3TLBA

Microcin c7 self immunity protein mccf in complex aspartyl sulfamoyl adenosine
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
335
structure length
335
Chain Sequence
PLLAAPLAVGDTIGFFSSSAPATVTAKNRFFRGVEFLQRKGFKLVSGKLTGKTDFYRSGTIKERAQEFNELVYNPDITCIMSTIGGDNSNSLLPFLDYDAIIANPKIIIGYSDTTALLAGIYAKTGLITFYGPALIPSFGEHPPLVDITYESFIKILTRKQAGIYTYTLPEKWSDESINWNENKILRPKKLYKNNCAFYGSGKVEGRVIGGNLNTLTGIWGSEWMPEIRNGDILFIEDSRKSIATVERLFSMLKLNRVFDKVSAIILGKHELFDCAGSKRRPYEVLTEVLDGKQIPVLDGFDCSHTHPMLTLPLGVKLAIDFDNKNISITEQYLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords MccF
publication title Structure and function of a serine carboxypeptidase adapted for degradation of the protein synthesis antibiotic microcin C7.
pubmed doi rcsb
source organism Escherichia coli
total genus 117
structure length 335
sequence length 335
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02016 Peptidase_S66 LD-carboxypeptidase N-terminal domain
A PF17676 Peptidase_S66C LD-carboxypeptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Class I glutamine amidotransferase-like 3tlbA01
3.50.30.60 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 LD-carboxypeptidase A C-terminal domain-like 3tlbA02
3T5MA 4IIXA 4E5SA 1ZL0A 3TLGA 3TLYA 5F1YA 3G23A 4MI1A 3TLGB 4INJA 3GJZA 4EYSA 4E94A 5FD8A 5JYBA 2AUNA 3TLBA 1ZRSA 3TLZA 3U1BA 3TLEA 4IIYA 5F9MA 3TYXA 2AUMA 5F5XA 3TLAA 3TLCA 4MJXA 4JVOA 5K99A 4H1HA 3SR3A
chains in the Genus database with same CATH superfamily
1M83A 3OETA 4JL6A 1IWPB 1YZ3A 2J3QA 5GMOA 5TMDA 5MHTA 3H42B 1N9GA 5DTJA 1DS6A 1D2AA 5E6UA 2X4GA 1EPUA 2AJ8A 5IUKC 3AW8A 2E21A 3OM1A 1U6JA 1X19A 2FFAA 3FKSD 1G0NA 4A91A 2IY7A 1VI4A 4JT9A 2JHGA 1K97A 3V4OA 3ZZNA 4CJXA 1G42A 5L3QA 3RGWS 4C4AA 3ZWOA 2CFRA 1S2OA 1X8JA 5DMHA 1T6NA 3ZG6A 1Z35A 3NYQA 1RQRA 2GZHA 5T6BA 4BO8A 4DLPA 4V0RA 1Z3IX 3CJRA 1QWOA 4ZVQA 3RAEC 4L6CA 1TI7A 2FF7A 5EVJA 4D0LB 5BPFA 4EQZA 3CX7A 2IOFA 3EVNA 4LZWA 3ZJVA 2C5EA 3UJ9A 2JGFA 4P4NA 3MJEA 1UDRA 2GBFA 3NBUA 3OKFA 3G02A 5FHRA 4YV1A 2CLEB 2Y4NA 3OURA 4HWSA 2Y77A 4X0EA 4FBGA 5AYVA 2B37A 2OILA 5EHXA 5EP1A 3BEOA 1XDGA 1RCUA 1UFQA 3VR4A 3R44A 4BNDA 2BGJA 2WJWA 3PNYA 2VK4A 4KO8A 1XMXA 5ALVA 3I6YA 3O73A 1JEQA 1J97A 1AZSC 3AR7A 3U0VA 3OUUA 3H3JA 4EYKA 1TU3A 1S3FA 1N2CB 3OPQA 1Y89A 4B3BA 1QV7A 4ZHQB 3U19A 4IINA 4ND2A 5EHQA 1OAOA 1HE4A 1CVRA 3AEUB 1QE5A 3SHTA 3SR4A 3OX3A 3K9LA 3K09C 4PE5B 4XJSA 1P2DA 5IUJC 4I1IA 4ACAA 2YHSA 4COOA 1L8AA 1U99A 1T3TA 1Y34E 4GX0A 4XSVA 1T36A 5JMTA 3UCXA 5F21A 2ZBVA 4BMSA 4C8AA 1FU4A 3K8ZA 2ZPUA 1UZNA 1WX1A 3JW8A 3M34A 1L5FA 4PYNA 4V1CA 3RKRA 3LUGA 3EMDA 5CPFA 3GA5A 1KO7A 4YHHB 3Q10A 3P8ZA 1K2VN 1W5FA 3PVCA 1NVVR 2ZSKA 4FMDB 5JFGA 2GZRA 1N8TA 1EK6A 3ONDA 3SYNA 3VSAA 4IPTA 5BWNA 1SXPA 3HBNA 3ZQKA 5E3HA 4Y9SA 3VR4H 4BGEA 1OREA 3RG8A 3D3QA 4F92B 2VNSA 2A9FA 1ZL2A 4M8NE 4WJLA 4U8HA 3N3BC 1LJ8A 1UBJS 5I7FA 1BDBA 3T7IA 2BFFA 2GTHA 1UJCA 3EQ9A 5I8PA 4O2AF 1L4NA 3E82A 4G0NA 4NE7A 3WYDA 4DLTA 5LDGA 1SXJD 1Z7GA 3WISA 2GN4A 3CX3A 4PS1A 1SHJA 2DT5A 2KHZA 2QIOA 3ZKWB 4BJ5A 3M6VA 4L2IA 4OB7A 1NI4A 3RKSA 2H5JA 2ZKIA 3DA8A 4YRBA 3AVXA 1TK3A 3A7EA 4LQ4A 3OTGA 1KXJA 3O4VA 4QO7A 2P79A 3CONA 4JJ7A 1L7VC 2IZ5A 2G9VA 3DQPA 3CT4A 4LCJA 4QAJA 4DC0A 2BFNA 1JRLA 1TFRA 4MULA 5FR2A 3W9UA 2ZB8A 4PZ9A 3TSCA 4KWHA 1DRKA 2AF3C 8MHTA 2QF7A 1YBHA 4AB1A 2HUPA 1N2XA 2G6BA 2I29A 2JFZA 2OE2A 3JQEA 3QFCA 3RT9A 5BRNA 2XUKA 4YRNA 2BGNA 2ZJOA 3AC0A 5JJBA 1AB5A 2O2EA 3U4HA 1F9EA 4JVNA 3G2LA 1VJDA 2XGJA 1WHTA 3EDYA 3OLCX 4TS4A 1E5QA 3L6BA 2X0FA 2IEAA 1Z5VA 4MKXA 3SM3A 4II7A 3H0KA 3VISA 1QGUA 4MKHA 4CEIB 3L0OA 1Q1EA 3EGIA 4KDCA 4F3TA 1CUYA 3IQFA 4FEGA 4Q34A 6REQA 3OLXA 3QYFA 4XWKA 5JBIA 4Y0AA 3SVTA 1IBLB 1FPQA 4BNUA 4GZ5A 3KVYA 3ZHSA 2VDUE 4M0FA 4PTLA 1CYDA 3VV2A 4FLEA 4H3VA 1WM1A 2MSNA 2NNLD 2V6JA 1I8TA 2XNHA 3FIUA 2JK1A 1GPJA 4IEIA 1AZTA 1CJCA 4ZARA 1UKZA 3NDIA 4KBYA 1U2TA 1QK4A 3HDVA 2V9ZA 1JZQA 4ED9A 3RVNA 1VHTA 2ARKA 2DPYA 5AK0A 1HX7A 2A1UB 1JUDA 1QUFA 3TMAA 4RL4A 1RC1A 2IYTA 3DE1X 3WHPA 4C5BA 2WYOA 2INGX 4KNWA 4R1SA 1G66A 5BUSA 1YQWA 4EY8A 4TYYA 5EPEA 4WK2B 3I58A 4RYDA 1ODFA 5JMOA 2PL1A 3DKRA 2C92A 3FETA 3HB5X 2ZB4A 2C4UA 1Q21A 3NIDB 5IT5A 3R3XA 3P2MA 3GZTB 1I7NA 1Q0PA 3RR2A 2IHYA 3G7UA 4HP8A 2IOYA 4TQGA 3T54A 4KO1S 3F74A 4A0SA 3R9IA 3BXMA 4HAZA 1UKYA 1EXWA 3DLPX 1RHJA 5FFMA 4QT4A 3AR9A 2AOVA 3HLYA 3IIMA 2L0XA 2V7QA 3EZYA 4XDHA 3JAWB 2R5WA 3UGQA 4LI3X 4U7GA 3PNMA 4FC7A 4CQMA 3TZCA 2QAGC 4OM7A 5FWYB 2XWBF 4NK5A 5KOIA 4YGYA 2BR4A 3NHKA 3HB1A 1N2CE 4JJEA 3K2EA 4R7TA 2JAUA 3EA5A 2OC4A 3DF9A 3GDHA 2H2WA 2AI2A 2H2DA 5I7RA 3L07A 1XD2A 5FP0A 1C9JA 1X77A 2E4UA 4X1IB 2ZAIA 3GAFA 4JENA 3AL2A 3DPIA 3BHIA 1FYVA 2AXNA 4L02A 2A0UA 2QQEA 3OLVA 1HYHA 4ZEMA 2O19A 5KCZA 2P68A 1HDYA 4YRTA 3H4MA 5BOSA 1VZ2A 3IRUA 1R6XA 1JDTA 2RH9B 1S3IA 4DMFA 3HVIA 3PYXA 2F7SA 5HNKA 3GU3A 3N3AC 4DR3B 1O3YA 5TNXA 4MEBA 3HVKA 4QYMA 3KHKA 1ZA2A 4JUDX 4MWDA 1U1EA 3ELBA 5BNTA 3EX7C 3L2OB 4Y6LA 1T13A 2YC2C 5AW7A 3NHSA 4Z4CA 1E3SA 4HB3A 1RFGE 2DHQA 2GPYA 4ONEA 4GU5A 5HTOA 3K0EA 1NXJA 5JZVA 3BHMA 4W63A 2QP9X 4BFLA 4NFSA 4Q5IA 2X3FA 2FZCA 3Q3HA 1VCNA 2A7QA 1QCYA 1VRCA 4UHKA 