2C5QA

Crystal structure of yeast yer010cp
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
232
structure length
231
Chain Sequence
SDLQKLQRFSTCDISDGLLNVYNIPTGGYFPNLTAISPPQNSSIVGTAYTVLFAPIDDPRPAVNYIDSVPPNSILVLALEPHLQSQFHPFIKITQAMYGGLMSTRAQYLKSNGTVVFGRIRDVDEHRTLNHPVFAYGVGSCAPKAVVKAVGTNVQLKILTSDGVTQTIPGDYIAGDNNGIVRIPVQETDISKLVTYIEKSIEVDLLVSEDIKNGIPAKQAQNDRRSVLKKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RRAA-LIKE PROTEIN YER010C
publication title Crystal Structure of Yeast Yer010Cp, a Knotable Member of the Rraa Protein Family.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural genomics,unknown function
total genus 74
structure length 231
sequence length 232
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.1.1.112: Oxaloacetate decarboxylase.
pdb deposition date 2005-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03737 RraA-like Aldolase/RraA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.100 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2c5qA00
5IR2A 2C5QA
chains in the Genus database with same CATH superfamily
4CDKA 3BHXA 3VTAA 3FEEA 4OC1A 5IR2A 4C86A 4LQGA 3GJZA 3TLZA 2C6GA 2XEIA 4JZ0A 4C8UA 4P4FA 1VBGA 4NGTA 2PCNA 3SJEA 2PVWA 2B0AA 3C8OA 2JBKA 4OC4A 2AUNA 1J3LA 3U1BA 2FM4A 2HWGA 3BI1A 1JDBC 1NXJA 4C8AA 4C9VA 4TJXA 5ELYA 5JYBA 4NGNA 4C9EA 2XEGA 3EZAA 4E94A 4P4IA 4C8FA 5IB9A 1EZBA 3G23A 3SR3A 4NGSA 3NOJA 4YN3A 3S9MA 4C8PA 4MCPA 4C9UA 2C6CA 1KC7A 1ZYMA 1R61A 4IIXA 3KASA 1KBLA 3D7DA 1BXRB 5F5XA 5FD8A 4OC3A 1CS0B 4P4JA 2XEJA 3TLEA 3TLGB 3KRVA 1NBWA 3I6SA 4OMEA 1Y9ZA 4OC0A 5D29A 4EYSA 3BI0A 3BXMA 3TYXA 4TWEA 1GGOA 3T07A 4TJVA 4C99A 2PVVA 1CE8B 4C8CA 5F09A 1C3OB 3EIFA 4MJXA 2MP0A 4MCSA 2CIJA 4MCRA 2E28A 4C85A 4OC2A 4H1HA 4MI1A 4P4EA 2C6PA 2YJTA 3D7HA 4W9YA 3EZEA 4NGPA 1KEEB 4C9AA 4JYWA 1CX8A 1V6CA 4CDJA 1ZRSA 2OR4A 4JVOA 1C30B 2EZAA 3ICUA 4P45A 5JVLA 4MCQA 1WVMA 2X0SA 4CO9A 4E5SA 3T0TA 2EK8A 3FECA 4P4BA 4KNGE 4OC5A 1T36B 2D0PA 2YJVA 3K4IA 1A9XB 4NGMA 5F1YA 3T05A 5K99A 1Z8LA 3SJFA 3EZBA 3T5MA 3TLGA 3IWWA 4COGA 1Q5XA 4INJA 2GP4A 3TLYA 3S9LA 2C5QA 4NGRA 2D0OA 3D7FA 3S9NA 1EZAA 2AUMA 4J0NA 3FF3A 2HROA 4C84A 2OOTA 2R82A 3D7GA 4IIYA 3FEDA 3I74A 1DIKA 5F9MA 4COBA 3TLAA 1ZL0A 4X3RA 4P44A 3TLCA 2XEFA 1JDEA 3TLBA 4M8DA 4NGQA 1DE4C 2OLSA 1M6VB 2EZCA 4P4DA 2EZBA 1VI4A 3SJXA 3IIBA 4C8TA 2JBJA 2HI6A 2DIKA 3RBUA 1VBHA 4CZ1A 4C9RA 1XF1A 2EK9A 3K9TA 3SJGA
