2C5QA

Crystal structure of yeast yer010cp
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
232
structure length
231
Chain Sequence
SDLQKLQRFSTCDISDGLLNVYNIPTGGYFPNLTAISPPQNSSIVGTAYTVLFAPIDDPRPAVNYIDSVPPNSILVLALEPHLQSQFHPFIKITQAMYGGLMSTRAQYLKSNGTVVFGRIRDVDEHRTLNHPVFAYGVGSCAPKAVVKAVGTNVQLKILTSDGVTQTIPGDYIAGDNNGIVRIPVQETDISKLVTYIEKSIEVDLLVSEDIKNGIPAKQAQNDRRSVLKKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Yeast Yer010Cp, a Knotable Member of the Rraa Protein Family.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural genomics,unknown function
molecule keywords RRAA-LIKE PROTEIN YER010C
total genus 74
structure length 231
sequence length 232
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.1.1.112: Oxaloacetate decarboxylase.
pdb deposition date 2005-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03737 RraA-like Aldolase/RraA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.100 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2c5qA00
5IR2A 2C5QA
chains in the Genus database with same CATH superfamily
2XEIA 3IIBA 4E94A 5JYBA 3SR3A 1KC7A 2JBJA 2R82A 4NGNA 3KASA 4JZ0A 4M8DA 5F5XA 2E28A 2C6CA 2PVWA 1NBWA 3TLBA 1WVMA 3VTAA 4TJXA 4W9YA 4TWEA 3TLZA 2EK8A 2HI6A 3SJEA 3C8OA 4C85A 4COBA 1V6CA 2AUMA 2XEGA 4INJA 4J0NA 4C86A 3U1BA 4P4FA 4P4IA 5F1YA 1Q5XA 3I6SA 4IIYA 3NOJA 4NGSA 4CDJA 3BXMA 3TLCA 4C9AA 2D0OA 2C6GA 2DIKA 1DE4C 1R61A 2YJTA 4OC0A 1M6VB 4C99A 3D7GA 2XEFA 2MP0A 3SJGA 4C8TA 2GP4A 3D7DA 4C9RA 4NGTA 4NGPA 2YJVA 5F09A 4MI1A 2AUNA 3EZAA 2EZAA 3T05A 1CX8A 1VBHA 5IB9A 1A9XB 1EZBA 4C8UA 3TLGB 2FM4A 3T5MA 2HROA 3FECA 1ZRSA 4CO9A 1KBLA 1CS0B 1VI4A 4OC4A 4OC2A 4P45A 2XEJA 3D7HA 4KNGE 3FEEA 1XF1A 3T07A 2OOTA 4IIXA 4JVOA 4P4JA 3G23A 2EZBA 4LQGA 2EZCA 1KEEB 4CDKA 3T0TA 1CE8B 3BI0A 5F9MA 3TLAA 1C3OB 2PCNA 3K9TA 2C6PA 4P4EA 3KRVA 4C8PA 2B0AA 1BXRB 4OC1A 3EIFA 4P44A 3RBUA 1Y9ZA 3SJFA 4TJVA 3S9LA 1DIKA 1ZL0A 3FF3A 3TLYA 4C9UA 4E5SA 1VBGA 2HWGA 2CIJA 4MJXA 3TLGA 4CZ1A 5ELYA 4MCRA 1JDBC 1C30B 3GJZA 4OC3A 1JDEA 4YN3A 4NGMA 1GGOA 4P4DA 3TYXA 5IR2A 2D0PA 3BHXA 2X0SA 4C8CA 4C9EA 4H1HA 4OMEA 3K4IA 2C5QA 3FEDA 4C8FA 4NGQA 1J3LA 3EZBA 2EK9A 3SJXA 4MCPA 2OLSA 1EZAA 4MCQA 3ICUA 5D29A 3BI1A 4NGRA 3S9NA 2PVVA 3D7FA 4MCSA 1Z8LA 1NXJA 4C84A 4C9VA 2OR4A 4COGA 4OC5A 2JBKA 3I74A 5FD8A 3EZEA 3TLEA 1ZYMA 1T36B 5JVLA 4C8AA 4JYWA 3IWWA 4EYSA 5K99A 3S9MA 4P4BA 4X3RA
