2C5QA

Crystal structure of yeast yer010cp
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
232
structure length
231
Chain Sequence
SDLQKLQRFSTCDISDGLLNVYNIPTGGYFPNLTAISPPQNSSIVGTAYTVLFAPIDDPRPAVNYIDSVPPNSILVLALEPHLQSQFHPFIKITQAMYGGLMSTRAQYLKSNGTVVFGRIRDVDEHRTLNHPVFAYGVGSCAPKAVVKAVGTNVQLKILTSDGVTQTIPGDYIAGDNNGIVRIPVQETDISKLVTYIEKSIEVDLLVSEDIKNGIPAKQAQNDRRSVLKKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Yeast Yer010Cp, a Knotable Member of the Rraa Protein Family.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural genomics,unknown function
molecule keywords RRAA-LIKE PROTEIN YER010C
total genus 74
structure length 231
sequence length 232
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.1.1.112: Oxaloacetate decarboxylase.
pdb deposition date 2005-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03737 RraA-like Aldolase/RraA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.100 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2c5qA00
2C5QA 5IR2A
chains in the Genus database with same CATH superfamily
4MCPA 3K4IA 4LQGA 4C9UA 3T07A 3D7HA 4OC4A 2OOTA 4C99A 3EZAA 3T05A 3EZEA 2XEJA 3IIBA 3SJGA 1Q5XA 3BXMA 3ICUA 2EZAA 4NGMA 4H1HA 4P44A 3SR3A 3TLGB 3SJEA 4M8DA 2XEFA 3S9MA 5IR2A 2X0SA 4OC2A 4C8UA 4TJXA 2YJTA 4INJA 2JBJA 3TLAA 4JVOA 4OC5A 3TLEA 4C86A 5F09A 4MI1A 5D29A 1WVMA 4P4IA 4CDKA 4P4JA 3C8OA 2GP4A 2XEGA 2AUMA 3FECA 2R82A 2OR4A 1JDBC 2CIJA 4YN3A 2B0AA 4J0NA 2E28A 1Y9ZA 4C8FA 2PCNA 4IIYA 3T5MA 1BXRB 3D7GA 1VBGA 2FM4A 3K9TA 4C8CA 1XF1A 2MP0A 2EZBA 4C9AA 4OC1A 4NGNA 2PVWA 4MJXA 1J3LA 4W9YA 4C8AA 5K99A 2YJVA 4MCRA 3BI1A 2HWGA 4P4EA 1NXJA 4P4BA 4P45A 4NGTA 3IWWA 4C9EA 4IIXA 1KEEB 5F9MA 3D7FA 3KRVA 4NGQA 2D0OA 1KBLA 3S9LA 2HI6A 5JVLA 3TLZA 4OMEA 4P4FA 5F5XA 3RBUA 4CO9A 1NBWA 3SJXA 1DIKA 5IB9A 2OLSA 1CE8B 4NGRA 4CDJA 1VBHA 2EZCA 4COGA 1CX8A 1C30B 4E5SA 2EK8A 2JBKA 1M6VB 2C6GA 3BHXA 3KASA 2HROA 1ZRSA 3FEEA 3TLBA 4C9RA 2PVVA 1R61A 1A9XB 3D7DA 1Z8LA 3GJZA 3I74A 4MCQA 4TWEA 4OC0A 4C8PA 1GGOA 4KNGE 5JYBA 4MCSA 4EYSA 1ZL0A 1EZBA 5ELYA 5FD8A 1VI4A 4CZ1A 2C5QA 3EIFA 4JYWA 4NGSA 1KC7A 2XEIA 3G23A 2AUNA 3I6SA 5F1YA 3VTAA 3U1BA 4COBA 2D0PA 4NGPA 1V6CA 1DE4C 2C6CA 3TLGA 3EZBA 4OC3A 4P4DA 1JDEA 3S9NA 1C3OB 3FF3A 4TJVA 4C8TA 3NOJA 1T36B 1CS0B 4C85A 1ZYMA 2EK9A 4X3RA 3SJFA 4E94A 2C6PA 3TLYA 4C84A 3FEDA 4JZ0A 3TLCA 3BI0A 3TYXA 2DIKA 3T0TA 1EZAA 4C9VA
