1O8UA

The 2 angstrom structure of 6-oxo camphor hydrolase: new structural diversity in the crotonase superfamily
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
249
structure length
249
Chain Sequence
b'LATPFQEYSQKYENIRLERDGGVLLVTVHTEGKSLVWTSTAHDELAYCFHDIACDRENKVVILTGTGPSFCNEIDFTSFNLGTPHDWDEIIFEGQRLLNNLLSIEVPVIAAVNGPVTNHPEIPVMSDIVLAAESATFQDGPHFPSGIVPGDGAHVVWPHVLGSNRGRYFLLTGQELDARTALDYGAVNEVLSEQELLPRAWELARGIAEKPLLARRYARKVLTRQLRRVMEADLSLGLAHEALAAIDLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6-OXO CAMPHOR HYDROLASE
publication title The 2 a Crystal Structure of 6-Oxo Camphor Hydrolase: New Structural Diversity in the Crotonase Superfamily
pubmed doi rcsb
source organism Rhodococcus erythropolis
molecule tags Hydrolase
total genus 91
structure length 249
sequence length 249
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.7.1.18: 6-oxocamphor hydrolase.
pdb deposition date 2002-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1o8uA00
4JVTA 3I47A 4MI2A 3RRVA 4NNQA 2WTBA 2J5II 3IBBA 1ON3A 3H81A 1XNWA 5KJPA 4JCQA 3LAOA 3K50A 5C90A 1Q52A 4YLHA 2F9YB 2A7KA 4ZDEA 1J7XA 3KTKA 3OT6A 4LK5A 4ASIA 3ZWBA 1PIXA 5DU8A 4FN8A 4JYJA 4MOUA 3HE2A 2F6QA 4Z0MA 4ZDDA 1OD4A 3K8XA 3KQFA 3R9QA 2VSUF 5KDRB 3TVUA 3OC7A 3H02A 3ZW8A 1WDMA 5CTCA 2EJ5A 4RYFA 4EMLA 3Q0GA 3R9SA 2FW2A 3QWDA 4K29A 3QMJA 1MJ3A 4RYFH 2D3TA 3U9SB 1FC6A 2VSUC 4ZDBA 5DZKA 3T3WA 4ZDFA 3L3SA 3QXIA 3PGQA 1Q51A 3STAA 3G64A 1YG6A 2BZRA 2Q2XA 3Q1TA 2F6IA 5DZKH 3PE8A 3MFMA 4DI1A 3T89A 4EMPA 3PEAA 1SG4A 4FNDA 4QIJA 1HNOA 2NP9A 5G1QA 1ON9A 4GM2A 3MOYA 2CBYA 2GTRA 2VREA 4U18A 1TYFA 3BPPA 1HZDA 3KTIA 1WZ8A 4EMMA 3MT6A 1UYVA 4HC8A 1FCFA 1NZYA 4OLQA 2VSSE 4FZWC 5INGA 3QYRA 1VRGA 3QXZA 2ZL0A 2ZL3A 3IB9A 5DKPA 3QKAA 2VSSA 3KTGA 2J5GA 1SZOA 4U1AA 1DUBA 2X24A 2PG8A 4K3WA 1XNVA 2IEXA 5JBXA 4ZU2A 5E0NX 2ZQRA 1O8UA 3ZWCA 1UYRA 2X58A 4KNPA 5DTWA 4IZDA 4WYOB 4U19A 2FZSA 2VSUE 4JCTA 1Y7OA 5DU4A 3VIVA 3T8BA 1JXZA 3RSIA 4ELSA 1WDKA 1FC9A 1YG8A 3BEZA 1EY3A 3GMAA 4L6WA 5DL1A 1WDLA 1N6DA 1DCIA 5C9GA 3V5IA 4GHNA 5E0SA 3RSTA 2PBPA 5FUSA 3V5EA 3NJDA 4KWBA 4I52A 3HLN1 4JCRA 3OMEA 3DORA 3NJBA 4ZDCA 5DUFA 3TT7A 4JSBA 4KD6A 2ZQQA 5CTBA 3T88A 