2C5QA

Crystal structure of yeast yer010cp
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
232
structure length
231
Chain Sequence
SDLQKLQRFSTCDISDGLLNVYNIPTGGYFPNLTAISPPQNSSIVGTAYTVLFAPIDDPRPAVNYIDSVPPNSILVLALEPHLQSQFHPFIKITQAMYGGLMSTRAQYLKSNGTVVFGRIRDVDEHRTLNHPVFAYGVGSCAPKAVVKAVGTNVQLKILTSDGVTQTIPGDYIAGDNNGIVRIPVQETDISKLVTYIEKSIEVDLLVSEDIKNGIPAKQAQNDRRSVLKKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics,unknown function
molecule keywords RRAA-LIKE PROTEIN YER010C
publication title Crystal Structure of Yeast Yer010Cp, a Knotable Member of the Rraa Protein Family.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 74
structure length 231
sequence length 232
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.1.1.112: Oxaloacetate decarboxylase.
pdb deposition date 2005-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03737 RraA-like Aldolase/RraA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.100 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2c5qA00
2C5QA 5IR2A
chains in the Genus database with same CATH superfamily
3TLCA 3TYXA 3VTAA 2GP4A 1VI4A 4NGRA 4JYWA 4P45A 4OC2A 1CE8B 1ZL0A 5ELYA 3T0TA 2OLSA 1EZAA 4P4EA 3C8OA 5F9MA 2E28A 3SJXA 4OC5A 3S9NA 4C8PA 1C30B 4INJA 4MCQA 2XEGA 4KNGE 3ICUA 3TLGB 3FECA 3D7FA 1R61A 3EZEA 2EZBA 3T05A 1ZRSA 3TLYA 2B0AA 4OC1A 4TJVA 2HWGA 1C3OB 4CDJA 3IWWA 3SR3A 5D29A 4C9RA 1CS0B 3KRVA 4NGQA 4JVOA 3I74A 4EYSA 2OR4A 4C84A 4TWEA 3KASA 4C9EA 3FEDA 1VBGA 2MP0A 3S9LA 4OMEA 4W9YA 1NBWA 3TLZA 4C99A 4C85A 3FF3A 5IR2A 4E5SA 2PVVA 4P44A 2D0PA 5F5XA 3K4IA 4P4IA 4OC4A 4NGTA 3SJFA 4IIXA 2R82A 4MI1A 4MCPA 4P4BA 4X3RA 1CX8A 1Z8LA 4C9VA 1BXRB 4IIYA 1A9XB 3D7DA 3SJEA 1DE4C 2FM4A 2C6PA 2XEFA 3D7HA 4C9UA 2EK9A 1ZYMA 2YJTA 3S9MA 3SJGA 1M6VB 3T07A 2CIJA 5K99A 1V6CA 1JDBC 2C6GA 4NGSA 3K9TA 4H1HA 4COBA 2EZAA 4C8UA 4COGA 4P4FA 4TJXA 3TLBA 3D7GA 4MCSA 4CZ1A 1KEEB 3T5MA 3TLGA 1KBLA 4C9AA 5JVLA 3G23A 2XEJA 2X0SA 2PCNA 1Y9ZA 4C8CA 1J3LA 3BHXA 2PVWA 3EZAA 3I6SA 4C8AA 4MJXA 5F1YA 1VBHA 2EK8A 3BXMA 5JYBA 1T36B 4CO9A 4J0NA 2HROA 2AUMA 4LQGA 4JZ0A 2JBJA 4M8DA 2D0OA 2OOTA 4YN3A 4C8TA 3EZBA 1EZBA 1Q5XA 1XF1A 4MCRA 2HI6A 1GGOA 2YJVA 3BI1A 1DIKA 4P4JA 1WVMA 4OC3A 1NXJA 2EZCA 4C8FA 4E94A 2XEIA 5IB9A 2DIKA 3NOJA 4NGNA 2AUNA 3U1BA 1KC7A 3TLAA 4P4DA 3BI0A 5FD8A 4CDKA 4OC0A 3IIBA 3GJZA 3EIFA 2C6CA 4NGMA 3FEEA 2JBKA 3RBUA 2C5QA 4NGPA 4C86A 3TLEA 1JDEA 5F09A
