2C5QA

Crystal structure of yeast yer010cp
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
232
structure length
231
Chain Sequence
SDLQKLQRFSTCDISDGLLNVYNIPTGGYFPNLTAISPPQNSSIVGTAYTVLFAPIDDPRPAVNYIDSVPPNSILVLALEPHLQSQFHPFIKITQAMYGGLMSTRAQYLKSNGTVVFGRIRDVDEHRTLNHPVFAYGVGSCAPKAVVKAVGTNVQLKILTSDGVTQTIPGDYIAGDNNGIVRIPVQETDISKLVTYIEKSIEVDLLVSEDIKNGIPAKQAQNDRRSVLKKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RRAA-LIKE PROTEIN YER010C
publication title Crystal Structure of Yeast Yer010Cp, a Knotable Member of the Rraa Protein Family.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural genomics,unknown function
total genus 74
structure length 231
sequence length 232
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.1.1.112: Oxaloacetate decarboxylase.
pdb deposition date 2005-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03737 RraA-like Aldolase/RraA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.100 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2c5qA00
5IR2A 2C5QA
chains in the Genus database with same CATH superfamily
4OC3A 3EZBA 4C9VA 2FM4A 4NGQA 2HROA 4IIXA 4OC2A 3SR3A 1DE4C 1V6CA 2XEFA 4KNGE 4NGTA 3IIBA 3S9NA 1VBHA 4NGNA 2YJVA 4P4BA 1T36B 4MCSA 2C6PA 3D7GA 1VI4A 1C3OB 3BI1A 4C8CA 4JZ0A 3T5MA 2EK8A 2EZAA 5JYBA 4INJA 5F5XA 3D7HA 2C6GA 3SJXA 1Y9ZA 2PVWA 3EZEA 1CX8A 4COGA 1ZYMA 2HI6A 3K4IA 4P4FA 1C30B 1DIKA 1CS0B 4JYWA 4OC0A 1J3LA 4C9UA 4OC5A 5FD8A 2B0AA 3TLZA 3IWWA 2JBKA 1ZRSA 4C85A 3NOJA 1KEEB 2XEGA 2R82A 4NGPA 4M8DA 3EZAA 4LQGA 3BI0A 5F1YA 3I6SA 3SJGA 4OC1A 4EYSA 4C99A 2PCNA 3D7DA 2JBJA 4E94A 3C8OA 3TLYA 3TLEA 4C9EA 4CDKA 3SJEA 4TJXA 3EIFA 1WVMA 4NGSA 4P4IA 2MP0A 4X3RA 2XEJA 4P44A 1EZAA 1Q5XA 4OC4A 1XF1A 5IR2A 5D29A 1EZBA 3S9LA 3T05A 4P4EA 2OLSA 3TLGA 1KBLA 4C84A 2EZBA 2AUMA 4NGRA 3GJZA 4W9YA 2AUNA 4CO9A 1VBGA 2YJTA 4C9RA 3I74A 5F09A 3BXMA 4C8UA 4TJVA 2X0SA 5JVLA 3FEDA 4H1HA 3D7FA 1NBWA 4E5SA 3FEEA 2E28A 4MCPA 1R61A 3SJFA 3VTAA 1JDBC 1M6VB 2D0PA 2D0OA 3RBUA 4TWEA 4C8TA 2GP4A 2C5QA 2DIKA 2XEIA 3T07A 3TYXA 1KC7A 2PVVA 3FECA 3K9TA 2HWGA 2OR4A 4OMEA 5ELYA 4C8FA 2EZCA 4JVOA 5IB9A 1NXJA 5F9MA 1BXRB 2OOTA 3TLAA 4MJXA 4MCQA 3BHXA 1ZL0A 4P45A 3FF3A 1GGOA 4YN3A 4C8PA 3TLCA 3T0TA 5K99A 1CE8B 3TLGB 2C6CA 4COBA 3S9MA 4NGMA 4IIYA 4J0NA 4CZ1A 2EK9A 1A9XB 1Z8LA 3TLBA 2CIJA 3G23A 1JDEA 4C8AA 4MCRA 3ICUA 4MI1A 3U1BA 4P4JA 4C9AA 4CDJA 3KRVA 4C86A 3KASA 4P4DA