1NZYB 3SLLA 1RJNA 2VX2A 3U9TB 4ELXA 4QIIA 2J5GD 3H0UA 3DJAA 4JJTA 3FF6A 4Q0GA 3P85A 2CE3A 3TLFA 4IZBA 3GF7A 4FZWA 3TRRA 1EF9A 5G1SA 4B3JA 2FBMA 2Q35A 5INFA 5IKLB 3U9RB 2DEOA 2J5IA 4OG1A 2C8TA 1UIYA 2F9IA 5DTPA 4JCSA 2A81A 3HP0A 1OD2A 2W3PA 4FNBA 3GF3A 3SWXA 4JOTA 4I4ZA 4KPKA 1PJHA 5JBWA 3GKBA 2QQ3A 4OMRA 4WCZA 4K2NA 4B3HA 1RJMA 2HW5A 4NEKA 4FB8A 3H0QA 1UYSA 1N6EA 4JWVA 4L8KA 4MXIA 2F9YA 3TZ3A 3BF0A 3QK8A 4QFEA 4ELWA 1K39A 3ZW9A 3GLMA 4U0HA 1UYTA 4I42A 1EF8A 2UZFA 3TVWA 2A7SA 2ZL4A 4B3IA 2VSUA 3MYBA 3ZWAA 2ZL2A 5DUCA 4U0GA 3WG5A 3M6NA 1XO6A 5KDRA 3KTHA 4WZ8B 4RCNA 3ISAA 2J5SA 3Q0JA 3JU1A 3LKEA 4U0GH 3P5MA 4Q1IA 4F47A 4G2RA 3N6RB 1K32A 2DUBA 5E0SH 3M6MA 5MGBA 3TDCA 2PPYA 1N6FA 1W2XA 1TG6A 1XX4A 3H0SA 5DU6A 5FIFA 5INIA 1FC7A 4FN7A 3R9TA 3Q7HA 4IZCA 2Q34A 3TV5A 1HNUA 1XNYA 4JFCA 3P2LA 2J5IB 3R0OA 2VSSF 3T8AA 2F9IB 4FJWD 3PZKA 3KTJA 3H0JA 3HRXA 3FDUA 4HNKA 5G1RA 1X0UA 3TT6A 4JYLA 3HINA 3ST9A 3QREA 3IAVA 3R6HA
chains in the Genus database with same CATH superfamily
4JVTA 3I47A 4MI2A 3RRVA 4NNQA 2WTBA 2J5II 3IBBA 1ON3A 3H81A 1XNWA 5KJPA 4JCQA 3LAOA 3K50A 5C90A 1Q52A 4YLHA 2F9YB 2A7KA 4ZDEA 1J7XA 3KTKA 3OT6A 4LK5A 4ASIA 3ZWBA 1PIXA 5DU8A 4FN8A 4JYJA 4MOUA 3HE2A 2F6QA 4Z0MA 4ZDDA 1OD4A 3K8XA 3KQFA 3R9QA 2VSUF 5KDRB 3TVUA 3OC7A 3H02A 3ZW8A 1WDMA 3BPTA 5CTCA 2EJ5A 4RYFA 4EMLA 3Q0GA 3R9SA 2FW2A 3QWDA 4K29A 3QMJA 1MJ3A 4RYFH 2D3TA 3U9SB 1FC6A 2VSUC 4ZDBA 5DZKA 3T3WA 4ZDFA 3L3SA 3QXIA 3PGQA 4HDTA 1Q51A 3STAA 3G64A 1YG6A 2BZRA 2Q2XA 3Q1TA 2F6IA 5HUQA 5DZKH 3PE8A 3MFMA 4DI1A 3T89A 4EMPA 3PEAA 1SG4A 4FNDA 4QIJA 1HNOA 2NP9A 5G1QA 1ON9A 4GM2A 3MOYA 2CBYA 2GTRA 2VREA 4U18A 1TYFA 3BPPA 1HZDA 3KTIA 1WZ8A 4EMMA 3MT6A 1UYVA 4HC8A 1FCFA 1NZYA 4OLQA 2VSSE 4FZWC 5INGA 3QYRA 1VRGA 3QXZA 2ZL0A 2ZL3A 3IB9A 5DKPA 3QKAA 2VSSA 3KTGA 2J5GA 1SZOA 4U1AA 1DUBA 2X24A 2PG8A 4K3WA 1XNVA 2IEXA 5JBXA 4ZU2A 5E0NX 2ZQRA 1O8UA 3ZWCA 1UYRA 2X58A 4KNPA 5DTWA 4IZDA 4WYOB 4U19A 2FZSA 2VSUE 4JCTA 1Y7OA 5DU4A 3VIVA 3T8BA 1JXZA 3RSIA 4ELSA 1WDKA 1FC9A 1YG8A 3BEZA 1EY3A 3GMAA 4L6WA 5DL1A 1WDLA 4NARA 1N6DA 1DCIA 5C9GA 3V5IA 4GHNA 5E0SA 3RSTA 2PBPA 5FUSA 3V5EA 3NJDA 4KWBA 4I52A 3HLN1 4JCRA 3OMEA 3DORA 3NJBA 4ZDCA 2YJGA 5DUFA 3TT7A 