chains in the Genus database with same CATH topology
4CDKA 3BHXA 3VTAA 3FEEA 4OC1A 5IR2A 4C86A 4LQGA 2C6GA 2XEIA 4JZ0A 4C8UA 4P4FA 4NGTA 3SJEA 2PVWA 2JBKA 4OC4A 3BI1A 4C8AA 4C9VA 4TJXA 5ELYA 4NGNA 4C9EA 2XEGA 4P4IA 4C8FA 5IB9A 4NGSA 4YN3A 3S9MA 4C8PA 4MCPA 4C9UA 2C6CA 3KASA 3D7DA 4OC3A 4P4JA 2XEJA 3I6SA 4OMEA 1Y9ZA 4OC0A 5D29A 3BI0A 3BXMA 4TWEA 4TJVA 4C99A 2PVVA 4C8CA 5F09A 3EIFA 4MCSA 2CIJA 4MCRA 4C85A 4OC2A 4P4EA 2C6PA 3D7HA 4W9YA 4NGPA 4C9AA 4JYWA 1CX8A 1V6CA 4CDJA 2OR4A 4P45A 3ICUA 4MCQA 1WVMA 2EK8A 3FECA 4P4BA 4KNGE 4OC5A 4NGMA 1Z8LA 3SJFA 3IWWA 2GP4A 3S9LA 2C5QA 4NGRA 3D7FA 3S9NA 3FF3A 4C84A 2OOTA 3D7GA 3FEDA 3I74A 4X3RA 4P44A 2XEFA 4NGQA 1DE4C 4P4DA 3SJXA 3IIBA 4C8TA 2JBJA 3RBUA 4C9RA 1XF1A 2EK9A 3K9TA 3SJGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IR2 A;  2C5Q A; 
#chains in the Genus database with same CATH topology
 4CDK A;  3BHX A;  3VTA A;  3FEE A;  4OC1 A;  5IR2 A;  4C86 A;  4LQG A;  3GJZ A;  3TLZ A;  2C6G A;  2XEI A;  4JZ0 A;  4C8U A;  4P4F A;  1VBG A;  4NGT A;  2PCN A;  3SJE A;  2PVW A;  2B0A A;  3C8O A;  2JBK A;  4OC4 A;  2AUN A;  1J3L A;  3U1B A;  2FM4 A;  2HWG A;  3BI1 A;  1JDB C;  1NXJ A;  4C8A A;  4C9V A;  4TJX A;  5ELY A;  5JYB A;  4NGN A;  4C9E A;  2XEG A;  3EZA A;  4E94 A;  4P4I A;  4C8F A;  5IB9 A;  1EZB A;  3G23 A;  3SR3 A;  4NGS A;  3NOJ A;  4YN3 A;  3S9M A;  4C8P A;  4MCP A;  4C9U A;  2C6C A;  1KC7 A;  1ZYM A;  1R61 A;  4IIX A;  3KAS A;  1KBL A;  3D7D A;  1BXR B;  5F5X A;  5FD8 A;  4OC3 A;  1CS0 B;  4P4J A;  2XEJ A;  3TLE A;  3TLG B;  3KRV A;  1NBW A;  3I6S A;  4OME A;  1Y9Z A;  4OC0 A;  5D29 A;  4EYS A;  3BI0 A;  3BXM A;  3TYX A;  4TWE A;  1GGO A;  3T07 A;  4TJV A;  4C99 A;  2PVV A;  1CE8 B;  4C8C A;  5F09 A;  1C3O B;  3EIF A;  4MJX A;  2MP0 A;  4MCS A;  2CIJ A;  4MCR A;  2E28 A;  4C85 A;  4OC2 A;  4H1H A;  4MI1 A;  