chains in the Genus database with same CATH topology
4OC3A 4C9VA 4NGQA 4OC2A 1DE4C 1V6CA 2XEFA 4KNGE 4NGTA 3IIBA 3S9NA 4NGNA 4P4BA 4MCSA 2C6PA 3D7GA 3BI1A 4C8CA 4JZ0A 2EK8A 3D7HA 2C6GA 3SJXA 1Y9ZA 2PVWA 1CX8A 4P4FA 4JYWA 4OC0A 4C9UA 4OC5A 3IWWA 2JBKA 4C85A 2XEGA 4NGPA 4LQGA 3BI0A 3SJGA 3I6SA 4OC1A 4C99A 3D7DA 2JBJA 4C9EA 4CDKA 3SJEA 4TJXA 3EIFA 1WVMA 4NGSA 4P4IA 4X3RA 2XEJA 4P44A 4OC4A 5IR2A 1XF1A 5D29A 3S9LA 4P4EA 4C84A 4NGRA 4W9YA 4C9RA 3I74A 5F09A 3BXMA 4C8UA 4TJVA 3FEDA 3D7FA 3FEEA 4MCPA 3SJFA 3VTAA 3RBUA 4TWEA 4C8TA 2GP4A 2C5QA 2XEIA 2PVVA 3FECA 3K9TA 2OR4A 4OMEA 4C8FA 5ELYA 5IB9A 2OOTA 4MCQA 3BHXA 4P45A 3FF3A 4YN3A 4C8PA 2C6CA 3S9MA 4NGMA 2EK9A 1Z8LA 2CIJA 4C8AA 4MCRA 3ICUA 4P4JA 4C9AA 4CDJA 4C86A 3KASA 4P4DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IR2 A;  2C5Q A; 
#chains in the Genus database with same CATH topology
 4OC3 A;  3EZB A;  4C9V A;  2FM4 A;  4NGQ A;  2HRO A;  4IIX A;  4OC2 A;  3SR3 A;  1DE4 C;  1V6C A;  2XEF A;  4KNG E;  4NGT A;  3IIB A;  3S9N A;  1VBH A;  4NGN A;  2YJV A;  4P4B A;  1T36 B;  4MCS A;  2C6P A;  3D7G A;  1VI4 A;  1C3O B;  3BI1 A;  4C8C A;  4JZ0 A;  3T5M A;  2EK8 A;  2EZA A;  5JYB A;  4INJ A;  5F5X A;  3D7H A;  2C6G A;  3SJX A;  1Y9Z A;  2PVW A;  3EZE A;  1CX8 A;  4COG A;  1ZYM A;  2HI6 A;  3K4I A;  4P4F A;  1C30 B;  1DIK A;  1CS0 B;  4JYW A;  4OC0 A;  1J3L A;  4C9U A;  4OC5 A;  5FD8 A;  2B0A A;  3TLZ A;  3IWW A;  2JBK A;  1ZRS A;  4C85 A;  3NOJ A;  1KEE B;  2XEG A;  2R82 A;  4NGP A;  4M8D A;  3EZA A;  4LQG A;  3BI0 A;  5F1Y A;  3I6S A;  3SJG A;  4OC1 A;  4EYS A;  4C99 A;  2PCN A;  3D7D A;  2JBJ A;  4E94 A;  3C8O A;  3TLY A;  3TLE A;  4C9E A;  4CDK A;  3SJE A;  4TJX A;  3EIF A;  1WVM A;  4NGS A;  4P4I A;  2MP0 A;  4X3R A;  2XEJ A;  4P44 A;  1EZA A;  1Q5X A;  4OC4 A;  1XF1 A;  5IR2 A;  5D29 A;  1EZB A;  3S9L A;  