4JSBA 4KD6A 2ZQQA 5CTBA 3T88A 1NZYB 3SLLA 1RJNA 2VX2A 3U9TB 4ELXA 4QIIA 2J5GD 3H0UA 3DJAA 4JJTA 3FF6A 4Q0GA 3P85A 2CE3A 3TLFA 4IZBA 4J2UA 3GF7A 4FZWA 3TRRA 1EF9A 5G1SA 4B3JA 2FBMA 2Q35A 5INFA 5IKLB 3U9RB 2DEOA 2J5IA 4OG1A 2C8TA 1UIYA 2F9IA 5DTPA 4JCSA 2A81A 3HP0A 1OD2A 2W3PA 4FNBA 3GF3A 3SWXA 4JOTA 4I4ZA 4KPKA 1PJHA 5JBWA 3GKBA 2QQ3A 4OMRA 4WCZA 4K2NA 4B3HA 1RJMA 2HW5A 4NEKA 4FB8A 3H0QA 1UYSA 1N6EA 4JWVA 4L8KA 4MXIA 2F9YA 3TZ3A 3BF0A 3QK8A 4QFEA 4ELWA 1K39A 3ZW9A 3GLMA 4U0HA 1UYTA 4I42A 1EF8A 2UZFA 3TVWA 2A7SA 2ZL4A 4B3IA 2VSUA 3MYBA 3ZWAA 2ZL2A 5DUCA 4U0GA 3WG5A 3M6NA 1XO6A 5KDRA 3KTHA 4WZ8B 4RCNA 3ISAA 2J5SA 3Q0JA 3JU1A 3LKEA 4U0GH 3P5MA 4Q1IA 4F47A 4G2RA 3N6RB 1K32A 2DUBA 5E0SH 3M6MA 5MGBA 3TDCA 2PPYA 1N6FA 1W2XA 1TG6A 1XX4A 3H0SA 5DU6A 5FIFA 5INIA 1FC7A 4FN7A 3R9TA 3Q7HA 4IZCA 2Q34A 3TV5A 1HNUA 1XNYA 4JFCA 3P2LA 2J5IB 3R0OA 2VSSF 3T8AA 2F9IB 4FJWD 3PZKA 3KTJA 3H0JA 3HRXA 3FDUA 4HNKA 5G1RA 1X0UA 3TT6A 4JYLA 3HINA 3ST9A 3QREA 3IAVA 3R6HA
chains in the Genus database with same CATH topology
4JVTA 3I47A 4MI2A 3RRVA 4NNQA 2WTBA 2J5II 3IBBA 1ON3A 3H81A 1XNWA 5KJPA 4JCQA 3LAOA 3K50A 5C90A 1Q52A 4YLHA 2F9YB 2A7KA 4ZDEA 1J7XA 3KTKA 3OT6A 4LK5A 4ASIA 3ZWBA 1PIXA 5DU8A 4FN8A 4JYJA 4MOUA 3HE2A 2F6QA 4Z0MA 4ZDDA 1OD4A 3K8XA 3KQFA 3R9QA 2VSUF 5KDRB 3TVUA 3OC7A 3H02A 3ZW8A 1WDMA 3BPTA 5CTCA 2EJ5A 4RYFA 4EMLA 3Q0GA 3R9SA 2FW2A 3QWDA 4K29A 3QMJA 1MJ3A 4RYFH 2D3TA 3U9SB 1FC6A 2VSUC 4ZDBA 5DZKA 3T3WA 4ZDFA 3L3SA 3QXIA 3PGQA 4HDTA 1Q51A 3STAA 3G64A 1YG6A 2BZRA 2Q2XA 3Q1TA 2F6IA 5HUQA 5DZKH 3PE8A 3MFMA 4DI1A 3T89A 4EMPA 3PEAA 1SG4A 4FNDA 4QIJA 1HNOA 2NP9A 5G1QA 1ON9A 4GM2A 3MOYA 2CBYA 2GTRA 2VREA 4U18A 1TYFA 3BPPA 1HZDA 3KTIA 1WZ8A 4EMMA 3MT6A 1UYVA 4HC8A 1FCFA 1NZYA 4OLQA 2VSSE 4FZWC 5INGA 3QYRA 1VRGA 3QXZA 2ZL0A 2ZL3A 3IB9A 5DKPA 3QKAA 2VSSA 3KTGA 2J5GA 1SZOA 4U1AA 1DUBA 2X24A 2PG8A 4K3WA 1XNVA 2IEXA 5JBXA 4ZU2A 5E0NX 2ZQRA 1O8UA 3ZWCA 1UYRA 2X58A 4KNPA 5DTWA 4IZDA 4WYOB 4U19A 2FZSA 2VSUE 4JCTA 1Y7OA 5DU4A 3VIVA 3T8BA 1JXZA 3RSIA 4ELSA 1WDKA 1FC9A 1YG8A 3BEZA 1EY3A 3GMAA 4L6WA 5DL1A 1WDLA 4NARA 1N6DA 1DCIA 5C9GA 3V5IA 4GHNA 5E0SA 3RSTA 2PBPA 5FUSA 3V5EA 3NJDA 4KWBA 4I52A 3HLN1 4JCRA 3OMEA 3DORA 