3TLBA

Microcin c7 self immunity protein mccf in complex aspartyl sulfamoyl adenosine
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
335
structure length
335
Chain Sequence
PLLAAPLAVGDTIGFFSSSAPATVTAKNRFFRGVEFLQRKGFKLVSGKLTGKTDFYRSGTIKERAQEFNELVYNPDITCIMSTIGGDNSNSLLPFLDYDAIIANPKIIIGYSDTTALLAGIYAKTGLITFYGPALIPSFGEHPPLVDITYESFIKILTRKQAGIYTYTLPEKWSDESINWNENKILRPKKLYKNNCAFYGSGKVEGRVIGGNLNTLTGIWGSEWMPEIRNGDILFIEDSRKSIATVERLFSMLKLNRVFDKVSAIILGKHELFDCAGSKRRPYEVLTEVLDGKQIPVLDGFDCSHTHPMLTLPLGVKLAIDFDNKNISITEQYLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MccF
publication title Structure and function of a serine carboxypeptidase adapted for degradation of the protein synthesis antibiotic microcin C7.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 117
structure length 335
sequence length 335
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02016 Peptidase_S66 LD-carboxypeptidase N-terminal domain
A PF17676 Peptidase_S66C LD-carboxypeptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Class I glutamine amidotransferase-like 3tlbA01
3.50.30.60 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 LD-carboxypeptidase A C-terminal domain-like 3tlbA02
2AUMA 5JYBA 5F9MA 3GJZA 3TLZA 2AUNA 3TLEA 3T5MA 4MJXA 3TLAA 4EYSA 4INJA 5K99A 4MI1A 1ZRSA 3SR3A 3U1BA 4JVOA 5F5XA 4H1HA 4IIXA 3TLGA 3TLYA 3TLBA 3G23A 4E94A 3TYXA 1ZL0A 4IIYA 3TLGB 5F1YA 3TLCA 5FD8A 4E5SA
chains in the Genus database with same CATH superfamily
3T9CA 4CLOB 4DARA 2NXWA 5EL0A 3BGDA 1I30A 4YAOA 5KYUA 2WI8A 1J21A 4MUIA 1PUIA 3DLHA 2FLVA 3MB5A 4N4AA 4HB2A 2V7PA 4N7JA 1C3LA 3FTFA 4NXMB 1P1KA 2NVUA 2VNJA 1SD5A 3PITA 1MX5A 4YRJA 3VV2A 3SQXA 1QRAA 3LSYA 2O8NA 3UGKA 1JSLA 3WK9A 2P9QA 1NI4B 4RHTA 2FZWA 4YAFA 2MR5A 3SJCA 4EZIA 4N8EA 4YUWA 2H1RA 3ELUA 3KJGA 4CMJA 2QBYA 2L2QA 1L5NA 2B3DA 4WBNF 3AVYA 4YJKA 4IXNA 4BMVA 5A62A 4LWPA 3D7DA 4HAUA 2G4LA 3CISA 4UPVA 4K40A 3KAKA 2R6JA 4XPIA 1DKLA 4E13A 3FOCA 5KSWB 2V55B 3D8RA 2PBLA 3R3JA 3DXXA 4QNMA 1SC4A 3M1AA 3PDCA 2Q27A 1Z5ZA 2BHRA 4MK4A 1RAEA 3HJCA 4NHEA 4TROA 1HT3A 2OZKA 4OP3A 3WRVA 1QH1B 2X0KA 3GARA 3MD0A 4L1KA 1N6LA 1OY1A 1IU9A 1QHHA 3L9XA 2XPCA 5KJ1A 1OBOA 4OB8A 1JBKA 1GG9A 1U8XX 1UBOS 3D54D 4FYJA 3A32A 5JMTA 1N2CB 5BP7A 4YDRA 1LA2A 3TN7A 3ND7A 4MUMA 5CIWA 2FP4B 4IEEA 1DQNA 1E5VA 1FX0B 1UMDB 1F0NA 1XNGA 4QVGA 4R7GA 3ROXA 3VPGA 4RD1A 5KHOC 4PG5A 4PO1A 3FYTA 2CVQA 3UAWA 2XTZA 3CN9A 1CEQA 5AFSA 3REQB 3LH5A 3O4GA 3ESRA 1E9RA 1DC3A 1POXA 1VRCA 1EI9A 1NSTA 1US8B 3ISTA 4TL7A 1TF5A 3EXAA 2HLNA 4OVKA 3CCCA 4TZTA 4DRXB 4ZOAA 2FLWA 4OU4A 2A86A 2Y1KA 1YR9A 4OFWA 4P38A 4Y18A 3RYHA 3U4MA 4KR9A 1TW3A 3D7LA 4LF6B 4G09A 1QIGA 1CUZA 4PSCA 3L7OA 1RRMA 5J63A 3L7YA 1SOWA 4DLBA 4U6QA 2B4TO 3PJDA 4EGAA 2QN8A 3CR7A 4F8JA 2W00A 3VVLA 1ZUNA 2A1TR 3A6GA 2C77A 4RBNA 1P2SA 3A3YA 4U1RA 1LGYA 2FPIB 4L5CA 4RIFA 1HT2E 5EWJB 5KOHB 2FMTA 2OXTA 4YXWA 1JMVA 1HFJA 3Q15C 2I1WA 4D0SA 1AKRA 1OLUA 3PC8C 5IEBA 3TRJA 2I99A 5HP4A 1XPOA 1EZBA 3K15A 3CR8A 2I6UA 1GLGA 2C94A 2JJQA 2VPTA 3F8WA 3TOCA 1AOXA 4E2ZA 2BP7A 5CA0A 4AYTA 2CXRA 2OZEA 3AUKA 4UZFA 6GPBA 3PUKA 4EI8A 1V8DA 1WHSB 1ZCZA 1UWCA 3VDRA 3KKOA 4QXRA 1L5MA 1PYOA 3NXKA 3UXMA 1IXZA 3MUFA 1WDLA 5G41A 2H52A 5EHGA 5K4AA 2C1EA 4DCPA 4MVJF 3IBFA 1Y63A 3AI1A 4G1MB 2GBLC 3FF3A 3RBAA 5CW2A 1E6LA 1QZZA 4E5DA 5CIYA 2HXGA 1LCIA 4GKBA 5KO2A 5CR9A 1LDEA 5KTRA 4BE9A 1DQPA 2DSNA 3B89A 3UENA 3CXUA 3C4VA 1BC5A 1S1MA 1FTQA 5FL3A 1SBTA 1KMNA 2UYHA 3QF4A 1ABFA 3R7BA 2HW8A 4RF2A 4ZCQA 1ULHA 1U81A 3AR2A 3C7AA 3LYUA 3PNVA 2POQX 3TOSA 3VO9A 3ZVRA 5KNLA 1YVRA 4TWEA 4GI2A 1DO8A 1NSYA 4J3JA 3TZCA 4BEWA 1VECA 1Y80A 1E4YA 4C84A 3CRZA 2JFFA 3ZV7A 1VB5A 2CUTA 1FS4A 1UPTA 1V8FA 4MDHA 1ZRMA 1JW9B 2OWDA 1BQEA 3MJEA 3GLIA 1C8VB 1EGQA 5ICCA 1TUGA 3W3AA 4OHFA 1UOPA 3AOEC 1OLXB 2I9PA 4FBMA 4FMDF 4YFVA 3RSLA 2X2EA 1JAHA 3OX3A 4C4SA 1M3SA 3ZZUA 4MRAA 2QVZX 1QG4A 5KSYA 1N2XA 1HDEA 2J08A 1T6BY 2LV8A 2QENA 2VT3A 3I2JA 2ETVA 2H8GA 2NO5A 1OXVA 5I7EA 2WD9A 1L7RA 2C2MA 1X13A 4EKIA 3AF2A 1JDZA 3D7RA 2HNAA 3IJPA 2O5CA 1S02A 3ZLVA 3O7WA 2Z8YM 2E87A 3K1JA 1GL6A 2B20A 2AUTA 2HU5A 3DD5A 4OAPA 1M2NA 2ECQA 3WYCA 5LBIA 3ZZNA 4WCFC 5HM8A 4UBLA 1E5TA 2YQ4A 2YRFA 4AKHA 5PGMA 3ISVA 4FOPA 1WE2A 1FU4A 1ZY2A 3U5TA 1P33A 3F97A 4HYQA 4JDPA 1K86A 4ZMSA 4X00A 4MVJE 1C3OB 3GW8A 3A6PC 4U63A 2D0PA 3NOVA 1OI7A 2FW9A 1VJTA 2GEBA 4ZC1A 1UP6A 3PUZA 1TB4A 2G7MC 2NU6B 2H92A 3EDQA 1NJFA 3ZJ5A 4B87A 3L6RA 1VE7A 3IHWA 5FNZA 4W9NC 1URPA 1W9HA 1EGHA 5ERXA 1ENPA 3WQHA 1DO0A 5B4TA 3ZDBA 2OBLA 1UBNA 4JJFA 1BJTA 4X94A 3DTYA 2YN0A 1TC1A 5L3VA 4Q3OA 4V0OA 5CPFA 2O2JA 4A2WA 1F0KA 2JFYA 3G79A 3R41A 4WFJA 4B3DA 2CFTA 2NZXA 2OZPA 3IQEA 4HD8A 5CUQA 1TVKA 2JEZA 3V42A 4JZ0A 4DIEA 1E61A 1EFKA 2X0JA 1ZQ9A 3KB6A 4EY4A 1QGDA 4OM7A 1YS4A 3PX3A 5UKDA 1EDZA 4QJBA 2ATEA 3DZCA 4YRBA 4H15A 2FTKE 4WVLA 2LTAA 1FXSA 2EQAA 1NA5A 4OF4A 3T5BA 4C03A 4D9BA 3V8MA 2JKVA 2P2DA 3PYLA 2FVYA 4MYCA 2X76A 2VPQA 3SICE 4MCPA 1KERA 3HV2A 4TLMB 5H9WA 4RADA 1USGA 5AH0A 1B73A 4HY3A 4JNKA 1IQRA 2JD1A 2DVMA 3FH0A 3HPRA 4Q3DA 4KPFC 2O6HA 3N2KB 2FEOA 1Z5GA 4R51A 2PEZA 4OK3A 1GV0A 4BO3A 3V4PB 1Y8QB 1FBNA 2ZRBA 