3TLBA

Microcin c7 self immunity protein mccf in complex aspartyl sulfamoyl adenosine
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
335
structure length
335
Chain Sequence
PLLAAPLAVGDTIGFFSSSAPATVTAKNRFFRGVEFLQRKGFKLVSGKLTGKTDFYRSGTIKERAQEFNELVYNPDITCIMSTIGGDNSNSLLPFLDYDAIIANPKIIIGYSDTTALLAGIYAKTGLITFYGPALIPSFGEHPPLVDITYESFIKILTRKQAGIYTYTLPEKWSDESINWNENKILRPKKLYKNNCAFYGSGKVEGRVIGGNLNTLTGIWGSEWMPEIRNGDILFIEDSRKSIATVERLFSMLKLNRVFDKVSAIILGKHELFDCAGSKRRPYEVLTEVLDGKQIPVLDGFDCSHTHPMLTLPLGVKLAIDFDNKNISITEQYLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MccF
publication title Structure and function of a serine carboxypeptidase adapted for degradation of the protein synthesis antibiotic microcin C7.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 117
structure length 335
sequence length 335
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02016 Peptidase_S66 LD-carboxypeptidase N-terminal domain
A PF17676 Peptidase_S66C LD-carboxypeptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Class I glutamine amidotransferase-like 3tlbA01
3.50.30.60 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 LD-carboxypeptidase A C-terminal domain-like 3tlbA02
4IIYA 4JVOA 4MI1A 3T5MA 1ZRSA 3TLGA 3TLZA 4EYSA 3GJZA 3TLEA 5F9MA 3G23A 3SR3A 4H1HA 4E94A 5F1YA 5FD8A 2AUMA 3TLCA 4MJXA 3TLYA 5F5XA 5K99A 5JYBA 4IIXA 3TLAA 2AUNA 3U1BA 4E5SA 3TLBA 3TLGB 4INJA 3TYXA 1ZL0A
chains in the Genus database with same CATH superfamily
1E6KA 1FE8A 1I33A 1PS0A 3OPYA 3KQYA 3HQ4O 3OFND 1NIJA 4MXDA 2F2TA 4RGQA 2Y4NA 3RHTA 3JVUA 1UBHS 4DAOA 1GVNB 2XA1A 4GYJA 4EYSA 4RTJA 2XF8A 3DT8A 1W44A 1UPXA 1TT7A 1TQDA 4PINA 5E3HA 1Y3DE 1JEQB 3L7IA 3A2MA 3HY4A 5ALLA 3SX2A 3PKJA 1X70A 2LKDA 2QVGA 2DECA 3BA1A 3P0FA 2XUKA 1KU6A 3HJNA 3QBVA 2NMVA 4HDSB 2NOAA 4HZGA 5DK4A 1G5FA 1JN0A 2JVKA 1KFEB 1SVSA 4MV1A 4UM5A 3TRHA 3CPSA 3VR4D 3TG8A 5EWJB 5JASA 3AVPA 4HNGA 1G20B 2ON6A 3B3AA 3HLYA 1CUEA 1QQ6A 1M76A 4FCTA 4N40A 4RLHA 1R6TA 1F2UB 2AF3C 2H2WA 4J16A 5M2QA 1OW3B 1P3Y1 4R2HA 1SJ9A 1XA0A 4CQMA 2RGNC 3R3WA 3FBWA 4TKZA 1A4XA 2SNIE 4HDAA 4U8HA 3ZLVA 3DOEA 1HDYA 3V3TA 3BD6A 3M3PA 1ZNZA 5JAIA 1JDEA 3CFYA 3WV4A 1R00A 3LYAA 3A9VA 1ZN7A 1XLWA 3AKCA 2OCYC 3RNLA 4AJHA 3SEZA 4BWYA 5CVTA 1A5TA 4OHUA 2H1SA 3ROQA 2B34A 2PYZA 4Y9SA 1JL3A 4KLRA 3D7GA 2QJOA 3Q1LA 2YJZA 4C0SA 1G2QA 3C8ZA 1C8LA 5CVUA 3H1TA 1YDEA 3H3XA 2FPLA 2YUTA 5E0KB 4COKA 3FJ1A 2PZKA 4FT2A 4E13A 4C9UA 2O2DA 3B9BA 4OLAA 1XHFA 1LI7A 3WGYA 1IN6A 1FZTA 3RSHA 4PHCA 1DB3A 1KDPA 2J45A 3UCFA 1WPRA 2JEOA 3N53A 1MAUA 1ZJ6A 2BJVA 3PHBE 4QOJA 1UIRA 2VJOA 3LCJA 4BFLA 5LP6B 1IVSA 4DIEA 3E58A 2ODAA 5DBIA 3DHNA 2WUFA 4OQFA 1XTJA 3H2HA 2Y9PB 5FUVA 1Y7HA 1B2LA 1RWMA 2Y1GA 2FFJA 2OQIA 1VL0A 2EF0A 4P2GA 4UE3S 3T38A 3TLBA 4YXWD 2XLBA 3QXXA 5BSFA 1U4SA 3ESDA 2XB6A 3T12A 5KNBD 2L0XA 4I1RA 1E9DA 3IAS6 3FFBA 5ADVA 5M7EA 2ZWVA 3R3XA 1U0JA 4OATA 1YJ8A 1VCMA 3W3ZB 5L8VA 1QFMA 4HO1X 3RC1A 1G16A 1T4BA 1O08A 4RANA 4RLQA 4QOGA 4EGCB 1KOGA 3TZKA 4YRIA 1G42A 2JAWA 1PK9A 2EXXA 4L3OA 1DBWA 3FGZA 2PHZA 4PYNA 1A2OA 1IY9A 1W5EA 1Y9AA 3TINA 3ZBQA 1ZY2A 4X8OA 3QVJA 2KLBA 3SK0A 2FMHA 1M6VA 4J0JA 3UV3A 2I4RA 3E1GA 3FWKA 3MJEA 3VH3A 1DMRA 1UBRS 3OG9A 4JOQA 3PQ5A 1WHTA 2GKGA 4R01A 2FPPB 2W2LA 5DXAA 1EESA 2KJQA 3LQYA 4QKQA 1FMTA 1JZSA 1NSFA 1L3IA 1YMVA 5G0UA 1ZGCA 5IBRA 4MIKA 4WVFA 4CW7A 3DUFA 3DVSX 3IAAA 1WR8A 4NYIR 3K9LA 1AA6A 4QUAA 2IRWA 4ZT6A 3LOPA 5K3SA 4M8DA 1CF2O 3GU3A 1JTVA 4GL2A 4PO9A 1ZCJA 3EXG1 1M8KA 4WFIA 3A1WA 3NH6A 1NJ5A 3ZU2A 4Z1MD 4NENB 1QK3A 3EFOA 1HBJA 3AESB 1E8MA 1NVTA 4X54A 4Q02A 3C6YA 1XC7A 3UMCA 3AP2A 4LWOA 4BZZA 2IGTA 3OFNA 2X8WA 3C1TA 1CTQA 2DZDA 2MSDB 3TBKA 1RM0A 2FMIA 1OFHA 4FX2A 3LX5A 5TT1A 2M6LA 3BSSA 4RQTA 3MCVA 5BYJA 5AUNB 5FA5A 3NZEA 4EDHA 3W5VA 4MRMA 2W4MA 2VRNA 3ZI7A 2EGHA 2XYVA 2HR1A 4KDCA 3HKBB 2GCGA 4XLTA 5DYGA 4J49A 4X20B 2PS1A 4MP6A 4H7DA 1XEXB 3VNRA 3VR4A 3GN2A 4OHXA 3LHKA 2B4AA 1WEHA 2E5FA 2G36A 1NC3A 3IE2A 4PWYA 1ZD1A 3RFXA 1CZOA 1UK9A 4CHTA 4ESOA 1RW4A 3WISA 5B3LA 2IKSA 1NXPA 1O8BA 4NI5A 2AJLI 2QTWB 4IG9A 3I9V1 2XEGA 2FM4A 1QGDA 1EFCA 2X5KO 1OJLA 2JIOA 3THRA 5ALHA 1EG7A 4YFYA 3TRDA 4YT4A 3O8CA 3KB2A 2KM1A 3E3NA 3KQVA 3RSFA 5HR5A 3R7WA 2D2EA 2KWIA 4Q34A 1ESDA 3A0RB 2VNSA 4IVRA 4ETNA 4RX1A 2XTZA 1K7XB 5K3DA 5CYOA 2CK3D 2YNMC 3T7KA 2OMKA 3ZZTA 1CRLA 3P4XA 2XB8A 2R0QC 2VOJA 4KXQA 4KXYA 3OZFA 1SGWA 5IC6A 2YZKA 4FFBA 5LP6C 5K6AC 2R5NA 3VPFA 1TF2A 1F9AA 3RF7A 1I1OA 5HXAA 5B7GA 5DTIA 2PJZA 2PT9A 3U5ZB 2FX3A 1KI8A 2X3UA 9LDTA 4UARA 5KX5A 4GL4A 2WA1A 2NU7B 1J20A 3E9ZA 3DEKA 4LJSA 2YDXA 3IOYA 5KCZA 1BCSB 1WTCA 2PXHA 4WT7A 5KAMA 4S04A 1Y5LA 2DRIA 3ULKA 4AP5A 2FP4B 2B6HA 2FXIA 1P1BA 4GE3A 1WDWB 1MUUA 2D5IA 1AIPA 3CGGA 5F1PA 4H17A 4U9UA 4LZPA 3V6MA 2X86A 4ZZ2A 1GDTA 2XHZA 3VR6D 2Q0SA 4LHWA 5M5BA 1Z2NX 4A0FA 1IQPA 1WMEA 4ZO9A 1PEKE 4EA8A 3AUAA 4O2AB 4AKGA 4G6ZA 4EHFA 5KSOA 5CMLA 1TUBA 1NUHA 1SKAA 4JLSA 3ZDYB 4EPRA 4F97A 4YXWA 1CJKC 2HO5A 4CG1A 3EVCA 4QJBA 5KNBA 1N2CB 3O31A 4ID3A 4J3JA 5I8WA 1QVVA 1BVHA 4P84A 4XVHA 1E1QD 4MLZA 1ZD4A 2AOUB 4OEHA 4S1PA 3KLBA 2XCUA 4IRUB 4OM8A 1PFQA 3RAPR 3FCSB 3CUTA 4GMGA 4PLTA 2W6ZA 