4PG8A 1LI4A 1EFDN 2R1UA 3MHPA 5FB3A 1C3EA 3BE5A 3M6MD 5DNEA 1M2KA 1Z5GA 3HNRA 2FZVA 1P4AA 3W8RA 3RUAA 5SY4A 4MVJG 2CK3A 2TMKA 4Y2GA 4IF6A 3PHGA 2QDXA 4HXFB 2PSSA 2O14A 3TWOA 1LB1B 2VDRB 4HNGA 1JFFA 2YZMA 5B7PA 3P4XA 5CLLA 721PA 1QH1B 4FJ2A 5HIAA 3NS7A 1QJ4A 3GJQA 3AV0B 1DPGA 1M8FA 2ZYHA 4C4OA 2AHRA 1G4UR 4UDXX 5AM0A 2PNJA 2NT4A 4TKUB 4ASUD 1KVQA 5ALMA 1C3LA 1QPBA 3UHAA 2H92A 5JJLA 1QDEA 3AB8A 2WFLB 2C31A 3LC1O 3K32A 3NYRA 3R5HA 5LBTA 3WHLA 4FE7A 1ZIOA 1MJHA 4H3SA 2D0OA 2D1RA 2B20A 4MTCA 1A9OA 1QRSA 4KH1A 4IIDA 3VFDA 1I7QB 4OHXA 2FZLA 4GP9A 2Q4EA 2WIKA 4QE3A 2EZBA 2XV1A 1DUVG 3EOBI 5DHRA 1VJTA 2I4MA 4ZGGA 3F7MA 2C58A 2DJ5A 1G16A 3H4IA 3NCTA 1V7QA 1UJNA 3ET5A 4M46A 2WC1A 1TM3E 5EWJB 5KTOA 2C2XA 1ZJYA 1H3EA 3ZZ0A 4MS3B 3FEEA 2IYQA 2PMEA 2Q45A 1KR5A 1HMPA 5AM5A 4CL0A 3QP9A 1K5HA 4ZO4A 2JLUA 3LD9A 1TUGA 1RRCA 1K86A 1JTVA 1NURA 3EXG2 2FGKA 1X3LA 1B76A 1PZFA 4S12A 3ZD6A 2JASA 3PLNA 1A82A 3ROEA 3UUWA 2IFTA 3EDRA 4IEEA 4UXHA 3HSYA 4C2AA 5L3SA 4REQA 5CVCA 1ZU4A 1FDTA 1G3IA 3A0UA 5DM2A 3C3XA 2ZQZA 1MR3F 4J91A 4LRXA 2YWGA 1HF3A 3FYDA 3VR5A 4FILA 4ZYTA 5JHGB 5JAPA 4CEJB 1G8MA 1OILA 2GB4A 1QG6A 1CJMA 3TCXB 5GPBA 3JQFC 1JSCA 3WICA 2QRZA 2BFCA 3LLUA 1Q5PA 4RDHA 4P4SA 1PN3A 4MW7A 4X8OA 5HS6A 4DV7B 5DLPA 4C04A 3D8RA 4PPNA 4AZTA 1UXHA 4IGAA 5I7OA 2BH9A 2A59A 2GPNA 1C3VA 1SVIA 3FPBA 4I5FA 4F2DA 2ZANA 4DLRA 4OB8A 3N07A 1OFTA 3HVUA 1VHWA 4KO4S 1RR6A 2E3JA 1AS0A 3N58A 4MV0A 4D0NA 2XMSA 3EG5A 5EJ5A 4Q66C 2HPVA 3DV0B 3B1XA 1B14A 2VEDA 3UKJA 4AUEA 4G9EA 2C6PA 2QRQA 1JMVA 2Z08A 2WIDA 3JQAD 1ZLXA 2ZBFA 2UVPA 1DX6A 2NQ8A 4BRZA 5CR9A 3COPA 3RIXA 3WGVA 4XDZA 5IMSA 3ESDA 3D7HA 1V7PC 1BX3A 2X8JB 1WDLA 4MUHA 2RIPA 4X1KB 2OQRA 3F8WA 4AT1A 4UHBA 5FI1B 1WB4A 1NIJA 4RK0A 1VBGA 4UBLA 1OF1A 1GO2A 3TL3A 2ECPA 3VR5H 2EKPA 1XZ8A 3ZLUA 2CUTA 3OJ0A 2XBUA 4C3OB 1FF9A 3NG1A 4EPVA 1ID8A 2HIGA 4NENA 2W6JA 1U8AA 4DEYA 4A2PA 5B4TA 5CCXA 1N78A 3IC5A 4D57A 3FPFA 4CG0A 4UHDA 3KD3A 3K6JA 1UMDA 2ILVA 3RRFA 1P2UA 1JB1A 1ZUWA 2XVZA 5EMKA 2QX8A 4HB0A 4HQOA 3IMCA 4NBRA 3ZV4A 4CMIA 2RI0A 1ZS9A 4N8SA 5EWLA 3A2LA 4Q9JA 2ZJ8A 3ND8A 2CEAA 2A9KA 1QDUA 2DWPA 2I54A 1BS2A 5T4FA 1JF8A 2NPFA 4O1IA 1XP8A 2OAP1 3WQQA 4MOWA 4RPIA 1EWYA 2N75A 1P0CA 4LMRA 1AO0A 1W25A 1YB5A 1TZ2A 2VJDA 3CIOA 4O1HA 4UATA 1ZICA 3T35A 4U5XA 4DA4A 4OBEA 3O4HA 4KU4A 4OHWA 3F6PA 3LX5A 5AVRA 2BJVA 2Y67A 2BFAA 1ND5A 1M0TA 3OCYA 1EFUA 1IQPA 3NHZA 2PL5A 1AKWA 5E9WA 1SK9A 2PBRA 3BQ9A 2PSJA 1ULTA 1KC1A 2D5AA 3NV7A 1SR8A 3MOIA 2BI7A 2ZT8A 5A0VA 1FZQA 1KAGA 4M7WA 1P91A 5TE9A 2Q9AA 2C59A 5FUYA 3ZS8A 1H85A 4M38A 4WFQA 3CF2A 4N3GA 3F3SA 3FHCB 5ITZA 3R5KA 4OK5A 2VATA 3DLTA 3LDFA 3O8LA 4FFBB 2FN9A 3C6XA 1QRAA 2B6NA 1TRHA 3SHVA 2JGNA 3I32A 1KH2A 1XZPA 2BKXA 3A14A 2PRZA 3AFOA 3KSMA 4HYEA 4G1EB 4KDFA 1AY0A 4Q4AB 3TI7A 4BEBA 4CV1A 1R0BA 2GZMA 3PHIA 1DBWA 3EA4A 3JATB 2HMUA 3H99A 2FV8A 1DQZA 4GBGA 3LX6A 1P9LA 3H2BA 3IQEA 4D3FA 2QG6A 1UBGA 4ND8A 4S24A 2WJ6A 3Q3GE 4PAWA 3TAUA 1A95A 1E94E 1WB5A 3W4IA 2HA5A 1PSDA 3GR6A 2DKOA 4ZO7A 5EHIA 3OU7A 1MNQA 2PL3A 3SR0A 4B4VA 1SCDA 1WJGA 4BN0A 1M1YA 5B30A 4PPQA 3QJYA 2ZAGA 1UDAA 2AMLA 2QTVA 4WZBA 2GBPA 5I7VA 2A3NA 1U2GA 3OEYA 3IKJA 1AGPA 3MIZA 3S27A 2QPLA 2XQGA 5JD3A 5L95A 2CDNA 1F2DA 1N6PA 1G8HA 2IDJA 3MUOA 4XM0A 1YHNA 3DMNA 2NXWA 3LHDA 3DNFA 4TL6A 2DHDA 4AJIA 1TOAA 3H16A 1L0BA 4HYTA 4AKHA 1G5PA 1OH6A 3FTQA 4B2YA 3K0SA 2F1RA 1T4BA 3ZY4A 3NUZA 3TNDA 5KVSA 4A8JC 2UZAA 1I13A 3C6QA 2B83A 2ZJ3A 1MJGM 4I1VA 3G88A 2GXQA 4HAOA 1P7PA 1E0JA 5H59A 2YQZA 4ZQFA 5EPOA 4CF4A 3AFIA 4LSGA 1AZLA 4BNKA 3TD9A 2J08A 2WNHA 3L1JA 2VDWA 1TO2E 4DUZB 3I9MA 2JI8A 1D0VA 1GNLA 2G5GX 1NLUA 3E58A 3HFSA 4GYJA 6PFKA 5JANA 5JYBA 3B1VA 1UC4B 3G1TA 2H57A 4UMEA 3WB9A 2UZ4A 3B82A 5A4KA 1QRTA 1VL1A 5F4BA 4RQUA 4ARVA 4D56A 5BP7A 6NULA 5F3DA 1X74A 1JWLA 1LD3A 1L7DA 2QTHA 2B8WA 3AP2A 1UK9A 4J7UA 4LK3A 1O7JA 2WJHA 2YY6A 3MBKA 4UUNA 5JTTA 1MX9A 1I01A 1NM5C 1D2EA 3LY9A 2WG1A 4N3AA 2H0QA 4PYRA 4EWLA 2DSNA 4F4HA 2G0TA 3KYDA 4YY3B 1KQPA 3W5IA 3LKZA 3T9DA 2BTQB 2MMCA 3W1VA 3LIPA 3HBLA 4PZ0A 2FPGA 2HAEA 1HQCA 3DDWA 1GDTA 2V1UA 2YIVX 5HM8A 1PR1A 2N42A 1N5DA 3I5AA 1E64A 5KDOA 1YBAA 4IKOA 4J0EA 4EYEA 4GO1A 3QMWA 3FDIA 3OFND 2G9QA 3ONEA 3S4YA 5INTA 2AXPA 1OFIA 3OCZA 2DU8A 1LCIA 1BN6A 1UP4A 2PWPA 4EF6A 5LQNA 3CO5A 4HGPA 4X62B 2DWCA 3ADBA 1KMCA 4KR9A 1NJ1A 1J25A 2GK6A 2N3ZA 3AF5A 3MPOA 4WACA 5EMHA 5ALPA 2FW7A 4WZAA 3WP1B 1N5LA 3L4JA 4TLDA 1OB5A 1SKYB 3HKBA 4FR0A 5IF9A 2O3TA 2IIVA 2WUWE 4FYYA 3G0CA 1QVWA 1V8ZA 1H2RS 4EA8A 3BWMA 1NUQA 1HYEA 3R77A 4O4JB 4X1OA 2DQZA 3ROGA 2DR2A 1E1NA 1N1GA 3BK2A 5D86A 4E13A 3CFYA 2ZJ1A 3BL8A 4PCAA 5P21A 5KOHA 2GSWA 5D3MA 2Q1SA 2VHTA 1V6AA 3FKQA 3IUNA 5EQDA 5FOSA 4WEOA 5A62A 5HKKD 1CJUC 4G0YA 2OCIA 4MWTA 2V96A 3GVXA 3PSHA 1IN7A 3ODPA 2DE0X 2I7XA 5J5AA 3GT0A 5CDFE 4NU5A 5JS6A 4C7OB 4ZCMA 1SVUA 2I1LA 1YS9A 3RRXA 1JSXA 5I4IA 1SKMA 1JILA 1UF9A 4YRPA 4BVKA 3GBSA 3ILXA 3E3MA 2R8XA 4KR6A 1MU0A 2F9LA 3SHFA 3SYRA 2YS6A 2MJLA 3WZLA 2RE8A 5ENDA 2OFFA 3PJFA 1RWBA 2R66A 2XCUA 3WK6A 4EVSA 4URXR 3DYIA 1DXHA 3Q40A 1UDBA 3TRDA 5B4VA 3M49A 3I2HA 2IA5A 3BB4A 3C4VA 3I01M 4LAFA 1OFGA 3H2JA 5JFOA 2CLDX 2IRWA 4F1KA 3JYHA 3AEQA 4YRIA 