIA 4TKUB 4OKSA 4GVPA 1I33A 4MVJH 4Y9SA 4Q7EA 3LLMA 4ZI2A 3W04A 1UR5A 4TYQA 4ZICA 3TE7A 3U61B 2OXEA 2PCJA 2BOVA 2DBYA 2HDNB 2Q7DA 3TLAA 2GGSA 4REQA 2B5VA 3ZD8A 1MC1A 5HKAA 1RPNA 4H59A 4TQ9A 4CM5A 5DT2A 4G0WA 1G42A 1TU0A 2ZXFA 4C7BA 1Y7HA 2HSGA 1XCLA 4OLHA 2C94A 4D98A 1ZU5A 2F8LA 1UIRA 3GZJA 1E0DA 2PH3A 3KKKA 5DYWA 1DRJA 2MCFA 3KD2A 3ZNPA 5CB6A 1E2IA 1EUDB 4PPYA 3ZIDA 3U4HA 3ZDDA 5ISMA 5ADVA 4M7OA 5COAA 5J63A 3MAJA 5C4IA 5HWSA 4YRIA 4QWMA 2F67A 3MXOA 4J0GA 3JQBA 1LEHA 4OQMA 2J67A 4RIGA 4ZODA 1CB0A 3KRTA 1FEZA 2NV0A 1XQWA 3RIXA 4IXMA 1PSWA 3AI3A 2QP3A 5K2MA 5DVZA 1J06A 2FPGB 1IULA 2GAAA 5CLIA 1ULSA 5LBTA 2YVUA 5FUMA 2EAUA 3QFRA 4P80A 5CCEA 1OIXA 4B85A 4MLPA 3E7DA 1CF9A 1ZWLA 3TKYA 1DKRA 1JDVA 2CBXA 1J00A 3PKZA 3REOA 5JYEA 1P19A 3ECAA 5ALNA 1A8UA 1Z73A 2FDCA 2DFNA 1T2UA 3U5ZB 3G9TA 1YJBA 1VMIA 3N2NA 1P2SA 5KWVA 4JGGA 2OM6A 3FPEA 1PZMA 1GHTA 1KPIA 1OHHD 2FW9A 2PYIA 2ZEJA 1NQAO 2Z8YA 3F46A 3MWKA 2OCLA 3PFBA 3RIMA 3R9WA 4MW9A 2X1VA 1U90A 1SQ6A 3P2OA 4JJZA 1XNRB 2I65A 3D1LA 4L9SA 1UFRA 1P1RA 3C3PA 3VC3A 3KUXA 4Q1FA 4EW3A 2BFEA 4OLFA 1C3EA 5IF3A 3QOXA 3WLIA 3E7PA 4V0MA 1B41A 1UJ4A 3DZFA 3HKDA 1VHDA 4X95A 1SPBS 3AXSA 3TLKA 2BSAA 2YFYA 4MUNA 4EHBA 2GN8A 5F7ZA 1QHXA 1Q1GA 2WYIA 3GDGA 4ZOLF 3GYBA 3OHPA 3VR4H 5MGBA 1IG3A 3WRYA 3VHRA 5C5IA 2FWRA 4L5CA 5KCMA 5LYJF 1Q6YA 3FDXA 3R0XA 1UP6A 4JI3B 4JUCA 4XJVA 1R0SA 2W8ZA 2DPMA 4HMOA 2C92A 2JFWA 1MIOB 4AY2A 3TGPA 3DL0A 1I3OA 2VXYA 1JJ7A 2H1VA 2ZYWX 1OWLA 1P17A 4QRIA 5LQNA 5DNYB 3PF8A 1XU4A 5E6UB 3PCRB 3ROQA 3KV3O 3O92A 3WNBA 1V41E 1Y80A 3UENA 3T05A 3ZI0A 1M73E 4CM4B 4UHDA 1YAHA 1U63A 1MO5A 2PO5A 3EQ8A 3HCEA 2QG6A 4W7IA 3GLIA 1BNCA 3IALA 3TD6A 5ELLA 4FYXA 3GRUA 3HCPA 3C16C 4TSKA 3HR8A 4K5QA 1THZA 4AJ1A 1I51A 3M9WA 3U6BA 3ASZA 4JAVC 2VSXA 3T6KA 2P40A 4X66B 4GKKB 5I9LA 3DO8A 4Q4LA 1NZDA 4XTCS 3WP0A 4QLBA 3AKZA 1PYDA 3GHYA 1YJ5A 