1Z5PA 4IYJA 3N1UA 3TH5A 3ZHXA 1YJBA 3PIRA 3KFLA 4JVOA 5F78A 3N2LA 3LVFO 4PQRA 2QKYA 4HN4B 3FTQA 1VRWA 3O84A 1PT5A 4KO1S 2CVZA 4BGDA 1Q5XA 4U8GA 3EGXA 1RABA 1C7ZA 4G85A 3RTEA 4YJ2A 4II2A 5DIFA 5LU9A 1NQAO 1L5NA 5G1OA 5KNBH 2GHRA 4JENA 3T3EA 1NM5C 3WRXA 4CLXA 4AG5A 2ZS7A 2Y0PA 3TLCA 4AAYA 4DMGA 1Y5IA 1XJCA 1TU0A 1ULSA 4Z1MA 1DIBA 1N0HA 4OQLA 4JI3B 4ZAYA 4WZAE 3N39C 4LZJA 4L6CA 4AZ3B 3HWRA 1RRFA 4RH0A 1YB4A 4QDTA 1NQWA 4F46A 2XD9A 3AKYA 2NV6A 1CU1A 3OSUA 1D1SA 4Y67A 3QVGA 2Q21A 3FVQA 2XYRA 4HDKA 4PZEA 3TR0A 4H7HA 4LJYA 4Z53A 1JMVA 1CZRA 4PRKA 1LS6A 2I65A 2J4FA 2J9FA 2W6MA 2J8ZA 2DHDA 3PUJA 1J90A 1QXSA 3AR6A 5H68A 2C2XA 4YI5A 1MO3A 2C7VA 3ZWAA 2D1QA 3BOSA 3AIMA 2NQ2C 4BNTA 1EK2A 4C7KA 3UB3A 2DT5A 3M6IA 1X74A 3VKVA 1DKNA 4J2TA 3GUCA 4JHXA 6ABPA 2Q1UA 1T3ZA 2A4KA 3QFHA 4ARVA 1T8RA 4E6PA 4UQLA 4ZC8A 2P6MA 4UM9B 5F23A 5AHWA 5A5FA 1OV4A 1OB2A 1M54A 3QKUA 4IDDA 1AE1A 3LU1A 3PA6A 4TLDA 4G9EA 5DXFA 3ZZMA 5JCZA 4PYKA 1E20A 1PBNA 2C5BA 2HF9A 2HL6A 2JJYA 2OV4A 2VAXA 2X4LA 5LNK6 5LC1A 4ZKEA 5KKCA 3WL5A 1FFAA 1TA9A 1UADA 2NADA 2II6A 3B5JA 1B1AA 3I52A 5JRZA 5CA0F 3TW0A 2CJWB 2YJGA 4LQLA 2DFTA 3IEKA 3EG9B 1O5OA 2CK3A 5G53C 5EFZA 2B25A 2F4VB 3UQZA 2EKZA 3EPLA 3ORFA 1QVZA 4ZCMA 2H51A 1E2JA 2BBTA 2JZCA 3IDOA 3SOPA 1BVUA 2V6JA 3I92A 3UC5A 1Q0UA 3C3JA 3TXAA 3C1OA 5B2EA 4MDFA 1RE1A 5IS2A 2VJMB 9ATCA 4OJNA 1ZGAA 4EJSB 2EG5A 1N2BA 3QEBZ 1M2NA 1YONA 3DLIA 1LH0A 2X4GA 1MZPA 1XZAA 1CUHA 3IHTA 1JU9A 4YEDA 4EG3A 4JXJA 4IF6A 1ENZA 4OUDB 1IFXA 3KVRA 2JEZA 4MUGA 4GI1A 2DU8A 5KTRA 3PI6A 1IC6A 1M72A 4EPXA 1TEZA 3C7KA 1S2OA 1NLFA 4OCZA 3PXEA 2JA1A 5J5VA 3R9XB 4C86A 2R7MA 3ED1A 3RAFC 2I62A 1P1FA 2C98A 2IYPA 2X5OA 4RTRA 4P1ZA 1P6XA 1TXGA 2G9UA 4PSUA 3UOGA 3VR6A 4CNQA 3Q4GA 3DL4A 3JRXA 1XZPA 3ZQJA 2EG9A 3CF0A 2P91A 4FMCF 1B74A 3EQ2A 4OHOA 4JVNA 3WK4A 4CQJA 4AKHA 2J6HA 1G3UA 4XUGB 5EE5B 4F9EA 4JLBA 1DJLA 3E4DA 4NU5A 3TLGB 1QDLB 1QG4A 3WGHA 1F20A 1RIFA 1VLHA 1CJBA 2GN8A 2WNHA 4BMYA 4AMYA 1SOMA 1E1QA 3PEWA 3G5TA 1RU3A 4R41A 5JVDA 3DM5A 4MCHA 4JV5B 2ICAA 1H5QA 1QHHB 4P3NA 1DRWA 1PJLA 3C87A 1P7CA 2HA3A 2PR2A 2RIRA 4U0JA 3WG9A 1SELA 4BLOA 1RADA 1MVNA 3DMFA 2R6ZA 5HS6A 3HVJA 4DM4A 2NU6B 1J5XA 1WW3A 2QWXA 3VGJA 2E85A 5ECWA 2B8EA 4X84A 1MC1A 3WLIA 5ENVA 3WLSA 3D6MA 2I3ZA 4HF7A 4Q66C 1NMZA 2FSFA 2FQXA 3I6SA 2F67A 1K6IA 2WKRA 3A3PA 4QUEA 4KR9A 3BZWA 1T2DA 1XMSA 2XNKA 4KQEA 5KQPA 1NSTA 5IT0A 2CSXA 3H1EA 3J7AC 3BF8A 4PFQA 5HIJA 1PEAA 4BFSA 2HGSA 1UODA 3MNFA 1FRFS 1XQ6A 4LMRA 4MW0A 4EUKA 1ZJWA 4N7RA 2HNKA 3GF4A 2XXAA 1DBIA 2X1MA 3SXPA 1EEHA 1SQ6A 5CFNA 1JWBB 4O5AA 2CZQA 3IE1A 3DWFA 1V2GA 3C0KA 4Y6PA 3OZCA 4DUGD 4S3MA 3OFVA 2GLXA 4L9AA 2PNJA 2O48X 3DAHA 3WL7A 2ZJ0A 4IXWA 4JAVC 1MAWA 1A4IA 3S6JA 3WA6A 3ZHVA 4DDKA 4OB6A 3CH4B 3Q0TA 4II7A 1N36B 3WLFA 1K0FA 1W9HA 3N8HA 1CUVA 4WKCA 3TXXA 4H9GA 5F7OA 3RSCA 1A3CA 1SK8A 2ILVA 4UTRA 5DNAA 4RIFA 1CY8A 1TTTA 4OFZA 2RG1A 1VTKA 1RMQA 1YCGA 5EE0A 6REQB 4AY5A 4EL0A 1UKZA 2Q50A 2ZGVA 5DEOA 2PCLA 4PPFA 4XAQA 3TM4A 4W8HA 4W9YA 3WBJA 2WSLA 4WSOA 1GZ4A 4QBIA 4NCBA 1BXRB 1B93A 3BERA 4J1NA 3T7IA 3GJRA 3DE7X 3KWMA 3ONDA 1PR9A 3MT0A 3QHPA 2GN1A 4TTIA 5AK5A 1CR2A 1I6WA 4BP3A 2VSNA 3C97A 1U5BA 3GVIA 3OLXA 1MRZA 1TU4A 4G5YA 1HNXB 4EJSC 4W7HA 5AW3A 3ZQUA 2GLUA 2Y0BA 1L4NA 1LJLA 4OH7A 2WAXA 2QRJA 3JXEA 2Z8ZA 4OD0A 3ICUA 2QQ0A 1XLTA 4GSYA 3LX6A 5FWXB 4KV9A 1E3QA 1OOEA 2GZ3A 3GLHE 4BKOA 2CJFA 4ZGBA 4EA9A 4OHYA 3A37A 3AXTA 1U2QA 3SZRA 1RVDA 1PWZA 2IU0A 3DVAA 4L7VA 5IKEA 4A91A 1EVLA 1SVMA 2OCGA 4PZAA 2H57A 1GPYA 4PX9A 4GE0A 2DGDA 3AI1A 1SBNE 2VZ9A 1UKAA 4QLBA 3IV6A 4GVLA 2C07A 2XYQA 4FDLA 2R751 2ATIA 1D1TA 1CYEA 2EFCB 1E63A 5B3JC 1KJ9A 5DOVA 2D5CA 1UJ6A 4MVJP 4C0AC 1FVXA 4UHJA 2ZBPA 2X6QA 3CIFA 1KH1A 1JZQA 4ZVTA 4C3ZA 3AFHA 1I0IA 1P7WA 4FMDB 1RAHA 3RU2A 3RVPA 4WPGA 2O19A 4RA6A 4M0EA 1C1DA 2WZDA 1UPTA 2QRQA 5KSWB 4M2LA 2IS2A 3ZEIA 5IARA 5TVGA 2GPTA 1J5PA 1PTJA 4PQGA 1YBVA 5L6MB 3G2KA 1N4DA 2SCUA 2P79A 2PKEA 1OYWA 4Z4CA 2C8LA 1AC5A 3NT2A 4GO1A 4TLEA 4RVSA 3K2IA 4FZRA 5F51A 4BMXA 1W4LA 3GBVA 3ERCA 1C3OB 5IEJA 3FIUA 3GRYA 4ND8B 2JFQA 1PZFA 5CLQA 2YXBA 5FXMA 2V7BA 5A7GA 1QDUA 1F8FA 2A92A 2J3MA 1UEJA 2ADOA 5CA1F 5D84A 1T13A 2WU1A 4J9UE 2PKXA 1WXFA 1N3IA 4MWTA 2OLJA 3VH2A 4R0NA 4I9HA 3WGUA 1E60A 5JD3A 1OFVA 2BFCB 3I23A 2O2SA 1XI2A 2JGRA 4F8EA 1S3IA 3OF3A 2GAAA 3V4PB 2H0QA 4R1NA 5B1SA 4G5OA 5DASA 4YUVA 1PAUA 1NUPA 4MR7B 5AKEA 1YL5A 1U2ZA 2Q2VA 1JDBB 3W8RA 3O47A 3LBNA 3ZGLA 1IDN1 4MDHA 4X6YA 2DKOA 5GIOE 4JP1A 3ZH2A 1WSWA 2XMDA 3IEMA 1A8UA 2D0OB 4ZOLB 3WADA 1U4OA 1Z4MA 3PC7A 4I46A 4NFSA 2QD4A 4ZQFA 5MN5A 3COPA 3VZQA 1QMGA 2GBPA 4E4RA 1TZMA 3OQIB 1R5BA 4QECA 3PGA1 4Q3EA 4XDYA 4EKGA 2W6PA 4X1OA 3QBTA 2I7XA 3H7IA 1QSGA 5BR1A 3E2PA 3QXSA 3ZNQA 3PFKA 4B6OA 2VXCA 1U3FA 5JXHA 3LW8A 4MO9A 2D74A 2EEPA 4UOZA 2HPZA 2BMFA 1MFPA 4NNPA 2FRDC 1VBGA 2P9GA 4DUGA 3T7CA 4YA6A 5FL3A 1KEPA 1VI6A 3UK0A 3VV3A 3WKDA 3ZIAD 2GJ8A 3MTJA 4ABYA 3Q98A 3E2IA 3KDPA 5JPDA 3HM9A 1AURA 5H3LA 3JR7A 4IXTA 2O3RA 4M98A 4MI1A 4N3AA 2P35A 2WWIA 1RYDA 2XVXA 4OK3A 3VPHA 3ILXA 4FKMA 4GSKA 2C31A 4RYLA 4NYJR 2O2ZA 1I8TA 3C7TA 3KKOA 1P33A 2P4SA 3N6RA 5A0FA 4K81B 1P4AA 3VO1A 1I6LA 4CKEB 3MWEA 