3DBHB 5LQSA 1EGMB 5B53A 1HDOA 3ESAA 1C80A 3LVRE 4RTMA 1BWRA 1P9RA 4FOTA 1ZIPA 2RGBA 2GHTA 3CINA 4FYXA 3N1UA 3OSZA 2P9ZA 1RAAA 2XUHA 3DTNA 2A9OA 2JIDA 4HBZA 2R4QA 2YH2A 3W6NA 5JMWA 1EP1B 5K0CA 2I66A 4KX5A 1ZMOA 4AJJA 2F67A 4L5BA 2FPPB 4KP7A 3STHA 3LF2A 2VHCA 1XO1A 3ORQA 4OXIA 4R71A 3F4BA 1SXJC 4BUZA 3MBOA 4X97A 4PYIA 3L4BC 4JBGA 2J9YB 3K1YA 1TTTA 4YT4A 3RS3A 2A0YA 2I7TA 3UNXA 3FHLA 4GH5A 1IK4A 2FR0A 4EG6A 1MEOA 1J0XO 2I03A 2FWPA 2XKAA 3L49A 2CLIB 4Q3EA 4YB8A 1JXMA 1L8XA 3KUDA 3O4RA 3AY0A 3CKLA 3EC2A 3GVPA 5IXYA 2QUZA 2JLZA 1JHYA 1JNYA 2YHIA 4YBRA 2PHZA 3TLZA 3UA4A 2VP0A 3WQRA 2NUAB 1GKKA 1U2DC 4L0QA 1RXEA 5IRCD 1WZCA 1IY9A 4LG1A 3WG9A 2OZVA 4HMOA 3C3EA 4I9UA 2AFHE 4MVYA 4HH3C 3I2IA 4F04A 1JAIA 3F8TA 2HY7A 1LLCA 1UFVA 3LBYA 5BSRA 1FFYA 3I0MA 4OMFG 4P8RA 4P45A 1SPBS 1AKMA 4S1VA 2I9PA 4E3WA 4KPYA 1PDOA 4CKEB 1K4MA 4CTOA 3HBFA 1K7CA 4U6QA 3R6GA 4PPYA 1WV1A 4C4TA 4BJ3A 1D1QA 3KYCA 1IK6A 4U6NA 4G5RA 4UUMA 2CLOB 1OX4A 1J8YF 1YWGO 4XTCS 3CN9A 3MLAA 3FDZA 3R6LA 4ZVNA 3DLIA 1WBJB 3KAPA 3FSGA 3EQ6A 3KZVA 4OC4A 4PZZA 1Y6ZA 2PWAA 3HLKA 1ISGA 4LYYA 2G9RA 4XPIA 3WDLA 2BDEA 3V1NA 5IT0A 2HMWA 4FSXA 3L8FA 2UYQA 1C4WA 5HJEA 4P0PB 2GM9A 5IAGA 3PJGA 2HU8A 2TMYA 1GV1A 2IZ6A 1AURA 1JJFA 3DZGA 2EP5A 3P97A 4P81A 3T12A 4DXHA 4M0PA 1HZJA 2QAIA 2AFIB 3GZNB 1M2OB 1SCAA 2GAIA 4B6GA 1MABB 4IIGA 1OBOA 3QQ5A 3R7DA 5FF9A 1Z7WA 3I52A 3N2GB 4I8DA 5DFAA 3I5XA 3CW2A 8ATCA 3D2BA 4RS4A 2ZEJA 2AQKA 3ZHRA 2ISSD 5FL7D 2Q9BA 1RBYA 4X94A 1OT5A 3LG2A 4RSMA 3K9FC 4GRAA 1Z0KA 2B30A 3PJEA 4LGMA 1WSBA 5KSZA 1K27A 2WOOA 1DB3A 5IT9A 1EGQA 1VGVA 1DV1A 2SECE 4GECA 3SEFA 1I36A 2D7CA 4RSRA 4I4LA 4Z86A 1T6XA 4B7ZA 4EW6A 1JFTA 1T43A 2I6UA 3LT1A 4G86A 1A9TA 3QKRA 5AJUA 1C4OA 1EAMA 4GWKA 1HOXA 1ZW1A 1N57A 4NJOA 2GYVA 1N6IA 2QTLA 3BZBA 3P96A 1I24A 2IV3A 5C5IA 2Q3CA 4XM2A 1JLKA 4MR8B 3KQPA 1YC2A 1NBMA 4FI3F 4JXKA 4MJXA 1W73A 4TYMA 1CIPA 1WU8A 1RPNA 2QZPA 3VPSA 1ZD3A 5G3YA 1ITZA 4X63A 4CTNA 1RBQA 1VBMA 2JB9A 1JL3A 2MSCB 2WJ4A 4H2DA 1ZPDA 1V5GA 4TTIA 1OR8A 4ZPJA 1SC6A 2G77B 1L5WA 4GLLA 3U7QA 2ZPAA 4YIHA 4Q19A 4Z9YA 2QQFA 1XEWX 5J4KA 1WPRA 3MT9A 2XDQB 1L1EA 1QH8A 1W35A 2FMFA 2R84A 2VK1A 4X20B 1HNNA 1SUCA 3D8HA 3EIHA 4LXYA 4LBWA 3K4IA 1A8HA 3HN6A 1HZZC 4PGHA 4XWAA 2X7XA 3R0IA 1YMVA 1Y3HA 3QXHA 2JJ8A 2GXAA 1SC9A 1CDEA 1Q2UA 1V8FA 3GQBB 2EJBA 4I6GA 1N5MA 1QFZA 4IX1A 4UNQA 2ZIVB 1NJ2A 1A71A 2BMAA 3U31A 3Q3IA 3WTBA 1TKRA 3MUNA 5FCDA 4JB2A 4BZZA 2O6HA 2RAPA 4G84A 4PSKA 3ETCA 4PX3A 2DFTA 5KWIA 1JR4A 2FZ5A 1R4MB 3WMFA 3MSCA 4NBKA 2XMZA 3C85A 1PZHA 2VZEA 2IYYA 3MRSA 3PQ8A 4QT0A 2OXIA 2WUDA 2OLSA 2ATIA 3NHAA 2QTMA 1EHYA 1GPLA 4QARA 4DA8A 2HJGA 5K8UA 1QZZA 2PX5A 3BTSA 1A2KC 4WESB 4A6DA 1M9NA 2CLHB 3ZXIA 4IHJF 2FAXA 3RC7A 5JCJA 4YRJA 3E84A 3ZY2A 4CGYA 4AF8A 4B8YA 1GAQA 2Z4RA 4Z0HO 5K0ZA 2QTZA 3AWDA 1BFDA 3DT6A 1OWLA 3KPJA 4IWXA 2QRKA 3VU9A 3INRA 4AMYA 5C18A 4KLAA 2XQKA 5JJ5A 1BWSA 2AMJA 2GPBA 2QVXX 2TRSB 4KXXA 3PFKA 2VA9A 4W8OA 3UV6A 2JD0A 4ALLA 4CIVA 1WAMA 1PL7A 1XLTC 1ODSA 1RWMA 3AYXB 3HA3A 3K0KA 1GZDA 1DJPA 1HKHA 2W2PA 1SAYA 1XT6A 3HFRA 4GI5A 4K9SA 4BE4A 2W98A 3SS9X 1GPNA 1I0ZA 5KCMA 4UQLA 1Y81A 1FXUA 2CFCA 3ETJA 3QX7A 4Q4DA 4OO3A 1EK2A 3VH4A 4Q37A 3MWKA 4O2BA 4K81B 5FOXA 5B5SA 4LHEA 4FFWA 1ZP6A 1WSDA 1J21A 1H2FA 2HYDA 3RSQA 4RWZA 1G55A 4F6LA 3PL5A 1NX9A 1RACA 1CZRA 2LP4Y 2A57A 7YASA 1SVLA 3LUHA 4FGKA 3NM4A 2X6QA 3OD5A 1UJBA 3UWPA 4Z9FA 3NHUA 4C89A 2C20A 4Z3DA 1SXIA 3HNPA 3F7OA 2P40A 1QC5B 3R40A 1NXWA 2PKRA 1WB9A 2PV7A 1OTHA 1XBTA 4ITUA 3C3MA 3T15A 3QNMA 4G89A 5LMUB 2FX2A 4EG5A 3Q87B 2AFIE 1PJAA 4OREX 1DJQA 4UDOA 5DW0A 4P36A 2I1WA 3C5HA 4H18A 3ZDZB 5B3JA 3CX6A 1W5TA 3SLKA 3GLGA 2UDPA 2W43A 4YA6A 2HCBA 4YRAA 1CX8A 2FWAA 4XD2A 5JTUA 1NMQA 4P3YA 2JIZD 4AM8A 2E9SA 2IPXA 4C2TA 4ZVPA 5CT6A 2E28A 4HLUA 4CKWB 4DT1A 4LJSA 3I5YA 1PDWA 5LYJA 2B78A 5FAKA 1JQAA 3OUTA 1PNOA 4YRGA 4JVOA 2H4HA 1P1CA 1NSYA 1M2VA 1Z6TA 2H9YA 4Q4HA 5AHKA 1E5TA 3S6JA 3T7KA 4BNVA 5MGNA 2ZKLA 5DN6A 1BU8A 5J59A 1R88A 5H3CA 2IUUA 1XX6A 2HRZA 3P9CA 1R9JA 1XLUA 1KO4A 1X39A 3T1VA 5LC1A 5L6LB 5CH3A 5JQGF 2V1XA 4IJWA 2V7TA 3AERB 4P84A 1ONOA 2PZLA 2QHXA 4NBVA 3CRQA 1YQQA 4IMJB 3WLJA 5REQB 3VV3A 3H9EO 3UT5B 3PUKA 1L5YA 4FHEA 2I62A 2MINB 5EIWA 3CKKA 1KDVA 4D4MA 4DIMA 9GPBA 2IPOA 3VH3A 3QE4A 2W2LD 5D1HA 3ZDYB 5JCXA 3C3CA 3SKXA 1YR3A 1W2GA 3VX4A 1B6SA 3HEBA 3KKNA 3AM1A 2CLFB 3ZGNA 1HFJA 5CPBA 3HEAA 2MYUA 5H1YA 2EOAA 2YJZA 5KVVA 3H4VA 1GR0A 1Z8NA 1LNQA 1X86B 1M7HA 3AOEC 2I6GA 4KTTE 1N6HA 2RGDA 2DUUA 3HZRA 4GOMD 4D8UA 2XDYA 1VSQA 4DMRA 2N1BA 3K92A 3TQOA 5AM4A 3ZYCA 1P5ZB 4AS2A 1F1JA 5ALIA 2O8DA 2ZUUA 3TTXA 1IN4A 3ZOZA 4MMYB 1LQUA 1BGVA 2FRVA 2RB4A 4EKGA 1US8B 3BIFA 3DM9B 1G60A 4L1KA 4LJ9A 5CFMA 2BEUB 2ID4A 5ALEA 4M9CA 1XVTA 1GQ2A 5KMGB 3U2QA 3TGPA 1KU6A 3PC6A 3MHTA 3VVMA 3LPCA 1WPGA 2HBQA 3RVBA 4ZRDA 3ZN2A 1M6WA 3W6ZA 2Z8XA 2VDQB 2ZFUA 3FPCA 4IZIA 3GLHA 1E3QA 4L74A 2M9MA 1RPTA 2OXFA 3IXQA 4QDOA 3DFZA 3Q1LA 4ZT3A 1QVAA 3GGGA 1XDUA 3FBGA 4GMFA 2GM3A 5KB3A 3EEOA 2F64A 4RE5A 2ZM5A 3GGPA 2BGKA 3GFOA 3JD4A 3RCBA 5IN5A 2VF2A 1SOAA 2XSZD 1Z28A 2YV3A 3MINB 3G5MA 4GRIA 4TT3A 4R2HA 4TLMB 5DGTA 1L6IA 1XAJA 2H8KA 3RYHA 3LQRA 1OXMA 3S1AB 