1KEVA 1RI3A 2C0PA 3LDAA 4P7GA 5LQJA 2NPIA 3I5XA 4EJSC 3QK7A 1E79D 1UFQA 2JGRA 4H59A 4HEHA 3B1JA 4NZOA 3RC1A 3VTAA 2WZDA 3RC2A 3NOQA 3R0QA 3JQ8B 4C8PA 2XMGA 3HR4A 3M70A 5EP4A 3T7RA 1GHTA 2P1RA 4HNRA 3E7DA 2JAQA 3IBCA 3HYNA 2P91A 2OXRA 2FF7A 4YV0A 4EFKA 3OQMA 4QBIA 3WWPA 4GIBA 1N3YA 2QPAA 3PQ2A 2I6GA 3OLVA 4EGJA 3B3QA 3BH7A 4AM8A 1Z0IA 3NQ41 1ISFA 4JKIA 3V80A 1NJ5A 5DTRA 2JK1A 3UO8B 2QZPA 4TQ9A 4C0KA 4D0NA 2PFGA 1JLSA 1I9GA 1QBKC 4BMDA 2BIFA 2GZ1A 3HJHA 3WO0A 4JR0A 5CDYA 5IN5A 4PNHA 1M1XB 1QO0D 3IVXA 3EC7A 3O8BA 3QU5A 3JYLA 1YB6A 1EVKA 2QN7A 4IIBA 2O8VA 5U4XA 2VHEA 4KV9A 4B6SA 2QW0X 4CLOA 1XJCA 3LUCA 1J22A 2OTCA 1Z15A 3DO8A 5G0UA 3HH8A 3NDJA 4LMPA 3OQ1A 2CNWA 3HU2A 3N8NA 4WZBB 4DOMA 4ZTUB 2HSEA 5KWIA 1WLYA 1WR8A 3U31A 3BULA 4F4CA 3A1SA 4IGFA 3T3OA 1NI4A 1B16A 1E1QD 3NPAA 4D44A 1FNDA 4PANA 1OLOA 5FDFA 1EG2A 1EU1A 1BMFD 1W2WB 1DXYA 4KQIA 1Q57A 3U81A 1XTSA 3AILA 5LA6F 5C32A 4TSFA 1W48A 2EG5A 4PC7A 3H65A 3NONA 1DDOA 5CCXA 3HKEA 1QFXA 1YR7A 2YKGA 3BF8A 3S8YA 1W35A 5ES4B 3UJNA 4H4EA 2QMUA 1E0KA 1LSSA 4WK6A 2QJFA 4H7JA 1JIVA 1SKQA 1AGPA 1MABB 4G65A 3Q72A 3ZWDA 1QH1A 1O94D 1DUSA 2R5NA 4KQ1A 4O2RA 2C0CA 5F52A 1G6KA 2DT8A 3ZCUA 3OCVA 4XJTA 2V97A 2ZRMA 4N03A 1TKBA 2YJ6A 3MK31 4OXNA 1JN0A 1N2CA 3HZHA 1P7YA 4U2GA 4RKEA 2PZBA 1I6KA 2R82A 4Q21A 1FX0A 1CPYA 1P17A 5HA5A 3B7PA 3GLHE 2D5IA 5E6RB 1M2FA 3HA3A 3Q11A 3N07A 3OZFA 1F2DA 3REQA 3NOJA 1FFYA 2DY1A 1LV7A 2IZ0A 1US8A 3C1UA 1RPNA 2QG9A 1XTTA 2FPXA 3K16A 3EMBA 1PZFA 4Q66C 4YLEA 3F3KA 5JASA 4BQNA 1QRUA 3V7YA 5CJJA 1GP2A 4YRTA 3KWLA 4DRXA 2FEPA 4KRGA 3DLCA 4FD3A 2O4CA 4GM0A 4C0HA 1B0PA 1ISPA 2DOKA 1VJ0A 1WDMA 1JH8A 3ESZA 2CNDA 4BOYA 1J2EA 2GCGA 2WYIA 3D6NB 3E1SA 2X0EA 4D56A 5IB9A 4GH5A 4MYRA 4OX9Y 1R12A 4PIMA 1YRQA 1ISSA 4P93A 5IMBA 5AVKA 3IS3A 2Q3HA 4TTVA 4TXLA 3HYSA 2FPIA 3BIFA 5EWJA 2IPNA 5IUKC 4WXRA 2EC5A 1N6KA 1B6SA 3N3AC 2DFTA 3PE3A 3TKAA 5ALYA 1QKJA 3TINA 3SIXA 1A97A 4D42A 3TF5A 1Q0LA 1BAPA 3TNFA 3MJVA 1U8UA 3O90A 4U6SA 2VTEA 4HGPA 2IH5A 3ORFA 3VOAA 2O0HA 2PBZA 4A8JB 3GEEA 1POWA 1W36B 3LWNA 1BDHA 3VJKA 4KPGA 1P2UA 1THGA 3ZX5A 2J07A 4MMXB 3UTCA 4MJLA 3NTRA 2ZE8A 3JQPA 2Z2KA 3QKSB 1R2QA 1DOHA 3FFXA 4JC5A 5DDIP 3RIMA 1JJAA 3LOQA 1L3CA 3KAPA 2GOYA 3JATB 1A9ZA 1ZVKA 4QFMA 2CXUA 2XE8A 1TA4A 3VGJA 4LHYA 2P4SA 5FBWB 2QL7A 4BMPB 2K2QB 4WGFA 5GY7A 3RIEA 3RRXA 1IM5A 1FJHA 1TW2A 4KR0A 1AE1A 3C1OA 1KU6A 2VZLA 4MQFB 5AK5A 4AMUA 5H5JA 1H3FA 4M89A 4ZIRB 3KQVA 1Y6GA 1U0HC 4ZQEA 1E79A 5B2ZA 1N0HA 3BMCB 3SVLA 4ALIA 1LLUA 1BVRA 2BR5A 2EZ4A 1T2NA 4KBGA 1AS2A 1OROA 4WLEA 3T1VA 4IXMA 3THWB 3GT0A 3ZWPA 1P5JA 3NGMA 3Q7SA 2XWJI 2E6UX 3IE0A 4IHJB 4W7SA 4K87A 4M3NA 3QU9A 1M2GA 3PKJA 3CCFA 3ZUGA 5JOQA 3OFND 2OHXA 3C98A 3Q6IA 4UPDA 1OLXA 3V8QA 2H0AA 3FECA 3M5CA 1KOFA 4LRWA 3K1YA 3TIIA 4B3GA 3EZ6A 2XNKA 3KKKA 1JTFA 2ZR8A 2QZSA 5ENZA 5EGNA 2P79A 2QN6A 4PE5B 1M33A 4M1ZA 3D2CA 5EWMB 2VT2A 3CINA 1HTWA 1X87A 3ZU2A 5CP8A 4UZEA 1E7QA 1E1KA 4C5CA 1XD9A 3DOJA 4RANA 5B3LA 2VVTA 1UUFA 2R6HA 1U02A 3HFSA 3L0PA 2HU2A 2WIFA 3WADA 2VQEB 1E1QA 3T3IA 1J8QA 1XU7A 1BMFA 1I3NA 4X3OA 1C3OA 1D07A 2HPHA 3M6LA 3SK0A 1RYZA 1KK0A 1MEJA 1K63A 1QAQA 2AJCA 2XNDA 3QVMA 4YALA 1MAAA 3V7FA 4HXFB 3ESYA 4BLTA 1NVBA 3NT5A 4EHDA 1G8HA 4EYEA 5B1HA 2I29A 4MB2A 4S0ZA 3UJ6A 2GB4A 1E2FA 1Z88A 2Q28A 1YIOA 1VLJA 2G3YA 2I80A 1QAMA 2CLHB 3PTZA 4EHKA 3EFBA 1CKEA 4AD8A 1QDEA 4FCCA 1O94A 2AJTA 1FQJA 4MCHA 2GZ2A 5LP6F 1PUXA 2ZU6A 4QLAA 2OGUA 2P4QA 4D4HA 3PUXA 3EVDA 1YI1A 2EQ5A 3R9IA 3RHFA 2FUKA 2M9MA 4O2AB 4JJGA 1X8KA 1R6DA 3SHOA 5HMLA 3WIEA 3G59A 4AUMA 2GERA 5LQNA 1W36D 2YV1A 2W4QA 3S5UA 4R2MA 4DTIA 2R44A 3QITA 2QE7A 1COWD 1F1JA 2YWFA 3NV9A 3IDOA 3T5TA 4KITB 1OT5A 1C30B 2JIZA 1YQ9A 4BQEA 1QK5A 1SKYE 2RH4A 4X93A 1XT6A 1D4OA 1WSDA 1F4LA 1GAQA 4P45A 3NWEA 3FCCA 1P61B 4IIEA 4LV5B 5LQMA 4TLDA 3DL0A 1YKSA 2H4FA 1SXIA 4MI6A 3D02A 4TS4A 2IX9A 4QICA 1PEAA 3IMGA 3R7LA 4GYWA 1XC7A 3IAAA 3N2KA 1AC5A 2R3SA 3BZWA 3NALA 4BMZA 2YRWA 1Y8QA 3P9XA 4HGNA 3SS8A 1M8FA 1UIMA 3LW8A 3NEJA 1IZ8A 4NE2A 2PPLA 1XTZA 5L45A 3JQ8A 3JQ6A 5DHRA 3C4QA 1ZNYA 1SNYA 4WINA 1XLWA 5MFPA 2ZZMA 4KREA 2CUNA 1X8LA 1P8JA 1BTOA 1BOOA 3G68A 3P0IA 4B2LA 4KH0A 1OWOA 3W5DA 2G88A 4R1NA 3T12A 5FPTA 5CM9C 3U5ZB 3EC1A 5BUZA 1P0FA 1QR6A 4OC4A 3B7GA 4U3JB 5L4SA 3FGPA 3ZQUA 1P9LA 1FZQA 3CONA 3PNSA 4RH3A 5EZYF 1D8AA 1MGOA 4NECA 1R0CA 1WA5A 3O47A 3WSTA 1BN6A 1ACMA 1NBME 3I9MA 3PHIA 4EYQA 1KY2A 4F91B 1I4DD 1YQTA 1TEHA 4ILKA 2R25B 3QLJA 3DCJA 2ILVA 1EUZA 3ONDA 3U3ZA 3CX6A 1AO0A 1G42A 5L8VA 2PMBA 4WZBA 1BRMA 5J1TB 3DLAA 5MGNA 4RVHA 4RDCA 1RWXA 4HH3C 2IWRA 4WOPA 3ZYCA 1NF2A 4MR9B 1AGRA 3ZE9A 1TIBA 5IUNC 1WXDA 2WE7A 4J0QA 4P5DA 5JR3A 2HCJB 5PNTA 3RNOA 2HI6A 2QU8A 4TUYB 2A0WA 3SLGA 2X6TA 4RHFA 4Z4EA 1SXJC 2FEKA 1A5BB 4O1HA 4P8RA 1IEWA 4HQFA 4Q7LA 3S7ZA 2GNPA 4YPVA 2GEKA 5L6LB 4Y6SA 4UM5A 2A0KA 2G67A 1XMQB 4OK5A 2G5CA 1YB5A 5DMXA 2YDXA 2DP4E 3ADPA 4J7UA 1GWNA 5FA5A 1CUBA 3O5AA 2BTEA 3FEEA 1MABA 2DYKA 1H85A 3TQIA 1U5AA 5AVQA 3PGKA 1PK9A 4J16C 4EYKA 4LECA 3OFNA 2LUOA 4X85A 4RKRA 2WJVA 4AQYB 4M55A 1TF7A 1U7ZA 4S0XA 3EFHA 4IIDA 2X8WA 1UM9B 2HJVA 3WLMA 3LSTA 4XZ3A 2NP7A 1Y42X 2LBPA 1YD7A 4GR5A 1O96B 1SKBA 2RI0A 