3M1YA 5EHGA 2XZLA 1COZA 1WIWA 3AHCA 3D1LA 1A2KC 2I6FA 2MYNA 2RCYA 3GAFA 4UFOA 1X1TA 5CNMA 3ZZUA 4P92A 3I2YX 4IUDS 4MWCA 3ZWWA 1G4UR 3AYZB 1PDVA 2J48A 4XFDA 1T9CA 1B14A 5BUQA 3QPAA 3EVAA 3JQRA 1RC0A 4TTRA 3U49A 1JMYA 1ZPDA 1SU6A 3V6LA 3GLIA 1BVRA 3NTVA 2C2OA 4QATA 5JO9A 3L0SA 4K9RA 2H2IA 2LP4Y 2MMGA 3TRKA 3UZUA 5I4CA 2HMAA 2BH2A 3FCYA 2CMFA 4H3VA 2DJ5A 2ILTA 4IDPA 3BXGA 5C34B 4URXR 1ZHHA 3EIHA 4ZI7F 3ZJ4A 2JGDB 4N1AA 3WWYA 2PNFA 4FK8A 1ZNYA 2Y2VA 5B1YA 3EZ9A 2XRZA 3PXCX 2Z2ZA 2JJ1D 1EVZA 2EKQA 1PD0A 4OOFA 3U2QA 3JTMA 5BN4A 3GPLA 2YY7A 1YQDA 2VTBB 2RHCA 1RI2A 5KHOC 2ZUBA 2PJUA 3OJOA 4JFAA 4LBYA 3IQXA 5D85A 1G8SA 1AHNA 2Q07A 3Q9LA 4PFSA 4Q4HA 4XB2A 3ZKWA 4F4JA 4S24A 2ID8A 1M0SA 1LWNA 3D81A 5JMPA 1GYRA 4PZLA 1MJFA 4EF6A 3IDAA 3KE8A 3I9JA 5FLKA 1W35A 4B8YA 1TZCA 2JAXA 3QIVA 4HLUA 4DSOA 1BGWA 4CEJB 2AZMA 2EOAA 2F62A 1VPVA 2O54A 5G0VA 4IMPA 3N76A 1PW5A 5K4AA 3IH5A 4RA9A 4RHXA 1C30A 2ZTHA 3RC7A 1T9AA 4DAEA 3LL7A 4DTCA 2MR5A 3U7QB 2JCBA 3H97A 3T61A 1JDBC 1R0BA 3T9DA 3P0RA 3ZKAA 4Q7QA 5LWQA 1V11B 2OZLA 3GEBA 4GOKA 4D92A 1M1YB 2EU8A 3W1VA 3VI3B 2C5QA 2R60A 1F4LA 3I42A 4IOKA 1HETA 4NMHA 2C77A 3LIIA 1X39A 4FS3A 1XMXA 2O50A 3MGKA 3IBCA 4HFNA 4DILA 3MA0A 3NAQA 4KW7A 3K2BA 4NC9A 1FMCA 1E0SA 1Z08A 2YASA 1OIVA 1J99A 3NIWA 1XZGA 1N7IA 2RH9B 4XQCA 1FX0B 1D0VA 5CLLA 3P2KA 1DX6A 5AKYA 3UMFA 3BE5A 3CIOA 1JFVA 2NYRA 1XCOA 2ZUCA 1UM9A 4HEA1 2J59A 1E9CA 4XYMA 5K0LA 3ROZA 4AUMA 3HH8A 3V97A 3IAHA 4JSYA 5JD6A 1I14A 1DKOA 4A3SA 4UVIA 2H5EA 2IPOA 2J08A 3EC7A 4C85A 4W9RA 4BGUA 3CPEA 1N0IA 4HI0E 1IJEA 1YQGA 1QHYA 2IS4A 3PEYA 1JDTA 2B30A 2CUZA 1ODCA 2QRKA 3PITA 2BMEA 4R9SA 1Y4SA 3IJPA 1EAYA 4G1BA 5I9BA 4X3OA 1TF5A 2HA7A 3HY6A 4ZP1A 1N9GA 2RMKA 2XX3A 4HDMB 3INRA 3F6YA 1DKPA 4L5IA 2H85A 1BU8A 4H3HB 4Q7KA 4Y30A 4FR5A 3TQHA 1AN9A 3PVSA 4L85A 2ERCA 4N3NA 2FR8A 2UZIR 2YIJA 3RQSA 3WWOA 3ZIAA 2FSHA 4QEDA 4RFSA 3SHQA 1VJ5A 5K0BA 2BH9A 2C4UA 4LOHA 4TS9A 5BSUA 3BBPA 3SSNA 3V9PA 3UANA 3TTYA 4KBYA 4EPWA 1JIKA 5P8WA 3TDMA 5FH9A 1NR1A 2XAUA 4FGWA 4O3FA 3VTKA 3VX3A 3KT3A 2NSLA 3I5YA 3U60B 2QYSA 2PEZA 3O8DA 1JHZA 2O9JA 1U3VA 2QTVB 1P4JA 3UT5B 1N0VC 2CNOA 3K0KA 4V0OA 4AJ4A 5LBIA 3G8BA 4JELA 1TAGA 3JD2A 2G08A 3ES9A 3IOBA 4M6WB 4MUFA 1DAMA 5TPWB 4ARSA 4CEHB 3F7TA 3GO4A 3OA0A 4RTKA 4ZVLA 1YBAA 1NHWA 2G82A 3FYDA 5F9MA 4EWLA 3HHPA 1CNMA 4C2UA 1TTPB 1VMDA 5AW0A 3CZ9A 5HFJA 1GVHA 2VAMA 3T5BA 3WKAA 3LCCA 2Z3WA 4OAQA 4R8KA 3SF8B 2OORC 3OJFA 4GECA 4ZEOA 4HVLA 2QR5A 2BKVA 1GU0A 2O20A 2OR3A 1RIIA 1SNYA 2W0SA 4OK5A 5CVCA 1RLUA 4TWIA 2QZZA 1A72A 2J0SA 3H4IA 3O73A 4RPHA 3TR6A 1U3TA 1ZINA 3TLKA 2PZGA 5C4MA 1E2QA 1F0NA 4JYPA 1XXHE 3CLSD 2PMWB 1YULA 2COUA 4MVJH 2JJ1A 3FG9A 4ZVRA 1RKQA 5H9VA 5LZ2A 2AA3A 3S4YA 2Z5FA 1EE1A 1MX5A 3UN1A 2A57A 3L8MA 5KNDH 2MSCB 1NQVA 2BCJQ 3ZW9A 1U2DA 4D96A 3B7GA 2WYOA 2IOFA 1JFTA 3VKGA 3KSBC 3KG2A 2WA2A 3BILA 2X13A 3ENKA 5KWEA 4WZAA 1X1SA 2YXEA 1GGKA 1RRMA 2R87A 3CZAA 3FYSA 4Z9FA 3K5HA 4F71A 4ZCIA 5KDOA 2I55A 4BJ3A 2PQ6A 5CLHA 3DYBA 2QNBA 4MV7A 2DPLA 4QU5A 2VYFA 3JV7A 3TEFA 2ZJ6A 2CDCA 4EENA 4CT0A 1UFOA 3IP6A 2ZREA 1UF9A 4UASA 3SC3A 4LF4B 1JIVA 4YN3A 2DG2A 5CLGA 5DHAA 1V6CA 3FLAA 3FTNA 4FFMA 5JNUA 1J4AA 5DP2A 1ULZA 4P34A 1VBMA 1X87A 1QH0A 2UKDA 5DM1A 2GYUA 3VM6A 3W9UA 1ST3A 3I76A 1IOVA 5KZMB 2QVLA 3QK7A 4G63A 3SJXA 2I2DA 3CX4A 4PZUA 4RY9A 3GJ6A 3JQ7A 4KYUA 3S2ZA 2DF8A 4I6JA 2PBZA 3WC4A 1KMHB 2GKOA 1LX7A 4ADSG 2CFCA 3KJQA 4LY0A 2WFMA 1DG9A 2R00A 3MEQA 3D6AA 3AM1A 1V7ZA 1ODSA 1GT6A 2PZJA 5JV5A 3C1UA 5CIYA 3ADBA 5JQGF 1E1NA 4OSPA 4YQZA 5FBHA 3W5HA 4BQRA 4DRZA 2H52A 1PJ2A 1QHSA 4C06A 5I4IA 2R6GA 4TSRA 2DE0X 3SC6A 4H16A 4UD6A 1H3NA 3LXUX 1GG5A 4DDWA 5JSZB 1NAHA 2MR6A 4N18A 3SM9A 2GXAA 4XPIA 2D5LA 1RLIA 2WU0A 3KDSE 4HH0A 2GWRA 4W6ZA 1V48A 5A3RA 5CDTA 2DPHA 2JGEA 3WDLA 4RIGA 3QSYA 4IKOA 1QGAA 1IH8A 1J2EA 1JHRA 1LK7A 3I3OA 1GFIA 3EN0A 4RXMA 5KJ1A 3FUUA 3L1KA 3R5TA 2QT1A 4TXNA 2GETA 2A9OA 1FYFA 3SC2B 4DSNA 1PIWA 5I7WA 3T3MB 4G4SP 3L4BA 1F4PA 2AX3A 1JT2A 1UAYA 2BZ1A 1CJSA 3HXPA 3QJ5A 5E7MA 3UKOA 1NXOA 1NOIA 3QFFA 1XCJA 3S2FA 3CURA 1HT2E 3KQSA 4Q24A 5T4EA 1KHTA 1A95A 1RQNA 1J56A 5JECA 3AB3A 3WLPA 2FDRA 3B7WA 4UU1A 1ZIYA 4RF4A 1Z6GA 2WEKA 3L1HA 4MUJA 3DAPA 1ZOPA 1JX6A 3K2EA 3FHLA 1VP3A 3WJ2A 2WJHA 3MBOA 3V8QA 1WMAA 1LKZA 3R7SA 2VXYA 4I81A 4ZJZA 4GBED 4XSHA 4COGA 1N9ZA 3HHEA 3L6EA 3A3KA 4OB8A 4WOCA 3FCCA 1ULTA 3K2QA 5DLQC 3TIIA 1M10A 1A5AB 2H11A 4YT2A 4DEVA 1TMKA 3PU6A 3GGPA 4M4SA 5DX8A 3O9ZA 2WIGA 3AQIA 1LWOA 2P4QA 3GN1A 4TTQA 4M1TA 4LX0A 1XN4A 3SKYA 2G72A 2WILA 5DNEA 4WXYB 4E5SA 2HSGA 2IUFA 2OXFA 4KK3A 4EKYA 3VU9A 1Q1AA 3A25A 1X7HA 1IUNA 1JFFB 3PIDA 1HTBA 4PYJA 5JZBA 4JYCA 8OHMA 1FDUA 2EZTA 3DG9A 3Q85A 3HV0A 5HMMA 1QWSA 1ZD5A 3ANNA 2R6FA 4R2XA 1N2EA 2HBYA 3I58A 3Q6IA 1Z8NA 4XUCA 1T34A 3WBFA 2GYVA 4ZDWA 4PY2A 3LE8A 5CU7A 3RROA 1M2VB 4DCMA 3RBXA 1Y1TA 3WQBA 4C3OB 1FDTA 3DFZA 4O59O 4PYRA 1CDOA 4BO9A 5A5DA 121PA 3QBJA 1Q1EA 2EAUA 5BOSB 3ZDEA 3CNHA 2VFAA 2BGGA 4K2AA 1T0BA 3ML1A 3T7AA 4JBWA 4L15A 7REQA 5AXBA 5GJCA 4OMFG 5AKZA 5EG5A 3BH0A 1BFUA 1UIMA 3N7AA 3VC7A 5HQ3A 2B20A 4E5UA 1Y4AE 4MMZB 4GDFA 1KFBB 2IL1A 3RK1A 3GP5A 1ZMXA 4N7BA 3RT7A 2A5FA 3TFWA 4CG2A 3BFKA 