4MCHA 1KK2A 2J6IA 4XD7A 3L7DA 4CFSA 1DUSA 1LBHA 2NAPA 2IBSA 2EYQA 1TUBA 3I9V1 3EGWA 3UJBA 4IWYA 5KYYA 2LBPA 3PXAA 4PWYA 2QT1A 3OZVA 3KEFA 1H3NA 2EKZA 4UUOA 2ISCA 2RI1A 2IUEA 3JQ9A 1FTWA 3K20A 3R7FA 4IW3B 4AN0A 4ECAA 1PEDA 3FGPA 4LUCA 4YI3A 1I6WA 4IDEA 4KE9A 3PI7A 4EGJA 1HM5A 2PZMA 4DR2B 3M1IA 3F6YA 3VXKA 2WHYA 1P0PA 1RQNA 3KB2A 5HIIA 2VUUA 3LLVA 5CA0B 4J2OA 3PFIA 3L0YA 3THWA 3O1JC 3PQCA 2EZCA 3HR4A 4KNVA 1JIIA 3MJHA 2XZLA 3IUYA 1NY6A 2YMMA 1L7OA 2ZVDA 4J1SA 1FFDA 2VAVA 1V95A 2IZ0A 2Q3HA 1FL9A 3AGPA 1LSSA 1DELA 2F3RA 2Y0EA 3DOFA 4ZYXA 5LMZA 4UHFA 5B2ZA 5HP4A 1BX1A 2P3QA 1GILA 3SK0A 3A3NA 3ZV3A 4BGIA 4OI2A 2J9FB 2DPHA 3B6KA 3HXKA 4P7FA 3B3QA 1LF5A 3G6KA 3JPYA 3KWMA 2EL7A 3LDAA 3KT0A 3WDKA 2ZIXB 1G64A 2J59A 5IH3A 4URYR 1DZIA 1VL0A 4ZDWA 5BV2P 3KOYA 4Y6SA 1GCUA 4EJ6A 2OB1A 1G5FA 3A4TA 3M33A 2ATEA 5ELLA 4E03A 5I4BA 1CLUA 4IDOA 2WPDA 3T3GA 2P90A 2WABA 4JI1B 3FMOB 4YRSA 3VNAA 2H8GA 4C78A 4LC1A 1YZTA 1VB3A 4M9ZA 2IWRA 2X0SA 2QLJA 3EQZA 4YMLA 5KNDD 1S3GA 1JNXX 2YFYA 3QA3E 5DZSA 1SVWA 3DKVA 3ER6A 1I3OA 2FLWA 2VDOB 1HSOA 1LY1A 3FDXA 4FCVA 5BYJA 4ARZA 4FLFA 2QN7A 2ZROA 2FR1A 3KXKA 1PL0A 3R23A 1YRQA 2F1OA 5L7YA 5EWMA 2QSYA 5BWOA 4AY3A 1WDMA 4DILA 2QN1A 2VRBA 4P34A 1PFQA 1PD0A 2BEJA 2X0RA 3DOOA 4EZIA 3C7TA 4EGQA 3DMDA 5A4FS 1DWOA 4EBBA 3BD8A 3MB8A 4UM7A 2XRZA 4G4IA 4CQNA 2O8EB 1B0PA 2ZATA 1AKRA 1Y0BA 3LVBA 4FBMA 4LGVA 4FSHA 2QVGA 3URKA 2FJUA 3QPDA 1QIMA 3RRYA 3KJZA 4QXOA 4COGA 3CS3A 4RHUA 5FPQA 5HE9A 3T9EA 1CP3A 4V02A 1DJOA 4ZMRA 2HJHA 1U3UA 1QONA 1M66A 3PNLA 3AUKA 5KYUA 3FTFA 3LOQA 4PVCA 4UQPA 1RYHA 4O5OA 1WCIB 4WY2A 5H5JA 4D02A 5KWSA 4J2TA 2NO1A 1PR2A 3ZCQA 5CLFA 2NZXA 3OE7D 2W6CX 4YAUA 1GG5A 4ZJUA 2PZEA 2O7RA 1E1KA 2NN3C 1Q14A 4CF3A 3IAEA 3D8NA 4K9RA 1LJUA 1ZCFA 2EQ5A 4K9DA 2VT3A 3SN6A 4GW3A 3EXFA 3IPXA 3RS0A 1FXSA 3E9DA 3GF4A 3FGNA 3LC7O 3JSXA 3CUSA 4OMDA 1WCYA 4UBJA 3C8ZA 5DTRA 1ZEJA 4R4JA 5K0TA 4OAQA 4LKOA 4PV7A 2DFKB 2WYHA 1Q92A 3KC2A 1SCKA 4Q9HA 3KDPA 2AYZA 2WWTA 4NGNA 1G2OA 5EXDA 1CF2O 3H1EA 4Q4LA 3UWMA 3FPSA 5LOVF 3E3OA 3Q8WA 3N7AA 2AMVA 1WLSA 4EUEA 3MQFA 4RO0A 1NVBA 2FSIA 2EKQA 2I2CA 3OT5A 3QVJA 1U7WA 5FTKA 4DADA 4UFNA 3J7TA 4ENTA 1FFXA 1W29A 3PF8A 4TKZA 1XVIA 2WVJA 3C6MA 2GJAA 3LO5A 3TSZA 1YTLA 3TZ6A 1GU7A 3S2SA 5BWMA 2R0QC 1QU3A 3CXRA 2HKIA 2RH8A 3CR7A 2B3DA 3KEQA 4QU9A 4JYAB 2I1QA 5FTLA 5LQAA 1VKJA 2YXLA 1Y4AE 3SZMA 2DLCX 3AHFA 1CR1A 4O1MA 1SQSA 1U8UA 3GJ6A 2VKTA 1K3UB 1PW7A 1BXGA 4B35A 2G3YA 2GBGA 3IAXA 4G1BA 2EK8A 1Z83A 3F7TA 4BBPA 2A88A 5KNBA 1G5RA 4E1BA 3SHQA 4OUKX 2QLLA 3F67A 3I4FA 4HAXA 5KU1A 4JLOA 5DTEA 1BOFA 3QMPA 3TCKA 4CV2A 4BNGA 5A6SB 1RIFA 2JD1A 3E0QA 2HIHA 4KQWA 2W83A 4RA9A 4OLBA 2NO6A 1XU7A 4WOCA 2JJYA 3T1YB 1XR3A 2P69A 4GQBA 4C6SA 1WXXA 4HY3A 1GL7A 2W48A 2GD0A 4LV8B 2C8VA 3R7SA 3SEZA 1WPXA 4HJRA 4EDFA 5AVOA 1F6WA 4M9UA 4CT0A 3R0QA 1DIBA 3C3KA 4J0IA 4PQRA 4NATA 5CNMA 3GVIA 3OCVA 2GZ3A 2ZJBA 1D4ZA 3DBRA 4K03A 2VSQA 4R9RA 5JDIC 2X13A 3ZXYA 1RADA 2ZE5A 4QFDA 3LQ1A 4N9QA 2VLBA 4ACBA 5A0TA 1S02A 3NFRA 1U8YA 1JDVA 2CKMA 5LJIA 3EQ2A 1ZJ4A 2IDKA 3HL4A 4KN9S 1JEEA 5KDLA 3SQNA 5ICSA 1AK1A 3GD7A 2CFOA 2CCJA 2JJ1D 2P9GA 3DMGA 1U7HA 3JVDA 4KVGA 3S2UA 3O2NA 3M83A 1VJ0A 4R84A 1R3UA 1DBSA 4G37A 5KNBH 3S5JA 4HAUA 4JBNA 3PTAA 1P5JA 1QO7A 2J4FA 4GC5A 3ITNA 1E2IA 2WU8A 3UIEA 2KLHA 4LJ5A 4BNTA 3NBZC 2C42A 2B34A 1D2CA 4PXSA 2GAFA 4QG7A 5CLIA 3AWIA 5F73A 5K7SA 1V8DA 4YLYA 5GAJA 1XZIA 2WU0A 4Z4QA 1A9QA 1E3JA 1Q3TA 4NMMA 4R1QA 1P7CA 2XNKA 2VLIA 4WADA 4KCGA 4EEKA 2Q0HA 4XUCA 3OKAA 4HWKA 3QTLA 3SLRA 3DDOA 4DR7B 1JXOA 5G0VA 2OOKA 4QRHA 3UGJA 2LIVA 3MS7A 5KI6A 3GGDA 2CYAA 2NTVA 3L9XA 3U9SA 4DC1A 3I9V6 4KV7A 3SGLA 4LYAA 1BXZA 3EDMA 1XG5A 5AJVB 1O6ZA 2VK2A 2C4TA 5DE3A 2GDZA 5JEEA 5JC1A 2ZBUA 4WT7A 2PSDA 3DVRX 3FRHA 3T9BA 1PQUA 1RE0A 2JFOA 4ADSG 1Q50A 1OIXA 3GN2A 3U17A 4C4XA 2RBEA 4OBWA 1Z18A 2Q4DA 1NXPA 4TKLA 5DP1A 1FFWA 3CSSA 3OJCA 1HE3A 2JPDA 2PS9A 3GBVA 3W5AA 4JLMA 1QLHA 4M21A 3PHJA 3AEUA 1WXIA 5H80A 2PUCA 3V2UA 3G9XA 4TMYA 1ABBA 3TSAA 2YFKA 3FVTA 2QJWA 2I7VA 3QFRA 3ESZA 1QANA 2H3HA 1UT6A 1GQQA 2E1RA 4R6XA 4DAOA 1KSJA 3OX2A 4MYDA 4YJ2A 2V0GA 2IW1A 2I6TA 1FYXA 2FPIA 3REGA 3RJ9A 3BHJA 3B60A 4MZDA 4WCVA 4PF1A 4QVIA 1NVUQ 2W71A 1FFBA 1T5IA 4AG5A 4JLNA 4D9FA 3U4GA 4NI5A 1XYVA 3AUYA 1OU4A 4JFRA 2B2CA 1J7KA 5IH7A 3QELA 5KSOA 2ZUDA 1ZBDA 2FPWA 5TX7A 4RD3A 3RK4A 2PBFA 4EY7A 5KWVA 3QWFA 1R8JA 3TECE 1TEZA 1DIGA 3FCOA 2YOGA 1OWOA 5KPDA 1P3Y1 3E7FA 4DKXA 4I50A 2FVXA 1Z74A 2P0AA 2YW2A 3E18A 5EYPB 3HYCA 3MGAA 2DMRA 3VOTA 4JJ6A 3ZGVA 5AKZA 2R4TA 3DB1A 1LS6A 1JR3D 2CCGA 5A1TA 1HQDA 1NQWA 3RUCA 2B5VA 3W3AD 2W58A 4IHAA 2YOFA 3TLXA 4D99A 3H6HA 1ZOIA 2W6MA 1GZ6A 3SEAA 1SBZA 1IVYA 3N2YA 2QROA 2D2XA 3AW9A 4XB6B 1MQ9A 5C1DA 3D2CA 5K4HA 2V7VA 2FXIA 3RV4A 1W46A 3BDAA 2PT9A 3HS3A 4IDHA 1Z0ZA 4IJUA 1F2UB 2DUNA 1WF3A 1MTZA 4H4CA 4LJ4A 1BCRA 2E18A 2AI1A 4ALJA 4F5ZA 1Y9JA 3QOFA 1PR6A 3FFWA 3BIXA 2VVTA 4Y30A 2QUHA 4EHFA 1YQDA 4HK4A 5JXIA 1PZNA 1U3WA 4A8HA 4C03A 2DTEA 4G2NA 1G6KA 3GFTA 1N1DA 1P1HA 1WKBA 5HHTA 3A6KA 4G1CA 1EFPA 1OIWA 4PZEA 5IAJA 2ZU0C 3OHPA 2NVOA 3SIWA 2BONA 4YP9A 4B40A 3TTSA 4CETA 2AC2A 3RSGA 4UQOA 4OGGA 2FEAA 1V16B 1T2UA 4B6OA 2FSVA 