2AE2A 4FSXA 2D2IA 1KMHB 1NMEA 1N8TA 2O7NA 1ZM9A 4Q12A 4AY3A 4M9XA 2GAOA 1PDWA 3CR7A 3V8PA 3H16A 2IYUA 5T41A 2C8VA 3RSLA 1SG6A 3G89A 4NMXB 3IVXA 5F1PA 4R1MA 4PSUA 2QRVA 2VDWB 2XOEA 4PAOA 4CMEC 4EB6B 1KTIA 5HQJA 1QRDA 4GZ3A 1ONPA 2D7JA 2FWJA 3PUIA 5L45A 1CDOA 5AVVA 3QX9A 1C3OA 1NUAA 3WL3A 4DQKA 4YDSA 4J03A 3N5KA 1R3UA 3K2EA 3AL2A 3RS9A 1RPZA 3IR5A 5EE0A 1Z8FA 3WI7A 5C7YA 1RC0A 4G84A 3V7YA 4MIOA 2VOJA 4NPHA 4C9UA 3JVUA 4C8AA 1WMFA 2Z30A 1GSHA 5LQRA 3UA4A 2WC1A 1Y9JA 3AM3A 3CLUD 3L8DA 2X0FA 2DIKA 3LSYA 3BYZA 3QVKA 1A9TA 2ORWA 3SNHA 4B7UA 2OQIA 4YXFA 3F71A 4OI4A 1KY5A 1DIRA 3PNMA 2AD1A 1XFDA 4CUKA 4J7AA 2CXQA 4HS9A 5AKHA 5B1SA 3TVDA 1QGAA 1I5EA 4OHRA 4YUYA 3LVFO 1TUEA 1YWGO 1U5CA 3Q7QA 2EFDB 4MCRA 1E7MA 1UADA 5LZ2A 1XD2A 1HTTA 3WIBA 3OFJA 3N28A 4RH0A 3QXHA 4N82A 5D1NA 1A95A 3EFBA 3ENWA 3QWAA 1J8QA 3ZHSA 1INLA 4CR7A 4NCIA 4HQFA 2H1LA 3R5XA 2W2OA 1SEVA 1N7HA 2DR3A 2GTHA 3LUFA 4RM3A 2WDZA 2ZBGA 3AWIA 3AR4A 4PFJA 3BH0A 4OP1A 3ZNQA 4TTRA 4QEDA 5E2IA 1RD4A 1BXZA 1VCOA 1B0UA 3DCNA 1Z5NA 3H7AA 3P2JA 4M46A 2FX2A 4KFUA 2QG9A 2Z98A 3F6RA 4ZVQA 1KNXA 4BV3A 4BASA 3K0SA 5JJCA 3I0NA 4HH1A 1Y5NA 2FEKA 2MSNA 3BMXA 3I1IA 2WHEA 1E2NA 2WJYA 4FQ7A 1GZ5A 2ZVQX 2HO4A 2YS6A 4KJZA 3JQ7B 5FWDA 5K20A 1KBZA 2X77A 2O6LA 1SCIA 4ALMA 1KRHA 2CMDA 4KNWA 2B1RA 4QBKA 1N2CA 3R74A 1C3VA 2ZI7A 4K9PA 2LCIA 2OILA 4KXXA 4AJLA 2SKEA 2H4WA 2RIPA 4OUDB 3UJ6A 4EY4A 1YB4A 5C1OA 1E8DA 1W4RA 2BVNA 1G3RA 2BISA 1WCYA 2CNWD 3FCAA 4GKVA 5DRYA 2QMOA 2GF2A 4BRWA 4W5QA 5AKYA 5AVRA 1TGYA 4PNPA 3T3DA 3KSMA 3SK0A 3GFQA 2VR1A 1BKDR 5TXGA 4ED9A 2O1XA 4UU0A 3RFVA 1YR1A 2DQ4A 4WK4B 5B5SA 1GOTA 4W5JA 4AUKA 1WHTB 1NJ5A 1DJNA 3GRVA 4MGYR 4XWYA 5K8CA 2FLKA 1NYLA 2HWKA 5KWJA 5HKBA 4RMHA 4HAZA 1Z4KA 3K32A 4A0GA 4AW9A 3DZCA 2F9LA 3A4MA 4LDNA 1KI7A 4UCWA 4ESOA 3NVMB 2VQ6A 3VA7A 3H5TA 5EJ9A 1XLVA 1KTVA 1Z6QA 1GGVA 2ZRBA 4ZT3A 