3T05 A;  4P4E A;  2OLS A;  3TLG A;  1KBL A;  4C84 A;  2EZB A;  2AUM A;  4NGR A;  3GJZ A;  4W9Y A;  2AUN A;  4CO9 A;  1VBG A;  2YJT A;  4C9R A;  3I74 A;  5F09 A;  3BXM A;  4C8U A;  4TJV A;  2X0S A;  5JVL A;  3FED A;  4H1H A;  3D7F A;  1NBW A;  4E5S A;  3FEE A;  2E28 A;  4MCP A;  1R61 A;  3SJF A;  3VTA A;  1JDB C;  1M6V B;  2D0P A;  2D0O A;  3RBU A;  4TWE A;  4C8T A;  2GP4 A;  2C5Q A;  2DIK A;  2XEI A;  3T07 A;  3TYX A;  1KC7 A;  2PVV A;  3FEC A;  3K9T A;  2HWG A;  2OR4 A;  4OME A;  5ELY A;  4C8F A;  2EZC A;  4JVO A;  5IB9 A;  1NXJ A;  5F9M A;  1BXR B;  2OOT A;  3TLA A;  4MJX A;  4MCQ A;  3BHX A;  1ZL0 A;  4P45 A;  3FF3 A;  1GGO A;  4YN3 A;  4C8P A;  3TLC A;  3T0T A;  5K99 A;  1CE8 B;  3TLG B;  2C6C A;  4COB A;  3S9M A;  4NGM A;  4IIY A;  4J0N A;  4CZ1 A;  2EK9 A;  1A9X B;  1Z8L A;  3TLB A;  2CIJ A;  3G23 A;  1JDE A;  4C8A A;  4MCR A;  3ICU A;  4MI1 A;  3U1B A;  4P4J A;  4C9A A;  4CDJ A;  3KRV A;  4C86 A;  3KAS A;  4P4D A; 
#chains in the Genus database with same CATH homology
 4OC3 A;  4C9V A;  4NGQ A;  4OC2 A;  1DE4 C;  1V6C A;  2XEF A;  4KNG E;  4NGT A;  3IIB A;  3S9N A;  4NGN A;  4P4B A;  4MCS A;  2C6P A;  3D7G A;  3BI1 A;  4C8C A;  4JZ0 A;  2EK8 A;  3D7H A;  2C6G A;  3SJX A;  1Y9Z A;  2PVW A;  1CX8 A;  4P4F A;  4JYW A;  4OC0 A;  4C9U A;  4OC5 A;  3IWW A;  2JBK A;  4C85 A;  2XEG A;  4NGP A;  4LQG A;  3BI0 A;  3SJG A;  3I6S A;  4OC1 A;  4C99 A;  3D7D A;  2JBJ A;  4C9E A;  4CDK A;  3SJE A;  4TJX A;  3EIF A;  1WVM A;  4NGS A;  4P4I A;  4X3R A;  2XEJ A;  4P44 A;  4OC4 A;  5IR2 A;  1XF1 A;  5D29 A;  3S9L A;  4P4E A;  4C84 A;  4NGR A;  4W9Y A;  4C9R A;  3I74 A;  5F09 A;  3BXM A;  4C8U A;  4TJV A;  3FED A;  3D7F A;  3FEE A;  4MCP A;  3SJF A;  3VTA A;  3RBU A;  4TWE A;  4C8T A;  2GP4 A;  2C5Q A;  2XEI A;  2PVV A;  3FEC A;  3K9T A;  2OR4 A;  4OME A;  4C8F A;  5ELY A;  5IB9 A;  2OOT A;  4MCQ A;  3BHX A;  4P45 A;  3FF3 A;  4YN3 A;  4C8P A;  2C6C A;  3S9M A;  4NGM A;  2EK9 A;  1Z8L A;  2CIJ A;  4C8A A;  4MCR A;  3ICU A;  4P4J A;  4C9A A;  4CDJ A;  4C86 A;  3KAS A;  4P4D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...