2I2BA 1U7TA 3ROQA 3H8VA 2YXDA 3OJLA 4H16A 2B5OA 5JZSA 1DL5A 1GNSA 1FRZA 5GQSA 1YZLA 3DE5X 3DPUA 3HBAA 3PNPA 4YCAA 1WB6A 3RGGA 1I4DD 3GRCA 2PBZA 4INPA 3O3OB 3R6TA 2BGUA 4GX1A 3ZQ6A 4D3XA 1OE0A 1XRQA 4QYWA 2BCJQ 3HR7A 2EL9A 3BULA 1NVVQ 4KFRA 1ZVJA 5BNIA 2IEZA 3SICE 1T5OA 4AJKA 3C1OA 2JGDB 1EUCB 5FUWA 1PWYE 1VB5A 5LD2C 3NVKI 1NFQA 3OPMA 2OHOA 2W8BB 4YJGB 2ZIFA 4KG7A 3IVCA 5HOQA 1JE0A 1GP2A 5DXJA 4A5SA 2PR7A 4W82A 1AGXA 2UZ3A 1XQVA 4LE2A 3DVSX 4DMUB 4DQUA 4BFTA 5GONB 1RZRD 3C4QA 2I71A 4C7VA 4WN9A 4OA5A 1YS6A 4BGDA 2NSYA 2H7XA 1L7EA 1TJ3A 4DQVA 1BFKA 2VTBB 5B3AA 5GINE 2QMUA 4MVWA 2UAGA 1W5BA 3NTVA 3DVQX 4N47A 1NMZA 2YNMC 1EI9A 1F51E 5CEJA 3JAKB 3IO3A 1E3WB 1Z2PX 3ZW9A 3U5TA 3ESXA 5MFPA 4C1NA 1NYLA 5E4YA 1YCFA 2ACVA 3EXIA 5DISB 13PKA 4GMDA 2ZR0A 3ZHBA 3VHXB 5IAKA 1S6YA 4BFXA 4HPJB 2OXEA 2N9UA 4R5MA 4JJ4A 2COKA 2WT4A 3B2EA 3O2JA 3E8MA 4ZU3A 1DJMA 5DDIP 5KTKA 1MGOA 1T10A 4CKZA 1KYVA 5HS4A 4H1WA 2NXCA 1JDBB 4NTZA 3W2GA 3HB0A 4PXAA 1IWBB 1FFAA 1OFHA 2D8AA 2X4DA 3GLFB 1BW9B 2OYCA 4I5IA 4F2GA 3FECA 5TQ0A 1OIVA 4OQNA 2PLRA 3ZQ4A 1NJSA 4R1TA 5FV7A 2O0KA 5AJYA 5NULA 5D3KA 1PU2A 3HJUA 3DBLA 1QHGA 2NZJA 1IBSA 1CDOA 3FYCA 3JQ7B 3LW7A 4JNCA 4XI9A 5EE9A 3ISTA 3U7JA 4BEJA 1E1CB 1CZUA 4BQQA 3IT1A 4PG6A 1L1FA 4LECA 1IMOA 1HPLA 1QPGA 3LCRA 3Q3VA 4HSGA 1O6BA 1M8GA 3UBTA 3O82A 3QJGA 3W5VA 3BSFA 1ZC3A 2BJHA 4BXOA 3L5OA 4GSLA 2ALJA 1BH6A 4CN8A 1CUEA 4MW5A 4DSZA 1Q91A 2ZJ2A 2VAWA 2XF2A 3IHWA 1F8FA 4UM9B 4G6ZA 1NKSA 1U0TA 5BQOA 3GPLA 2X2PA 3KLMX 3UXHA 3R3ZA 5BW8A 2FRDC 2NGRA 2OUKA 2ZJ7A 2XECA 2HH9A 3UJ7A 3DLAA 2XCTB 4QOSA 2M1XA 5EHNA 821PA 2BZGA 4GPZA 5ADUS 5LQMA 1LLDA 1I4WA 4YMWA 1AU9A 4EKDA 4MCQA 3I6IA 4GVPA 2DLNA 3AQ4A 3DYBA 1KORA 1NSTA 4TTRA 1CC1S 2YRFA 3HPQA 3LNTA 3TIFA 1JVSA 4CMHA 1E79A 2IUYA 2G9NA 4KXQA 1YBFA 3F8SA 5FHQA 4ZK2A 3LX4A 4BE9A 5K0GA 5EJEA 1M75A 3D8SA 4WERA 3SQWA 4P4IA 1EFHA 1G1MA 1RS0A 4CLHA 1FYWA 1DHRA 2B8NA 3IT3A 3LHIA 4H31A 4TXMA 4MUFA 1EEHA 3CX8A 3W7AA 3BJEA 2JCSA 1W9MA 1POXA 1P4JA 1TU4A 4LXQA 5AVUA 5KX5A 1OV6A 1ZK3A 4GKVA 1PSZA 3K0AB 1NZJA 1V4BA 4ARUA 1QH0A 4YMIA 3VZSA 1K92A 1LVHA 2DP4E 2Y1KA 4F4DA 3DOHA 4YAOA 4XIYA 5BQPA 1XTJA 1FW8A 2WU4A 3IBFA 4G5QA 3W9SA 3AF6A 1ZVVA 3OQVA 4IO1A 1NASA 1Q7EA 3NT2A 2OFPA 2WQZA 1I5EA 1FPMA 1P1JA 1JLSA 1QFXA 3DLBA 4MUKA 5EOVA 3QKSA 4J0NA 2GBCA 1XV5A 5DWDA 1YIDA 4NARA 3CSUA 2OP0A 4PFSA 3ZV7A 4BL5A 5F78A 3OTOB 3AHCA 1CUGA 3IDZA 3B1YA 3FG9A 5EXSA 1LRKA 4PR3A 5JD5A 3AONB 3EC7A 4M36A 2C9BA 2REBA 1NW5A 4DAEA 4ND3A 4EK9A 2OGWA 1WL8A 5CCEA 1AS2A 3SM9A 1ZD9A 1Z34A 1ISPA 4ZKEA 1WKCA 4ZOQI 5MGBA 2OTCA 3AH8A 2MSKA 1VHQA 3FKJA 3QNUA 1HH4A 4O3FA 2PTHA 2VUIB 4IRMA 3EPKA 3O31A 1U7OA 2HXYA 2XE8A 3O8BA 1AV7A 4X64B 4DZZA 3AEZA 3B36A 3MB5A 1GPAA 3I34X 3GRVA 1UXIA 3EW9A 3DO5A 3LMKA 4RZ3A 4MRVA 1PBTA 3K09A 4KI7A 1YJBA 5D85A 4Q6WA 1FVHA 4LQGA 1T0HB 3IEKA 3MS2A 1S5PA 1YDHA 1KI8A 2JAOA 4XDGA 4ER0A 3RU2A 2OBNA 2ZYVX 2PVSA 3DAHA 3P2IA 3P2JA 3RFFA 4OHCA 1L8OA 1TM4E 2W2NA 3GWZA 4YBZA 3WYAA 4E22A 4G65A 3A1TA 1GRRA 3QWHA 1TMOA 4WD3A 1ENYA 3OY2A 1U1GA 3NBKA 2VQDA 3FRIA 5FPKA 3WOHA 2WWRA 2QTRA 4KQ2A 5I9MA 4A6EA 1U8ZA 1DAOA 1UC8A 3OY7A 4UBNA 4FD3A 1E8DA 1G8AA 3BAFA 4RKWA 3V7FA 4E46A 2COEA 1L4GA 2X0IA 1VKZA 1C7IA 2LWIA 4MV8A 2GNPA 3MWDB 3RS4A 1EX7A 1GYPA 2NM0A 3L46A 2IHBA 4ATNA 4MJ7A 1OVMA 3TE7A 1TYCA 1XTQA 3LLMA 1WMBA 4GI7A 2X8WA 3CRZA 5CM8B 4BMXA 5JJCA 2QM3A 2X1VA 4WCDA 1ZZGA 1J0BA 1GT6A 3OLYA 4TT8A 3SI7A 4B73A 5FA8A 4CKBA 4EARA 1T5SA 5HRUA 2VXYA 1E8MA 1QU2A 2C3UA 1OUMA 1U94A 3L1KA 5HJ7A 2RDMA 4FJ1A 3AJ8A 5MFZA 4GBMA 3IEVA 4I99A 2ZSBA 3TL6A 3WK7A 2FNAA 1TA0A 1ZH2A 2EBHX 4LTDA 4ND4A 2R6GA 5KIAA 1J2EA 1EZ4A 1RAIA 3EN0A 3V8PA 1XPRA 3TN7A 3GVCA 3IR6A 1XA3A 3FMVA 4PLVA 4Y2JA 4Y7DA 3WVNA 5FI3A 4DGQA 5JBQA 1TAQA 4RKRA 5ALJA 4EYOA 5HYVA 2IEDA 1JH9A 1F5SA 1YQEA 1O08A 1XMSA 2OENG 1QF7A 2P62A 3EXAA 1SC4A 3I2JA 3K5PA 4GLOA 4NDZA 4ZREA 3OQOA 2G17A 4OG2A 5CDFA 4OQLA 4RSHA 5DT2A 3MXOA 4M0DA 3EISA 1ZUHA 2OB2A 4FR2A 2Q1WA 4RA6B 2QLTA 4C0QC 3TFQA 4BX9A 4Z4FA 1KMIY 2CCKA 5I7HA 1Y5LA 2JFNA 4AJOA 5AVKA 3E48A 3BERA 3AILA 1LPOA 1JPNA 3Q7TA 5E3IA 1K9SA 4BJ6A 4JLWA 2G5CA 4F2HA 2AJBA 5AJTA 2PUVA 5FEUA 1DXQA 2B5WA 3C1UA 2H1LA 2ZRAA 5EZ6B 2W6QA 2XMQA 2W6ZA 2ZT7A 1VZ3A 1ETHA 3OUZA 4L4UA 4Q9KA 1T26A 3V46A 3J7AC 3EG9A 1LH0A 1Z9BA 1U0OC 1UOPA 3BBPA 3W2IA 1H2YA 3FJ1A 1PR0A 4WNAB 2IV7A 3KQUA 4QU5A 4OHZA 3JATA 1Y1PA 4MV3A 4NGTA 1QOQB 2PN1A 2Q1TA 1C29B 1CULC 1IL0A 1R0RE 2JVIA 5D5PA 4MQFB 2G8NA 1N6RA 4UAVA 2ONJA 4E3ZA 2Q1UA 2REQB 1M1NA 1XLWA 3H17A 4L95C 4DXAA 2JLBA 1VQ1A 2VOJA 4YREA 1EUQA 2D1SA 3SU8A 1ONBA 2G82A 4M1WA 3L0ZA 2Z09A 1CUZA 4C9BA 5AIBA 1JLLA 2D2IA 2DX7A 3C48A 1YI0A 2GK3A 2J3EA 4OIFA 4WRRA 5JSYA 5LA6F 4CIBA 1T3GA 4BVFA 2P3LA 4FKMA 1YRWA 3SF8A 2DBQA 2RCYA 3TOSA 3OG9A 4E51A 1LPSA 1RQGA 3AHEA 2ZSAA 3GLUA 2F9FA 3RUFA 2EX0A 3ZDBA 4B83A 2DB3A 1C0IA 2BHNA 2BF4A 1BE0A 1KF0A 1EGVB 5DNYB 1ADJA 3SQDA 1YVPA 5BORA 4D4HA 4KSBA 4NE9A 1J1IA 2PBLA 4R8SA 4NZNA 4ZYVA 3K73O 5FUVA 2AFHA 1RXCA 2UZ1A 5J23A 2QAGA 4OHYA 3EXG1 3SDZA 3WQBA 4C3ZA 4LFBB 2R8RA 4WSOA 2ZI4A 1G1AA 2A30A 2Q99A 1UBSB 4JJIA 3KUUA 2C3YA 3VU0A 1ZD1A 2XEJA 2G7ZA 1ZITA 4H7JA 5EP3A 1FRVA 1F6BA 