4EMPA

Crystal structure of the mutant of clpp e137a from staphylococcus aureus
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
189
structure length
189
Chain Sequence
IPTVIETTNRGERAYDIYSRLLKDRIIMLGSQIDDNVANSIVSQLLFLQAQDSEKDIYLYINSPGGSVTAGFAIYDTIQHIKPDVQTICIGMAASMGSFLLAAGAKGKRFALPNAEVMIHQPLGGAQGQATEIAIAANHILKTREKLNRILSERTGQSIEKIQKDTDRDNFLTAEEAKEYGLIDEVMVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Helix unfolding/refolding characterizes the functional dynamics of Staphylococcus aureus Clp protease
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords ATP-dependent Clp protease proteolytic subunit
total genus 65
structure length 189
sequence length 189
chains with identical sequence B, C, E, F, G, I, K, L, M, N, S, T, V
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4empA00
1J7XA 1VRGA 1ON9A 2CE3A 3TV5A 4FJWD 2VSUE 2F9YB 5INGA 1O8UA 1OD4A 3OT6A 1XNYA 4U1AA 1ON3A 4EMMA 2X24A 3SWXA 3TT7A 3TVWA 3DJAA 3RSTA 4IZDA 4JSBA 1WZ8A 1DUBA 4U0GA 3BPPA 1NZYB 3M6MA 2Q35A 3KTGA 3PEAA 5MGBA 1XX4A 3Q0GA 4RCNA 4Q1IA 3MT6A 3R9TA 3NJBA 1Q51A 1WDKA 3STAA 4FZWA 4FZWC 4ZDFA 2VSUA 3QK8A 2J5GD 2ZL2A 3TVUA 1EF9A 4K2NA 2D3TA 4FNDA 1JXZA 2ZQRA 1K32A 1YG8A 2PPYA 4RYFH 4L8KA 5JBWA 3TRRA 2UZFA 4JCRA 3DORA 3RRVA 1HNOA 5DUCA 2GTRA 4EMPA 2VREA 3KTHA 2VSUC 3QREA 1FC9A 3QWDA 3OMEA 3TLFA 5DU4A 2C8TA 4ELXA 5DKPA 2W3PA 2ZL0A 2J5IB 4NNQA 1DCIA 5DU8A 5E0NX 4JFCA 4KNPA 4I4ZA 4FNBA 1SZOA 4WCZA 5INFA 3IBBA 4FB8A 3OC7A 4QIJA 5FIFA 1NZYA 3KTJA 4B3HA 3HRXA 1WDLA 4KPKA 5JBXA 4IZCA 4ZDBA 2DUBA 2VSSF 1Q52A 3H81A 4F47A 3TT6A 3GF3A 1UYTA 3H0JA 4QIIA 3T8AA 2Q2XA 3KTKA 3K8XA 2DEOA 2VX2A 1N6FA 5KJPA 3V5IA 2NP9A 3U9SB 3HP0A 5FUSA 3Q0JA 3M6NA 5E0SH 3PZKA 4MXIA 1HNUA 4B3JA 4U0GH 4K29A 1XNVA 2HW5A 3QKAA 3MYBA 3KQFA 3GKBA 2J5SA 2X58A 3H0UA 4OMRA 5INIA 2FZSA 3JU1A 3PE8A 1Y7OA 4I52A 3ZWBA 5CTCA 3G64A 4G2RA 2QQ3A 5DUFA 2ZQQA 4HNKA 4GHNA 3LAOA 4JCTA 3FF6A 3Q7HA 3K50A 3HE2A 2F9IB 4MI2A 4KWBA 2WTBA 3U9RB 3FDUA 3H0SA 3LKEA 4JCSA 3TZ3A 3V5EA 3H0QA 3U9TB 3VIVA 1TG6A 2BZRA 4FN8A 4Q0GA 5DTPA 5DZKA 