chains in the Genus database with same CATH topology
3VTAA 2GP4A 4NGRA 4JYWA 4P45A 4OC2A 5ELYA 4P4EA 3SJXA 4OC5A 3S9NA 4C8PA 4MCQA 2XEGA 4KNGE 3ICUA 3FECA 3D7FA 4OC1A 4TJVA 4CDJA 3IWWA 5D29A 4C9RA 4NGQA 3I74A 2OR4A 4C84A 4TWEA 3KASA 4C9EA 3FEDA 3S9LA 4OMEA 4W9YA 4C99A 4C85A 3FF3A 5IR2A 2PVVA 4P44A 4P4IA 4OC4A 4NGTA 3SJFA 4P4BA 4MCPA 4X3RA 1CX8A 1Z8LA 4C9VA 3D7DA 3SJEA 1DE4C 2C6PA 2XEFA 3D7HA 4C9UA 2EK9A 3S9MA 3SJGA 2CIJA 1V6CA 2C6GA 4NGSA 3K9TA 4C8UA 4P4FA 4TJXA 3D7GA 4MCSA 4C9AA 2XEJA 1Y9ZA 4C8CA 3BHXA 3I6SA 2PVWA 4C8AA 2EK8A 3BXMA 4LQGA 4JZ0A 2JBJA 2OOTA 4YN3A 4C8TA 1XF1A 4MCRA 4P4JA 3BI1A 1WVMA 4OC3A 4C8FA 2XEIA 5IB9A 4NGNA 4P4DA 3BI0A 4CDKA 4OC0A 3IIBA 3EIFA 2C6CA 4NGMA 3FEEA 2JBKA 3RBUA 2C5QA 4NGPA 4C86A 5F09A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C5Q A;  5IR2 A; 
#chains in the Genus database with same CATH topology
 3TLC A;  3TYX A;  3VTA A;  2GP4 A;  1VI4 A;  4NGR A;  4JYW A;  4P45 A;  4OC2 A;  1CE8 B;  1ZL0 A;  5ELY A;  3T0T A;  2OLS A;  1EZA A;  4P4E A;  3C8O A;  5F9M A;  2E28 A;  3SJX A;  4OC5 A;  3S9N A;  4C8P A;  1C30 B;  4INJ A;  4MCQ A;  2XEG A;  4KNG E;  3ICU A;  3TLG B;  3FEC A;  3D7F A;  1R61 A;  3EZE A;  2EZB A;  3T05 A;  1ZRS A;  3TLY A;  2B0A A;  4OC1 A;  4TJV A;  2HWG A;  1C3O B;  4CDJ A;  3IWW A;  3SR3 A;  5D29 A;  4C9R A;  1CS0 B;  3KRV A;  4NGQ A;  4JVO A;  3I74 A;  4EYS A;  2OR4 A;  4C84 A;  4TWE A;  3KAS A;  4C9E A;  3FED A;  1VBG A;  2MP0 A;  3S9L A;  4OME A;  4W9Y A;  1NBW A;  3TLZ A;  4C99 A;  4C85 A;  3FF3 A;  5IR2 A;  4E5S A;  2PVV A;  4P44 A;  2D0P A;  5F5X A;  3K4I A;  4P4I A;  4OC4 A;  4NGT A;  3SJF A;  4IIX A;  2R82 A;  4MI1 A;  4MCP A;  4P4B A;  4X3R A;  1CX8 A;  1Z8L A;  4C9V A;  1BXR B;  4IIY A;  1A9X B;  3D7D A;  3SJE A;  1DE4 C;  2FM4 A;  2C6P A;  2XEF A;  3D7H A;  4C9U A;  2EK9 A;  1ZYM A;  2YJT A;  