3ZOKA 4C43A 5C2JB 4M49A 3E27A 4FWIB 4RWEA 3WYCA 2AOTB 2D5CA 1W93A 1RI2A 4HS4A 4OC0A 3I9FA 1DKOA 1EJBA 2AXEA 1FXWF 3JQGB 4ZT4A 5KYNA 1EP9A 4GZLA 4JBHA 3DXFA 2OMEA 4AROA 4F9FA 3KHSA 3MTBA 3M6XA 4QXAA 3M5PA 3SXPA 1XZNA 4HX2A 4TTAA 4X1YB 1NJFA 2ACKA 4DSNA 1ZN2A 1BMQA 4I1RA 5HR5A 3GO4A 2IUSA 5LQRA 2B92A 2EXXA 4WXEA 3X1DA 1XD8A 3G79A 4LNUA 4X7MA 4ZI7B 2DVMA 3DDUA 4ZYWA 4NPAA 1TC2A 1JWBB 1DZ3A 2OV3A 1R5NA 1IIRA 5JJKA 1YUMA 4E12A 1LZKA 3C70A 2ZRJA 4EHIA 3KR0A 3PC8C 4M55A 4MRNA 5G1NA 3W5CA 2QN2A 4A7PA 1RI3A 1FDOA 4TXJA 2WTAA 4TTJA 1KZGB 2E4ZA 4J7CA 5K2MA 2XBMA 3Q8XB 5IM5A 1UDXA 1MAWA 2IEIA 3H9CA 1GY8A 4FX2A 4ON9A 3NJ8A 2Y0DA 1D4OA 2IDMA 4F96A 1WVMA 1BE1A 1N2BA 4URWR 2VF5X 3I92A 2Y68A 2X5KO 3JVEA 4GQAA 4BMYA 1N6LA 4BLSA 2WD8A 3FFXA 5DEOA 1WSAA 2QXYA 3MMSA 5SYNA 3DEYX 1KKLA 2VCYA 4NFYA 5KYXA 4NOLA 1KY4A 1P44A 4GLJA 4H7DA 5CX1B 2O48X 3LQKA 3PKZA 4E07A 4Z4HA 4TV8B 5KJ6A 3I62A 2FQQA 4BTVA 1ZOLA 3LYHA 2IYEA 2AC4A 2DZDA 1MEEA 2RHRA 3Q9UA 4MCJA 4CM7A 2C6CA 2GETA 2HSJA 3DDHA 5JI3E 2QN8A 1Q3HA 3TLCA 1CJVC 3OPYI 5JCPA 2UUOA 4GR5A 3DE2X 4HV4A 1MLDA 1AHIA 1YJAA 2W6ID 1I5RA 1A5AB 3VAYA 2B3TA 4C7OA 3VNUA 1HNXB 1IONA 2ZSIA 1JHZA 3BMCA 1DIHA 2I3BA 4P31A 4BKPA 3G2OA 4KMRA 4ZI2A 3E22B 3EGOA 1XDDA 2EZ8A 1P6QA 5FBHA 4KIGA 3H6GA 1CCWA 1JKJB 4QLOA 3P0EA 2WWGA 3VDXA 2XXAA 2O23A 3OHSX 2XEDA 1R8SA 3HG7A 4RY0A 4BVBA 1G63A 4DYVA 1ONNA 5JSFA 2B36A 1P74A 2AE2A 2FSSA 3IVXA 5LP6B 3LPMA 2YCBA 4ZOLB 4DEVA 3LRXA 2V5UA 4I0WB 1FB5A 3CURA 1DDOA 3EVBA 4Z54A 4NULA 2GTIA 4B6EA 5HJ5A 2VYCA 2ADMA 3DZKA 1DKUA 5KREA 4YV0A 4FMPA 1P19A 2QRGA 1X1RA 4NOKA 5PGMA 3THYB 1XD9A 5B7QA 3ZU4A 4ZIRB 3KPVA 2VFAA 4GPD1 4NEQA 1CRLA 1Z4KA 4IIYA 3MF4A 4TXNA 2WKQA 2KW5A 3WKEA 3ZNNA 3DFFA 3ICUA 2CBXA 4DMLA 5K8CA 2EJWA 3WMWA 3RSFA 1RBZA 1J6UA 3TZEA 4B0PA 2PUHA 2JCGA 3FVRA 4QJ4A 2HROA 1GARA 2XTAA 1Z0IA 2C2WA 2IBMA 1FX0B 3FAKA 3RSLA 5AVXA 4DLAA 4YMVA 1J2YA 2M1ZA 4S2EA 1XZBA 2X8AA 1LK5A 3I76A 4JODA 4MI1A 1X7YB 2CFIA 3L18A 3L7JA 4S2UA 3VR3D 3W9BA 1KOGA 2NYUA 5CM9C 5EMJA 5C80A 4OC1A 1OSNA 3NR2A 3KPYA 4G5HA 3GEGA 2QN3A 1R1DA 2QW0X 2NUAA 2O1EA 2VBFA 5BSMA 3BF8A 3VGJA 3HWSA 3AJDA 1NBWA 2ZSHA 2ZTMA 2HLNA 4RK4A 5JXHA 2VHUA 2AL7A 1B3RA 2LIPA 3ILHA 3MTJA 3AK4A 3F3KA 1EZAA 3FYTA 3STVA 4BGUA 4RVCA 4AX4A 2XZTA 1BVYF 5FEMA 1B2RA 3D9QX 2V5VA 3CLTD 1GNRA 2H4FA 2HHJA 2PS0A 4C2BA 3WQHA 5M29A 3HB4X 2ORVA 4C0BA 1UXGA 2C03A 3ZBUA 4QYIA 3DWFA 4YI5A 3WMGA 2CHEA 3NBFA 1M74A 3OTHA 4J3FA 4F56A 1I33A 1CZKA 2NZ8A 3WK8A 4R1NA 2BKUA 1LNSA 3WRYA 5DYTA 4TL7A 1J09A 5ICGA 4YAGA 4WH0A 5LVAA 1DWQA 4IZ6A 5A9SB 1GZ5A 2N0SA 3BICA 1KI6B 3CH6A 3GJRA 4LSMA 4Y6GB 5GWXA 3ZE0B 3UTCA 5BW6B 4H77A 3W05A 3U7GA 2VTEA 1O0CA 2BMFA 1F38A 3DXXA 3M2PA 1RKBA 3T4UA 1YVDA 4QSMA 5BN5B 5TF4A 1BWQA 2BRUC 3SY8A 5BVHA 1VPDA 1KP3A 4IJKA 2QBYB 2G8LA 3HABA 1EE2A 3KDSE 3AY7A 3M8KA 3LDHA 4FW9A 4IIXA 4KXVA 3PX7A 1Z2CA 1EZ1A 4KAXA 1R0SA 2WD7B 4CIDA 4M8IA 1RJDA 4CMKA 1T1RA 4J49A 4QU8A 1KZ4A 1V2HE 3LPAA 1QTIA 3WLIA 2EARA 1AIPA 3C8UA 1HDXA 3N2GA 3FPHA 3S1LA 1BHO1 1UOEA 2FZWA 3OA2A 4UD2A 3ZLVA 2AE1A 5J2TF 4BB5A 4OY3A 4BN4A 1X1BA 2IE8A 1IM5A 2HZBA 5H8WA 4M8SA 4BVEA 3ZWWA 1NVKA 1W8IA 4DWWA 1MORA 3SEQA 1E6WA 4XGIA 3OPXA 2H5LA 3CTMA 3Q85A 2O2ZA 3DGEC 4Q7LA 2OMKA 3L4SO 4XARA 1J07A 2EYUA 4F93B 5KINB 1AOXA 3HUEA 1DCFA 3FHJA 2OBLA 3STYA 4EVRA 3ZVLA 2OYSA 2R7KA 2X2EA 3NEPX 4BIMA 1UP7A 2QTTA 3B38A 3BJZA 3P7MA 5DRYA 1PJLA 2BDUA 4CQJA 4ZVMA 4ZYLA 4CEHB 3PC3A 4AJPA 3O21A 4YCCA 3ED1A 4Q1AA 3M4JA 1OB2A 1XEXB 4Q4JA 1MO6A 1YD7A 2GN2A 1GTVA 2JAQA 3EJ6A 3R0JA 5TQVA 4LE1A 4I8XA 3CVYA 1Z22A 1KH3A 1Z5PA 5F3RA 1IBMB 1E98A 2HK9A 2VZ9A 3HCFA 3VPDA 4MR8A 3CEAA 3TGWA 4V0SA 4J16C 5CFPA 5FQOA 3VA7A 2FMHA 2PEZA 1PQ4A 2K5UA 3PUZA 2IPAB 1COWD 3IUBA 4G9GA 4GPAA 1RVV1 1J4AA 4I4TB 2ZQ5A 3I72A 1ZSVA 4BFUA 4KPFC 3WL5A 5IZCA 3L8CA 3BH7A 5EJFA 3RAGA 2JK0A 1DAPA 4NDNE 1XFDA 3HYRA 2YWJA 4MPDA 3IELA 4HQNA 1PL8A 3EWNA 4Q39A 1C1YA 3THOA 2R68A 4JHLA 4EL0A 2QRVA 3G2NA 4KRXA 4X20A 3M4ZA 5KKAA 3P0JA 1EVEA 1NXQA 2XLCA 2VPTA 4LOAA 4M4SA 2YW9A 4UUQA 3JALB 2WUVA 4EY6A 3K96A 4C4RA 3ZDRA 4C76A 1LX7A 5K03A 1OROA 2NLOA 2R87A 1ARZA 2JKZA 2X9NA 4LTMA 4QHYA 1SIUA 1EVJA 4R3WA 5KVQA 3V2IA 4D92A 1XYYA 3ADCA 5EIAA 1ZWKA 1T5LA 4OHFA 1DEAA 3DD5A 1UJ6A 1XYGA 3V4PB 3T95A 4P22A 3MRTA 4TJVA 1KNQA 2AEMA 4ZQHA 3QI7A 5IARA 3KV3O 2QYSA 3L6RA 3SX0A 3PFBA 4IP0A 1AUPA 1YL7A 3OBIA 3OAAD 3QEAZ 2HNBA 2B9EA 3NW9A 3STWA 3HY6A 4BZQA 3AJ9A 5WRFA 5EE3A 1HQKA 2PSFA 3KVNA 1VP3A 5HZKA 5C9ZA 3HVRA 2AGVA 4WESA 1KU0A 3WXBA 3SDBA 3QXSA 5K3FA 3LTEA 5IJ9B 1RHUA 1XDSA 2F8LA 3C7CB 1SOUA 3JR7A 4HDCA 4F60A 3BRWD 1IFXA 1TGYA 1NM5A 4J7AA 5CDGA 1VMDA 5JS1A 2A0KA 5IT4A 1T9BA 2C9ZA 4D6XA 3ZGZA 1PNTA 5K01A 2GDJA 5LL6P 1SUSA 4EOGA 3PDHA 5F1PA 1PFGA 3I6ZA 4ER6A 3BRCA 5JYDA 1D03A 1G9TA 1GAEO 1RQLA 4HNAB 3WDMA 4RK1A 4YJ3A 3CLHA 5IW8A 4B75A 2Y8EA 2DFVA 1UKAA 1GZ3A 1A7UA 4P98A 1N1EA 2QUIA 1U98A 2BBSA 4PGMA 1LPBB 4UTXA 1YRLA 4ZU6X 1MKYA 3SD7A 1GQFA 1WXHA 4UTNA 3TLKA 3AVOA 3E2IA 3TVYA 5ALRA 1SIBE 1NQAO 2A14A 121PA 1XCGB 3CM0A 3EXHC 5EGNA 4ZHQF 1LTQA 5CAEA 5BRJA 5AVVA 2B4TO 2P9EA 4MLDA 4JYCA 3ZVKA 2ZCVA 4OI0A 3Q7IA 4G0OA 1H2EA 1Q11A 3R3SA 4RW0A 1FUIA 3HKEB 