3NJBA 4ZDCA 2YJGA 5DUFA 3TT7A 4JSBA 4KD6A 2ZQQA 5CTBA 3T88A 1NZYB 3SLLA 1RJNA 2VX2A 3U9TB 4ELXA 4QIIA 2J5GD 3H0UA 3DJAA 4JJTA 3FF6A 4Q0GA 3P85A 2CE3A 3TLFA 4IZBA 4J2UA 3GF7A 4FZWA 3TRRA 1EF9A 5G1SA 4B3JA 2FBMA 2Q35A 5INFA 5IKLB 3U9RB 2DEOA 2J5IA 4OG1A 2C8TA 1UIYA 2F9IA 5DTPA 4JCSA 2A81A 3HP0A 1OD2A 2W3PA 4FNBA 3GF3A 3SWXA 4JOTA 4I4ZA 4KPKA 1PJHA 5JBWA 3GKBA 2QQ3A 4OMRA 4WCZA 4K2NA 4B3HA 1RJMA 2HW5A 4NEKA 4FB8A 3H0QA 1UYSA 1N6EA 4JWVA 4L8KA 4MXIA 2F9YA 3TZ3A 3BF0A 3QK8A 4QFEA 4ELWA 1K39A 3ZW9A 3GLMA 4U0HA 1UYTA 4I42A 1EF8A 2UZFA 3TVWA 2A7SA 2ZL4A 4B3IA 2VSUA 3MYBA 3ZWAA 2ZL2A 5DUCA 4U0GA 3WG5A 3M6NA 1XO6A 5KDRA 3KTHA 4WZ8B 4RCNA 3ISAA 2J5SA 3Q0JA 3JU1A 3LKEA 4U0GH 3P5MA 4Q1IA 4F47A 4G2RA 3N6RB 1K32A 2DUBA 5E0SH 3M6MA 5MGBA 3TDCA 2PPYA 1N6FA 1W2XA 1TG6A 1XX4A 3H0SA 5DU6A 5FIFA 5INIA 1FC7A 4FN7A 3R9TA 3Q7HA 4IZCA 2Q34A 3TV5A 1HNUA 1XNYA 4JFCA 3P2LA 2J5IB 3R0OA 2VSSF 3T8AA 2F9IB 4FJWD 3PZKA 3KTJA 3H0JA 3HRXA 3FDUA 4HNKA 5G1RA 1X0UA 3TT6A 4JYLA 3HINA 3ST9A 3QREA 3IAVA 3R6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JVT A;  3I47 A;  4MI2 A;  3RRV A;  4NNQ A;  2WTB A;  2J5I I;  3IBB A;  1ON3 A;  3H81 A;  1XNW A;  5KJP A;  4JCQ A;  3LAO A;  3K50 A;  5C90 A;  1Q52 A;  4YLH A;  2F9Y B;  2A7K A;  4ZDE A;  1J7X A;  3KTK A;  3OT6 A;  4LK5 A;  4ASI A;  3ZWB A;  1PIX A;  5DU8 A;  4FN8 A;  4JYJ A;  4MOU A;  3HE2 A;  2F6Q A;  4Z0M A;  4ZDD A;  1OD4 A;  3K8X A;  3KQF A;  3R9Q A;  2VSU F;  5KDR B;  3TVU A;  3OC7 A;  3H02 A;  3ZW8 A;  1WDM A;  5CTC A;  2EJ5 A;  4RYF A;  4EML A;  3Q0G A;  3R9S A;  2FW2 A;  3QWD A;  4K29 A;  3QMJ A;  1MJ3 A;  4RYF H;  2D3T A;  3U9S B;  1FC6 A;  2VSU C;  4ZDB A;  5DZK A;  3T3W A;  4ZDF A;  3L3S A;  3QXI A;  3PGQ A;  1Q51 A;  3STA A;  3G64 A;  1YG6 A;  2BZR A;  2Q2X A;  3Q1T A;  2F6I A;  5DZK H;  3PE8 A;  3MFM A;  4DI1 A;  3T89 A;  4EMP A;  3PEA A;  1SG4 A;  4FND A;  4QIJ A;  1HNO A;  2NP9 A;  5G1Q A;  1ON9 A;  4GM2 A;  3MOY A;  2CBY A;  2GTR A;  2VRE A;  4U18 A;  1TYF A;  3BPP A;  1HZD A;  3KTI A;  1WZ8 A;  4EMM A;  3MT6 A;  1UYV A;  4HC8 A;  1FCF A;  1NZY A;  4OLQ A;  2VSS E;  4FZW C;  5ING A;  3QYR A;  1VRG A;  3QXZ A;  2ZL0 A;  2ZL3 A;  3IB9 A;  5DKP