4MQUA 5FEUA 1PR5A 3CVXA 2IYLD 1BC5A 4EY7A 3OQPA 2DUJA 3A7DA 4TLBA 4BRUA 4Q3DA 1F1JA 2I4MA 3H2YA 3PPYA 1D07A 4C89A 1V3QE 3HXTA 1D2CA 1JLLA 1GUZA 2Y67A 3F6PA 5BWNA 4S1NA 4REOA 4ZVPA 1ZK3A 4FEEA 2HU5A 4CN8A 1E3MA 2NU9B 1DBQA 2Q1YA 4CLOB 2VHQA 2WTMA 3OTQA 4JL6A 4P93A 5G41A 3ANSA 3WMGA 3WLNA 5AW8A 5DTRA 1GUDA 4XJSA 4R8LA 1HOTA 5IM4F 1U6IA 2DFPA 4W5WA 1R74A 3QENA 4G9BA 4LEIA 4WZZA 1QP4A 4KYVA 2XA9A 3U4MA 4OA5A 2H2FA 1OGYA 2VQ6A 3GJSA 4U02A 2MP0A 1LF5A 4HNQA 3LBAA 3REGA 4TUYF 3WGKA 2QUZA 4CKWA 2EZ4A 1CQJA 2L69A 1D04A 2Q4OA 3GOHA 5IZCA 2OV8A 2UXBB 3ZK8A 4M0FA 2FRXA 2YFQA 4B5LA 3UMVA 4BTLA 2W6JD 1DAGA 2YZNA 3EZFA 4PO8A 1M1ZA 3EF0A 4RGYA 1VE5A 1EP3B 2I1WA 1E1DA 2V3WA 2Z5LA 4Q7LA 5GVSA 5JXWA 1ZU5A 4A4DA 4YUXA 1URPA 4OLBA 2I8AA 1N6LA 3A6GA 2O23A 4GI7A 1V9CA 4KI0A 2R65A 5BPFA 5B4TA 3RTAA 1S3GA 1FCJA 3MGAA 1YVRA 4M9CA 3VU3A 1XCMA 3TIXB 1JJIA 3ZS8A 4RKRA 3H17A 2GBLC 3SZLA 2PUEA 2YJ5A 3L1UA 2VPWA 5HF8A 3RUPA 3OTOB 1Y63A 7ADHA 2FVYA 1JDUA 4G26A 1RWQA 3WQSB 3H6KA 1G0OA 2VA9A 4MV3A 1Q6ZA 1XPRA 3DA8A 4S35A 2B2NA 2G40A 1OFUA 4YP9A 3RFTA 2BFBB 3C70A 3OF5A 1E9EA 3RFFA 2ZI5A 4D8YA 3WQQA 5BRAA 1AMNA 5KO2A 3S44A 1A7JA 3S5JA 3UICA 1NF9A 2A0YA 3JQ8A 1GL7A 4B2IA 1RM5A 4X63A 5GTDA 5LYJB 4J0IA 4HUQB 3PLAE 3BGSA 1M6EX 2IOYA 4ZMRA 3FSJX 3QY0A 1L7XA 1RWOA 1TJNA 1TF7A 1W0JD 2R48A 7ABPA 3FMPB 4ZA2A 3O93A 3TJRA 3PD0A 5HGXA 2GCOA 4NG4A 4U00A 5JPIA 2DBYA 2A5YB 3H6HA 1Q1BA 1U9YA 1NQOA 1ZD3A 4WLNA 5KYNA 5E2AA 4YGXB 1SBHA 5EJFA 3WLJA 2VZEA 2C7BA 1C8KA 2Q4DA 1H2YA 2I4OA 5HKBA 3L4KA 1SRQA 1K3FA 3O95A 3RK0A 4LZZA 2JHGA 4MTLA 1TYBE 4ZVMA 1E0JA 1E5TA 1JLSA 1Q95A 2W5UA 1E6CA 2JH3A 3BGVA 3GAMA 4XXHA 4BLSA 2DH5A 4K9MA 4UREA 1W85A 1PU2A 2X2EA 3R23A 5SY4A 2H8KA 2OB2A 1JLHA 2GFQA 2OXRA 1VOTA 3FDXA 4KAAA 4YBRA 3LPMA 5AJUA 5AM5A 3T52A 1VJCA 3OZAA 4Z3KA 4QVIA 5TPZD 3UG7A 2FEWB 2HFJA 2JLSA 3RS9A 4A03A 1Q0RA 4BX0A 1SIUA 4BLRA 5F76A 2QQFA 3ECAA 5LB2A 2OAEA 4OPMA 3WY9A 2AE1A 3LF1A 1Q0PA 3HUFA 4GOND 2RSLA 3VPXA 4O4LF 1I4WA 5E4FA 1JG6A 3USCS 3HMQA 4ENQA 2F1HA 1A77A 1EJ6A 2PZEA 1TKRA 4Q6BA 2PE5A 1UZLA 4RKQA 3WZ2A 3X2FA 5FBKA 2V4ZA 4GWGA 1DCFA 1L8AA 4RSHA 5DWDA 1ZUD1 2RC6A 3F5SA 1DXOA 4PBTA 1DO0A 3RJ5A 2VXOA 3H5WA 3VJLA 3CNOA 4EX6A 4CCSA 3T9FA 3QRWA 2ZE6A 3FM9A 3W77A 3NQ41 4H7FA 1MOQA 1EFVA 2FN8A 4MGYR 1WXGA 1ZGJA 3JSXA 2ZRDA 4HS4A 1Q21A 1FXSA 2PUGA 1WLYA 4AWAA 1GIAA 1YD7A 3G0DA 4N8DA 3FRJA 2VDJA 2VYCA 3DXZA 4X3RA 2FFQA 4E7PA 3ONNA 3G6KA 2DKFA 1VL5A 2BMAA 4NAVA 4C30A 2NT3A 2VDVE 3U7IA 1GSHA 3GRCA 5T57A 4K5QA 1SQGA 3V80A 1KI6B 3KWJA 3N70A 4MYSA 3HEBA 3AW8A 3KSUA 2WWGA 1NYTA 3KOOA 1CVLA 4BQFA 3BCSA 3DKRA 1E99A 4TVKA 2HJSA 2IDMA 5A1JA 4NFLA 3QVUA 1J1ZA 1TDJA 2W6JA 4ZT5A 1NYQA 3AB8A 2WB4A 4JKYA 2PRJA 4WNIA 1N5KA 2O3UA 4JQSA 1GV1A 2WAMA 4BEBA 1M0WA 3CPJB 4RNDB 3SN6A 1EFUA 2H16A 2PO7A 4UAJA 5HBRA 1HG0A 2QN2A 4DSUA 1Y6RA 2Z2JA 3DWEX 5EUCA 3P9PA 1NUUA 3ZZ1A 4O63O 4YP0A 3WV5A 3K09C 5AK6A 4COBA 2QX8A 3B1KA 3KEOA 4GX5A 4RVGA 5JEEA 4DQLA 5EP2A 1XSEA 3SZGA 5C9ZA 1V39A 1JR2A 3LX8A 1C5KA 4MPJA 4PZZA 2Q62A 2Z0MA 2RG7A 3P0HA 4Q1EA 1PV4A 3NOJA 4WWHA 5DM0A 2FFRA 4NYMQ 3SFVA 1XDUA 2VQDA 2XCLA 3I6ZA 3OWHA 4H3KB 4QXQA 3UK6A 1Z7YA 5BNIA 1RWXA 4OJTA 1EDEA 2GTPA 2VJCA 3DO5A 4J03A 1GKUB 1KZ4A 2OB1A 3WWEA 1W2GA 2AUTA 3L04A 2NO0A 4C87A 1GRQA 1JA0A 1IXZA 1T5LA 1VRCA 1KMIY 3G8AA 1HWYA 2F90A 2FJPA 2O2EA 4JJ7A 4KIWA 5U4QA 4F7WA 1NJ2A 3ZJUA 4UCFA 1JIIA 3LVBA 4OB7A 2NSHA 2QY9A 4KMMA 3ETLA 1ZJJA 5GJBA 2XMPA 2AZTA 3ZW7A 4ZT4A 2Q1SA 5JAHA 1K8RA 3EZBA 3F1KA 1W0JA 3HO6A 1KEKA 1E3DA 5EXEA 2FSVC 2ASVA 3QWFA 3HKCA 3JR3A 1FC0A 2HCFA 3FPSA 1G20E 4MLPA 4XM2A 3W2TA 4DCUA 1RLTA 2CXPA 1MJHA 1AQIA 4I1VA 1VBHA 3G79A 2ZIVB 3SBOA 4ZZ3A 5K0GA 1I6MA 1PTKA 2WRZA 1MRNA 1Y7TA 4M1KA 1QIFA 3DR5A 4KGZA 2SECE 3IA2A 2RJNA 5ALFA 5IDWA 4JIMA 1DLJA 4U6NA 1YB5A 4BYGA 2WFAA 3DE3X 1HT1E 3UF0A 2DUWA 1WUIS 3F78A 3PRJA 4S1OA 4F4HA 2C97A 4Q0MA 4ETMA 2ZIFA 4BZQA 1N75A 1WB4A 4H1HA 1L4UA 3TTWA 5TPZA 2P5TB 4QHTA 2VNHA 1K5DA 5JARA 5HIMA 3A9WA 3KVOA 2AR9A 5T4BA 2ANBA 2FPGB 1XG5A 2VHEA 3V8RA 3MCZA 3C3WA 4RK7A 4D9EA 2EHJA 4CMEC 1ABFA 4B45A 3HB7A 3KQLA 3ZD7A 1A1VA 3PXUA 5AI8A 5CBPB 3R5JA 4CIWA 3BWBA 3EUEA 2VDWA 4MROA 5HZGA 2BOVA 4KIFA 2BEUB 3ETEA 3EVBA 3B85A 2V0CA 4MHTA 4FGZA 3HZHA 2RGCA 2Z6AA 3F2IA 1GPBA 4O4IB 1F12A 2CFIA 2WG2A 3DZBA 1AZWA 3GVHA 4MW1A 1VZ3A 1IY0A 1ACJA 1J70A 1WZIA 1GGMA 4FI3C 1Z6XA 3PSAA 1JILA 1KSJA 4LVUA 2O0LA 2D2FA 4OXRA 3TL3A 4BP8A 4F5YA 5EE9A 4QXOA 1PLJA 4XEUA 2CLMB 2CZCA 4FDMA 1HEUA 1TTHA 1UJMA 4MWSA 4CRWB 1IVYA 5L4SA 1YBHA 3JQ9C 4WFJA 3AIOA 1I0ZA 4C4AA 3HYNA 1LK5A 1FS4A 5DE3A 5TV2A 3ZHUA 5K01A 5BW8A 2NNWB 3RPEA 1ZKDA 1L7VC 5C8ZA 3WLKX 4R40A 1CX9B 3D7MA 3H9JA 5BYBA 5K0JA 1HDCA 4FFPA 3V4OA 5KU7A 1YIAA 4CGZA 2GASA 3E9MA 3IESA 1HFEL 4RY2A 5LDGA 5BOVA 3B3QA 3G5MA 1KEZA 5BV7A 1FXWF 2XSZD 2P8JA 2IBMA 3SNKA 1V8BA 4TKVA 3E5NA 3D59A 2QTBA 5JS2A 1VL2A 2ZYWX 1YDWA 2LD4A 2XMZA 1JTEA 3F4LA 2O4UX 3HBLA 5LQMA 2YWCA 3FNFA 4O1HA 4EUHA 1DWQA 3O4FA 3C2QA 2IYYA 2Y05A 3VV2A 1J7JA 1F2DA 1DWOA 1HXHA 2D1TA 2W2KA 4HFJA 4Q7JB 1BKDR 1E7WA 1GAQA 1P6QA 2FETA 2JAUA 4EATA 3OEHD 6CHYA 3QX8A 2FFHA 2G9QA 5IK2D 1INLA 1J2YA 3RM3A 4R8SA 4FQ7A 4UUNA 2DQYA 