3NKFA 4M6WA 3TX6A 3SMQA 2R751 1JHDA 5YASA 4R41A 2FP4B 2EP7A 1BJRE 1XNRB 1QLWA 1QC5A 3OJXA 1YIAA 2ZZMA 2CV2A 2XMPA 2GGSA 3L0SA 3IQZA 3LUFA 1RLMA 2XKBA 4KK3A 1O94D 3TE6A 3RADC 1W44A 2E4YA 2W2TA 2CVOA 3CE6A 1PEKE 2IXDA 4UHHA 4M7RA 1PGOA 2AX4A 2YBEA 3JZDA 1ISMA 3PC4A 4XB1A 1VLMA 1D2MA 2IY9A 5KJFA 2ZIEA 3IMKA 5SYMA 2PAAA 5EZQA 1XTBA 1XN1A 4ZVOA 4CN9A 5CNIA 4EHNA 1SK8A 2EWVA 4HLQB 3MJTA 4OXYA 4Q3DA 1JJ7A 2UV8A 1CD5A 4B6QA 3DHYA 3BSYA 4BQIA 4MGYR 1P29A 3HCPA 3MPUA 3EH2A 3K9NA 1KVSA 2WMNB 4KJZA 4C9UA 4UBMA 1NF8A 2A1IA 3U3KA 2YICA 1AF7A 3K71B 2P2NA 3H1FA 3EVFA 2IWHA 3HFGA 1BHSA 4MB6A 3WOVA 1CUHA 2CDRA 1PD1A 2JI4A 2OHJA 3CJTA 4P9NA 1RYZA 4G0ZA 3RANA 3VHQA 4AWAA 3H04A 2R62A 3UJ6A 2Q2QA 3TUZC 1JKFA 3J81k 1HNWB 3VUFA 5FWXB 4IZOA 4LHYA 3K2QA 4QGHA 3N8KA 1UBMS 5JXGA 4XFDA 4KKXB 4TL9A 5H81A 3ZXXA 4DR4B 4C86A 5I7EA 2NYRA 2ILTA 1BMFD 2RHMA 3AFHA 1CFZA 1RDFA 1VKOA 3KFXA 3M5DA 2CHVA 1E9AA 4MWGA 2GCGA 1XVUA 5AOAA 2NU7A 5CXXA 2GM5A 3ECSA 1PVOA 1JDPA 4IY1A 2ID8A 4FYWA 2IW3A 1YJQA 2C5GA 1ZM4A 1TAHA 4UDYX 2AKYA 3BVPA 3V9AA 1H0RA 3B6MA 3KR2A 4LMPA 4U3JA 1XWWA 2BY4A 2R1VB 3FJYA 2QLBA 3S8MA 2O05A 1WZNA 3KSBC 2H59A 2AYYA 3EMKA 2SCUA 1BAPA 2E55A 2GUWA 3NAZA 4K9MA 3EDQA 1OI7A 3OOYA 4R2IA 1Q3KA 2J33A 5TMEA 4MICA 1JAXA 1T8PA 3ETDA 3K1AA 1TNDA 3V1TC 1XCJA 1VE1A 1Y98A 4NBNA 1I5OA 2CVHA 3I2GA 4PHTA 2PCLA 3LHSA 3PDWA 5GJWC 1WG8A 4GVLA 3WGJA 1M10A 3KVVA 2H2GA 1U2DA 4P44A 4P0QB 2HCTA 1B8VA 1I2DA 3R3UA 2C97A 1X0XA 3PHCA 4MYHA 1GPBA 2J0QA 1NXVA 3HUUA 2WUFA 3BK1A 3ZIUA 1D3AA 1V3VA 1Z0FA 4FFPA 1AKUA 3VHRA 3PPXA 5KMGA 5LFAA 3KUXA 1K1EA 3CUUA 4RVGA 3WWOA 4BZPA 3OWHA 4YP5A 1NE2A 4D25A 4LBZA 4QXQA 2RSLA 2WHRA 1LLUA 2IZ1A 2O7VA 2Q5EA 2ZSEA 5F76A 4ZCLA 2IS6A 4CQLB 1L4MA 3YASA 1MC4A 4GYKA 5BQFA 2Z83A 3CJQA 3S29A 1S2NA 3S9NA 3E7PA 4HDOB 5KAPA 3E9MA 2GPTA 4G1UC 2NV2B 1A72A 1WRBA 1YT5A 4KPUB 4OQXA 3AEYA 3JQ6A 3OZBA 2NV6A 4IQ0A 3MIIA 3OU6A 3S1AA 1NV8A 2O0JA 2NSDA 4UMFA 2OORC 4JVMA 1HLGA 3C24A 2ORWA 3JD0A 2ROQA 2WTMA 3D3WA 4NPHA 1YO6A 3P9RA 1OA0A 2VL7A 3PR3A 5F7JA 3S2YA 4PX5A 3H5OA 1QMGA 1NXSA 3UH0A 4TTQA 3LH5A 4GMHA 2JLVA 1RQ2A 2QPAA 3CUEF 3I30X 4R2MA 3FGZA 1O1YA 3LBAA 4R0VA 5D3ZA 4A2QA 3KL2A 4MVCA 1GJRA 2NSLA 3GP3A 1E5VA 4NNOA 2YMLA 5IMBA 4IOKA 1LBTA 2BKEA 3VJKA 3WNVA 5CA0A 2B6HA 1K5GA 2V9CA 3TEMA 1R50A 2X76A 2EZ4A 3HGMA 3I04M 3IVMA 3PICA 5JSZB 1EWTA 2YJVA 3E9RA 5IVHA 4UW9A 2DCMA 2DPMA 5AJXA 1O6CA 2F48A 2HLDA 4YAWA 5DH9A 2V55B 1C41A 4UUBA 4QGSA 3N8GA 3RAFC 4UKDA 1XZCA 1Q7GA 3OEEA 2VHWA 1TLLA 2F00A 1QR2A 3PDIB 3LXUX 1Q6YA 4YT8A 1E3EA 8OHMA 3WLKX 1GQOA 1KAEA 4HI0E 4CI0B 1XRLA 3DPSA 2WHPB 4L9SA 3Q7SA 5JECA 4KREA 4TWZA 1AV6A 4DLBA 2MT9A 3K0FB 2DOKA 4RPLA 1A76A 3W6PA 3EAQA 4LKRA 4A82A 1F12A 1NW6A 1BH2A 1AC5A 2BFDB 1X7DA 2XMBA 3BFXA 3JASA 1NHWA 2HMSA 4MQ5A 2V6GA 4XUEA 5A4JA 1A9YA 5IEBA 2I3AA 2LR0A 3QBJA 4UZSA 5K3EA 1W76A 3D31A 1AHNA 3GY0A 4NG4A 5E2IA 5K8TA 4A0RA 2Q5IA 1IZ8A 2OBFA 1S2GA 3EOZA 4U9UA 1N36B 5K0BA 3V7UA 1NPYA 5COBA 2W2QA 3JYNA 4IJVA 5HBGA 5J1SB 4G23A 1G7CA 5F5XA 1KJJA 3ICPA 3V8VA 4URFA 4UVIA 5A3RA 1SCIA 4HYYA 2ZITA 4GPEA 5CBKA 2BL4A 4WOKA 1A1VA 4YIKA 1WHSB 3ZU3A 2FUG1 3ZHXA 4DSOA 4E6PA 1MBZA 1ORRA 3O6VA 3D5EA 2BELA 1OMOA 5DYIA 2VYVD 5CM2Z 3KX2A 5EQJB 4GI2A 1R0WA 2PLWA 3Q3CA 1HZZA 4MUXA 4G0WA 1JXQA 1CETA 4R54A 1U5BB 3FOAA 3N05A 1NQTA 2Q3JA 4Q3NA 3G13A 1VDMA 2WIAA 2E85A 2WM8A 2F3PA 4G0QA 3M9LA 3PR1A 4QTTB 5G41A 5JY6A 2D5BA 3ENNA 4JSRA 2Z1NA 1IM2A 3O8DA 1TA9A 2ZB2A 3WNCA 4OX9B 2GRAA 8LDHA 4LV6A 4EMUA 1C7EA 1Q0UA 1E4YA 4Z4GA 4TWEA 2AG5A 2XE4A 3EYWA 4UREA 1QRUA 1G7SA 1W30A 5EKSA 3UMYA 3N9IA 2OO5A 2Z58A 1KY3A 3R20A 4ID3A 4JK3A 4M0CA 2ZAOA 1F8YA 1O89A 2CZQA 4HL6A 5G1OA 3DEFA 3AHJA 3SC2A 3PUYA 3VC2A 4LSZA 5B37A 2O8CA 4EBFA 5BSKA 2SBTA 2YC4C 3BF7A 3H7IA 3K15A 2NUBA 4MWOA 4QDZA 4TUYB 4EG3A 2H2AA 5C8YA 4NFLA 2GZ1A 1ZK4A 5CCBA 1NLMA 4RTJA 4HADA 3RUEA 4KXUA 4D8VA 2WDZA 4KAJA 4GZ6A 2IGTA 3N2KA 4OHRA 2H1OA 2E5LB 1YTUA 1II8B 1XLTA 3AR4A 3PWZA 3HPRA 3ZWPA 4KAAA 5EP4A 4QQ8A 2G0AA 4C4PA 3VC3A 3ZHQA 1E4EB 1KBOA 4J0FA 3RHFA 2CNWD 4GXTA 3GFFA 3LKBA 1WVIA 1A50B 1ZNWA 3A6LA 1WA5A 1U9JA 2C98A 3OEHD 4NS4A 4Y1EA 5IYZB 1P60A 2HJ9A 5CLGA 1DLJA 3U09A 3QX8A 4TTPA 1NFFA 1VGQA 2Z95A 2BHTA 2WE8A 4MR9A 4X8HA 1B8PA 4DTIA 4BP9A 4FLMA 2BEVA 1TMKA 2PL9A 3ACBA 3GV0A 3HKDB 4IJ6A 1SBNE 3B51X 3OM0A 4ARCA 4DPMA 1GRVA 1FYDA 2GCEA 2B82A 3ZE6A 2QOEA 3H2GA 2VHYA 3W1WA 3F9RA 4P3NA 2WY2D 2RKWA 2A7XA 2P30A 3CUWA 3ZWNA 5LNK1 1JDSA 3DMRA 2TECE 3C2QA 4RUKA 4WK6A 4M60A 3WLMA 2BKVA 4M1ZA 1WXGA 3HHEA 5EIFA 4MUEA 2G83A 1HYQA 4INAA 2IYOA 5EKTA 3UB4A 2IXTA 4R1MA 1FVFA 4XGRA 5FAXA 1IN1A 1BYUA 1HO3A 3ZZUA 1C5KA 1Z0UA 2QRJA 5TQ2A 4N5LA 1Q1ZA 1N8NA 1BJKA 4L72A 2IU4A 4B79A 2FX5A 1O96A 2RGCA 5AOVA 1TYBE 1L8QA 3RU9A 2XCLA 3H87A 4JASB 1DFHA 5HFJA 4CNBA 4GYYA 6CHYA 1N9GB 1BMDA 4NH4A 2WMDA 4HNHA 2PRYA 3FSEA 4C4SA 4Y9TA 1NQVA 3A32A 4F38A 1PLLA 5HUHA 4JBXA 1ZGHA 5TGZA 1FMFA 4HDNA 5L3QB 1MO4A 1SURA 1W0JD 3MJDA 3QPWA 1GN8A 1DO8A 3M5CA 2GD2A 1QO0A 4C06A 4GZ3A 2F3QA 1JA1A 4TXLA 3EWSA 3HK2A 3TAXA 4WXRA 1TMGE 1VG8A 1JT9A 1JV2B 1KSHA 2PLAA 3CLTC 4PRKA 2BP7A 4WXMA 3ZCVA 4DANA 4PSVA 3CB4A 2AJLI 4TS3A 2ZDHA 1E6EA 1FFSA 1AXGA 4ZQBA 