chains in the Genus database with same CATH topology
2XEIA 3IIBA 2JBJA 4NGNA 3KASA 4JZ0A 2C6CA 2PVWA 1WVMA 3VTAA 4TJXA 4W9YA 4TWEA 2EK8A 3SJEA 4C85A 1V6CA 2XEGA 4C86A 4P4FA 4P4IA 3I6SA 4NGSA 4CDJA 3BXMA 4C9AA 2C6GA 1DE4C 4OC0A 4C99A 3D7GA 2XEFA 3SJGA 4C8TA 2GP4A 3D7DA 4C9RA 4NGTA 4NGPA 5F09A 1CX8A 5IB9A 4C8UA 3FECA 4OC4A 4OC2A 4P45A 2XEJA 3D7HA 4KNGE 3FEEA 1XF1A 2OOTA 4P4JA 4LQGA 4CDKA 3BI0A 3K9TA 2C6PA 4P4EA 4C8PA 4OC1A 3EIFA 4P44A 3RBUA 1Y9ZA 3SJFA 4TJVA 3S9LA 3FF3A 4C9UA 2CIJA 5ELYA 4MCRA 4OC3A 4YN3A 4NGMA 4P4DA 5IR2A 3BHXA 4C8CA 4C9EA 4OMEA 2C5QA 3FEDA 4C8FA 4NGQA 2EK9A 3SJXA 4MCPA 4MCQA 3ICUA 5D29A 3BI1A 4NGRA 3S9NA 2PVVA 3D7FA 4MCSA 1Z8LA 4C84A 4C9VA 2OR4A 4OC5A 2JBKA 3I74A 4C8AA 4JYWA 3IWWA 3S9MA 4P4BA 4X3RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IR2 A;  2C5Q A; 
#chains in the Genus database with same CATH topology
 2XEI A;  3IIB A;  4E94 A;  5JYB A;  3SR3 A;  1KC7 A;  2JBJ A;  2R82 A;  4NGN A;  3KAS A;  4JZ0 A;  4M8D A;  5F5X A;  2E28 A;  2C6C A;  2PVW A;  1NBW A;  3TLB A;  1WVM A;  3VTA A;  4TJX A;  4W9Y A;  4TWE A;  3TLZ A;  2EK8 A;  2HI6 A;  3SJE A;  3C8O A;  4C85 A;  4COB A;  1V6C A;  2AUM A;  2XEG A;  4INJ A;  4J0N A;  4C86 A;  3U1B A;  4P4F A;  4P4I A;  5F1Y A;  1Q5X A;  3I6S A;  4IIY A;  3NOJ A;  4NGS A;  4CDJ A;  3BXM A;  3TLC A;  4C9A A;  2D0O A;  2C6G A;  2DIK A;  1DE4 C;  1R61 A;  2YJT A;  4OC0 A;  1M6V B;  4C99 A;  3D7G A;  2XEF A;  2MP0 A;  3SJG A;  4C8T A;  2GP4 A;  3D7D A;  4C9R A;  4NGT A;  4NGP A;  2YJV A;  5F09 A;  4MI1 A;  2AUN A;  3EZA A;  2EZA A;  3T05 A;  1CX8 A;  1VBH A;  5IB9 A;  1A9X B;  1EZB A;  4C8U A;  3TLG B;  2FM4 A;  3T5M A;  2HRO A;  3FEC A;  1ZRS A;  4CO9 A;  1KBL A;  1CS0 B;  1VI4 A;  4OC4 A;  4OC2 A;  4P45 A;  2XEJ A;  3D7H A;  4KNG E;  3FEE A;  1XF1 A;  3T07 A;  2OOT A;  4IIX A;  4JVO A;  4P4J A;  3G23 