2JFXA 3GV0A 4WXMA 2GEKA 1Y80A 3TNFA 1VM6A 5IJZA 2DQZA 1EUDA 3BS4A 2P5YA 1JEDA 3P32A 1NPTO 2X0RA 5JRDS 4RU1A 1WA5A 2QRVB 3A6HA 3C8MA 4EB6A 1G5HA 1XNHA 621PA 2GF9A 3L8FA 4DB4A 3KJHA 2XT9A 2RK3A 3QOWA 1TL7C 4RPGA 2VPIA 4RK1A 4L07A 4LDQA 4WY5A 3LUDA 3WYFA 1UQRA 1Z7BA 3AIKA 1PI3A 1IZ7A 1OX6A 4B3MB 1FYVA 3H5OA 1OXKB 4G5XA 3WK8A 2FN9A 3DDHA 3GLIE 1NA5A 3LQ1A 4BV8A 4HB0A 4F21A 3WOHA 4HQLA 3MSCA 2CMKA 1COWD 3CC8A 4FB4A 4R0MA 3LT4A 5FAKA 4A6DA 1NN3A 3AERB 1JYFA 5HCNA 1D2NA 3IOMA 5ADWA 4TZ0A 3QM1A 3HBNA 4MI3A 4F2WA 4MCQA 3E5RA 4F72A 3G2JA 5JBQA 4W5TA 5FTMA 2Q9UA 2DWCA 4AX4A 2O2CA 3DDSA 1US8B 4KV7A 4RJTA 1J8YF 3KO8A 4Y9DA 1Y3FE 4PV7A 4CEIA 3BMNB 4EJMA 4CR6A 4HX2A 3FX2A 4PIMA 1YZUA 2PZBA 3PQEA 2P4EA 1FTSA 2YYAA 3AI7A 4ZI5A 3WB9A 2ISCA 2VK4A 4QC2A 3IO3A 4RAQA 3RS3A 4BZWA 3ZE2B 2VWQA 4PAWA 1RXVA 4ZV4A 2VPQA 2XUPA 1BTOA 1WULS 2B99A 1UP6A 4FP9A 4I8IA 4IFBA 1MB9A 2QPLA 1RP1A 4WJZA 3I9FA 3UA4A 1W4BA 1N5DA 2WT9A 2C78A 2HRZA 3L1JA 4P3XA 1CJTC 2CWWA 2CB0A 3BIOA 2I2CA 2WE8A 3DOIA 3TZCA 4EGAA 3QMPA 5C3MA 1RHMA 2PT7A 4IJ6A 2IZ5A 2I2FA 2HHAA 2R44A 2WV9A 2ZULA 4I19A 3RYHB 4PYIA 1TQ4A 1VIAA 3KALA 4YCDA 2XUGA 3RVMA 3S1AA 2ZWPA 5CBKA 4BC0A 3TQOA 3BA6A 3A4NA 4QQRA 1NQUA 4KACA 2C5FA 3HJTA 2GP4A 1CHNA 3NS7A 1V6AA 2O8CB 2AUNA 1E2MA 1GZ5A 1L6IA 2DAPA 1T1RA 2M2IA 3AM5A 1LSUA 2O52A 4GPAA 3VTAA 2XMGA 5FUYA 2WU4A 1LPOA 5D1HA 2AYYA 2UDPA 4GM4A 1THGA 1XLVA 1N2CE 2VATA 1QZTA 1T6XA 2P0YA 2HK9A 3FVWA 4PAQA 5JROA 5A5EA 3SQLA 3NCTA 1QC5A 1BJRE 1QONA 3A1DA 2C2YA 2WUGA 3B1JA 3KKLA 3UPDA 4DY4A 3H9UA 5H4GA 2NV2B 3Q7TA 1EE2A 3D8SA 1K8YB 4YCJA 3UH0A 1CUGA 1NI5A 1V35A 3WIBA 4X91A 4AO8A 2OK8A 1RCUA 2ZVQX 1QE0A 4D6PA 1ZRHA 4WLEA 3CZCA 1YRLA 2XSZA 4YX9A 5WRFA 4BEWA 2Z4SA 3DZFA 2BBWA 1WSBA 3DNMA 2DM6A 2PVSA 4I66A 5TJ9A 1U8AA 3EGCA 4UEWA 2HRRA 1QE5A 2IY7A 3RTCA 4D46A 1K5GA 3KYDA 4QARA 3L8CA 3NBYC 4LSZA 4KAFA 2VTKA 4U7FA 1W5BA 2Y76A 2ZIXA 4IH4A 2GN0A 3A26A 3EBLA 3K94A 3OEHA 2Z1NA 3PFCA 5DEIA 2GRAA 4M89A 4GMHA 2WF6A 1WZCA 2V97A 5IK2A 1X42A 1QYRA 4L9SA 4E2FA 5A9RA 3V32A 2HK8A 2J09A 1QZZA 3K6SA 4P7GA 3ZY3A 2HADA 3TI7A 2ZAMA 3QU7A 3MFQA 1JQ5A 1D4FA 1I3OA 2X8JB 3ET4A 4L8FA 1WETA 2BMVA 3QA9A 1OYYA 1F0YA 5D01A 4EUSA 3RRYA 2PWPA 4B3FX 5KMGA 3NP9A 5AVWA 3IUJA 1TCBA 1QGED 1DJQA 3PTLA 4XB1A 1A9SA 3JQ6A 4ZAZA 4Q9KA 3SZUA 1OAOC 3PUWA 1GFSA 1SC3A 4AWXA 3B5IA 4IQGA 3TQFA 2ENWA 3CV3A 1KYIA 4QUHA 5HFAA 2PT5A 2X0NA 2BZ0A 5JXJA 3K9BA 4KL8S 1RHKA 1NR7A 2F3TA 4D5EA 5IJ0A 1TIPA 1JNYA 4HDNA 2WMOB 1TW3A 4GM0A 4HFMA 4LDRA 4ME6A 5IDVA 1COWA 2A78A 2HXSA 3E22A 3LF2A 5FORA 2VSYA 1A97A 1JALA 1OILA 1ZESA 2X42A 2VSXA 2IP2A 3DTVD 3M6AA 5DXJA 4MRVA 1L7PA 2OZPA 1T36B 1VL8A 4CMBA 1UBSB 2ZS9A 5T41A 4DIUA 1GPMA 3BDAA 2FQYA 4F3RA 3RIGA 4F2PA 3ZCXA 2BFFB 1NTRA 3SFZA 2Q3CA 1JHOA 2O7QA 4U2GA 3HBJA 3OOJA 3OD5A 4FDVA 3WGQA 1UBLS 2FSSA 3C8HA 3T5DA 1RZRD 3UFXA 1N6OA 4QOEA 1Y9DA 3TOSA 1XZDA 4XVQA 5K0NA 3W05A 2BP7B 2ZJOA 3D7SA 3OKFA 4O1IA 4P45A 3NB0A 2Z83A 4FVTA 4GPTA 4C0WA 3TQQA 1T1EA 5J63A 2FPKA 2ODNA 2PRSA 1ODJA 2P78A 4DVGA 1E3SA 4UJ3A 3EIUA 3B1VA 1AQUA 3KPWA 3IVCA 1ABEA 3DV0A 3ZV5A 1RQXA 3NYWA 2OGUA 1AKNA 4GGOA 4TVOA 4DA8A 4QGBA 1HEIA 4D0LB 4EQ6A 4JGIA 3L7KA 4DC1A 2GPWA 3NYQA 3QEOA 1GQQA 3N58A 3LKBA 2WZBA 3K70B 2X2OA 4C4YA 3L8GA 2V6FA 3GT3A 3HP1A 1X80B 1J0AA 2X2PA 3D3WB 2LW7A 4I14A 3EGEA 4ML3A 4P3PA 2GX6A 1JBKA 3W6NA 3T1TA 4YMGA 4HBGA 2LWIA 3FTCA 2PV0A 3FF3A 1SBZA 4LTMA 2IYTA 5IN4A 1ITZA 2JHPA 1IJBA 2ZE8A 1TFRA 4CCYA 4ND6A 2G8LA 2QZ9A 1N5JA 3UXEA 4UTOA 2Q45A 3GUYA 3R5KA 2BELA 4I7EA 4MCIA 3GLSA 5C4GB 1FJXA 2NW6A 2PH1A 1NDHA 1UOQA 3PE4A 2IXEA 4NV3A 4B2PA 4IV8A 3MZ0A 4BS9A 1MAVA 3C45A 1N57A 2CFRA 2ERYA 4J0QA 1A9QA 4PPYA 3OQNA 1YZTA 1KRHA 4MQEA 4DLZA 3MQ4A 3SDBA 1G5QA 2A0XA 2QDXA 4H1TA 4WTOA 3ND5A 4AJEA 1EFRD 1S9DA 3NAGA 4ZICA 3E7WA 1U90A 4KU4A 1G9SA 1PFUA 5A6VA 3T54A 1D9ZA 4E4YA 4F12A 1U94A 4WN9A 3D7FA 2BRUC 5A4JA 2BGNA 3JQFC 3HDYA 5K3FB 1TYAE 1YDGA 4DRYA 4Z5XA 1UOPA 1XF9A 2HOQA 1NBAA 1G8AA 1LQ2A 5E4TA 5CA0B 4DT1A 4YGYA 4DARA 2E0IA 4YT5A 3TW8A 1WVIA 2D0DA 3E3AA 4LHSA 4QSMA 5JE8A 2SHKA 3PNKA 4LXHA 1N6NA 3BJIC 3PS9A 3KBBA 1UXHA 5EIWA 2IU3A 4AQDA 1E0DA 3WNDA 3KYBA 3DDOA 2V7UA 3RNOA 3V1TC 1U65A 2A0KA 2PU7A 5JAOA 4BCDA 2YNMD 3C6QA 3UCEA 1TO2E 4OA8A 2APJA 3W0LB 1U4NA 1G7RA 1G7TA 1NU6A 2EZ8A 3BPSA 5MGBA 2FV8A 1FRQA 3O03A 4LOJA 3QF4B 2XUFA 3KU4A 4A6EA 1A9PA 3L8DA 2JJ2D 1SOUA 3C5HA 4G4IA 2PUWA 1G1MA 3K0AB 2HQOA 3CRNA 3F8TA 5LWHA 2WM9B 3N86A 4L1KA 4PPQA 2GZDA 5PGMA 2G7MC 2JVJA 4C07A 4MCRA 4IX9A 2YFKA 1QYXA 1T1JA 2KPOA 2Y0CA 3K7EA 5I7AA 1QZUA 2R6CA 4BCCA 4EMUA 4P6VF 1D09A 2QYOA 4R69A 1R16A 1BH2A 2C9MA 4J6EA 4XFJA 5DHTA 1EGQA 1V71A 3DTVA 4FGLA 4WBNA 2BR5A 2ZRHA 5KWJA 2XWPA 3RVLA 5IUJC 1XRPA 1K89A 4OMDA 3QMWA 2EJTA 2ECPA 3GUVA 1L7RA 5AVJA 1Z06A 3WFZA 2JFOA 4PVCA 5J1SB 4V0KA 3SWWA 2GXQA 3BMQB 1DOHA 2XXBA 2EQ5A 1EU1A 1YE5A 2DBVO 1A9ZA 4WINA 5ALJA 3A11A 3ENNA 1MABB 1Z6YA 2GCIA 5FADA 3V55A 3G0HA 3V4SA 4MJLA 1CEXA 1SHKA 3V1NA 1CY1A 1VA5A 2VHJA 4XDZA 4OQ4A 3A2NA 1QJ4A 1EE9A 4FILA 1FBNA 3GVXA 4M37A 1YR1A 4ZOCA 1OY1A 3MUOA 4UOEA 4TLMB 5LIPA 3UVEA 4JJEA 1GG9A 3SX0A 4CF5A 1T8UA 1JAYA 1LC3A 2I66A 3DOJA 3AEQA 5AXAA 5SZJA 4N5MA 3PEUA 