A;  3QKA A;  2VSS A;  3KTG A;  2J5G A;  1SZO A;  4U1A A;  1DUB A;  2X24 A;  2PG8 A;  4K3W A;  1XNV A;  2IEX A;  5JBX A;  4ZU2 A;  5E0N X;  2ZQR A;  1O8U A;  3ZWC A;  1UYR A;  2X58 A;  4KNP A;  5DTW A;  4IZD A;  4WYO B;  4U19 A;  2FZS A;  2VSU E;  4JCT A;  1Y7O A;  5DU4 A;  3VIV A;  3T8B A;  1JXZ A;  3RSI A;  4ELS A;  1WDK A;  1FC9 A;  1YG8 A;  3BEZ A;  1EY3 A;  3GMA A;  4L6W A;  5DL1 A;  1WDL A;  1N6D A;  1DCI A;  5C9G A;  3V5I A;  4GHN A;  5E0S A;  3RST A;  2PBP A;  5FUS A;  3V5E A;  3NJD A;  4KWB A;  4I52 A;  3HLN 1;  4JCR A;  3OME A;  3DOR A;  3NJB A;  4ZDC A;  5DUF A;  3TT7 A;  4JSB A;  4KD6 A;  2ZQQ A;  5CTB A;  3T88 A;  1NZY B;  3SLL A;  1RJN A;  2VX2 A;  3U9T B;  4ELX A;  4QII A;  2J5G D;  3H0U A;  3DJA A;  4JJT A;  3FF6 A;  4Q0G A;  3P85 A;  2CE3 A;  3TLF A;  4IZB A;  3GF7 A;  4FZW A;  3TRR A;  1EF9 A;  5G1S A;  4B3J A;  2FBM A;  2Q35 A;  5INF A;  5IKL B;  3U9R B;  2DEO A;  2J5I A;  4OG1 A;  2C8T A;  1UIY A;  2F9I A;  5DTP A;  4JCS A;  2A81 A;  3HP0 A;  1OD2 A;  2W3P A;  4FNB A;  3GF3 A;  3SWX A;  4JOT A;  4I4Z A;  4KPK A;  1PJH A;  5JBW A;  3GKB A;  2QQ3 A;  4OMR A;  4WCZ A;  4K2N A;  4B3H A;  1RJM A;  2HW5 A;  4NEK A;  4FB8 A;  3H0Q A;  1UYS A;  1N6E A;  4JWV A;  4L8K A;  4MXI A;  2F9Y A;  3TZ3 A;  3BF0 A;  3QK8 A;  4QFE A;  4ELW A;  1K39 A;  3ZW9 A;  3GLM A;  4U0H A;  1UYT A;  4I42 A;  1EF8 A;  2UZF A;  3TVW A;  2A7S A;  2ZL4 A;  4B3I A;  2VSU A;  3MYB A;  3ZWA A;  2ZL2 A;  5DUC A;  4U0G A;  3WG5 A;  3M6N A;  1XO6 A;  5KDR A;  3KTH A;  4WZ8 B;  4RCN A;  3ISA A;  2J5S A;  3Q0J A;  3JU1 A;  3LKE A;  4U0G H;  3P5M A;  4Q1I A;  4F47 A;  4G2R A;  3N6R B;  1K32 A;  2DUB A;  5E0S H;  3M6M A;  5MGB A;  3TDC A;  2PPY A;  1N6F A;  1W2X A;  1TG6 A;  1XX4 A;  3H0S A;  5DU6 A;  5FIF A;  5INI A;  1FC7 A;  4FN7 A;  3R9T A;  3Q7H A;  4IZC A;  2Q34 A;  3TV5 A;  1HNU A;  1XNY A;  4JFC A;  3P2L A;  2J5I B;  3R0O A;  2VSS F;  3T8A A;  2F9I B;  4FJW D;  3PZK A;  3KTJ A;  3H0J A;  3HRX A;  3FDU A;  4HNK A;  5G1R A;  1X0U A;  3TT6 A;  4JYL A;  3HIN A;  3ST9 A;  3QRE A;  3IAV A;  3R6H A; 
#chains in the Genus database with same CATH topology