3V55A 5LQCA 1CY0A 3TSWA 3PV0A 3DZDA 1AN0A 2QS9A 5IUNC 1XLVA 2EW1A 2VZ8A 3NHRA 2YKGA 1P1FA 4TSKA 1AK9A 3ZCRA 4G07A 5I9TA 3G2MA 2OSVA 5AI8A 4BNDB 2CF6A 3GIWA 4G2TA 4Y1FA 4JWKA 5C37A 2HSEA 5G40A 4GKJB 3DW1X 5AKGA 1FJXA 1UADA 1XQ9A 1GITA 5M3BA 2BKAA 3ZE8A 5LIPA 1OYOA 3IPRA 4M8LA 2Y0PA 1UZLA 4BLWA 1YB1A 1N5RA 1UMCA 2C1EA 2GI4A 2ZW9A 3PGKA 4NEHB 3KR1A 5TRTA 5IK2D 1X14A 4I9HA 1YCDA 4UFPA 3T5CA 4Z0NA 3KBBA 1ZNQO 4YUYA 4F06A 1GG8A 3LQQA 2OD2A 4KQGA 2AVNA 3OJFA 1P6XA 3EW7A 3AIMA 1T36B 2QTWB 4QUKA 4MVJD 4BDSA 2R7MA 1MZPA 3LRTA 1ACLA 2CWDA 2GFQA 2XDAA 3AZOA 4AU1A 2IYSA 4UTRA 4V1CB 2ODAA 1OX5A 2ZULA 4HN2A 2P6PA 1YR8A 4IV0A 2XA9A 1EZBA 3M9WA 2ISQA 2IP1A 4AMVA 5JOQA 5A0FA 4WLEA 1R7RA 3X2SA 1CVIA 4FOSA 4MYUA 2ODWA 1MZVA 4YDHB 4JYPA 5KKCA 2JRCA 4WCFC 4KVZA 3B5JA 5A4IS 3MW8A 2O54A 1YJ8A 2OHVA 4QPZA 1DVRA 1XXHE 1UPBA 1PYGA 2EQBA 4LWOA 3TRHA 1TU0A 1DKQA 2Z2IA 1W36C 4M9XA 1IJFA 4V2UA 4HQ0A 1JG3A 1ENOA 4HUQA 4JGBA 4CKXA 3IXLA 3JV7A 1YNOA 2NZWA 4HVLA 5KQGA 4L2IB 16PKA 1CUSA 5D6OA 2PH1A 4NRDA 1NI4B 1X1SA 3PDCA 2JC3A 4QQKA 1C7JA 4YVFA 1P80A 1XCMA 5ALHA 2Q3DA 4IQ8A 2H63A 4I7EA 2P11A 1P62B 1B00A 1G7TA 2XEIA 4C22A 1CY6A 4M99A 1IUKA 3RE1A 4RBNA 2FWJA 1PQWA 3PYLA 3FFTA 2OBMA 4H1VA 1TPZA 3B1WA 2JLRA 4WBNA 1L3BA 1MH9A 2DH5A 3G5TA 1EK5A 3DVLA 1YC5A 2FK7A 4LCBA 2QG4A 2I76A 5I9IA 1EXDA 2PUTA 2O3JA 3ADKA 1CEQA 3GUVA 4ZV9A 3UPDA 3B1JA 2QD1A 4IDFA 2FUG6 4DV2B 1IXYA 4OATA 2Z6VA 1JE1A 2C61A 3DQZA 1QGUB 4C5CA 1A8QA 1WUIS 3PKJA 3WK9A 1G4HA 1WQ4A 2GJSA 2W2KA 4NAUA 6REQB 4L7QA 1OV4A 3T3HA 5DCWA 2VNJA 3DE3X 5DWQA 2REXB 1DG3A 2CE2X 2ECOA 2OZKA 5J2TA 2BCGY 2OT3B 4WUTA 1F8GA 2XMCA 2Z4TA 1P0IA 1YMQA 1RKVA 4HWOA 5F2EA 3SFZA 3D7GA 2POCA 4DN6A 3JQBA 3R5FA 1E1YA 4N7RA 4NZMA 5L40A 3LQFA 5C5EA 4JUCA 1F60A 4G0XA 5A3JA 4NBTA 1KK3A 2X4LA 3FFAA 4RTLA 2QPTA 2IS2A 3FDJA 4IV5A 5GVSA 3K2IA 3AKZA 1XZAA 4ZU1X 5GGYA 3O0DA 1KH1A 3P5BA 4MWZA 1XMJA 1Q7BA 4LZJA 1P0MA 5CB0A 3C14C 3AUFA 4JUIA 3M3PA 3NRJA 3VTZA 4NBLA 4I1YA 5KC8A 2Q3MA 1SIOA 4RIHA 3A3OA 4O4JF 5T64A 4DG9A 5BSGA 4DV5B 4ZXPA 3VAZA 1PTJC 3WDSA 1IJEA 1AA9A 4MEAA 3GNTA 2PCJA 4AN1A 3GZJA 4BMZA 4W6ZA 1Y7TA 2RGNC 3WKBA 1KGDA 4EUKA 4L50A 1Y8ZA 4YJGA 4JI8B 1DO2A 1N3YA 3G8DA 1FP7A 1GYQA 1LZLA 1WEKA 2WIJA 1T2VA 2CFTA 4RXMA 4C0JA 1EVKA 3D5TA 5D51S 1VLLA 4FWTA 1QLJA 4CQMB 1F7UA 5EIHA 2WLSA 4JUAA 4ID9A 1QRRA 4XCVA 1XEWY 1K08A 3JZIA 1NFRA 3GCDA 3LCVB 4BKMA 1YZVA 3EGVA 5A03A 4E2FA 3Q6IA 4EEXA 4DR6B 1DDIA 2HK8A 1V1RA 4D4IA 5HIKA 1JIVA 3ZZTA 3EZ9A 3KFVA 4K28A 4QUDA 4B2LA 3AU8A 1LS1A 1XD2B 1Y1TA 1C1DB 3DL7A 4K1XA 1O94C 3GYGA 4LNAA 1ZA1A 5G0WA 1E3WA 3DDZX 2Z04A 1XU4A 2LE0A 3G89A 3NHWA 3OESA 4P0TA 3A6GA 1XCLA 5IVDA 3WZ2A 5LQJA 5AUPB 2YVKA 4OQ4A 4W5JA 3VHXA 5LNK6 5F09A 3UHFA 2C9DA 4FOPA 3OZRA 1OFVA 3EEQA 4GGOA 3DTTA 4LY6A 4X7BA 1H4TA 3RAJA 5BOSB 1JBKA 5AESA 4BFCA 1F9AA 5BR8B 4PQYA 4QUIA 4INJA 1IB0A 1E0KA 4NCJA 3SZUA 3PX3A 4FWBA 1S4QA 4TWJA 1BW9A 3BWVA 2WSYB 2QTCA 4TRJA 2QBYA 1QIHA 4LZPA 2BHRA 2NU8A 3VSDA 5DNCA 3OD1A 2WF6A 1PJZA 2DPGA 2ZSDA 1SUWA 2J6CA 1OZ0A 3QEJA 4ZWNA 3VZQA 1IU9A 4Q1VA 4ZCSA 2J46A 2PA3A 4ENVA 3RWBA 1Y3DE 3VYRB 2BISA 3JQ7A 5AOCA 2JDIA 5A06A 4N6NA 4IIJB 3EPHA 4EHHA 1E1CA 4EKYA 3M6UA 4NK4A 2W2MA 2VA8A 3A9CA 2R48A 3HTXA 1Z33A 3SJUA 2A6PA 1GPMA 4HCJA 3CSDA 5JLJA 5K05A 2JGAA 3PITA 1U3TA 2QDKA 3DW3X 3P0IA 4KDEA 1ML3A 3ZBTA 4FT4A 4JOQA 4NC9A 2HDNB 2H9IA 4RGVA 1CU1A 3BWBA 3H5TA 3UOWA 4XVHA 2E5FA 4FZ5A 1U9YA 4HRYA 1PKEA 3VJLA 1UMBA 1OI2A 1JFFB 1JS1X 3KQVA 3NEJA 3DBOB 1L4HA 1N6OA 4YROA 5C0OE 3AVWA 2DQ4A 4UUPA 2RBGA 3OMWA 4K87A 3OCJA 1WZ2A 2FN3A 3GUYA 2IZZA 1ELOA 2FWMX 3E8SA 4ENPA 1ZD5A 2FZ4A 2OOSA 4KR0A 4G67A 1FSFA 2D0OB 4RELA 4ZQIA 5A2GA 1JYEA 2Y1FA 4KAFA 4PU0A 3WGNA 1NNI1 3K8QA 4RV5A 4PS0A 4PONA 3PXGA 1EVYA 3DCNA 4QPCA 5EESA 2XUZA 2C5QA 4LY0A 3AL3A 3I83A 4JI5B 3D6JA 3C3DA 1JN0A 3P9ZA 2ZSUA 5FULA 4W1QA 4LNHA 4AQ7A 3ZDEA 4GOLD 5FBWB 3EY9A 4Q01A 2OLKA 2H9AA 4BX0A 2QRNA 4RQAA 3SBXA 4LOIA 5FTMA 3EAFA 3FA2A 2O4CA 1EEXB 2P1RA 1Z7EA 3GPDG 4RX1A 5D5QA 3T5DA 1L5RA 1M34E 3ZWAA 1I7SB 1P7WA 1U8FO 4RJJA 3E03A 3KCNA 1OZGA 2C96A 4YRDA 1IBCA 1WP9A 5HF5A 5BT8A 3IAAA 3X3HA 5GV8A 1JGTA 4EJSC 4TMKA 4H0NA 5B4UA 3CNQS 3W0LB 1CG6A 3VKWA 1VCOA 2ODPA 4Y1RA 1Q0HA 4REQB 3AHDA 3FZQA 3JRWA 4U7WA 1EYZA 1VIVA 4GEKA 4J0CA 4YDQA 4JC8A 2C4NA 3MEQA 1B8UA 1U11A 4HQ6A 5FIUA 1OTXA 1CPYA 2ZXEA 3UMFA 4EM6A 4F4FA 1UJ2A 2XWSA 2YN2A 2BFCB 4AL4A 4P4SB 3O93A 3SJCA 4DCSA 3GDFA 2AFVA 2A9JA 2BM9A 1DCTA 2IYVA 2FQYA 3JYPA 4KUHA 4R2JA 3ICOA 4MRSA 5FTNA 1EBFA 4JC5A 2VSXA 3GFVA 1KVTA 3BMNA 4GNKA 1CR0A 1NGSA 2KI5A 4I4IA 1A8UA 2FJPA 2Z2ZA 4RORA 3IAFA 3ZTYA 1CJKC 1K7FB 1E0DA 4NZZA 1R0XA 3HM2A 4HR7A 1IB6A 2FN7A 3CZ4A 3TM4A 4R7ZA 2GEKA 2UVPB 3NNDA 3QVWA 4OK3A 3B1FA 2I3ZA 3WLPA 4RV4A 4EYSA 3T0IA 1MGPA 3K9CA 2XOKD 3NWBA 5BRAA 3ANXA 2QVCA 1DJNA 3M3HA 4UAGA 1QDLB 5FOUA 3LSTA 4NCXA 4PFJA 2JBKA 2BCEA 1J33A 2IODA 4IVQA 3HBMA 3ZC3A 2AEJA 3M89A 4TZTA 4KGZA 1A7JA 1ONPA 1O5OA 3ONVA 1Z2NX 3KOMA 5GJCA 5J4LA 1GKUB 2Z3ZA 1JEDA 1IHUA 3R0ZA 2R4UA 2R3SA 1BO6A 1GGHA 3NP7A 4B48A 3NXSA 1L4YA 1G291 1UMDB 4HT3B 3WIUA 1Q77A 5C53B 1DNPA 4HAWA 4RFLA 2X40A 2P35A 5CJJA 4MDHA 3L01A 1CE8B 3E8XA 5EWLB 5AW0A 5I8WA