1Y3BE 4FZJA 1X15A 3RIMA 2VAWA 4A5OA 3EVZA 2FW8A 5BRJA 2A33A 5K0CA 4UBMA 1Z0FA 4F1WA 1H2BA 3OM1A 4X65B 1Y4DE 3P9NA 3S99A 1Q20A 2ZG6A 4Q19A 4A0GA 1HMYA 2UZ4A 5H16A 1MEJA 4C76A 3MTQA 5TF4A 4F56A 5JTTA 2CXOA 4ACBA 1V5WA 4NGPA 4OU5A 3H5VA 3VR4H 2VQEB 1S5PA 1U5CA 4HDSA 5JRJA 3KVVA 3AR4A 1VB3A 3OIDA 3TEJA 4F6CA 1YOVA 4JYMA 1ZVVA 1A50B 2NTJA 1QJCA 5EWJA 5HZMA 5JPCA 1XP5A 3BXXA 4OYYA 4ZRDA 3HR7A 4FZ3A 1D6JA 1ZLXA 1V0JA 2D59A 2HZBA 2O1WA 4Q16A 4TLCA 5LN1A 2PVVA 1F2UA 3CNNA 3CZMA 3OJ0A 1JVSA 2WWRA 1CUDA 1ZZEA 3ED5A 3K73O 2OO3A 5A5GA 1P5FA 1E18A 5AMXA 5LZ9A 3L6UA 5AVUA 1EWVA 1SA0B 1L5SA 1XK7A 3ABOB 4KQCA 1EFRA 3BAFA 3ESYA 3PI7A 4F86A 1QIGA 4X60A 2X5XA 1Q74A 4EFDA 1A5SB 3M9XA 3HG7A 3AONB 3QYPA 4JD5A 4JBLA 5JATA 1XJQA 3ETGA 1N33B 3ASZA 1H6DA 2EGGA 3AJ8A 5CCDA 1IVNA 2H5JA 5BQ3A 3RUFA 4DWVA 5K0SA 1GUAA 1KZYC 2FPMA 3H2JA 4C78A 3EA5A 4G09A 1T2UA 1L5OA 1T4DA 4I1PA 4HRVA 2E4XA 3H1FA 3GMSA 3H7AA 3Q3JB 1XELA 3MW8A 2F48A 1I5RA 1FS6A 2JFFA 5BVGB 1FY2A 5FTWA 1ZAYA 2PX6A 3GFTA 1F60A 2P2GA 5A2QA 5IKPA 2QJFA 2W2VA 3U40A 3I5UA 5F98A 3L0BA 3IPXA 2Q5IA 2WJPA 3M0EA 3NANA 1GLGA 2XMSA 4R0VA 1IEWA 2YNMA 1QBKC 4PZ0A 1PT7A 3LHSA 4FFNA 3WL8A 1X1BA 2C2BA 2ZIGA 4FFOA 2R6HA 4P4DA 3EVEA 5AQEA 3WLTA 3MAJA 4PLPA 1JXOA 5K6AA 4G2NA 1E5XA 1JDSA 4X0EA 2B36A 3I12A 3EGIA 4J07A 4Q1AA 2JJ2A 1Y6JA 1T2NA 3GDHA 4Y2PA 3T06B 1FS5A 3MJ4A 4HGZA 4DIBA 2HK7A 1N2OA 3Q2KA 2Q9AA 3CW8X 1IBSA 3K0FA 2H9YA 2YC4C 1WCXA 3BCHA 3KFXA 2V55B 2VDPB 1QHIA 4JX9A 2QAGC 4LXQA 4M3NA 3S1LA 3NTUA 3PNPA 3GEHA 4TGLA 4G37A 1GL9B 4LZOA 3VHRA 4KREA 1XDBA 2WOJA 3LZ6A 4EW2A 1XRJA 3EMDA 3OEYA 3BSYA 1CJCA 1PJQA 1JNXX 3CU5A 3K4PA 2W93A 4FUQA 4KGDA 4P82A 4PTLA 4QDJA 4CDGA 3IURA 4DRXB 1HKUA 2FW0A 5JAMA 4C84A 4PU0A 4L73A 4MVXA 4ZJPA 5CA1B 5LXTB 4X7PA 1OLXB 1Q1QA 3KR9A 3PLRA 4D8TA 5DWQA 3RFVA 1CY7A 1TO6A 3C41J 3ESQA 1KL7A 5J3JA 1RLOA 3OHMA 1DZIA 1RE0A 2FPPA 1KAMA 4U4AA 5C1PA 3ENZA 3GFBA 3HI4A 4CIVA 4MNTA 5D8DA 2BKEA 2YJTA 4PG8A 3AF5A 1NR5A 4H6WA 2YYSA 3U4QB 5BWBA 4AJOA 2FWPA 1VG8A 1CULC 4TS4A 1X7ZA 5AHXA 2BHRA 4YYZA 1FP4B 3LUFA 2OVBA 3HE3A 2E21A 1XD2A 1P8AA 1CY0A 1XZKA 3VOTA 2ZTLA 1CQIB 5LLDA 3F90A 4CVNA 3WWDA 3QUTA 2JL1A 2FJ0A 2JFHA 4US1R 2Q6TA 4O4HF 5BNTA 4YDQA 2ZUSA 1UEXC 1JWAB 3WXMA 2XOEA 1QTNA 1Y1QA 4A36A 5DLDA 3ZCPA 4MR9B 4N5LA 4PSKA 5EIBC 3KT6A 1HA3A 3NHWA 1E6EA 3F9CA 3M1IA 1PUXA 1AXRA 1NM5A 3O9MA 1DTWB 2YJ3A 4HWTA 5EY5B 4M46A 5L40A 5IVKA 2V54A 3HKBA 4GRIA 3WDMA 4X20A 4L0CA 4JQZA 4J3FA 1XEXA 3IAM1 1M1YE 5KPJA 1V5EA 3TAHA 1UKVY 1KK2A 2WF9A 2WYUA 2CNNA 3IR7A 5HBGA 3EDMA 2ZDQA 4FMBB 4YJGB 1RI5A 4UM9D 5TF0A 5FI3A 5CJ2A 1I30A 4QNMA 2O0JA 3DAOA 1M75A 3L6OO 5IVIA 3M8KA 3OMXA 1EFLA 5KJ6A 2IV7A 2FE1A 1FFHA 4KXLA 3WX0A 2Y0EA 1HE3A 4DUPA 4RULA 1MIHA 4BFUA 1SG0A 2HGZA 4AQYB 3R8XA 5KVVA 4B3GA 3VSBA 1UBEA 4YHBA 1GEGA 1M1UA 5DM2A 1TQHA 5DCUA 4AWBA 1BXGB 2J9RA 3H1AA 3HY3A 4LY3A 2ZKIA 5JY1A 3AT1A 1E1MA 4UU7A 1PJTA 3DTYA 1HKHA 1JLKA 5EZYA 1WJGA 4D0GA 4DLWA 4DS3A 4IDQA 2P9HA 2B8WA 2WF5A 4KUGA 2ZITA 5E7QA 2O8EA 4FFSA 3S28A 1XV5A 4UEOA 1NMEA 1FRZA 4DXDA 3H5RA 4KQ9A 4JL8A 4ZI7B 1HQYE 1KBLA 2WU3A 2Z2IA 3U26A 1XTSA 5I4KA 3O8OB 2WYVA 4RH1A 4J1TC 1WE2A 3A6DA 1BCSA 1A5BB 3WJAA 2QZ4A 4PIPA 2PUFA 1OLSA 3H6GA 3FMOB 3V2GA 3WB2A 1AT1A 4W5QA 1ZK0A 1X7XB 2FP4A 1UXIA 2FMKA 3UB4A 1OYOA 1FSSA 1EIZA 4ITVA 2HKIA 4YRBA 4F45A 3VR6H 4F5WA 4BJ5A 1T1GA 4B3RB 1LLCA 2R8BA 1BWQA 4IZHA 3ZJ5A 2VJDA 3PC8C 5BV8A 4RWZA 4UUBA 2DFNA 3V4VB 1EGHA 4ZN6A 2HCBA 2GD6A 3ZOKA 3P27A 5A02A 5KYGA 2ECFA 3EWIA 2IXGA 1RM3A 3O1IC 4OHVA 1GDHA 1YHNA 1QB7A 4KHZA 5I47A 1N2CA 1B41A 1DT3A 4V38A 4GP7A 2XUIA 4C7OA 2LPMA 2ORIA 1CFJA 3DKKA 4RPCA 5MN4A 4KDEA 2F9MA 1H9BA 1JG4A 4Z8XA 4BUCA 1X77A 4AL4A 1I94B 2G6TA 1ST2A 3SMQA 2H2HA 3JYHA 3GQBA 4AYXA 5SYAA 5EHIA 2DQSA 2BGTA 3PHJA 3F7OA 5EVJA 5H80A 2A1UB 1KDTA 3DHWC 3N2NA 1CDDA 3GJ4A 4L3WA 5DTJA 2GK6A 4D4GA 2R7NA 3ZDQA 5AJYA 2DYKA 3U6BA 1XIVA 3M6LA 1F6WA 1K6XA 1BDMA 1WMDA 3JQGB 5DBGA 1I1NA 3IKJA 1HDXA 2JIQA 3OHSX 5K2OA 1F0KA 1BN7A 1ELOA 2AFRA 3PNLA 3QVXA 4I55A 1NJSA 3COWA 1JKFA 2HSWA 3AKEA 2P5SA 2BLNA 4FIDA 4Z2AA 3IXLA 3SJZA 3JQEA 3LV8A 1TA4A 1QK4A 3GB9A 1ECPA 3WIVA 2Q3BA 2RKBA 2JGIA 3B70A 3EODA 1R6AA 3G59A 3UMBA 3IS3A 3SHWA 4JY7A 3PQ6A 2HQRA 1T25A 3IMGA 2OOTA 4M0MA 1X1DA 5DLYA 1NIPA 3RF6A 4KLCA 1K7FB 5DVZA 3UHPA 3C5EA 4BAZA 3IAFA 4CTOA 1YI0A 3IVXA 2XTAA 3GLFE 4QDZA 1PL0A 7YASA 2HU2A 3LBHA 1AH2A 1Q1ZA 1FZQA 1ZM7A 1FEZA 3DZHA 4E14A 3HWWA 5FLYA 1PJAA 5DM70 1RZ3A 2C9CA 2PJDA 2C0CA 2GGSA 1TM5E 2DB3A 4YIKA 1UDRA 4HXFB 2B1JA 1TEVA 3MJDA 1U1FA 2AQKA 2FZLA 4C0XA 3COJA 3S9MA 1H69A 2HZ7A 5ILOA 2HA4A 2O8NA 1SUFA 5JZSA 4HR7A 2QZSA 4WJLA 1PJ4A 1J22A 2P3QA 4JJAA 2CFOA 2JBAA 1Z0UA 1K68A 2GH1A 2JLXA 5NULA 3MWFA 1SOWA 2EC5A 2NO9A 4M7RA 2C5EA 3CEJA 3IPLA 3L9WA 3AKDA 3GEPA 2M1XA 3NTOA 4JUDX 5DX0A 5LQRA 3RYCB 3IXQA 3HR8A 3SYTA 3NOQA 4IIGA 1O58A 1WMFA 2K87A 2B37A 1FL9A 3NR2A 3OO0A 1MIOB 2HH9A 2DPMA 4P2BA 4EFNA 1P1JA 2YS6A 4JFRA 3UPTA 4JYZA 5TT0A 1WQ4A 3TE6A 3MJSA 2HIHA 2QLMA 2XPCA 3URKA 4UTVA 1WB5A 3DLHA 1I36A 3HJBA 1ZS9A 1N92A 1Q77A 1X1CA 3C6ZA 3IEXA 3RUCA 2C3PA 3CJTA 3MINA 1Y48E 4EJSA 1XPJA 1K7YA 1KO1A 1E58A 1E96A 2CD9A 5AW2A 4A1OA 5KQRA 