1KPHA 3COZA 1AK1A 2YYYA 5CNIA 3N7AA 1XMQB 4CQMD 1T34A 3PDUA 1ZYMA 4WKPA 1E6CA 3IP1A 5LQMA 4X0EA 3IUNA 5CPFA 3CW2A 5JS7A 5CRIA 1HQDA 3LP6A 1L4MA 3DBHB 3IDSA 4P3PA 3SEAA 4QKQA 4F5ZA 4GMDA 3N0VA 1OH6A 3ANLA 2B6HA 4OEHA 3S55A 4RZ3A 2OCGA 3IIIA 4JLNA 1C1DB 1ZXXA 2HROA 2WPDA 3EGIA 3D6JA 3MB8A 1HDGO 4XASA 5ITZA 4H0FA 3G1WA 2YXEA 2O1SA 4H17A 3WG9A 3JQRA 4Z8XA 5ECWA 4FT2A 1E59A 4U5QA 3ADCA 1RXCA 2AXPA 1WCIB 2XX3A 4JOSA 5GV7A 1KL7A 4J4BA 4UTRA 3AJ8A 2AZTA 3GZTB 3QX3A 2ZAGA 5JXJA 1P5RA 3VI3B 4KXUA 2Z4RA 4MR9A 4X00A 1IN1A 3EVTA 4QRDA 5AK5A 3KELA 4KDEA 3S3TA 1HM5A 3TW8B 1P2FA 4YHBA 2C98A 2I78A 3IO5A 1E7QA 4P34A 3K8OE 3STUA 3ZZ0A 4DKJA 2J87A 4EHFA 1QIHA 4B3SB 1KK0A 2WU0A 2DZDA 2JHAA 1R50A 2IF2A 3TH5A 1JV2B 1RCUA 1XNHA 5E4JA 3C5HA 3AG6A 2FH5B 3GJ5A 4YDHB 4S0ZA 5AXDA 1LZLA 3VAZA 2XA1A 1ANKA 3L4KA 2FUEA 1E1RD 3MRXA 4TYPA 3FCXA 1WPGA 4WNAA 2FK8A 2QYSA 2LRHA 1GZHB 2WAAA 4UAUA 3GIWA 4DIDA 3SOZA 3WLOA 1ECCA 1T4CA 2BGLA 2GEFA 2KMLA 1Q3HA 2ONYA 1T2CA 3AETB 3D54D 3IAS6 3ZZUA 1M2KA 4HGYA 2QVCA 3RVLA 4AJ4A 3GMDA 1YZGA 2X9NA 2J5KA 4RIEA 3RUEA 3ZW7A 4FBMA 4FUQA 3EX7C 2EDCA 1EZBA 4NK4A 3EPKA 2I03A 1IZ0A 1R6VA 3T8YA 1SOUA 3H2HA 3FOAA 5EJFA 1N3BA 3ZGYA 3NDJA 3HVUA 1LCIA 1E92A 2VOEA 1KYQA 2V1UA 3CINA 4KNYA 3KSDO 4D3ZA 1FDTA 1V8OA 3UMGA 1MG0A 4BFCA 3NNNA 4MB6A 4X62B 2C84A 1XMVA 1CQWA 3PX2A 3MD0A 3V42A 4YV0A 4Q4HB 5AUPB 4J07A 2B4KA 1L1FA 4EX7A 4A5OA 2FR8C 4P31A 3P71T 3Q3JB 4HB0A 1SVMA 1TU3A 4IOJA 3G0OA 1QX4A 1R66A 2ZRIA 4QOEA 2AZXA 5ALMA 3HL0A 3TLGA 4AZVA 3WMGA 3ITEA 2KPOA 4WBSA 3JVDA 4BQFA 1JDTA 1RE0A 3AB7A 4JKOA 2AKAB 4TTVA 3TRKA 4DCMA 1F5NA 5JQGB 3DNMA 3RVJA 5DP2A 5AHKA 1XEWX 1CVRA 2I4LA 2JIMA 4F8EA 3EPPA 1GTRA 1QYDA 4JVNA 4ZHQF 4ZOLA 4QGSA 1MDFA 2Z1DA 1B1CA 1U8FO 1R0RE 2PT9A 4Z3KA 5AIBA 1IAVA 4HQ0A 3ZCSA 3HKBA 1JR3A 2BGTA 1GR1A 3IKLA 4C0BA 3LL4A 2BKVA 5JQGA 1EM8A 1E1LA 4RHFA 3MB5A 