 4JVT A;  3I47 A;  4MI2 A;  3RRV A;  4NNQ A;  2WTB A;  2J5I I;  3IBB A;  1ON3 A;  3H81 A;  1XNW A;  5KJP A;  4JCQ A;  3LAO A;  3K50 A;  5C90 A;  1Q52 A;  4YLH A;  2F9Y B;  2A7K A;  4ZDE A;  1J7X A;  3KTK A;  3OT6 A;  4LK5 A;  4ASI A;  3ZWB A;  1PIX A;  5DU8 A;  4FN8 A;  4JYJ A;  4MOU A;  3HE2 A;  2F6Q A;  4Z0M A;  4ZDD A;  1OD4 A;  3K8X A;  3KQF A;  3R9Q A;  2VSU F;  5KDR B;  3TVU A;  3OC7 A;  3H02 A;  3ZW8 A;  1WDM A;  3BPT A;  5CTC A;  2EJ5 A;  4RYF A;  4EML A;  3Q0G A;  3R9S A;  2FW2 A;  3QWD A;  4K29 A;  3QMJ A;  1MJ3 A;  4RYF H;  2D3T A;  3U9S B;  1FC6 A;  2VSU C;  4ZDB A;  5DZK A;  3T3W A;  4ZDF A;  3L3S A;  3QXI A;  3PGQ A;  4HDT A;  1Q51 A;  3STA A;  3G64 A;  1YG6 A;  2BZR A;  2Q2X A;  3Q1T A;  2F6I A;  5HUQ A;  5DZK H;  3PE8 A;  3MFM A;  4DI1 A;  3T89 A;  4EMP A;  3PEA A;  1SG4 A;  4FND A;  4QIJ A;  1HNO A;  2NP9 A;  5G1Q A;  1ON9 A;  4GM2 A;  3MOY A;  2CBY A;  2GTR A;  2VRE A;  4U18 A;  1TYF A;  3BPP A;  1HZD A;  3KTI A;  1WZ8 A;  4EMM A;  3MT6 A;  1UYV A;  4HC8 A;  1FCF A;  1NZY A;  4OLQ A;  2VSS E;  4FZW C;  5ING A;  3QYR A;  1VRG A;  3QXZ A;  2ZL0 A;  2ZL3 A;  3IB9 A;  5DKP A;  3QKA A;  2VSS A;  3KTG A;  2J5G A;  1SZO A;  4U1A A;  1DUB A;  2X24 A;  2PG8 A;  4K3W A;  1XNV A;  2IEX A;  5JBX A;  4ZU2 A;  5E0N X;  2ZQR A;  1O8U A;  3ZWC A;  1UYR A;  2X58 A;  4KNP A;  5DTW A;  4IZD A;  4WYO B;  4U19 A;  2FZS A;  2VSU E;  4JCT A;  1Y7O A;  5DU4 A;  3VIV A;  3T8B A;  1JXZ A;  3RSI A;  4ELS A;  1WDK A;  1FC9 A;  1YG8 A;  3BEZ A;  1EY3 A;  3GMA A;  4L6W A;  5DL1 A;  1WDL A;  4NAR A;  1N6D A;  1DCI A;  5C9G A;  3V5I A;  4GHN A;  5E0S A;  3RST A;  2PBP A;  5FUS A;  3V5E A;  3NJD A;  4KWB A;  4I52 A;  3HLN 1;  4JCR A;  3OME A;  3DOR A;  3NJB A;  4ZDC A;  2YJG A;  5DUF A;  3TT7 A;  4JSB A;  4KD6 A;  2ZQQ A;  5CTB A;  3T88 A;  1NZY B;  3SLL A;  1RJN A;  2VX2 A;  3U9T B;  4ELX A;  4QII A;  2J5G D;  3H0U A;  3DJA A;  4JJT A;  3FF6 A;  4Q0G A;  3P85 A;  2CE3 A;  3TLF A;  4IZB A;  4J2U A;  3GF7 A;  4FZW A;  3TRR A;  1EF9 A;  5G1S A;  4B3J A;  2FBM A;  2Q35 A;  5INF A;  5IKL B;  3U9R B;  2DEO A;  2J5I A;  4OG1 A;  2C8T A;  1UIY A;  2F9I A;  5DTP A;  4JCS A;  2A81 A;  3HP0 A;  1OD2 A;  2W3P A;  4FNB A;  3GF3 A;  3SWX A;  4JOT A;  