3U3JA 5CT8A 1QQ5A 2E48A 1SXJB 1CZHA 5BYAA 5IPFA 3OSZA 4MS3A 4OUDA 4GZ6A 1ZC4A 1YJCA 4D4KA 1F3LA 1E6WA 1P44A 1EA7A 2JANA 1VSUA 3OUTA 4BEVA 5JYCA 4HZUB 5BNZA 3QSGA 2P9EA 3ER8A 4D2IA 2VP6A 2W9XA 3T94A 4DA0A 2VQFB 1XB2A 3T15A 2ZBDA 3TCNA 3L5KA 3KBOA 2BDUA 2F4NA 2OOSA 2P9JA 2JBHA 2XGMA 3K20A 2HSZA 3O38A 5EFOA 3BIWA 3GH3A 2OG1A 3CE9A 1FUKA 5K8LA 1OXVA 3G0IA 3G23A 2OOKA 3D4NA 1H65A 3KHTA 2WD7A 1RWBA 4GR4A 2RHJA 2V5UA 1VLJA 2Q7OE 2OPBA 1XL0A 4I5IA 1R18A 3DEJA 4DEXA 2QSUA 5F2OA 2N1BA 4Q1FA 1X9IA 5DGCA 1HOXA 2XEFA 3NBQA 3QJGA 2FZEA 3PFIA 3EASA 4H59A 2NU6A 4J3NA 3RE1A 3LUPA 3W9YA 4IICA 4BFCA 1BE8A 1ENOA 3FGOA 3OHPA 1N1DA 4I0WB 1ZIDA 5LUBA 10MHA 2DBZA 2FH5B 1CLEA 2DCUA 4RETA 1YK1A 3ODPA 2XBMA 3GC6A 2WZCA 1MHTA 1PP4A 2QUIA 3VR5A 1LS1A 1BRTA 3HDQA 2PKRA 4E5YA 4DGQA 3DC7A 2L42A 1FMFA 1BEZA 4MRAA 1VIVA 4L9RA 3FOZA 4I50A 1YZLA 4NBNA 1ZAKA 1YQEA 3D1JA 1OAAA 1P9WA 1ZA2A 4H7PA 3CLUC 2NU8B 4FPXA 4Y2XA 1M6YA 2O0HA 1LW7A 5KQSA 4LRQA 2VP2A 4IIFA 3VKHA 3M9LA 1MR3F 5B7PA 3BF7A 5LA6B 2A88A 3B6KA 4IXDA 3OZRA 1UC4B 3ADCA 5TQ2B 2XKAA 1AHIA 5AOCA 4GI5A 5BUZA 4TN1A 1QLWA 3HLTA 2BGJA 2C6GA 2XMCA 1QTRA 4I6GA 2XODA 1S2GA 3HVKA 5DBEX 3T9BA 1I7DA 3R74A 3VKWA 4D43A 1DJNA 2ETXA 1RXSA 1BXRA 3HXKA 4OTZA 4B09A 5F9HA 2J6CA 1KIMA 3LCMA 5CNJA 1ZIOA 2OSBA 4MKGA 5TMPA 1XN1A 3K35A 4LQGA 1ISFA 5EJ4A 1UK6A 3OMLA 1VCHA 3CM0A 4KUEA 1GILA 3P0IA 4MQMA 3QLUC 1V8FA 4MV5A 3OT5A 5KBYA 1FSGA 2XE4A 5KX5F 3SLRA 3EPHA 3EJ6A 2EZCA 3VQTA 1SXJC 2GO1A 4WZBE 3I6BA 3C7DB 4BNUA 2B69A 1QWOA 4K6OA 1TYEB 5F5NA 2AFHB 3C6XA 3HFSA 2AXPA 3NPAA 4TLLB 2ODQA 3NEAA 4KRFA 3HV2A 1V47A 3HPQA 1Z7GA 4D8XA 3DEHA 4UCXA 1VI4A 1FQWA 4QXRA 4TYQA 3VNQA 4RF3A 1TLTA 4FN4A 2CBZA 4GI3A 1BFDA 4MVJG 3UO8B 1MKYA 2B7LA 1XD8A 1RLJA 1WUYA 2ZRKA 1KZ7B 1FYEA 4TRRA 4UCWA 5ESDA 3ZHTA 3FZYA 3IMFA 4GKBA 5CYFA 1F3OA 2HT1A 1JHQA 4GEGA 5SICE 2GESA 4D3DA 1ETHA 1PWXA 5I9SA 2H0RA 3PGVA 3HDTA 3PX3A 5F4ZA 3EWAA 4JMLA 4D3FA 3FHOA 1MXFA 2HREA 3G0GA 1U2GC 2R1UA 1UFKA 3S8YA 4J90A 2XYHA 3PQ4A 3N28A 1KYYA 1QTIA 3DSRA 3ILVA 4JJGA 4JVSB 3NVKI 2ZRNA 5CVVA 3OCJA 1TAQA 1H42A 4QOFA 5FTNA 5C3UA 4EEKA 2G0NA 3MWYW 3ADDA 1HR0B 3CKMA 2QGZA 3BXHA 4KTVE 1C3OA 1Z5GA 2WT8A 1I3NA 2VWHA 2WPDD 2ZSJA 4ND8A 5DMXA 4BFVA 4ENWA 1CUYA 5KREA 2G1PA 1XK6A 1P2TA 3GPCA 4LV8B 4Q9AA 3P4UA 1EWRA 3KCQA 2NPFA 4EUNA 3FUTA 1P4SA 4MYCA 2OBBA 4PS0A 1QRRA 3GUZA 4UOQA 3MD0A 3CX6A 3LKVA 1JFLA 1T4MA 3B3FA 1AUPA 2BFCA 5EKUA 4J0NA 2V0NA 3SYLA 2ZEJA 3P0JA 2O2JA 2KYRA 3EMKA 4F84A 2GZRA 3DUWA 3FHTA 3I8XA 1A71A 2HSEA 3H2IA 1BGVA 3WWZA 2HJ9A 1E2UA 1YZGA 2D2IA 3GOQA 4MR7A 4KE6A 3BK2A 1U99A 3RYFB 4NEHB 1KNXA 4F9FA 4WADA 1I4TD 3JWGA 4TUYB 4DQVA 3FOAA 4LNAA 4ZOLA 3RHZA 2BMDA 3BG5A 4BC1A 1MA3A 4PN3A 1X94A 3KQTA 3RWOA 2Y77A 1T9KA 4UZFA 4L72A 4XVCA 4D02A 1E7SA 2QI9F 3OQIA 4CL2A 3LP6A 4EG0A 2B2XA 4KO4S 1A4RA 2VK1A 3HUUA 3CF4G 3IUQA 3IO5A 2H48A 5E2BA 3VZCA 3AEZA 1K6JA 2QM3A 1MA0A 5EPOA 3QU5A 1N7GA 4CTJA 3LLMA 1NI4B 2IODA 9MHTA 1KVRA 1DI0A 4XR4A 1PWYE 3TGLA 2XUAA 4JR1A 1GZHB 3CRVA 4TX1A 1UC8A 2OHGA 2OHOA 2QK4A 4IIHA 3NI2A 4BE7B 1J25A 2QT0A 4WEOA 3QVOA 3S70A 2Q7XA 4AICA 2FMXA 2B9EA 4ESHA 4HNTA 5CB4F 5T3YA 4RD4A 4KE8A 2GM9A 4HMOA 3K0BA 4DQ0A 4BO1A 2J67A 3IIJA 3DHEA 1W75A 4D74A 5BMOA 1OX4B 4Q4DA 1KH3A 2BIFA 3FPEA 4CFSA 4GU5A 2OCAA 4KYTA 2AMVA 1EB8A 2W6OA 3CBGA 3L82B 3KSAC 2WWFA 4CLEA 2PKCA 2HJHA 1WQ1R 1L4YA 2DULA 4MW7A 3VRHA 3QU9A 1YRWA 1T5SA 2JI7A 2A84A 3QITA 5ELMA 3I1JA 4M8IA 3W5CA 1R50A 3TIGA 1R37A 4FUTA 5DYTA 3DBIA 3HVUA 4L76A 1DT5A 3IJEB 3JYNA 2BGMA 3MLAA 4MKXA 4ZHSA 2PGOA 1PR0A 3FHJA 3FKSD 2QP3A 2BKLA 3D6VA 5FWYB 1Y6FA 4J6FA 1GNQA 3P5SA 1ACLA 4HX9A 5HPYB 4DPKA 5LFAA 1XPUA 1WCIB 4RD0A 4M0DA 4Y1EA 4HRAA 4R7ZA 2FSPA 2ETVA 2ZUVA 4NONA 1GNSA 3HWSA 3I2JA 4YJHA 2EEZA 4R16A 1QDEA 1L4GA 1NVVQ 3EUWA 2G07A 1EZZA 2GMWA 3KKZA 4MW5A 3WLLA 1A9TA 3PL1A 4AC9A 3E84A 5FV7A 5C51B 1X7YB 3JZAA 4U7PB 2UZ3A 3I01M 5LZ8A 2WTBA 3D8UA 4OI1A 4YRKA 3EEOA 1RPNA 1IHOA 5IP5A 1RYYA 1PK7A 1X8JA 3WLRA 3SVZA 5H8WA 3ND6A 2GZHA 2B5OA 3LXRA 1G4HA 1TMYA 3R3UA 4XWTA 3DCJA 2VYVD 4E5VA 2OBYA 2CLEB 5KOHA 1OXUA 3PKZA 5LOVF 2CEAA 2WE7A 2IWHA 2EKDA 1LJ8A 1XZIA 3CX8A 3FWZA 5DSTA 4X66B 4CEJA 2CV2A 4O4LB 1Z8HA 3BCUA 4FNGA 4B7ZA 3PNVA 2Z43A 1QIJA 5AI4A 5K45A 4WFQA 3Q9NA 3VZRA 4IHJA 2IT1A 4B71A 5TMDA 4NBUA 4BRZA 2EJCA 3IUNA 4BCBA 3G2HA 3U7QA 3V1MA 3CEPB 1PYGA 4ARIA 4DLYA 3OTIA 1R9JA 3T4EA 4LGCA 2QROA 4ZOEA 3OZDA 2WPDA 1V11A 3KD2A 3AK4A 2HQ1A 5L3RA 1M1YA 3FUVA 4J2HA 3TPCA 4AF6A 4AIRA 1SHLA 1DO2A 3SHVA 5KVCA 1HYGA 1UANA 4XZ3A 2ZJZA 3TVDA 3CR7A 1E94E 2GD1O 4NV1A 3WYAA 2XEJA 4AZVA 1NP6A 1X1AA 4TMFA 5FNVF 5LL6P 1CJUC 3VSAA 3FZNA 4UMVA 1QF7A 3L7JA 3IQHX 1FX0A 4UHEA 4AJ1A 3DMTC 1K8XB 2E4AA 3N2KB 2JAPA 1VJGA 4J2OA 5CVEA 1DKRA 5I5GA 1C9NA 2AMYA 3BAZA 1VKZA 3H8WA 3O4RA 5K8TA 1OX5A 4YREA 3GRRA 1R9GA 3U44B 2IYOA 2R86A 3BXZA 3R5HA 1FLVA 4NMWA 2FN7A 4NCAA 3HFJA 3AVXA 3IAS1 2WIKA 3F49S 1SXGA 4G1CA 2C2KA 4G8JA 4L7QA 3VNVA 2GRUA 3H1PA 4Q9IA 2QS9A 1MNAA 1YJ5A 1XMPA 5LMZA 3SP1A 2WSYB 2EL7A 2BGLA 1XJWA 2ID7A 3A27A 3G0CA 3DHVA 3PGMA 5BQXA 2ZJ5A 2FU5C 3UJ3X 1ORRA 3E70C 3KEFA 1TAHA 3UWSA 4JBHA 3GJYA 4CKCB 1NBEA 1CD5A 2BFDA 5EJAA 1FNBA 5AJHA 1IG0A 