4P4E A;  2C6P A;  2YJT A;  3D7H A;  4W9Y A;  3EZE A;  4NGP A;  1KEE B;  4C9A A;  4JYW A;  1CX8 A;  1V6C A;  4CDJ A;  1ZRS A;  2OR4 A;  4JVO A;  1C30 B;  2EZA A;  3ICU A;  4P45 A;  5JVL A;  4MCQ A;  1WVM A;  2X0S A;  4CO9 A;  4E5S A;  3T0T A;  2EK8 A;  3FEC A;  4P4B A;  4KNG E;  4OC5 A;  1T36 B;  2D0P A;  2YJV A;  3K4I A;  1A9X B;  4NGM A;  5F1Y A;  3T05 A;  5K99 A;  1Z8L A;  3SJF A;  3EZB A;  3T5M A;  3TLG A;  3IWW A;  4COG A;  1Q5X A;  4INJ A;  2GP4 A;  3TLY A;  3S9L A;  2C5Q A;  4NGR A;  2D0O A;  3D7F A;  3S9N A;  1EZA A;  2AUM A;  4J0N A;  3FF3 A;  2HRO A;  4C84 A;  2OOT A;  2R82 A;  3D7G A;  4IIY A;  3FED A;  3I74 A;  1DIK A;  5F9M A;  4COB A;  3TLA A;  1ZL0 A;  4X3R A;  4P44 A;  3TLC A;  2XEF A;  1JDE A;  3TLB A;  4M8D A;  4NGQ A;  1DE4 C;  2OLS A;  1M6V B;  2EZC A;  4P4D A;  2EZB A;  1VI4 A;  3SJX A;  3IIB A;  4C8T A;  2JBJ A;  2HI6 A;  2DIK A;  3RBU A;  1VBH A;  4CZ1 A;  4C9R A;  1XF1 A;  2EK9 A;  3K9T A;  3SJG A; 
#chains in the Genus database with same CATH homology
 4CDK A;  3BHX A;  3VTA A;  3FEE A;  4OC1 A;  5IR2 A;  4C86 A;  4LQG A;  2C6G A;  2XEI A;  4JZ0 A;  4C8U A;  4P4F A;  4NGT A;  3SJE A;  2PVW A;  2JBK A;  4OC4 A;  3BI1 A;  4C8A A;  4C9V A;  4TJX A;  5ELY A;  4NGN A;  4C9E A;  2XEG A;  4P4I A;  4C8F A;  5IB9 A;  4NGS A;  4YN3 A;  3S9M A;  4C8P A;  4MCP A;  4C9U A;  2C6C A;  3KAS A;  3D7D A;  4OC3 A;  4P4J A;  2XEJ A;  3I6S A;  4OME A;  1Y9Z A;  4OC0 A;  5D29 A;  3BI0 A;  3BXM A;  4TWE A;  4TJV A;  4C99 A;  2PVV A;  4C8C A;  5F09 A;  3EIF A;  4MCS A;  2CIJ A;  4MCR A;  4C85 A;  4OC2 A;  4P4E A;  2C6P A;  3D7H A;  4W9Y A;  4NGP A;  4C9A A;  4JYW A;  1CX8 A;  1V6C A;  4CDJ A;  2OR4 A;  4P45 A;  3ICU A;  4MCQ A;  1WVM A;  2EK8 A;  3FEC A;  4P4B A;  4KNG E;  4OC5 A;  4NGM A;  1Z8L A;  3SJF A;  3IWW A;  2GP4 A;  3S9L A;  2C5Q A;  4NGR A;  3D7F A;  3S9N A;  3FF3 A;  4C84 A;  2OOT A;  3D7G A;  3FED A;  3I74 A;  4X3R A;  4P44 A;  2XEF A;  4NGQ A;  1DE4 C;  4P4D A;  3SJX A;  3IIB A;  4C8T A;  2JBJ A;  3RBU A;  4C9R A;  1XF1 A;  2EK9 A;  3K9T A;  3SJG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...