A;  2EZB A;  4LQG A;  2EZC A;  1KEE B;  4CDK A;  3T0T A;  1CE8 B;  3BI0 A;  5F9M A;  3TLA A;  1C3O B;  2PCN A;  3K9T A;  2C6P A;  4P4E A;  3KRV A;  4C8P A;  2B0A A;  1BXR B;  4OC1 A;  3EIF A;  4P44 A;  3RBU A;  1Y9Z A;  3SJF A;  4TJV A;  3S9L A;  1DIK A;  1ZL0 A;  3FF3 A;  3TLY A;  4C9U A;  4E5S A;  1VBG A;  2HWG A;  2CIJ A;  4MJX A;  3TLG A;  4CZ1 A;  5ELY A;  4MCR A;  1JDB C;  1C30 B;  3GJZ A;  4OC3 A;  1JDE A;  4YN3 A;  4NGM A;  1GGO A;  4P4D A;  3TYX A;  5IR2 A;  2D0P A;  3BHX A;  2X0S A;  4C8C A;  4C9E A;  4H1H A;  4OME A;  3K4I A;  2C5Q A;  3FED A;  4C8F A;  4NGQ A;  1J3L A;  3EZB A;  2EK9 A;  3SJX A;  4MCP A;  2OLS A;  1EZA A;  4MCQ A;  3ICU A;  5D29 A;  3BI1 A;  4NGR A;  3S9N A;  2PVV A;  3D7F A;  4MCS A;  1Z8L A;  1NXJ A;  4C84 A;  4C9V A;  2OR4 A;  4COG A;  4OC5 A;  2JBK A;  3I74 A;  5FD8 A;  3EZE A;  3TLE A;  1ZYM A;  1T36 B;  5JVL A;  4C8A A;  4JYW A;  3IWW A;  4EYS A;  5K99 A;  3S9M A;  4P4B A;  4X3R A; 
#chains in the Genus database with same CATH homology
 2XEI A;  3IIB A;  2JBJ A;  4NGN A;  3KAS A;  4JZ0 A;  2C6C A;  2PVW A;  1WVM A;  3VTA A;  4TJX A;  4W9Y A;  4TWE A;  2EK8 A;  3SJE A;  4C85 A;  1V6C A;  2XEG A;  4C86 A;  4P4F A;  4P4I A;  3I6S A;  4NGS A;  4CDJ A;  3BXM A;  4C9A A;  2C6G A;  1DE4 C;  4OC0 A;  4C99 A;  3D7G A;  2XEF A;  3SJG A;  4C8T A;  2GP4 A;  3D7D A;  4C9R A;  4NGT A;  4NGP A;  5F09 A;  1CX8 A;  5IB9 A;  4C8U A;  3FEC A;  4OC4 A;  4OC2 A;  4P45 A;  2XEJ A;  3D7H A;  4KNG E;  3FEE A;  1XF1 A;  2OOT A;  4P4J A;  4LQG A;  4CDK A;  3BI0 A;  3K9T A;  2C6P A;  4P4E A;  4C8P A;  4OC1 A;  3EIF A;  4P44 A;  3RBU A;  1Y9Z A;  3SJF A;  4TJV A;  3S9L A;  3FF3 A;  4C9U A;  2CIJ A;  5ELY A;  4MCR A;  4OC3 A;  4YN3 A;  4NGM A;  4P4D A;  5IR2 A;  3BHX A;  4C8C A;  4C9E A;  4OME A;  2C5Q A;  3FED A;  4C8F A;  4NGQ A;  2EK9 A;  3SJX A;  4MCP A;  4MCQ A;  3ICU A;  5D29 A;  3BI1 A;  4NGR A;  3S9N A;  2PVV A;  3D7F A;  4MCS A;  1Z8L A;  4C84 A;  4C9V A;  2OR4 A;  4OC5 A;  2JBK A;  3I74 A;  4C8A A;  4JYW A;  3IWW A;  3S9M A;  4P4B A;  4X3R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...