chains in the Genus database with same CATH topology
4MCPA 4LQGA 4C9UA 4C99A 3D7HA 4OC4A 2OOTA 2XEJA 3IIBA 3SJGA 3BXMA 3ICUA 4P44A 4NGMA 3SJEA 2XEFA 3S9MA 5IR2A 4OC2A 4C8UA 4TJXA 2JBJA 4OC5A 4C86A 5F09A 5D29A 1WVMA 4P4IA 4CDKA 4P4JA 2GP4A 2XEGA 3FECA 2OR4A 2CIJA 4YN3A 1Y9ZA 4C8FA 3D7GA 3K9TA 4C8CA 1XF1A 4C9AA 4OC1A 4NGNA 2PVWA 4W9YA 4C8AA 4MCRA 3BI1A 4P4EA 4P4BA 4P45A 4NGTA 3IWWA 4C9EA 3D7FA 4NGQA 3S9LA 4OMEA 4P4FA 3RBUA 3SJXA 5IB9A 4NGRA 4CDJA 1CX8A 2EK8A 2JBKA 2C6GA 3BHXA 3KASA 3FEEA 4C9RA 2PVVA 3D7DA 4C8PA 1Z8LA 3I74A 4MCQA 4TWEA 4OC0A 4KNGE 4MCSA 5ELYA 2C5QA 3EIFA 4JYWA 4NGSA 2XEIA 3I6SA 3VTAA 4NGPA 1V6CA 1DE4C 2C6CA 4OC3A 4P4DA 3S9NA 3FF3A 4TJVA 4C8TA 4C85A 2EK9A 4X3RA 3SJFA 2C6PA 4C84A 3FEDA 4JZ0A 3BI0A 4C9VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C5Q A;  5IR2 A; 
#chains in the Genus database with same CATH topology
 4MCP A;  3K4I A;  4LQG A;  4C9U A;  3T07 A;  3D7H A;  4OC4 A;  2OOT A;  4C99 A;  3EZA A;  3T05 A;  3EZE A;  2XEJ A;  3IIB A;  3SJG A;  1Q5X A;  3BXM A;  3ICU A;  2EZA A;  4NGM A;  4H1H A;  4P44 A;  3SR3 A;  3TLG B;  3SJE A;  4M8D A;  2XEF A;  3S9M A;  5IR2 A;  2X0S A;  4OC2 A;  4C8U A;  4TJX A;  2YJT A;  4INJ A;  2JBJ A;  3TLA A;  4JVO A;  4OC5 A;  3TLE A;  4C86 A;  5F09 A;  4MI1 A;  5D29 A;  1WVM A;  4P4I A;  4CDK A;  4P4J A;  3C8O A;  2GP4 A;  2XEG A;  2AUM A;  3FEC A;  2R82 A;  2OR4 A;  1JDB C;  2CIJ A;  4YN3 A;  2B0A A;  4J0N A;  2E28 A;  1Y9Z A;  4C8F A;  2PCN A;  4IIY A;  3T5M A;  1BXR B;  3D7G A;  1VBG A;  2FM4 A;  3K9T A;  4C8C A;  1XF1 A;  2MP0 A;  2EZB A;  4C9A A;  4OC1 A;  4NGN A;  2PVW A;  4MJX A;  1J3L A;  4W9Y A;  4C8A A;  5K99 A;  2YJV A;  4MCR A;  3BI1 A;  2HWG A;  4P4E A;  1NXJ A;  4P4B A;  4P45 A;  4NGT A;  3IWW A;  4C9E A;  4IIX A;  1KEE B;  5F9M A;  3D7F A;  3KRV A;  4NGQ A;  2D0O A;  1KBL A;  3S9L A;  2HI6 