4N76A 5E6RA 4ARCA 2Z2ZA 1ZGZA 3NXSA 3CYFA 4ZHQF 1UJ4A 4DJTA 3T9FA 4IDCA 3VR1A 3COSA 4C0BA 4Z9XA 3LDGA 4MYTA 1E7RA 4NENA 3SMVA 3OZ7A 3SF8A 1WF3A 4DXAA 4LHEA 4RZXA 4OSOA 4KXYA 1EZZA 3P0JA 2R6GA 1ZH0A 4TV8B 3RDPA 1LEHA 1DJLA 2ZRLA 5B7GA 5CLIA 2XNSA 3FY4A 1L9KA 4CMIA 1U3UA 4ZYYA 2TMDA 1KQFA 1LSJA 1L1RA 2F4NA 2JI7A 3P2YA 4QJ5A 4ENQA 2V9PA 3H3FA 4ZCPA 2I87A 4TYYA 2FFAA 2L19A 3A58B 1B00A 3QVWA 2BFBB 4N12A 1M6WA 3EIFA 1T4GA 2FWMX 3WWYA 1U0TA 3KQYA 4V3CA 4F4DA 3PQEA 1KJ8A 3D7GA 1AZWA 1K8YB 1U3WA 2DU8A 3GJXC 3VOTA 1ISRA 1EVQA 1O5TA 1LTHR 3G2MA 4GOND 5I4CA 2H5IA 5I7UA 2DHQA 4DV4B 1ATIA 1Q7CA 1PFGA 3E35A 5EXTA 3TL2A 4FVTA 3CKYA 3W9SA 5A3RA 5B7NA 3LUKA 3V4RA 1L7DA 3VH4A 2ZUFA 1OU4A 1MTOA 3C14C 1RZUA 2A2ZA 2NZYA 2QL5A 2YWHA 3FTQA 4QU5A 1J20A 4IF4A 5H80A 4BTVA 4CYMA 1PS8A 3F5MA 4BN0A 4Z6KA 2BSXA 2GD1O 3GLFB 4YMLA 1BDMA 2FN7A 3DYIA 3CLUD 3QA9A 2OAGA 4P5PA 1W47A 3LCMA 1G8PA 4A8JA 1HYHA 2C0QA 3ZDRA 3RAGA 2JJMA 2EK9A 2FUCA 2WJGA 3P8ZA 1COWA 1P73A 4UTXA 4BTLA 7MHTA 4FGLA 3I9OA 4ENWA 2H85A 2NSYA 2PV7A 3LDFA 1D0IA 2AG0A 1JEYB 3QKSA 1AKVA 2QTAA 4J49A 4CKYA 3DKPA 1FU8A 1ZRSA 3GGSA 4WJZA 2QRZA 3ABOB 2GHTA 3JATA 1CERA 4EK9A 2J3LA 3PEYA 3AI2A 3DMGA 3K4QA 2DUWA 4MQFA 3OX2A 5JUWA 2VFAA 4JI7B 4JBWA 1U9YA 4KFSA 2FWNA 5EC8A 4M0EA 5A6SB 4ZIRA 3IUQA 4DCCA 4DDHA 3FFWA 5T5QA 3QJYA 3HCDA 5IDYA 1A8SA 1KOGA 2X0RA 3BMCA 2CJXA 3TW4A 2FSIA 3LHFA 3WQBA 1SQ0A 3CXRA 2ZYVX 3UKDA 2WHXA 1AMOA 1MOPA 1WF6A 3M4XA 3THWA 3WNCA 3RWMB 2ID7A 4HFNA 4IHJA 2HPZA 4KX3A 3PU6A 4IP0A 1W8IA 1ESDA 1DTEA 3ASYA 1SPBS 1YCDA 3QSGA 2UZ1B 2HBQA 4OFBA 2C61A 5FOQA 1GCOA 1PJLA 1VHWA 3EDMA 3MRTA 1HE8B 1PLJA 1W44A 4OIMA 2FR1A 4YCAA 4LZWA 1AGYA 4PCUA 4L0DA 4AXXA 4DKJA 4IKEA 4GGOA 1WBJB 3O91A 1NYLA 3EASA 5L3RA 2XMCA 5EFZA 3W9YA 2GKSA 3IQDB 1ODIA 3ZE1B 1K1EA 5EWMA 2FQYA 4ZOLF 3BSSA 3PGLA 4IDAA 5I01A 3ZGXA 3IELA 4MI3A 4RTRA 5K3BA 3G7SA 4D43A 1QF6A 1TK3A 3UXHA 1PNVA 3VJLA 1L4MA 1OILA 3GWZA 3LO5A 4FN5A 3RFXA 3JQ7B 4JROA 4NMXB 3UQZA 1XCOA 2F3UA 4W5OA 3TLEA 4TTIA 4ZCRA 3KBOA 4IVPA 1CF2O 5FUBA 1CUEA 3FVQA 1HEIA 5KPDA 2BE7A 1UEJA 1S8FA 2C8LA 1CY8A 1LK0A 2QJWA 3M1IA 4R81A 4D79A 2AG1A 4PZZA 4OQQA 1ZW6A 1LLFA 5IG2A 1KAGA 1MRZA 4ZTBA 5IHPA 1SZPA 1L5QA 4PHFA 4U7DA 3IUEA 1D1PA 1KOJA 1RC1A 3UAVA 1G5TA 3GDGA 3RRMA 4EF4A 2GASA 4L4UA 4S24A 3WLSA 2WVHA 1IBLB 4F56A 4CM5A 5KQMA 1LBIA 4ZT6A 4RVGA 1W581 1X9GA 3A11A 4D6YA 3OTQA 3ZKWA 4DCJA 3ILHA 4FFMA 1G7RA 4MKXA 4HGQA 3W8RA 2P3SA 5IVKA 4I4TF 2ENWA 2LKDA 2CWWA 1OW3B 2W2XA 5EYPA 4A92A 4PRYA 5JXWA 4BBAA 1YL7A 3PR2B 4US1R 2X0SA 4O2AA 2R5FA 2YQZA 3ZWBA 4EY3A 4JU9A 4Q9LA 1WXFA 2X1HA 3TB4A 5JIBA 1HTBA 1ZIYA 2ODTX 3PFCA 4RELA 5JY1A 3MG9A 1C30A 3CUVA 2WWRA 1DT5A 2B2NA 2IUYA 1PO7A 2Q21A 2WU1A 3GMIA 3HDJA 4QFBA 4MB6A 1NYQA 2X2OA 4BASA 4CG2A 3U7HB 2QTVB 4DC1A 4FE7A 4DQVA 1NJGA 4BNTA 3Q8MA 1VC2A 1G41A 1N8NA 4NNJA 5ALIA 4KLZA 1Q83A 1SELA 3I92A 1K3TA 3N8IA 4S1PA 1HX7A 2BISA 1GSIA 2A5FA 2HSZA 2PRSA 5KWEA 1TMYA 1U3DA 1J0EA 1HY3A 3WMXA 4NYIQ 1PR1A 4E5KA 4HGYA 2D2IA 3HGQA 2P7HA 1GADO 1XK7A 3B9QA 5JDIA 4ND5A 3SLKA 1ORTA 3I6ZA 5HR5A 3DMDA 3PD7A 4CT5A 3QOXA 3WZ2A 1SCAA 3HKBB 1R0SA 3ZLUA 2DR2A 1GFIA 2ZR9A 1JL3A 4MINA 4OD0A 4YAJA 1HI9A 1WV1A 1GGFA 1WXHA 2P62A 3BSWA 1KEEB 3K3PA 4XVQA 5EN4A 3TSYA 2X8AA 3B6KA 2XUPA 2VHWA 1NR1A 1GY8A 3F46A 3ND9A 4U3JA 2YWBA 4Q9NA 3WYDA 5AVWA 3I04A 2ALJA 4P4NA 2FZLA 2JVIA 2Y0PA 5I5GA 4YREA 2OK7A 4IICA 5B6JA 3QVTA 3ZCXA 2ORWA 1MRNA 3LT4A 2MINB 3IR6A 1PLLA 2IYXA 3DPUA 2XYVA 5COBA 3UBTA 2NAFA 4GLLA 3UK0A 1T5LA 1OJ7A 2WP8J 3DAOA 3SQDA 1TEVA 3V8PA 3CSDA 3UHJA 4UUMA 2PWAA 2HIHA 3ESCA 2OB1A 3IQGX 2HEIA 4PTZA 2OO5A 3OBBA 4G0PA 3UMFA 4CM1A 1E3DA 5SYMA 4MR9A 4TVBA 2NLOA 2XEDA 3PXUA 3MELA 3MOIA 3TTXA 2YW9A 2HDWA 3NM4A 1BKYA 3A1VA 3KSAC 3VHQA 1W0JA 3AR7A 1Q95A 1ZHHA 2PV0A 4TUYA 3K9QO 1QAOA 4OY3A 3COZA 3ITNA 5TR9A 2SBTA 1H5NA 1Z2NX 3GLIE 2XYRA 1Y5RA 1DBWA 2PMCA 4DSZA 4BJ1A 1RP7A 4HLNA 1L4FA 3I0NA 4NVRA 5COAA 3BXZA 5AUQA 5FAXA 3PSHA 3OIGA 1GTJ1 3NHRA 4FHZA 3IMKA 3WMGA 4KR6A 5ICSA 2HUPA 2P9TA 3A26A 3FTPA 4NZ9A 5A9SB 2EL7A 1E66A 1V5IA 1ZP6A 1UXHA 3CA8A 3C3AA 3DLTA 3PA8A 3ZHUA 4NBLA 4EMBA 5J2TB 4EH1A 2WEKA 4R8KA 2F2TA 3EZYA 5CH3A 1PZXA 4YRCA 4KMMA 5FTJA 5BWMA 1LS6A 2VXCA 3HXOA 3D5QA 1FNMA 3Q2IA 3TUIC 1UM9A 1N2BA 2HK6A 5FI1B 3DTTA 4NARA 4IJ6A 4DVJA 1BQ4A 4IRMA 4PTLA 2JH8A 3QWHA 1O96A 4H7PA 4HDOB 4WZAB 1KDVA 3SSMA 3HXMA 2IE8A 1CIVA 3V00A 4K2AA 4LZJA 1TU0A 4E7PA 2JFNA 2EBFX 5I9SA 2J3MA 3ZY6A 3BHJA 3EE6A 3R3XA 4GM1A 1G63A 2RJ3A 1JS1X 1KDTA 5DHUA 5C8XA 5HF5A 3P4XA 4JOQA 1P1JA 3QPDA 1LBEA 4GU5A 1PSDA 3PFIA 2WW8A 4LDRA 4TV8A 2BYTA 3AY0A 1ZKMA 3HCBA 3K2QA 2WUFA 2JA1A 4W63A 4LC9A 1ML3A 3BREA 3N28A 4ZYVA 3BXMA 5AW3A 4G5RA 4Q82A 2QX6A 3T1TA 3FE2A 2FDCA 3I6MA 2BFBA 1D1TA 3DR3A 3H2HA 3C7DB 4HGRA 2QF7A 5K0FA 1XKTA 2Z57A 4BS9A 4DILA 5EJ8A 1L5RA 1GN8A 2GA9A 3P9CA 3WGYA 3GFRA 4HXEB 1S0UA 3D4BA 3OLYA 4JCOA 3TECE 1DIOB 4ZCSA 4YS6A 3TQSA 1T9ZA 4I7EA 1XF9A 3F7NA 2NUTB 4P35A 2RONA 2P2NA 2UYOA 4ZDIA 3E84A 1J2TA 4DUZB 4BCBA 1BN7A 2R96A 5EJ6A 3B70A 3PGA1 3L1IA 3COWA 4RSRA 4ENSA 5CVTA 5KYYB 3EQZA 1XZ8A 1Z28A 4LG1A 2EF1A 2QP3A 5EJMA 3GLFA 4EY6A 1JT9A 1D6SA 1STOA 2UU9B 3RVBA 3G0BA 3O8QB 2P6NA 