3S9M A;  3SJG A;  1M6V B;  3T07 A;  2CIJ A;  5K99 A;  1V6C A;  1JDB C;  2C6G A;  4NGS A;  3K9T A;  4H1H A;  4COB A;  2EZA A;  4C8U A;  4COG A;  4P4F A;  4TJX A;  3TLB A;  3D7G A;  4MCS A;  4CZ1 A;  1KEE B;  3T5M A;  3TLG A;  1KBL A;  4C9A A;  5JVL A;  3G23 A;  2XEJ A;  2X0S A;  2PCN A;  1Y9Z A;  4C8C A;  1J3L A;  3BHX A;  2PVW A;  3EZA A;  3I6S A;  4C8A A;  4MJX A;  5F1Y A;  1VBH A;  2EK8 A;  3BXM A;  5JYB A;  1T36 B;  4CO9 A;  4J0N A;  2HRO A;  2AUM A;  4LQG A;  4JZ0 A;  2JBJ A;  4M8D A;  2D0O A;  2OOT A;  4YN3 A;  4C8T A;  3EZB A;  1EZB A;  1Q5X A;  1XF1 A;  4MCR A;  2HI6 A;  1GGO A;  2YJV A;  3BI1 A;  1DIK A;  4P4J A;  1WVM A;  4OC3 A;  1NXJ A;  2EZC A;  4C8F A;  4E94 A;  2XEI A;  5IB9 A;  2DIK A;  3NOJ A;  4NGN A;  2AUN A;  3U1B A;  1KC7 A;  3TLA A;  4P4D A;  3BI0 A;  5FD8 A;  4CDK A;  4OC0 A;  3IIB A;  3GJZ A;  3EIF A;  2C6C A;  4NGM A;  3FEE A;  2JBK A;  3RBU A;  2C5Q A;  4NGP A;  4C86 A;  3TLE A;  1JDE A;  5F09 A; 
#chains in the Genus database with same CATH homology
 3VTA A;  2GP4 A;  4NGR A;  4JYW A;  4P45 A;  4OC2 A;  5ELY A;  4P4E A;  3SJX A;  4OC5 A;  3S9N A;  4C8P A;  4MCQ A;  2XEG A;  4KNG E;  3ICU A;  3FEC A;  3D7F A;  4OC1 A;  4TJV A;  4CDJ A;  3IWW A;  5D29 A;  4C9R A;  4NGQ A;  3I74 A;  2OR4 A;  4C84 A;  4TWE A;  3KAS A;  4C9E A;  3FED A;  3S9L A;  4OME A;  4W9Y A;  4C99 A;  4C85 A;  3FF3 A;  5IR2 A;  2PVV A;  4P44 A;  4P4I A;  4OC4 A;  4NGT A;  3SJF A;  4P4B A;  4MCP A;  4X3R A;  1CX8 A;  1Z8L A;  4C9V A;  3D7D A;  3SJE A;  1DE4 C;  2C6P A;  2XEF A;  3D7H A;  4C9U A;  2EK9 A;  3S9M A;  3SJG A;  2CIJ A;  1V6C A;  2C6G A;  4NGS A;  3K9T A;  4C8U A;  4P4F A;  4TJX A;  3D7G A;  4MCS A;  4C9A A;  2XEJ A;  1Y9Z A;  4C8C A;  3BHX A;  3I6S A;  2PVW A;  4C8A A;  2EK8 A;  3BXM A;  4LQG A;  4JZ0 A;  2JBJ A;  2OOT A;  4YN3 A;  4C8T A;  1XF1 A;  4MCR A;  4P4J A;  3BI1 A;  1WVM A;  4OC3 A;  4C8F A;  2XEI A;  5IB9 A;  4NGN A;  4P4D A;  3BI0 A;  4CDK A;  4OC0 A;  3IIB A;  3EIF A;  2C6C A;  4NGM A;  3FEE A;  2JBK A;  3RBU A;  2C5Q A;  4NGP A;  4C86 A;  5F09 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...