4I4Z A;  4KPK A;  1PJH A;  5JBW A;  3GKB A;  2QQ3 A;  4OMR A;  4WCZ A;  4K2N A;  4B3H A;  1RJM A;  2HW5 A;  4NEK A;  4FB8 A;  3H0Q A;  1UYS A;  1N6E A;  4JWV A;  4L8K A;  4MXI A;  2F9Y A;  3TZ3 A;  3BF0 A;  3QK8 A;  4QFE A;  4ELW A;  1K39 A;  3ZW9 A;  3GLM A;  4U0H A;  1UYT A;  4I42 A;  1EF8 A;  2UZF A;  3TVW A;  2A7S A;  2ZL4 A;  4B3I A;  2VSU A;  3MYB A;  3ZWA A;  2ZL2 A;  5DUC A;  4U0G A;  3WG5 A;  3M6N A;  1XO6 A;  5KDR A;  3KTH A;  4WZ8 B;  4RCN A;  3ISA A;  2J5S A;  3Q0J A;  3JU1 A;  3LKE A;  4U0G H;  3P5M A;  4Q1I A;  4F47 A;  4G2R A;  3N6R B;  1K32 A;  2DUB A;  5E0S H;  3M6M A;  5MGB A;  3TDC A;  2PPY A;  1N6F A;  1W2X A;  1TG6 A;  1XX4 A;  3H0S A;  5DU6 A;  5FIF A;  5INI A;  1FC7 A;  4FN7 A;  3R9T A;  3Q7H A;  4IZC A;  2Q34 A;  3TV5 A;  1HNU A;  1XNY A;  4JFC A;  3P2L A;  2J5I B;  3R0O A;  2VSS F;  3T8A A;  2F9I B;  4FJW D;  3PZK A;  3KTJ A;  3H0J A;  3HRX A;  3FDU A;  4HNK A;  5G1R A;  1X0U A;  3TT6 A;  4JYL A;  3HIN A;  3ST9 A;  3QRE A;  3IAV A;  3R6H A; 
#chains in the Genus database with same CATH homology
 4JVT A;  3I47 A;  4MI2 A;  3RRV A;  4NNQ A;  2WTB A;  2J5I I;  3IBB A;  1ON3 A;  3H81 A;  1XNW A;  5KJP A;  4JCQ A;  3LAO A;  3K50 A;  5C90 A;  1Q52 A;  4YLH A;  2F9Y B;  2A7K A;  4ZDE A;  1J7X A;  3KTK A;  3OT6 A;  4LK5 A;  4ASI A;  3ZWB A;  1PIX A;  5DU8 A;  4FN8 A;  4JYJ A;  4MOU A;  3HE2 A;  2F6Q A;  4Z0M A;  4ZDD A;  1OD4 A;  3K8X A;  3KQF A;  3R9Q A;  2VSU F;  5KDR B;  3TVU A;  3OC7 A;  3H02 A;  3ZW8 A;  1WDM A;  3BPT A;  5CTC A;  2EJ5 A;  4RYF A;  4EML A;  3Q0G A;  3R9S A;  2FW2 A;  3QWD A;  4K29 A;  3QMJ A;  1MJ3 A;  4RYF H;  2D3T A;  3U9S B;  1FC6 A;  2VSU C;  4ZDB A;  5DZK A;  3T3W A;  4ZDF A;  3L3S A;  3QXI A;  3PGQ A;  4HDT A;  1Q51 A;  3STA A;  3G64 A;  1YG6 A;  2BZR A;  2Q2X A;  3Q1T A;  2F6I A;  5HUQ A;  5DZK H;  3PE8 A;  3MFM A;  4DI1 A;  3T89 A;  4EMP A;  3PEA A;  1SG4 A;  4FND A;  4QIJ A;  1HNO A;  2NP9 A;  5G1Q A;  1ON9 A;  4GM2 A;  3MOY A;  2CBY A;  2GTR A;  2VRE A;  4U18 A;  1TYF A;  3BPP A;  1HZD A;  3KTI A;  1WZ8 A;  4EMM A;  3MT6 A;  1UYV A;  4HC8 A;  1FCF A;  1NZY A;  4OLQ A;  2VSS E;  4FZW C;  5ING A;  3QYR A;  1VRG A;  3QXZ A;  2ZL0 A;  