2Q45A 5M3BA 5AJXA 3QQPA 1Z16A 4GOKA 1Y1TA 2WM9B 4IH1A 1U4OA 2IYQA 4ZOCA 3UPTA 4AKSA 3SOPA 3R7SA 3Q3GE 2C9MA 2F55A 1JEYA 3UJDA 5SY6A 1M2JA 3ND6A 4NTZA 3F9IA 4HNSA 5EA2A 4B3FX 2Z1MA 2H4HA 2HQOA 3GYBA 2KHZA 3H1BA 1HE1C 3G2HA 1ABBA 4CCWA 1JUDA 4M37A 2I6TA 3RSOA 2V7VA 2OFFA 3P32A 3NV7A 1PV4A 5JJLA 2FWPA 4BGIA 3FLMA 4HK4A 1X70A 5CT9A 1U2DA 2AE2A 3MXOA 4BNKA 3NHJA 2CD9A 4HJXA 3OQPA 5JNVA 4DIFA 4XVUA 4BVFA 1KZ1A 3AR6A 2L0XA 5E8RA 3OMWA 2DRIA 1DXOA 1YAJA 1HMPA 1MDBA 4G2NA 1E20A 1T13A 2Q0QA 2Q5CA 1C8LA 2Y1DA 3FOWA 3UMGA 5DRYA 2J6BA 4CMBA 2D2EA 1N5MA 4LRSB 3V7WA 3NUGA 3Q5GA 2OMEA 2J3EA 2UZ1A 4IIUA 3T9AA 4RFLA 1DIBA 1LXCA 1HDXA 3FRJA 1LKZA 4L57A 5HILA 3EVGA 2RHHA 1JFVA 1PTJC 1PV1A 4H6PA 2ZETA 4XSHA 1YKFA 3I45A 1P4RA 5BT9A 1DEAA 2FG7C 2EV9A 1UBGA 1A04A 1V0JA 2FMUA 1PEYA 5H7XA 3H17A 4YLGA 2FWBA 3PFKA 3OY2A 5H68A 4D3XA 1M1YE 3GLTA 5IWCA 3TGLA 1OKKD 4PHHA 2VJCA 2DHRA 1AZTA 5BT8A 4N9QA 4UBIA 3SX0A 3JQ7A 4X6XA 2GK3A 1E3SA 5ELYA 2EX0A 3JAKB 4IO1A 5CEFA 4UNQA 3VPSA 1YR2A 3MNFA 4FUQA 1YIAA 2FFQA 4GI1A 1PT5A 4QQFA 5LBTA 4WOJA 3C5VA 1Y3BE 1IZYA 2XUIA 1R0YA 2IF2A 3L40A 4MITA 1U0JA 1TXGA 4NK5A 4V39A 4WLUA 5F64A 1T1EA 5F4ZA 5JALA 4P3YA 3EEBA 4I5EA 2DWOA 5BNTA 1NF8A 2KW5A 4R8SA 4L0MA 2O8CB 4A4DA 4C8AA 1QTRA 1NC1A 5KSOA 5KYNA 3AL0C 2XVZA 4E5PA 4TJVA 4C22A 1UXGA 3KTFA 2BRUC 4GDFA 4KIWA 3RBVA 3M1YA 5T7BA 3K94A 4ARUA 3BD6A 2JBKA 2PN1A 2RK6A 5A9TA 1L7OA 4JLVA 4DNQA 3CG4A 1KQ3A 4IDFA 4LFBB 2IA5A 3TQOA 4Y9DA 3LFHA 4UU1A 2OLEA 3T7KA 1R9GA 1RW4A 3AGPA 2H1LA 4DMLA 1CDDA 2VPPA 3DPIA 4CTOA 1NOIA 4RETA 3FZNA 5EINA 4Z86A 4HN9A 4C30A 3TFWA 1RE1A 2HQ1A 1EVIA 3CRVA 3OLXA 3TNDA 4YQZA 1UKBA 3STYA 4ME6A 1NAHA 4BO2A 3LPMA 3CNEA 2QTVA 3TZLA 2BGJA 1O95D 2DWCA 4EMSA 1GCIA 1I32A 1R6VA 3QKTA 2EFCB 4WZ6A 1CY1A 1OREA 1X14A 3AR8A 3I5UA 2AG8A 4MQLA 4ZAYA 2VIIA 2ZI3A 1YRBA 3LAWA 4BY9E 3EISA 3PEUA 1EFLA 4XWYA 4UFNA 3T8YA 4IHJF 1RXUA 2W2NA 3TE7A 2IYAA 1SBQA 2XNJA 2JJYA 1TAGA 4G67A 4I50A 3EZFA 3FMOB 2WFAA 3AEYA 1GGKA 1XQYA 2A5LA 2GSDA 1ZXBA 2R5WA 3INRA 2R6AA 4ZO7A 3ZG6A 4WXMA 2H29A 3ZWNA 2O5EA 2WF5A 1CQWA 5D5HA 4AICA 1GAJA 2O2GA 5M34A 1ESCA 5IH3A 2Z1DA 2FG5A 1EXNA 2C2XA 2AR0A 2QSJA 3VNRA 3HKBA 1Z35A 4FSHA 1GGEA 1C7JA 1M1ZA 1L8AA 2W11A 4JOSA 1ZESA 1JGTA 1UH5A 3JYQA 3EXHC 4X8HA 5H16A 5DN9A 3V3TA 4C6TB 3CIFA 4FLMA 2YYSA 1KEEA 1P4HA 4M9RA 4AWBA 1QK3A 5BRJA 2AYYA 1N0IA 1AQUA 1I0LA 1TX4B 4YYEA 2XEFA 2JI9A 2VHZA 4JR2A 3JRWA 1M6NA 1W88B 3BDAA 4GZ6A 1V5GA 4B6JA 4CCYB 5C8YB 2EOAA 5CHEA 2JARA 2MINA 4IOKA 2XOKA 3EUAA 3EGCA 3JQBC 2VNIA 3PNPA 5DSXA 3Q4GA 3KR9A 2B7LA 2XOEA 2BMFA 2ZSAA 4UOQA 2H5LA 1W5AA 1P2GA 1Y6RA 1J39A 2HC9A 2PU5A 3C43A 4OP1A 3BK1A 4DLSA 1PG0A 5T4HA 1IXKA 1CDOA 2HSGA 2I1LA 1DCFA 2G1AA 2GWHA 5ERYA 3WLRA 4D0RA 2HHHB 1UC8A 4XEHA 1IDN1 3ZGVA 4QU0A 2YR0A 4ZO9A 4WADA 3UYKA 1HG1A 3RAEC 1IVSA 1QHYA 3VAYA 5LYJB 3WRXC 4JSYA 2DQZA 1U2EA 4XARA 2ID4A 2XQGA 4Y7DA 3RK1A 1RC0A 4ZZIA 5JMWA 1EYZA 2YWRA 2QPOA 3OIWA 2DCUA 5I9NA 4R9UC 3OIVA 3FMGA 3WTCA 3AHCA 1SY7A 2G6TA 4IQ8A 2V3VA 4R2HA 4ZO4A 1LJ8A 5F77A 1Y1QA 1JLMA 4BMCA 5CLFA 2F1JA 1XTVA 1W5SA 4RCYA 4AC9A 4O2AF 3IFSA 5A9SA 2AFRA 2G6BA 4WAUA 4YT4A 2BF7A 4KXFB 3AETB 3O3NB 3FHOA 4G8JA 1T2UA 5J2TA 2FGJA 3DC2A 3ZH2A 3FYDA 2AOXA 4KGVA 4OKSA 4AMZA 5AKYA 1VQ1A 1YRLA 2ZRKA 5BSVA 1P3JA 1X8XA 3LIPA 1Q0HA 4B1FA 4H4CA 2R86A 2RI6A 3Q5EA 3R3VA 1VE3A 4FOLA 5M04A 1HFKA 4JXJA 3PRHA 5HBGA 5HKLA 1NP3A 5FV7A 2COKA 4LCBA 5A05A 1ZDMA 2NZUG 4TMZA 2ISCA 3I01M 3M3HA 4QPPA 4WZAA 2EP5A 1OU0A 1AT1A 2JFHA 2MYPA 3E5NA 4FIZA 1JKXA 5AM5A 1PT7A 5ICEA 2GRUA 1A1SA 1L8OA 2DFDA 2FX5A 1RLMA 5GZ1A 1U5BB 2DHCA 2BSQA 1CJBA 1KIFA 1OKKA 4YRNA 1JFSA 1FS5A 3V32A 4LXTA 3AI3A 3WIBA 3UW3A 4TKVA 1CU1A 4ISCA 1ZIPA 1NZFA 4NIMA 5AVVA 2WF7A 1I36A 3MMZA 1C50A 5BQ5A 3E1KA 1FTWA 2IOYA 2P6RA 4NGRA 1DKMA 3TNLA 2ZBUA 2B3TA 2PGNA 2UVDA 4U8HA 3GBSA 4JD5A 1YONA 3MCAA 4FDAA 1TCUA 4YGXB 5E7JA 1U7OA 5FJJA 1ZVVA 4IJUA 1Q7GA 1UT8A 3HLTA 4J6EA 4GX0A 4D45A 3JQFC 5H81A 5GADl 2FN3A 4MLCA 4FS8A 1R1DA 3EG5A 1UBMS 1KSGA 5CEJA 4C8TA 3IOMA 4TTPA 5DTEA 3CB4A 1G3MA 4KODA 4GFDA 1MW9X 4XWWA 1QRDA 2IVFA 5DM2A 2NUTA 2FQXA 2QW1A 3AKEA 4XD2A 1LVGA 2GD0A 1WSAA 3A25A 2A5JA 2HV9A 3GAFA 3T4XA 4Q0MA 1HYGA 2FWJA 3U4CA 5B57C 3ZVMA 1RWOA 1RHKA 3HJNA 3HRKA 3OC0A 4LXHA 4OQZA 4PXSA 1OPXA 4CE6A 4FFWA 1CUGA 2IC5A 2AW3A 2B8TA 2QUJA 3AUFA 3WNBA 4BFVA 1QM5A 1T1IA 5K0NA 5K4HA 3IMEA 2HM7A 1SK9A 1RJ9B 3ZBTA 4HAZA 2EK8A 2YV5A 1C9DB 5LZ8A 3KCQA 4CZ1A 4NAHA 3O8QA 1COZA 3I3OA 1DCTA 1G66A 4JVNA 2FY8A 2XUOA 3AHEA 5EIOA 3NBMA 1A9QA 2XWSA 3LGAA 4DMHA 3LUJA 3TLCA 5LMCA 2CF6A 1RQPA 3PX7A 4D4GA 2BAGA 4P9NA 1BKSB 1O95A 3VPFA 4JOBA 1TMOA 3DV2A 4PO3X 1U7UA 1EX9A 1H42A 4BRUA 2D1SA 4XM2A 3L8MA 3ZCVA 1T8UA 2WUWE 3MJCA 1PNOA 1V25A 2NTEA 3MLAA 4MW1A 3NBYC 1NM5C 4EARA 1C8BA 3VFDA 1G5FA 1LDBA 3E03A 3UHPA 4D1YA 1B8NA 5C51B 5FBKA 5G0VA 1NQ5A 2BFNA 4ISBA 4YRRA 3VR0A 4YHHB 3L06A 1GOTA 3ENWA 4MGIR 2OLSA 1AKTA 1J8YF 3WJ2A 4V0NA 1ODSA 2DTEA 2PD6A 3ZHBA 2AH5A 1WUKS 3M4YA 3TTSA 2WKPA 2HZBA 4R2KA 3TL3A 3D3KA 1UZLA 5C1DA 5DNEA 1CF4A 3Q41A 4HX9A 4I5FA 3QEBZ 3TD2A 1GG8A 1V6AA 2FMXA 1XDWA 1YE3A 3AV3A 3JX9A 4CM3A 1K6EA 4BKUA 5JCZA 5JROA 3E48A 1NV9A 1EFAA 4NZMA 