5CW1A 3CVVA 3T1QA 2EJBA 1XDSA 2WV9A 4BO7A 4PO8A 1D6MA 4IUBS 1P7YA 4IS3A 1VG0B 4JDPA 4LZOA 1V4BA 4OC3A 2EFHB 3LDGA 3HJUA 3FPHA 2VTVA 4NMWA 5AKXA 2CK3A 2IUUA 4EUFA 1MB3A 4EKIA 2P3SA 3UMCA 1GKIA 3ZS8A 3DZJA 2XCOA 3PUWA 4NBNA 1P7VA 4WERA 4F21A 1PEDA 1XQ6A 2HXYA 2P11A 1AG9A 3KTDA 1X8KA 3TQFA 3ROXA 3TR6A 3ZN2A 2A1TR 3BA1A 3CZRA 4LG1A 4WN9A 5F9MA 4M98A 2ZE6A 4HZUB 1JG6A 4HDCA 3LE8A 3SFVA 5FBKA 4E2FA 2IXFA 5EMNA 2XITA 2BTEA 3M49A 5FNZA 3WIVA 4YR9A 4KFCA 4I5IA 5KVQA 2JH8A 4XVRA 2QT9A 3A14A 5TY0A 2IZ1A 1QFMA 5KNCD 2GI4A 4HDOB 4RMNA 5EWMB 4IXDA 5AI6A 2QUKA 3GZNB 2BM1A 1S7GA 3EVGA 1ODTC 2H57A 3B6MA 3LVBA 2CKDA 4D57A 2RG7A 3B53X 1W5FA 4HB4A 4JWKA 3H8WA 3IBTA 1GUYA 1TECE 5CD9A 4ZI3A 2VF4X 1U2EA 4RL4A 2ACVA 5A0TA 4C8FA 1JQAA 4ZZ1A 3NGLA 4ZJYA 3IQEA 1TM7E 1YXMA 3WXMA 3ET5A 4HAXA 1HYBA 2SNIE 1H1LA 4ZDJA 4IKEA 3WY9A 1F8XA 2BJHA 2PANA 2W22A 2WWVD 4A0RA 1FY2A 1SHZA 4UCFA 2JHGA 3RRXA 3U7EB 1AXGA 1BS2A 4CE6A 4E5NA 1SBZA 2NACA 5HRAA 3HXOA 3GF4A 1FP7A 2JAWA 1MOSA 2XNKA 4N3NA 4AZTA 1J1UA 1V8FA 1G38A 4FBGA 3VR1A 1GUDA 1K5DA 1Z18A 3DZGA 3GCZA 4IIJF 4WW0A 3V80A 1X8LA 3DLAA 3MMNA 1MENA 4UUPA 1W5AA 3RRFA 1TU4A 3WOVA 1PJ8A 2PUCA 1OWNA 4HF7A 4H18A 2C9CA 2LGJA 2ZXEA 4YAJA 1C9YA 2PPVA 4TMYA 3KB8A 3DZ8A 1U0GA 1M2VB 2HF2A 2NO1A 3H5VA 4Q3KA 5FOUA 2C2KA 3RKRA 1JEEA 4F86A 1SOAA 5JSZB 3COSA 4X6YA 4I36A 2VK8A 1IZ9A 4QASA 1LTHR 4BBAA 2O54A 4R2JA 2OL4A 1XVAA 2F9FA 3A9WA 6GPBA 5HJ5A 1MVOA 1SA0A 1JAIA 5A5GA 1MH9A 2F3SA 3W77A 1K2VN 2DWPA 3ZWVA 5ELYA 1A9YA 1FFYA 1O95C 2ONCA 2FZVA 3BQ9A 3O2NA 3QYJA 1IN5A 1XRPA 1FUUA 4EVQA 3ZHXA 3KKLA 4DSOA 4YRNA 3GVPA 3OJ0A 4BECA 3UAVA 1F1JA 3STTA 4Z53A 1ZD4A 4O1HA 3ZXYA 3LQRA 4JQOA 3P9NA 3K6SB 3H3JA 1XZFA 1BG6A 3WHPA 3K0AB 2VBFA 4M8KA 4YLEA 1ULBA 1CZHA 1USGA 3BXZA 3D6UA 3UUEA 3TEMA 1XN1A 1FX0B 1UANA 1XMIA 1OFIA 4HUJA 2PGAA 1LPBB 2BE9A 1QAMA 3DQPA 1YA4A 1OWOA 4EUNA 1U4NA