A;  5JVL A;  3TLZ A;  4OME A;  4P4F A;  5F5X A;  3RBU A;  4CO9 A;  1NBW A;  3SJX A;  1DIK A;  5IB9 A;  2OLS A;  1CE8 B;  4NGR A;  4CDJ A;  1VBH A;  2EZC A;  4COG A;  1CX8 A;  1C30 B;  4E5S A;  2EK8 A;  2JBK A;  1M6V B;  2C6G A;  3BHX A;  3KAS A;  2HRO A;  1ZRS A;  3FEE A;  3TLB A;  4C9R A;  2PVV A;  1R61 A;  1A9X B;  3D7D A;  1Z8L A;  3GJZ A;  3I74 A;  4MCQ A;  4TWE A;  4OC0 A;  4C8P A;  1GGO A;  4KNG E;  5JYB A;  4MCS A;  4EYS A;  1ZL0 A;  1EZB A;  5ELY A;  5FD8 A;  1VI4 A;  4CZ1 A;  2C5Q A;  3EIF A;  4JYW A;  4NGS A;  1KC7 A;  2XEI A;  3G23 A;  2AUN A;  3I6S A;  5F1Y A;  3VTA A;  3U1B A;  4COB A;  2D0P A;  4NGP A;  1V6C A;  1DE4 C;  2C6C A;  3TLG A;  3EZB A;  4OC3 A;  4P4D A;  1JDE A;  3S9N A;  1C3O B;  3FF3 A;  4TJV A;  4C8T A;  3NOJ A;  1T36 B;  1CS0 B;  4C85 A;  1ZYM A;  2EK9 A;  4X3R A;  3SJF A;  4E94 A;  2C6P A;  3TLY A;  4C84 A;  3FED A;  4JZ0 A;  3TLC A;  3BI0 A;  3TYX A;  2DIK A;  3T0T A;  1EZA A;  4C9V A; 
#chains in the Genus database with same CATH homology
 4MCP A;  4LQG A;  4C9U A;  4C99 A;  3D7H A;  4OC4 A;  2OOT A;  2XEJ A;  3IIB A;  3SJG A;  3BXM A;  3ICU A;  4P44 A;  4NGM A;  3SJE A;  2XEF A;  3S9M A;  5IR2 A;  4OC2 A;  4C8U A;  4TJX A;  2JBJ A;  4OC5 A;  4C86 A;  5F09 A;  5D29 A;  1WVM A;  4P4I A;  4CDK A;  4P4J A;  2GP4 A;  2XEG A;  3FEC A;  2OR4 A;  2CIJ A;  4YN3 A;  1Y9Z A;  4C8F A;  3D7G A;  3K9T A;  4C8C A;  1XF1 A;  4C9A A;  4OC1 A;  4NGN A;  2PVW A;  4W9Y A;  4C8A A;  4MCR A;  3BI1 A;  4P4E A;  4P4B A;  4P45 A;  4NGT A;  3IWW A;  4C9E A;  3D7F A;  4NGQ A;  3S9L A;  4OME A;  4P4F A;  3RBU A;  3SJX A;  5IB9 A;  4NGR A;  4CDJ A;  1CX8 A;  2EK8 A;  2JBK A;  2C6G A;  3BHX A;  3KAS A;  3FEE A;  4C9R A;  2PVV A;  3D7D A;  4C8P A;  1Z8L A;  3I74 A;  4MCQ A;  4TWE A;  4OC0 A;  4KNG E;  4MCS A;  5ELY A;  2C5Q A;  3EIF A;  4JYW A;  4NGS A;  2XEI A;  3I6S A;  3VTA A;  4NGP A;  1V6C A;  1DE4 C;  2C6C A;  4OC3 A;  4P4D A;  3S9N A;  3FF3 A;  4TJV A;  4C8T A;  4C85 A;  2EK9 A;  4X3R A;  3SJF A;  2C6P A;  4C84 A;  3FED A;  4JZ0 A;  3BI0 A;  4C9V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...