4KAAA 2CJPA 4OG2A 4LFAB 4QOSA 1ISHA 4C4TA 3JTEA 3U7QB 3CEPB 1CJVC 3LYAA 4ZVPA 4TV8F 1ZIDA 3PHBE 4UVHA 3TZ6A 1RFGE 2XUGA 3UXYA 4L6IA 5T4EA 3GDHA 3R7WB 1Y1RA 4KQ6A 2Z9CA 2J0UB 3U80A 4AT1A 1RMTA 1U2SA 4GXQA 4PZEA 3SX2A 3K70C 1N34B 1XZLA 2YJGA 3ILSA 2Q3BA 4MJ3A 1BD4A 1HRKA 3GFGA 4IS2A 5FPYA 5TSDA 1JQAA 3JAKA 3E9EA 2HGSA 2PGLA 1B41A 1TC2A 4LY3A 1WUHS 3MB8A 1U2TA 4H1WA 3WB2A 2JDID 3GH1A 3VDNB 5DF1A 3T07A 3M4NA 4U0JA 1E1RD 1KJYA 3DDCA 3HYTA 4BWYA 1LI7A 4EMTA 1IHXA 4G8DA 1YBHA 1V9SA 1NBAA 4PTYA 1KKUA 2R87A 4U7JA 2O8CA 3L5OA 1W5FA 3UOGA 2H9AA 2XMRA 5EXDA 1E64A 3L1HA 4GF5A 3N6RA 3G17A 1A7KA 2UYCA 2ZAIA 4TWJA 3EC2A 3SKYA 4EHIA 4B5LA 1OB2A 5T67A 3SQMA 1HLPA 2Q3EA 2HADA 2GPSA 4ZQCB 3IDSA 1X3SA 3L4KA 3X1MA 2HMYB 4IUDS 5JAHA 4BBPA 5ALVA 4RH0A 4EYOA 2REBA 4B4WA 4RLSA 4UAJA 4UTVA 3K8ZA 1I7DA 1T9KA 3MINB 1NASA 4UVIA 4QBHA 4BGVA 5F21A 4J1QA 2IKSA 2F7SA 2RHTA 1GA4A 1YACA 4UAVA 3HXQA 1SQSA 2FV8A 3QMVA 5A2GA 4ZV9A 2QQGA 3W9BA 4LQCA 3FYSA 5EIBD 1QP7A 4TJXA 2WHRA 1A7AA 1R10A 1EWTA 2VSFA 2ZT8A 3T4UA 2CL7X 3OFKA 3QX7A 3UMCA 4B5KA 3QU4A 1RLIA 2PIDA 4P4GA 3RIYA 3S9MA 1KP3A 4WERA 4QDJA 3L6DA 4JN6B 4ARAA 1QWOA 2ZWMA 3UUWA 4BQFA 4Q37A 3KXLA 4UNRA 1JKFA 3M6WA 2HO5A 3A4LA 5JQWA 3BI0A 4ADSG 4X6UA 1V4BA 3N7UA 2YC4C 2G4CA 3OQVA 1H2BA 2QYSA 4FHFA 2Y1EA 3T61A 4B7XA 4B71A 3GH3A 4F6LA 2OC9A 1PKXA 4ZT2A 4FS3A 1AKUA 1II0A 1Q19A 2DBQA 1TOAA 4GPZA 4JLSA 4F4FA 1QVRA 2B34A 1TTQB 2XKKA 5F3WB 4JI6B 5DWVA 3QBJA 5ILGA 2JAPA 2Q1TA 1IH8A 4Q1FA 1C9JA 1ZD5A 4YH1A 3RT1A 1CCWA 5JJ5A 2VG8A 4LVCA 1XA3A 4V03A 4PGMA 3PXXA 4PRKA 4KO8A 5C8YA 4CCYA 2OCLA 1ZC4A 4UNPA 3BXPA 1QP0A 4GP6A 1WVMA 4F72A 4TX1A 1KO8A 1SUCA 3KOZA 3L7NA 1FNNA 1P18A 2BEWB 3ZQ6A 1UODA 4GX5A 3KR1A 1WQ3A 2QW8A 2QI9C 4QEZA 3JARB 3AGQA 4B7CA 1Q22A 4DZTA 4L4ZA 3FROA 1CJMA 3CF0A 3EWNA 4L9AA 5C4MA 4DM4A 4E32A 4BUJA 2Z4RA 1K2WA 3KRTA 2PUGA 2A0FA 2FFBA 1GFZA 1UINA 3OICA 3NZEA 5LYJA 4YAIA 5ICMA 5C1BA 4U7PB 4DQ0A 2UUAB 2CKMA 4GAEA 4URHA 2QGFA 3OZXA 1NXTA 2RK3A 2XVYA 4FZ3A 4NBNA 5EP2A 3T0GA 4AJJA 1MJ5A 2PX0A 4CVNA 1EZ4A 1PJAA 1UIRA 1H6DA 4NH4A 1IAQA 5KAMA 5AQ1A 5KREA 4AL4A 4NABA 3AETA 2V6MA 3ZHTA 5DI9A 3K96A 1TM4E 2OP0A 1UOOA 4YT5A 3FBGA 5KVSA 4PU0A 4FSDA 5GOTA 2QUBA 1GXSB 3QTTA 2NW6A 3HCEA 4YRSA 3NRBA 3WIOA 4BBJA 3PT9A 1E6KA 4N39A 1XRLA 1XQ1A 2IIBA 4IIJA 1NY5A 3ZGNA 4C8CA 5ETJA 2W5UA 2YYAA 3CH4B 4TLBA 5DHSA 3ZD6A 4NYMQ 2CSXA 4J1NA 4NU5A 4DA6A 2WKRA 3FNFA 3OTIA 2VBGA 1W1UA 2CLFB 1ZR4A 4G5GA 4LGCA 3DTVD 1N6HA 3JYOA 1D2NA 4NGQA 1TL7C 4FR5A 4OI1A 4OHUA 3D7SA 1QVWA 3EARA 3KO8A 5AI0A 3TSCA 2PH5A 4CGZA 1GKYA 1AQYA 1SCKA 3NR2A 4GMHA 2ZK7A 1MCZA 5JANA 5L7TA 3EQ6A 1EBBA 3IEXA 1MG0A 5THQA 3WYFA 3SZLA 4JV5B 1YBVA 1WSWA 2JDIA 2YTZA 5T4FA 3LLCA 3A3PA 3G0DA 2QOEA 4Q1EA 3S2ZA 3V9AA 1O6ZA 5DM60 1R0ZA 2HA5A 2BGLA 2RJOA 4FYKA 1TUBB 2K87A 3T4EA 3BFPA 3IUBA 1QRTA 2FQQA 3C41J 2AI3A 1DUIA 1UK7A 1F8YA 3L8GA 2Q1SA 4NBRA 4NE9A 2CFOA 2NZ2A 4FT4A 5HM6A 5LPNA 4E5NA 3H2SA 4I9UA 5GONB 3RVPA 1YJ5A 4ZDJA 4L28A 2OXCA 4BNZA 2VSNA 4NX2A 2C2YA 3OPQA 4E09A 1TO2E 3VZPA 3U9LA 3V6LA 1RJ9A 2QAGB 2VS1A 1LWNA 3B1KA 3CY6A 3PE6A 4O02B 2PPVA 5TQJA 3WMFA 4GGMX 5LB4A 5HRCA 3T1YB 3TR5A 4GQAA 1Z0DA 3I53A 3PSAA 4LPKA 4C87A 1ODTC 4TVSA 3U3RA 5JV5A 2QUZA 3CRMA 4GYKA 3C5EA 3EOAI 1PT8A 4GLOA 2RBKA 3HJUA 1H6BA 1EP2B 4V0KA 3T35A 3CPJB 3IHTA 1T8SA 1C9EA 5LN1A 1U3GA 1KF0A 2PSEA 3N1UA 3ORHA 4ZN6A 4HWKA 2QAIA 1E0JA 1L3BA 2WD7B 3I5MA 3KKQA 1AA6A 2VDWB 1J06A 2AJDA 4B17A 3TGPA 1SXHA 1X0VA 2ZWOA 1JG7A 2V5VA 5JCPA 5AKHA 2F3SA 4C2AA 4J7AA 3N2ZB 4XVRA 3SR3A 1T4MA 1SCBA 2HU7A 5EJEA 2CCKA 4ZU1X 1A8IA 5LJIA 2Q4TA 3LP6A 3QVOA 3DJYA 3OVMA 4JEUA 3HY6A 3AP1A 4TXNA 4IWNA 2K7FA 1FFGA 1WDWB 1IQ0A 2XMZA 1NW4A 3B51X 2NXNA 4LNAA 4RIIA 5EXPA 2VQDA 1IRXA 3SC3A 4XCXA 3U7QA 5AW7A 1EJ6A 2PQ6A 1MQAA 1MRSA 3BFVA 5TRTA 5F33A 1AUPA 1ETUA 2IUFA 4MUAA 2A59A 4YV7A 4JHLA 3R7WA 3PF9A 3BHNA 5AM3A 1BMDA 3G6WA 3PUHA 1ZH6A 4YCSA 1QP8A 2O3TA 2P9FA 4CLXA 3NHLA 4OUKX 3V33A 1ULTA 2BBTA 1T2VA 3FW1A 2E2WA 3BXEA 1YQWA 3HV0A 3KS9A 3FPHA 2BEUB 3FPLA 2E4ZA 1E58A 1Z0KA 3FWYA 4MWTA 3C7KA 5AJYA 3W5SA 3WG9A 3ED1A 1SD2A 1FRQA 1WXQA 3EEQA 3ROTA 2YXPX 2CT8A 2FW7A 4J03A 3KB1A 3JYPA 1O97D 3BMOB 3JD4A 4MWGA 1GPDG 4B6OA 5B1EA 3Q8LA 1ZGCA 4GKKB 4ETNA 1ZMXA 2X9GA 3U3OA 3ZBQA 4GPBA 4WMLA 1ZAYA 1DRWA 4L6AA 1M74A 1R50A 1CHDA 4MVJM 2I76A 2YUTA 2E4YA 3UATA 5DYGA 1RKXA 5G53C 3C6YA 3PV0A 3GLUA 1IZ0A 3LBAA 4JC0A 4JFAA 1X8JA 1M2HA 3AJAA 2HMTA 4LJKA 5B2FA 3O2SB 4OLJA 1KEWA 2NSHA 1Z33A 2XV1A 4GX1A 4Z9BA 3CVWA 2ZJ4A 4HUQB 2JGJA 3UJAA 4KFCA 2ZSUA 2BZ1A 4NJOA 1Q17A 2WPDD 4BNYA 5JBQA 4DJJA 1M5TA 4GZMA 1C0PA 2G04A 4GYJA 4Y2UA 1BHO1 5EKSA 5F1KA 3WLJA 4BLPA 4D96A 3MINA 3O4HA 3VX4A 4O8CA 4ES6A 4J0NA 4RHEA 2Q9UA 1CY6A 1Z6XA 1R4ZA 3DTVA 3GJZA 3GOQA 3I72A 1T25A 4IYRA 2YWEA 3QLVA 4X7PA 3ES9A 2G0NA 1KMHA 1FYVA 3C1TA 1PCXA 2DH5A 5AJUA 2E4WA 3O38A 4ZYZA 4C9EA 1OI4A 2GCPA 2C31A 4DJ5X 3O74A 2J0QA 1GLNA 2M6SA 1ICIA 3MTBA 2H9YA 2HTFA 2W6CX 2Z1NA 3GMDA 2A14A 2XVAA 2X0NA 3UOWA 2HA4A 2JBJA 2TSYB 3QPBA 2MMGA 3EFEA 4CF4A 4C9RA 2OBNA 1X92A 2NADA 4HX2A 3C7CB 2WJZB 5TARA 2HJSA 3L5KA 4RCZA 3Q3JB 5JYBA 5B64A 4JIGA 1Q91A 4WRRA 1PW7A 4XGNA 1SVSA 4LWZA 4XUEA 2IU4A 1RQLA 