2ZL3 A;  3IB9 A;  5DKP A;  3QKA A;  2VSS A;  3KTG A;  2J5G A;  1SZO A;  4U1A A;  1DUB A;  2X24 A;  2PG8 A;  4K3W A;  1XNV A;  2IEX A;  5JBX A;  4ZU2 A;  5E0N X;  2ZQR A;  1O8U A;  3ZWC A;  1UYR A;  2X58 A;  4KNP A;  5DTW A;  4IZD A;  4WYO B;  4U19 A;  2FZS A;  2VSU E;  4JCT A;  1Y7O A;  5DU4 A;  3VIV A;  3T8B A;  1JXZ A;  3RSI A;  4ELS A;  1WDK A;  1FC9 A;  1YG8 A;  3BEZ A;  1EY3 A;  3GMA A;  4L6W A;  5DL1 A;  1WDL A;  4NAR A;  1N6D A;  1DCI A;  5C9G A;  3V5I A;  4GHN A;  5E0S A;  3RST A;  2PBP A;  5FUS A;  3V5E A;  3NJD A;  4KWB A;  4I52 A;  3HLN 1;  4JCR A;  3OME A;  3DOR A;  3NJB A;  4ZDC A;  2YJG A;  5DUF A;  3TT7 A;  4JSB A;  4KD6 A;  2ZQQ A;  5CTB A;  3T88 A;  1NZY B;  3SLL A;  1RJN A;  2VX2 A;  3U9T B;  4ELX A;  4QII A;  2J5G D;  3H0U A;  3DJA A;  4JJT A;  3FF6 A;  4Q0G A;  3P85 A;  2CE3 A;  3TLF A;  4IZB A;  4J2U A;  3GF7 A;  4FZW A;  3TRR A;  1EF9 A;  5G1S A;  4B3J A;  2FBM A;  2Q35 A;  5INF A;  5IKL B;  3U9R B;  2DEO A;  2J5I A;  4OG1 A;  2C8T A;  1UIY A;  2F9I A;  5DTP A;  4JCS A;  2A81 A;  3HP0 A;  1OD2 A;  2W3P A;  4FNB A;  3GF3 A;  3SWX A;  4JOT A;  4I4Z A;  4KPK A;  1PJH A;  5JBW A;  3GKB A;  2QQ3 A;  4OMR A;  4WCZ A;  4K2N A;  4B3H A;  1RJM A;  2HW5 A;  4NEK A;  4FB8 A;  3H0Q A;  1UYS A;  1N6E A;  4JWV A;  4L8K A;  4MXI A;  2F9Y A;  3TZ3 A;  3BF0 A;  3QK8 A;  4QFE A;  4ELW A;  1K39 A;  3ZW9 A;  3GLM A;  4U0H A;  1UYT A;  4I42 A;  1EF8 A;  2UZF A;  3TVW A;  2A7S A;  2ZL4 A;  4B3I A;  2VSU A;  3MYB A;  3ZWA A;  2ZL2 A;  5DUC A;  4U0G A;  3WG5 A;  3M6N A;  1XO6 A;  5KDR A;  3KTH A;  4WZ8 B;  4RCN A;  3ISA A;  2J5S A;  3Q0J A;  3JU1 A;  3LKE A;  4U0G H;  3P5M A;  4Q1I A;  4F47 A;  4G2R A;  3N6R B;  1K32 A;  2DUB A;  5E0S H;  3M6M A;  5MGB A;  3TDC A;  2PPY A;  1N6F A;  1W2X A;  1TG6 A;  1XX4 A;  3H0S A;  5DU6 A;  5FIF A;  5INI A;  1FC7 A;  4FN7 A;  3R9T A;  3Q7H A;  4IZC A;  2Q34 A;  3TV5 A;  1HNU A;  1XNY A;  4JFC A;  3P2L A;  2J5I B;  3R0O A;  2VSS F;  3T8A A;  2F9I B;  4FJW D;  3PZK A;  3KTJ A;  3H0J A;  3HRX A;  3FDU A;  4HNK A;  5G1R A;  1X0U A;  3TT6 A;  4JYL A;  3HIN A;  3ST9 A;  3QRE A;  3IAV A;  3R6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...