1TB4A 5EHXA 5M04A 4DJEC 1T5HX 4IL5A 3VDXA 1F2TB 5IKXA 5EJEA 3PENA 4Q5IA 2C8JA 5FUQA 2OBXA 5DNDA 3VC2A 4CM8A 3T3OA 4TV9F 1C80A 2NZJA 1Y8ZA 1DMSA 3BZUA 4AS2A 1QFYA 1P4RA 1K6MA 2BLLA 4MUHA 1KFKB 4HLDA 3NATA 1KE1A 5BSHA 2P8SA 2IPLA 4WOPA 2POQX 2G4CA 3X1ZA 3UH1A 3HU1A 2EW1A 4HNAB 3GX1A 2JLCA 2XB2A 5KB3A 4R7GA 1B15A 4I5FA 1ZOOA 4PQFA 5TPWA 4G25A 2O3TA 5K3OA 4M1MA 3ROEA 1QG2A 2G67A 3GZ4A 3MTGA 4Y6RA 1NZJA 5EQFA 2O5EA 1EJBA 4QBHA 2D00A 3I9MA 1NURA 3AUFA 3LRPA 3WLEA 2Z8XA 1G5TA 3CF2A 4N3BA 1WY5A 3TFQA 1TCCA 4DQUA 2PDAA 5JCOC 4MMXB 3SF8A 4AG3A 3A1FA 1E59A 1SZDA 4BFYA 4B4OA 5BSKA 3FKSA 2ZPUA 4W5OA 2I7VA 1DFIA 2XY4A 1CKEA 2P62A 3R9WA 4M1QA 4RW0A 2JFPA 1XQWA 2LDXA 3GGJA 1BGXT 1JIXA 2PYIA 3E9EA 2YVKA 1KDOA 1ARZA 3NASA 2ZB3A 2ZUUA 4EW6A 2FR0A 4BX2A 1MOZA 5AYVA 1D2GA 3FBGA 1H23A 3L6BA 2VJNA 3JQAB 1VMKA 1A88A 1IMOA 4QUIA 3DM9B 1IK6A 5IJWA 4TWEA 1O57A 3ECSA 3KLMX 4LGMA 3ZHOA 2WM2A 3GJTA 1EH5A 3V2UA 2H31A 4AFNA 2XUDA 4C6TA 4LF9B 3ZX5A 1H85A 3MQFA 7MDHA 1TZJA 1U3UA 3G49A 3QKSB 1OH5A 1JR6A 1WXHA 4F6LA 2AJTA 1YFZA 3RCBA 3UMSA 4RJIA 4NGMA 1RRGA 1OI3A 1QGZA 4UBOA 2VYVA 3IC5A 5HHTA 2PX4A 2GEFA 3GXOA 2W4IA 4LE0A 5DHUA 4WASA 3WMXA 3DVQX 2I03A 1HE4A 3K9QO 5CH3A 4AI6A 3H1GA 4JEMA 1BWRA 3GLFA 2CL5A 4XRRA 4Q6WA 2ATXA 1QYWA 3GWZA 3JZIA 4U2EA 1DC8A 1NW5A 4EVRA 1GWNA 4WJKB 1ESCA 3PVZA 3AUXA 2VP9A 4U6SA 2JBJA 2PYDA 4TWRA 8ATCA 2QXYA 4CM7A 4NATA 1QFJA 1TFUA 3CW9A 1C1YA 2QR2A 3IIMA 5DW0A 5DN9A 4XDHA 1JQEA 3EVDA 3F46A 2VH1A 2Q7DA 5B2FA 3JWJA 1RRVA 4KIUA 2IBTA 4EHDA 2FZWA 2OQVA 1DUSA 1SULA 1I7PA 2GDJA 4HL6A 4O02B 4BNDB 5HW0A 4AM8A 1BHJA 4R1QA 5CHYA 4K9OA 4CYMA 4IIJA 1L5RA 2NUTB 1LBSA 1ZUHA 2ZVDA 4UUPA 3WGZA 4DOMA 1QU2A 2Q6IA 4NHEA 5LU8A 4CO9A 4IV5A 2W2QA 4HZIA 2DWPA 2YRFA 1I5EA 4WX2B 1LDYA 2UUPA 1CT9A 1NKVA 4RYDA 4NJOA 1DAEA 1NTOA 2B4RO 2AX4A 2BL4A 2C99A 5FEMA 3UOAB 3R9XA 2ZR9A 4MPDA 5GP1A 5FBZA 4EHHA 3BRQA 4GKVA 4AD8A 1Z4OA 3OOHA 1NT2A 1RXEA 3CHYA 2WSIA 1AQ6A 3OIWA 4TV8F 1R3DA 3IUMA 5TQJA 4C1BA 4O6VA 4P4LA 1FQOA 1TGYA 3O83A 1L7OA 3AIIA 5CK4A 3RSZA 5JS7A 3K4IA 2Q5LA 4QUDA 1JR4A 1C29B 1UWKA 5C8VA 1QAMA 3PXDA 2X8AA 1SCDA 1Q92A 2LVBA 4KITB 1JQBA 5PNTA 4LWQA 3P9KA 4V02A 1K9SA 3SC2A 2FUG6 3F47A 3ZWQA 2OZEA 4NX2A 5JSQA 3OE4A 4GGPA 2WJ6A 1NXQA 2VJAA 3GMDA 4M7OA 3U37A 4Q4AB 1E7YA 4LF7B 221PA 3FR8A 2A8YA 2JNWA 3PL5A 2M6KA 4AQ7A 2K2WA 1II8B 1IB6A 1GCGA 1Y42X 1Z62A 1MB3A 1Z2PX 2NTNA 3SCZA 2R62A 2QTCA 1KJIA 1M74A 2GHQA 4IDAA 4JHLA 3IPCA 3KD3A 4OQXA 5DNCA 1H2EA 4LCJA 1CVIA 2G4LA 4R6XA 4LK3A 3C3CA 3O3MB 2IYVA 4NU6A 5D00A 5ICGA 1NU8A 2JFYA 5EIFA 1KSHA 1YQ9A 1CB0A 1TVKA 5IRCD 3OM0A 3CEHA 3PNSA 1XHLA 2VTEA 4QXMA 5C53B 4X1KA 5FBWB 2Y1FA 1XOIA 5BQPA 4Z2YA 1XFDA 2FUKA 1OPRA 3HN6A 3R0QA 4G9GA 5G3ZA 5BUCA 3VH4A 5EXSA 2WQ6A 2C3YA 2FLVA 2X0JA 1SEVA 3HPRA 3QJYA 1C9JA 2H18A 1F8GA 2WV7A 4CM6A 4EHIA 4CNBA 4QJ5A 1A9XB 4QREA 1EDDA 2ZJ4A 2DTDA 4FZVA 4EOGA 1T29A 2QD5A 4WNAB 3W8EA 3HVRA 1OI4A 3VJMA 1LEHA 3A1CA 1D2HA 2MSEB 2C9DA 1ZD2P 3QHQA 1T2VA 2CDAA 1YUBA 5E4JA 4PCUA 4RD2A 3FR7A 1M2VA 4RVCA 5KAPA 2I3BA 2ZANA 1NFRA 3W2GA 5DBFA 1G2IA 3Q5DA 1P62B 4RZUA 4MGHA 3ZGOA 4A9AA 1JI0A 3LO8A 4L6IA 2E4ZA 4B84A 1VL1A 1EEXB 3II6X 1XMVA 4PLVA 4RVUA 5CDYA 3V1YA 1JG3A 3ZV6A 1DDIA 1KORA 2IUTA 2Q2WA 3WGVA 1NVUQ 1HORA 5LNK1 2UAGA 2V6GA 5BO5A 2Q1TA 2ZYGA 1YIDA 4BUJA 1GPUA 4CMCA 5C5DA 1KMCA 2CUNA 5HJEA 4C4ZA 4N03A 4JZ0A 3FMFA 1IZ0A 2AW5A 1T6YA 2FEOA 4I4IA 1DAFA 1PS8A 1THMA 2HBZA 4BDSA 5CFOA 4XGNA 4RJJA 1DHRA 3HXOA 1ZG3A 3N8DA 5BQ5A 1WU7A 5CLFA 2JFGA 2CUKA 3PHLA 4ENUA 3B2QA 4H6PA 1QIIA 3F5MA 2VP5A 2WABA 3OC0A 3K4HA 4U2CA 2EV9A 1C4XA 1T3SA 1ZSYA 4OP1A 1I0LA 5CCXA 1DNPA 4CLOA 1YASA 4BX9A 4OXQA 1WWKA 3GFRA 5ESWA 4PG6A 5DIZA 1SHJA 1SB9A 3LLCA 3INYA 3K1AB 4YP5A 4Z8YA 5CB6A 4L8GA 3MBKA 2EARA 2J85A 5BW4A 5EWMB 3N5KA 3VX4A 1DIOB 1L7EA 3CMCO 5HJ2A 3UWDA 4EI8A 4P4GA 5EQDA 3FPHA 3C7AA 3M49A 3E1KA 4RV9A 4Q93A 4Z4FA 2YBDA 1WF6A 4D45A 5DNYB 4WZBA 5D1NA 5B6IA 1YFLA 2HCRA 2V7VA 4L74A 3RRJA 5A04A 1YTUA 1P0MA 5JSUA 3QHAA 4JSRA 2OFOA 1C7IA 2Q4BA 3ZGYA 1RYHA 3H87A 4JJZA 2E1PA 3W8FA 3QZUA 1J07A 2PSJA 4ZODA 3LT0A 3GROA 3PE3A 1GCUA 3LECA 5DT2A 3JTEA 3RYIB 2ZJFA 2OY0A 4AUEA 2W00A 3GFQA 1YDHA 4LVCA 4OHMA 4ALNA 4E31A 1T9HA 1BHQ1 3ASVA 4ZO7A 4ZPXA 4XGKA 4JR0A 5REQB 1JJAA 3KUCA 4I2NA 4RWEA 4W9NC 3SR3A 3OQMA 2AJBA 1E62A 2ZW9A 4NECA 2OPHA 3WHLA 2BSQA 4IGKA 2JD0A 1VBFA 3DO8A 3STXA 2FE4A 3RSGA 2O0MA 3K9CA 4O0LA 2BFBA 3BFVA 1U8YA 4F8YA 5FUBA 1ID1A 3LG2A 2QX6A 1IBLB 2IOQA 4QAQA 4BY9E 1SCAA 1AQLA 2GARA 3H5TA 3KM0A 3ELDA 3GGSA 4HD8A 4W1PA 1YDMA 2ONYA 4GNKA 4B34A 3U1BA 2WFLB 2P7IA 2ZSUA 3PRKE 3VA7A 1PYDA 4BWGA 2WJIA 5JZOA 2QPOA 3W6ZA 3F6RA 3NH9A 3RKRA 5J58A 1FYDA 4BVLA 1E6MA 1UBKS 2YXLA 3BMXA 3LUHA 5GZ3A 4ZQIA 3PBKA 2HA0A 4BWFB 1X7GA 1HTTA 2H5LA 2PLWA 1AU9A 1W1WA 3NUGA 3QWBA 4IO1A 2JZOA 4TMZA 1GD1O 5H3HA 3KV1A 2O6LA 3QE4A 4ZCRA 3AY7A 3MJVA 3QEMA 1GLVA 5LB4A 2DIKA 1UEIA 3OPXA 5HKOA 1E6UA 3ZS9A 1ZDMA 2ERXA 4Z0NA 1G8HA 1N1MA 2QSJA 3VU1A 2ZSBA 1Q44A 2AVDA 1EK1A 2DCMA 5B1DA 4DBLC 5LQNA 3ZY4A 1TAUA 1YS4A 1O94C 2COKA 2NVUA 3LGSA 1ZXLA 3ZGVA 2VF7A 3J81A 4UBJA 1DXHA 1PRYA 2GPSA 2LNDA 2IHYA 5BV0A 1DC6A 2QQ5A 3QEAZ 1JR3E 2FEMA 2EWVA 2FQWA 2O2YA