3LZDA 1AUXA 2OB2A 4DLXA 1G5IA 5DIZA 2DSTA 3GV0A 2J3JA 4D97A 2P4HX 4QO8A 4XWOA 1Z18A 3C8HA 3VJRA 1OTHA 1RIIA 3OOWA 2JFOA 3PIDA 3NVAA 4Q9DA 4RHUA 3KLMX 5F73A 3UICA 1CR6A 3VA7A 2PX8A 3K9WA 3U60B 3K4IA 5B7PA 2ODEA 4PX2A 1GGHA 4CMAA 3KDPA 5LFAA 3HWWA 2Z6AA 3LTEA 5D3ZA 1LI5A 3Q3CA 1G1AA 4P2GA 4RQTA 1V3VA 4PV7A 1H4QA 1WB6A 1VIVA 2BEWA 2DFKB 2XDAA 3EMVA 4XGQA 3UMJA 3ZQ4A 5KVCA 3KC2A 3RIGA 3JARA 2H4JA 1W8DA 4UQOA 2XUKA 3DWFA 1SUEA 5JS6A 2P68A 2RGGA 2X2PA 2H0QA 4XWTA 4M83A 1CZOA 4GNRA 5SYNA 3KNZA 5K2MA 2OPBA 5C0OE 1W4AA 1Y82A 4NF2A 3TE6A 2I7VA 2P11A 2PL9A 5DNCA 7MDHA 4Q19A 1WUTA 1LTKA 4BQSA 4KDEA 1NONA 4MOWA 3LQKA 1JLRA 4PSVA 1JEAA 1HETA 1QHGA 2CEAA 3HABA 3K0HA 4NMHA 4NMWA 4BVJA 2B69A 1GEGA 1M6YA 3BDIA 4QA9A 4D5EA 2A9OA 2H63A 1RRCA 4F5EA 4MW0A 4LBVA 3KALA 4TTQA 4B7ZA 1OGJA 2ZRDA 4OI4A 5HRUA 4E5YA 5HZMA 1RKBA 3WNDA 1L0BA 3CEHA 4G5HA 1A2KC 5AW6A 1FS6A 4F71A 1XKLA 3KYCB 1NE2A 1QV7A 1K2VN 1RXWA 2IW3A 2WVAA 1IBCA 3IMCA 4OA8A 1GXSA 2FFJA 1PJ4A 4G0WA 5HPYB 1MKYA 3WYBA 5D3KA 3L4BC 3G9UA 3ZDQA 1DIHA 4TMXA 2C42A 3MYYA 1GO2A 5D5PA 3DW3X 4OQNA 3DT9A 2ONCA 1U1GA 2XRZA 1CB7A 5D87A 2JFPA 3PGMA 3RFCA 1U9CA 3LP8A 3PWZA 1Y6JA 1GA6A 3F96A 1JYEA 3M1LA 4R9RA 2DFLA 1FJXA 4MIOA 2X4DA 1K3UB 3JZMA 2ZB3A 1G3IA 2FSHA 2NZ8A 3QMWA 4J1TC 4N7BA 5C18A 3AVXA 1LU9A 4UU0A 4TXMA 1QYVA 4M1EA 1XTUA 3LOUA 1CLUA 3U0VA 5CBKA 2V0GA 3LQYA 3G1WA 3GG2A 2A84A 4F38A 1D3AA 2UXDB 1GR0A 3NM5A 1DX6A 2YJ4A 2R1TB 4NKRA 3SDBA 2IS6A 4RHYA 3SPXA 1WXEA 4Y67A 3L4JA 5K09A 2AEEA 3VVBA 5AJWA 1BS1A 1JA0A 4MHSA 1HZZA 4EVRA 5E9WA 3VO8A 1G7TA 2QRUA 4PPYA 3TVYA 5C8YF 3U3JA 1WRBA 4YVFA 1TUBA 3LZ6A 3EXG1 3TQFA 4K0KB 3QJ5A 2BJVA 4GKAA 1ULBA 3L7JA 4LXXA 4J0IA 5ALEA 1D6NA 1NKVA 4E22A 3LTNC 2HA2A 3QKIA 3Q2OA 5FP0A 4P3NA 2FJPA 2VYFA 4IDQA 3W77A 4RTQA 2CFRA 3B53X 2ZVDA 5AUOB 4PWZA 5KOIA 1KE1A 3WGVA 3LBNA 4LHSA 1N1GA 1CNFA 2QAGA 3PQ5A 1OZHA 1TQHA 4DSOA 1YMVA 1SIBE 3R0JA 4XDHA 2FR8C 4EWLA 1NJ1A 4XWKA 3P9ZA 4IXDA 4TQUS 3E05A 4NJMB 1O94C 3BF7A 2I5PO 3SZGA 1O8BA 3D4LA 4JK3A 4LTDA 1UKVY 2EJVA 4R1SA 3R75A 1RADA 2Z8ZA 4IEIA 5KNBD 4UM9B 1I2MA 2YXBA 1GUZA 4NU8X 2RAFA 4RZ3A 3LCVB 3BRWD 3CUKA 4I81A 2IF0A 3GP5A 1Z45A 2HA3A 2EKBA 3QKWA 4IQ4A 4XYMA 4E2WA 5DIFA 1LNZA 2PVCA 1TJNA 2WWGA 3VU1A 3TDNA 1LFAA 1U4NA 1EGVB 1I0IA 1TO6A 4ED9A 3I0MA 5AM1A 3HXPA 5DGCA 2CSUA 3BD9A 3IA2A 2WD7A 1W19A 4XA8A 3PCXA 5DX8A 2OV6A 4J0HA 2VDWA 1I13A 2ZYSA 1W5EA 2LXNA 2CL0X 3KOXA 3Q3IA 4IILA 3PNMA 1S7CA 3NTUA 3RI3A 5IVPA 2WR8A 3QGMA 3M5WA 2WM8A 3OP4A 1U2GC 4AQ7A 4GWGA 5E3IA 3AX6A 3MTEA 3OKPA 3OH8A 3ABRB 3TCKA 5E0KB 4CIDA 1E4OA 4OHPA 3VR5D 3DBVO 2IPAB 2PKCA 3MJHA 3Q5DA 3GX1A 1RXCA 4EAAA 2IX3A 1UBEA 3PVZA 7AT1A 2G40A 4II3A 2I1VB 4N3NA 1ZCBA 2DWUA 4G5QA 2X7XA 1JH9A 2JHCA 4H35A 1B6RA 3M6IA 4IOMA 2MCFA 1QGYA 4K9DA 4PXAA 5K0GA 2BUAA 4XYEA 1X94A 2JCVA 4H6WA 4JYWA 4JUCA 2R1VB 4ARVA 2OV1A 2WUGA 4EGQA 4KSYA 5IN4A 1SUIA 4AMBA 4MIEA 3FVVA 3FXAA 3U09A 3DLPX 3GDWA 4ZAWA 2NUPB 4FPXA 2NXJA 2WTBA 1S4QA 2JLRA 2ON6A 4H60A 5HXAA 3FF1A 3SFVA 4DZZA 2OBMA 5JWHA 5BR1A 3CTMA 2HT1A 3H5LA 5D7NA 1GDTA 4X7MA 3S27A 1H8ED 1X19A 3H6GA 5CT6A 1ZUIA 4RQUA 2BEUA 2ZRAA 5EUBA 1G18A 1ZD8A 1CULC 3WGZA 2A8YA 3I4LA 1CUJA 1EB8A 2AMYA 3CO0S 2GVZC 1VIYA 4BO7A 5CXQA 3K0SA 2HYIC 1L4UA 2CXOA 3BMOA 3QX8A 1Q7TA 3AJRA 3QU7A 1EAMA 3DEKA 1E9FA 3CUSA 3UB3A 1T2EA 4LHWA 4XR4A 4ZQFA 1P91A 4YRKA 1B76A 3GLIB 4DCVA 1U9JA 2PLNA 2XBLA 3JZAA 3HWRA 4C2UA 4TQGA 5EMHA 5J4YA 1FTGA 3P27A 4XB2A 3RREA 4EEXA 3A9SA 4TMFA 3EYWA 1IBRA 3M6AA 3AFOA 1EA7A 3AYXB 1VPEA 2JRLA 4FD2A 5CU7A 5DSTA 1EHCA 2O05A 5EJAA 4N1AA 5CDTA 4UU8A 2JHGA 2P40A 1TQ2A 4IM7A 1RJFA 3O3CA 4HUQA 3C1AA 4QYWA 1UKAA 1QUEA 1SBIA 2H2IA 4NPHA 3ZVKA 4B9EA 3UA4A 1GCUA 2JD0A 4N5NA 5AQEA 3AM4A 1OXXK 3L1JA 1Z2DA 1N0VC 3NHBA 4D9MA 3AG6A 3L05A 4I1IA 1VTKA 2WVJA 1KSFX 2HHCA 4MO9A 5DW3A 2PANA 1CX9B 3OJWA 1A77A 3BQNB 3MBKA 4UM9D 4LHVA 4ZGBA 1YUBA 5FV4A 3DYVA 3KRVA 4TOIA 3ETJA 4G1FA 3AUAA 1V1MB 3D6FA 3GN2A 2EX1A 2VK2A 1UJCA 3ORQA 4M76B 3CX8A 4NRDA 4CQLB 1ZMRA 4HNGA 4KNWA 5C7OO 4L8YA 3J81A 4P4JA 2CLKB 2BM0A 2A3NA 3L1KA 2OEPA 4JWTA 3TDKA 1A7UA 3G7UA 2QTLA 5AR1A 3IP8A 3HY3A 2QM3A 4J7XA 1W5TA 1GYRA 4L5BA 4B6GA 4L8WB 4GO1A 4PZLA 4F1JA 1KVRA 3GRCA 2PE5A 2DKOA 4QJ4A 4P34A 3PNQA 3CKMA 4AY5A 4H3KB 1WDKA 4RWZA 3ZI7A 1BX1A 5EHQA 3KVNA 4YMUA 2J4DA 4KCGA 3D7MA 3O26A 4W6ZA 2X77A 2VYQA 1HOXA 5IT0A 2CDAA 3VM6A 4BL5A 1F14A 3A1CA 3DE5X 1G19A 4C7MA 5EGSA 3ZPXA 1DQYA 1C0KA 2P9JA 1Q1NA 4LOIA 5KZMB 1FYFA 1SBYA 1HL3A 2N75A 2GTPA 4BLUA 2PVWA 2QXUA 4DUPA 4L6CA 2DKNA 1VE5A 1G5QA 3OFJA 4I9FA 2D5AA 4HBZA 5HKOA 1AQNA 4Z4IA 4NGSA 1KC7A 3KYJB 3SC4A 1J24A 3CEJA 1SMKA 3CF6R 1RYBA 3FB4A 5CX4A 1KVTA 4X65B 1Z7WA 3QTBA 3G2QA 4EW6A 3KM0A 2R00A 3IIEA 1TZ2A 3H86A 2NUAB 4BO1A 3AR5A 5BWLA 2QT1A 3SEFA 2RHRA 3S8EA 3BXFA 2Y8EA 3BRWA 1PD1A 1RWQA 2IOFK 3MAAC 4JT2A 4QASA 1CYEA 2HFKA 2X4LA 3DDUA 3MHPA 4IDPA 4KHZA 4DLYA 4IZIA 1J7JA 4V2UA 2ZI6A 4GDMA 2PLRA 4WBSA 3WL8A 2IBTA 2QXYA 1GRNA 4KFTA 3B1XA 4PHTA 3EZ2A 3MWDB 1GR1A 4QUIA 5AKIA 4FXOA 5HE8A 3RAPR 4BYMA 1QGAA 4F3NA 2GTIA 1KDPA 2ZYTX 2I2AA 5CLLA 5P8WA 1R4NB 2Z09A 5ITWA 3DE3X 1WPQA 2G8NA 2XRFA 4XJVA 1VYUA 3I62A 1RHRA 4Y6PA 3O1LA 1HSZA 2QTNA 4LC1A 2G70A 3PHHA 3VR5A 2Q5LA 4WCFB 3QFHA 4Q9HA 4MDFA 1M0WA 1QNFA 3KKMA 3KQMA 1CFZA 3ZHRA 4FGKA 4UCQA 4YK7A 1BHSA 1UC4B 4TPKA 1YQXA 2AC2A 5CFLA 3MJSA 1WO8A 5IKEA 2PH3A 1DKRA 4GQIA 3MWLA 1Y4DE 4RENA 5IFKA 4RPGA 3SJXA 3H83A 2ORED 2Q5HA 1X1CA 2X5NA 5AMXA 3GIDA 4CMEC 3CZAA 1JFRA 4OSPA 3VDXA 2Z58A 2QD2A 4O4JB 5DP2A 3IKLA 4QNRA 3FYUC 3S2SA 1CRZA 1E5XA 1K6MA 5F12A 3UPUA 3F5FA 3LLUA 2XWBF 3KOOA 2VK4A 3QELB 4RTPA 4JBYA 4AURA 3X1ZA 4XAQA 1Z36A 3QNUA 1NDUA 2XCIA 4L15A 1DMSA 2ZDHA 5ISMA 5B3JA 1RWKA 3OZTA 2F59A 2ESRA 2R1TA 4YB8A 1ENZA 4NCAA 5JZVA 1RLOA 3OZBA 1UOEA 3WGHA 2Z2XA 3CUTA 5B3KA 1FFHA 3HJGA 1HURA 1YK0A 2DBZA 1MIOA 4MV4A 5CVEA 2D7CA 1KAQA 2PKXA 3PP8A 3RVNA 4JX8A 5IRCD 3EHDA 3E2PA 4INJA 1Z5PA 3G8DA 3FOBA 1GQYA 1I6LA 1S3SA 4ZTZB 3OOHA 1A4XA 1Q0UA 3NP9A 2BZ0A 1KXJA 3R77A 4GG1A 5SY9A 3AQIA 3WNZA 4OK6A 4DM3A 4M9CA 1TVEA 4JYBA 2WOOA 5CFMA 1PWZA 1BHJA 3L7IA 3JVDA 4YT2A 2YXNA 2E85A 3H1PA 5E4YA 2YNMC 5BN4B 2WQZA 2IOHA 1G8FA 3GT4A 2JLBA 4RF4A 5KTKA 2HB6A 3CHYA 4Z9FA 1VL2A 4KWIA 4EJSB 1Y81A 2VT7A 3W8DA 3IDZA 3QPCA 4GZ5A 2WAYA 4FGJA 4NJMA 4BZQA 3HE3A 1OE0A 3UYLA 3P1JA 5J59A 3JU3A 1L2TA 3F6RA 4QG7A 2IEZA 4KXWA 1JG4A 3HDVA 3L7BA 1KP2A 4FB4A 3KSMA 3II6X 5L40A 1P2FA 2AC4A 2P2YA 5AXCA 3OTOB 1PP4A 3HA7A 3QG1A 4AZSA 1M5RA 4C0AC 3QI2A 1ZL2A 3QENA 3AF3A 5NLLA 2ZUTA 1PSWA 3ROZA 1GZ3A 2GHRA 1DV2A 2XE7A 4DV2B 2LRHA 2CNKA 3H9BA 2Q3CA 3F3YA 3PLNA 3EAGA 5BN3B 4DMUB 3PDIB 4B47A 5JS1A 3SR4A 4JL8A 4DIUA 1OZGA 2O14A 2ZYGA 4G1UC 2N1MA 1H9AA 4IRUB 1NR5A 2QN9A 3RABA 3G0HA 1RM4A 4LK2A 3FNEA 3OQJA 4URZR 4COBA 1X1RA 4QDXA 3KSBC 3HUDA 4LMRA 1XQWA 4RNCA 4EHHA 1AUVA 4ZOQI 3PFFA 3SMQA 3G2KA 5FTKA 4P4BA 4BB6A 1B93A 1CY7A 1FU7A 1NBHA 4DBLC 3A4VA 2CHEA 2E82A 1XKQA 1IN7A 4FT2A 3IUSA 1OTXA 2PDAA 2Q99A 1PVVA 2R1VA 3IO3A 1BGVA 5E9JA 1BFUA 1EFCA 1PR9A 4PSKA 2YJNA 4QUAA 2NUPA 4RKYA 4MCRA 1DBQA 5HQJA 5K8LA 3ZE7A 5KTNA 2WP0A 1JHUA 3HVHA 1ZMBA 3D2AA 2WNIA 1V47A 3WYEA 4YCBA 1FFDA 1Z8FA 3J7AC 4KL8S 2GNAA 3QQ5A 5A4DA 3GAMA 2UVQA 4OHVA 4BX9A 2Z2IA 3LWZA 1PJBA 4MVJP 4Q05A 4ANFA 2QRVB 4RJIA 4ZARA 3S70A 1EVZA 1V3UA 2VCEA 1PGPA 4ECAA 1GRRA 2HPAA 1G5RA 1E1DA 4CIWA 3O4RA 5FH9A 3TFOA 5TEWA 3MJFA 4BVEA 3WLNA 2J9XB 4KE6A 4FK8A 4NLLA 1SZCA 3F4BA 1F2TB 2P6OA 4M6WB 3DBHB 4QT0A 4ZVRA 1WXIA 3IT1A 1N2EA 2CFSA 4Q4JB 5GONF 2DHEA 4PQGA 1U04A 4F3RA 1HQKA 3PNKA 3WA6A 2M98A 4C7VA 1QQTA 2PGXA 3MWKA 4MYDA 4TGLA 2CMDA 2JRCA 1CZNA 1HM5A 2Z95A 3EEFA 1N9ZA 3RPEA 2PUCA 3GJRA 4CMKA 4YDSA 1W2HA 2II6A 3M6MD 4OB6A 4CZ2A 1K8ZB 3IT3A 6REQB 4IFBA 3KYBA 2NX2A 2ZTVA 2Q1XA 1WABA 1X7ZB 1Z0SA 4YI5A 3K05A 2QTGA 3TJRA 4A2QA 4DV5B 4NXNB 1FLNA 4P1ZA 3KTOA 5FKJA 3QH4A 3EVZA 4L4YA 2Y92A 4LF4B 3AP3A 3GJTA 5CB0A 4X62B 4GPD1 4D0LB 4O4HF 1QIEA 1FRFS 5DGXA 1Q0RA 5HIJA 3MRXA 4LQ4A 1E3QA 1HO3A 2FYTA 4FX2A 2YWDA 3EY4A 1E89A 4RPJA 1E4EB 2CF5A 2FSUA 1ZL0A 2ZBPA 3CFYA 4PPFA 4KIGA 1IN8A 3CB2A 4LDZA 3S7TA 4F85A 1OOEA 1OFVA 4ER7A 1E98A 2Z30A 3QU2A 5AW4A 1R4AA 3LY7A 3PC8A 1V1MA 1VA4A 2C5AA 1G0OA 3LF1A 4KYIB 4U5QA 2OOTA 1E2EA 1XLTC 4G41A 4S1NA 4BLVA 4CQLA 2YW2A 4K28A 1G2PA 2QMZA 5EE9A 4YYZA 1WETA 4DG9A 4OYHA 3ROPA 5JATA 5JXHA 1XIVA 4V38A 2FPLA 4M0FA 4ETMA 2PL5A 1Y7PA 2UDPA 5C52B 3NATA 2B5WA 3ZDAA 4HDRB 3WDMA 4E03A 1ADGA 2MR6A 5AK4A 3KK0A 5ALSA 5KOJB 2GBLA 1NNSA 3AVUA 2QM8A 4X6YA 1HV8A 1O8CA 3AXSA 4H7KA 4EB6B 1M8GA 1ISJA 2BFFB 1PFWA 5JO9A 3T9EA 4BGUA 4EMUA 2C5QA 3NRJA 1GPYA 2PS9A 3L41A 1ZGAA 2HWUA 2OVBA 3EZGA 3H4VA 3I83A 4R0VA 3B8HA 4G5OA 1ORRA 4PO8A 2XYHA 1E8NA 1SKUA 5LKRA 3EOZA 3OM1A 1F4VA 4G8BA 4RULA 4NBVA 2F3RA 5HIKA 2JZOA 4Y2TA 1VIAA 2X1LA 1QDLB 1U80A 1Z7GA 1GPH1 3CLKA 3DMFA 2PRIA 3F73A 1VJGA 2R8OA 5ECYA 2VYVD 1TM1E 1HQCA 4I4LA 5IC5A 2O1SA 3GUZA 2NUAA 4EKGA 4NV0A 3L0ZA 4EITA 4II7A 3UMMA 3C3BA 2JVKA 5I7OA 4FZ5A 3AOEA 1T0UA 3FTCA 1AK1A 2BF4A 4IW3B 1H1TA 4UTOA 1MENA 2WNSA 2HMVA 4PLPA 4TWZA 3EPLA 4HS9A 2HO4A 4JA2A 4M7OA 2F4VB 3MWDA 1KJQA 5E2AA 1XCMA 3EZLA 3FFTA 6YASA 2R11A 2GVDC 3KAJA 2Y05A 1BFKA 3HR8A 3I9FA 2AOVA 1A9YA 3WZMA 5CA1B 3SC6A 1E77A 5JARA 1ZSVA 5J3JA 2AXNA 1HLGA 4QC2A 3KTDA 2Z2YA 2K5UA 3COVA 3GNLA 4RNDB 4WCFA 5JLAA 2O8BB 1P9OA 1N6NA 2W6OA 2X23A 3GA7A 3N75A 4UM7A 1MH9A 1VIMA 2C20A 1GGOA 4TTRA 3W6PA 3HSSA 5GJVC 1XU9A 3IBSA 1ZZEA 3B6MA 2O1WA 3G0OA 1TYDE 3K0AB 3M6UA 2F67A 2XA1A 5IFLA 3QHQA 1NIJA 2FHSA 2ZB8A 1DC5A 2CLEB 1CNMA 4W9NA 4D46A 5BORA 5JXJA 1LRLA 1E9EA 1F12A 2VTDA 3NAZA 3TW0A 4DR1B 1QKKA 2GKGA 5IJZA 2EW8A 3RSCA 2IYSA 1O9GA 3FI0A 1OBCA 2B4AA 5FLYA 4D4LA 2QRNA 3QELA 2AB0A 1O3YA 1UR5A 2NSDA 1XRQA 1PR5A 1RYDA 1J00A 3GGDA 1B1AA 4GQBA 3OM8A 4H2DA 1ZU4A 1EP3B 2FHPA 3VX3A 4DUGA 1TAUA 1SEVA 4OJQA 4MQ4A 2KLBA 2ZDGA 1SCIA 1NZDA 4MW7A 3NRCA 2YIDA 5A71A 5B7QA 1E6MA 2HIGA 2OV4A 3VU3A 1F3OA 3JVUA 3VSEA 5HUJA 3K92A 5IYZB 1LJLA 1XEAA 2NO0A 5CXXA 4QQ8A 5CCEA 1SWVA 3PXEA 5IW8A 1WS6A 4AF8A 2BMEA 2DPHA 3CE6A 3D8TA 1E1NA 3ZDEA 3VH3A 2C9DA 5KWJA 4PCVA 1R64A 4FFVA 2PWBA 3KKPA 5D84A 2PFSA 3P4YA 1KI4A 2ROQA 4LISA 2EWVA 2DWQA 2REOA 1II8B 5REQB 3DEJA 5TF0A 4DXDA 1JR2A 4W9MC 4RXMA 1XZDA 3FDXA 5BN4A 1SBZA 1BVHA 1R6XA 3O1HB 2A78A 2RKOA 3IEPA 2X58A 4JGGA 4KKXB 5I8WA 4EJSA 4R31A 1LK5A 2BPOA 4GEKA 4IGKA 4QRHA 5H82A 3H05A 4KE7A 4EO4A 2VUTA 4HNQA 3A3OA 2XXAB 4M9XA 2AG6A 2XAUA 1B8UA 2TRSB 2V7UA 4EEZA 2MSKA 3VNVA 1WAMA 2IDZA 1XWFA 3R5KA 3H87A 2YWCA 5A06A 1TYCA 9MHTA 2C95A 4C5BA 4B84A 1MJNA 1E9BA 4RLFA 3FPGA 2D1YA 4OQPA 1SXGA 2YN2A 1KRHA 2CBGA 5CJPA 5FQNA 5HW0A 3KDAA 1RQRA 3N8GA 3LC7O 5T64A 1FW6A 1QV9A 2CCGA 3BHMA 3NVKI 1P3DA 4B7UA 5BN3A 2HHLA 4C86A 3PDIA 2Q3DA 1WCV1 1LBHA 3CLSC 4MA0A 1D0SA 2QLNA 4AZ0B 2AMVA 1IULA 1I6MA 2OCDA 2MSDB 2Z08A 3H04A 4RVDA 4EL5A 5FX2A 3S9NA 4HB3A 3JD0A 4OLFA 4BFLA 4QM6A 4KQFA 3PA6A 1TCVA 3VNUA 3BIXA 2CZCA 4BNHA 1DQZA 1C5KA 1KGDA 5DXAA 2C8JA 4WK2B 2RG1A 1EZAA 2GAAA 2BEJA 2XZDA 4L9RA 4NG5A 2JH3A 4QE3A 4UUPA 3WHPA 3ID6C 3LHDA 4I08A 2C5FA 3HGTA 3HB9A 3NC4A 3QWIA 1JALA 2IGTA 5K99A 1ESEA 3DE2X 3PK0A 3PUWA 1SXJB 5H3CA 3WAGA 4AZ3B 3X1YA 3M3PA 1FDUA 2FR0A 4JI1B 1OXBB 1J1IA 1U90A 2JA2A 2VP0A 3ET4A 1IY1A 3HFRA 3M4ZA 3E8XA 4Q3EA 2WSYB 4KOAA 4V0ME 5CFOA 1E2JA 2P67A 5J23A 1NRIA 3SHWA 1XROA 4I2VA 4YQYA 3R8XA 2EERA 4JQCA 3JRNA 1FSPA 2VYVA 3KQPA 5ER6A 2H17A 3J7TA 3ETCA 4PCAA 2B82A 4B3RB 4R3WA 1EA5A 2QRVA 2C7VA 4MGHA 5ILQA 1YZLA 4I4IA 2I65A 1G64A 1NUSA 2F00A 2Q2NA 3G7NA 5G0SA 4YLYA 4WESB 1OTYA 4PC6A 2IFTA 5DT2A 2WHQA 5J5AA 5BY2A 3EHEA 4L3OA 1U4SA 2BN4A 4LJ8A 4P53A 2PX2A 4BN5A 1B3BA 3CNOA 4ZRMA 1MX1A 1RJWA 4K6KA 3QXHA 1F2TA 2IIVA 4M6WA 1NQWA 1YT5A 3DBHA 3PPYA 4EKDA 4Q4JA 4P92A 3ROKA 2PSHA 1Z8DA 3QVSA 3T3MB 2RHDA 2WSSD 3PHGA 3TR6A 1N7HA 3EBOA 1B8PA 3O83A 4GMDA 4OU5A 1PZMA 2LDBA 3E0XA 3GBVA 4HB0A 4YUXA 3U44B 2Y1FA 1YJAA 3A9VA 4X41A 3ZTTA 1EX6A 4DJFC 1H2FA 3EIEA 4NQRA 1JPUA 6REQA 1V2HE 5JPIA 8LDHA 1X7ZA 2GO1A 3GLGB 3INGA 4V1CB 4JMPA 1W93A 4XRGA 5KNDH 4Q16A 1LVHA 3GK3A 3DZGA 4AJ1A 4BFWA 5SV2A 7YASA 1NBWB 3O4IA 1KO5A 2EJTA 4RF3A 3ROQA 5LNK6 3A06A 4NDZA 4CMHA 1E4EA 1K7XB 1SC6A 3DCIA 5E7IA 1CWUA 3N0TA 4JP3A 4M0DA 3RIXA 5D29A 2AQ8A 5DB4A 3UGTA 8AT1A 1VI5A 2AC7A 2ZB4A 4BYGA 3QXXA 3ZCPA 3OE5A 1H2ZA 4CUJA 2HHJA 3AH8A 3WGNA 2C9CA 4KXQA 3WI7A 1GKIA 1U99A 1LNQA 2RGWA 2XUHA 2Y99A 1IOVA 2I8CA 2UKDA 3RHTA 5F2EA 1EDOA 2YMPA 3D43A 3V2GA 1C3EA 4QZVA 1ZVQA 1QZUA 3I58A 1DRUA 2W37A 1G0NA 1P5FA 2ZS9A 3C3YA 3EGOA 1NJSA 4XFKA 4OXXA 1UM8A 1B2LA 2FEXA 4HDRA 1KZ6A 2UYQA 3IA7A 4UFOA 3D6VA 1AN0A 5KOJA 1OH7A 2GK6A 2P27A 5DGIA 4G0YA 1X9HA 1TGYA 3P2KA 4EB6A 2GM3A 1NBIA 4JEIA 4LE1A 2XB9A 3HPQA 1FPMA 2BFFA 4QTZA 2PR7A 2XR1A 2X3YA 2IEIA 4MMZB 2C2GA 1ZSNA 3K1TA 1WZCA 4MW2A 3U4GA 4DWVA 4LNUB 4MGKR 3IP5A 1WL8A 1CYDA 4EAQA 3THYB 2Q4OA 2ZYRA 5M29A 2SECE 1HNNA 4CEIB 3JPWA 1CG6A 2Q2QA 3CVYA 3SY8A 3IAXA 5F78A 2O57A 2B4QA 3UIEA 5A5DA 4E6EA 3CMCO 2IU6A 5FCDA 3DR5A 3F1LA 5A6VA 3NBUA 4NBTA 3IVGA 2O3UA 1W6UA 2NO4A 4QUHA 2B94A 5SY4A 2CDRA 1C9NA 4C0LA 3N0VA 1TT7A 3HA2A 4IV0A 3JD2A 2Q1WA 3KQNA 3PFNA 1IXRC 1T43A 3OTGA 4M8IA 4PPNA 1ZJ5A 1WPRA 1FF9A 3ESBA 4GOMD 1H0HA 1UXKA 4U4AA 2OHJA 4AJ2A 4EA8A 4IF6A 1DU4A 2FSGA 3NHWA 5I9TA 2YFQA 5TJ9A 4F3YA 3DULA 3TMYA 4AP9A 1LQTA 4MGYR 1FLDA 5D3QA 1GT6A 5JCJD 4OBXA 4KTVE 1IJBA 2VDKB 4N6OA 5IF9A 4OOEA 1G60A 1WPXA 2O2ZA 1BXZA 4YECA 5CA1A 2RD2A 3G9ZA 3CF2A 1I01A 2O8BA 5HK9A 3ITKA 1YOVB 3V3KA 1SR8A 3GMSA 3H4IA 1JNYA 4YJ2B 4KYTA 5ALUA 5K3AA 1WNTA 4D4KA 3OU6A 5F5LA 2J7PD 1N7IA 3D6UA 1KYZA 2VJBA 3QA3E 5JSQA 3A04A 3MUEA 3K0AA 1RYYA 4MUKA 2O19A 1NOJA 1FYWA 3M6FA 1BGXT 3VZDA 4UVDA 1Z6GA 1P62B 1SZJG 2PNJA 1C0IA 2WAXA 3Q3HA 5CFPA 1OXUA 1L6IA 4M1KA 3ENKA 3AYZB 3BWDD 4PAWA 1EXWA 3FRHA 3R76A 4AO8A 3SYNA 4B3HA 5LMNB 3FRIA 3WWCA 1Z25A 2Z98A 1ODKA 5BN5B 1IN5A 2BBWA 3V7NA 2YHAA 3NUQA 2J5BA 3AHJA 1U0FA 4W1SA 4X84A 3A1NA 5T8KA 3WRWA 1Y9EA 4E70A 3Q9UA 4B74A 4XASA 3Q8XB 1ZIOA 1B15A 1Z4JA 1VYTA 2IODA 3TB6A 1E0AA 2VHJA 3WRYC 3EWSA 4RE6A 3AL3A 3K4HA 5FXMA 1GSHA 1JNXX 2IZ7A 1K7FB 1BXRA 3WLAA 2EXXA 3THRA 1GL9B 2Y0DA 1WEKA 3K0KA 1RVDA 3FLBA 4GR4A 4JEMA 2BHSA 3DNFA 4XJSA 5D1HA 4RTLA 4CIYA 2TMGA 5IYZA 3T3NA 3L8DA 4U02A 3OQHA 4JX9A 2V0CA 4K46A 4BMSA 1NC3A 3K9TA 2G1JA 2ZYDA 3AWIA 4UHEA 2JFUA 1IG0A 2CB0A 3FZQA 4YTEA 1W5BA 4A73A 2WSSA 1X7WB 3C3PA 2Z2JA 3OURA 5JLJA 5BV7A 4PZPA 5DCWA 2QNBA 1KS2A 2GVNA 2XEXA 3BH6A 1U8ZA 1KO7A 3T7SA 4BWGA 2EZAA 1Y4AE 2ZXEA 4XOUA 4PEVA 5REQA 4V1CI 3NBQA 3VH2A 3U16A 3B9PA 2X1MA 3EFOB 5B30A 5IEJA 1BU5A 3LKBA 3HCNA 2FCRA 4MV0A 3A6LA 3HRHA 1OFUA 2I2BA 4G9GA 3E5MA 3RJTA 2GLXA 4MV6A 4MVWA 3WLTA 3E4DA 2AZ4A 3A4NA 4KP7A 4N9WA 3OE7D 4BVLA 3NIDB 2XXAA 3FZGA 2NV0A 5CB4F 4D8TA 3TLJA 4YHBA 3LCRA 2DETA 3P19A 4BKMA 1FFEA 1NX9A 3NDPA 4X20B 3BRQA 2F3QA 2N46A 5L3SB 3O2QB 3K31A 2ZJOA 4QPCA 3BCRA 3TK1A 1PNQA 3AR4A 4M1SA 5U4QA 1Y1KE 3HJBA 1LI4A 4F5DA 4TZKA 2BHLA 1XEFA 1KEUA 3DHEA 3A1TA 3IERA 3ONFA 3OCWA 4GC5A 2HROA 5IR2A 2WG0A 1E7WA 3DNMA 1W30A 2ATVA 3A28A 1MBZA 4HLQB 4ID3A 3RK0A 3LGSA 4IKOA 3WK6A 4B80A 1K4MA 4MWOA 1X7HA 1NVKA 2RHLA 3PC7A 4PR0A 3RAJA 3RYTC 2VK1A 4I3FA 5JY6A 3ZJTA 2VUIB 1VB3A 2Q29A 4RHCA 1GKKA 4RMNA 3R6WA 4F2HA 1P77A 4FX5A 2BC9A 5JS7A 2WU3A 3OCZA 1RRVA 2B83A 3I8XA 1LDGA 5LUBA 4U2EA 5I9BA 1KO1A 4WL0A 4G23A 4D9EA 3KZCA 3UWOA 4O4JF 1DG9A 1NI5A 4B46A 5L53A 1FTNA 4F8YA 1IIRA 4NCXA 3X1DA 1SXJA 2BR3A 2X5KO 4AZ3A 4DM7A 4P31A 4TMVA 2ZR7A 2ZBRA 2VXBA 2ZCJA 2VJMB 5JO0A 5D5QA 2ZIFA 3GLRA 3ZWCA 1YK1A 2QS9A 4PX9A 2DPXA 2A6PA 3G5UA 3FETA 4FNMA 3JWGA 4BV8A 2W2MA 2R68A 3C3JA 4OQFA