1SG4A 1N6EA 3QMJA 4MOUA 4ZDDA 3BF0A 3ISAA 5DZKH 5G1RA 3MOYA 1N6DA 5E0SA 4KD6A 3HLN1 4YLHA 3SLLA 4ELSA 2Q34A 3GMAA 1FCFA 1YG6A 5C90A 4Z0MA 3I47A 3P5MA 3ST9A 2IEXA 3GLMA 1WDMA 3L3SA 4JYLA 4DI1A 2VSSE 3HINA 4HC8A 1HZDA 2EJ5A 4JYJA 3IB9A 2PG8A 4ZU2A 1OD2A 1K39A 2A81A 2CBYA 3ZWCA 3PGQA 5G1QA 3QXIA 3MFMA 1PJHA 3R9SA 1TYFA 4FN7A 2A7SA 5DU6A 3H02A 4U19A 1EF8A 3T89A 2ZL4A 3R6HA 3WG5A 1UYSA 4WZ8B 2F6IA 2VSSA 1UYVA 4IZBA 3NJDA 4ASIA 2FW2A 4K3WA 2J5IA 3T3WA 3T8BA 4JJTA 2J5GA 4JVTA 4JWVA 5CTBA 3ZWAA 4ELWA 2ZL3A 2A7KA 4GM2A 3P85A 3RSIA 3ZW8A 1XNWA 1RJNA 1UIYA 4RYFA 2FBMA 4U0HA 1W2XA 3N6RB 1XO6A 4JCQA 5C9GA 1X0UA 3R9QA 3KTIA 3P2LA 3GF7A 4EMLA 2F9IA 1MJ3A 4OLQA 2J5II 3ZW9A 4ZDCA 4QFEA 4B3IA 4U18A 5DTWA 3Q1TA 4I42A 4L6WA 3QYRA 3R0OA 1EY3A 2F9YA 1RJMA 3T88A 2VSUF 1PIXA 2F6QA 3IAVA 1UYRA 4NEKA 4OG1A 4WYOB 4JOTA 3BEZA 4ZDEA 5DL1A 1FC6A 5KDRA 5G1SA 4LK5A 3QXZA 5KDRB 5IKLB 2PBPA 3TDCA 1FC7A
chains in the Genus database with same CATH superfamily
1J7XA 1VRGA 1ON9A 2CE3A 3TV5A 4FJWD 2VSUE 2F9YB 5INGA 1O8UA 1OD4A 3OT6A 1XNYA 4U1AA 1ON3A 4EMMA 2X24A 3SWXA 3TT7A 3TVWA 3DJAA 3RSTA 4IZDA 4JSBA 1WZ8A 1DUBA 4U0GA 3BPPA 1NZYB 3M6MA 2Q35A 3KTGA 3PEAA 5MGBA 1XX4A 3Q0GA 4RCNA 4Q1IA 3MT6A 3R9TA 3NJBA 1Q51A 1WDKA 3STAA 4FZWA 4FZWC 4ZDFA 2VSUA 3QK8A 2J5GD 2ZL2A 3TVUA 1EF9A 4K2NA 2D3TA 4FNDA 1JXZA 2ZQRA 1K32A 1YG8A 2PPYA 4RYFH 4L8KA 5JBWA 3TRRA 2UZFA 4JCRA 3DORA 3RRVA 1HNOA 5DUCA 2GTRA 4EMPA 2VREA 3KTHA 2VSUC 2YJGA 3BPTA 3QREA 1FC9A 3QWDA 3OMEA 3TLFA 5DU4A 2C8TA 4ELXA 5DKPA 2W3PA 2ZL0A 2J5IB 4NNQA 1DCIA 5DU8A 5E0NX 4JFCA 4KNPA 4I4ZA 4FNBA 1SZOA 4WCZA 5INFA 3IBBA 4FB8A 3OC7A 4QIJA 5FIFA 1NZYA 3KTJA 4B3HA 3HRXA 1WDLA 4KPKA 5JBXA 4IZCA 4ZDBA 2DUBA 2VSSF 1Q52A 3H81A 4F47A 3TT6A 3GF3A 1UYTA 3H0JA 4QIIA 3T8AA 2Q2XA 3KTKA 3K8XA 2DEOA 2VX2A 1N6FA 5KJPA 3V5IA 2NP9A 3U9SB 3HP0A 5FUSA 3Q0JA 3M6NA 5E0SH 3PZKA 4MXIA 1HNUA 4B3JA 4U0GH 4K29A 1XNVA 2HW5A 3QKAA 3MYBA 3KQFA 3GKBA 2J5SA 2X58A 3H0UA 4OMRA 5INIA 2FZSA 3JU1A 3PE8A 1Y7OA 4I52A 3ZWBA 5CTCA 3G64A 4G2RA 2QQ3A 5DUFA 2ZQQA 4HNKA 4GHNA 3LAOA 4JCTA 3FF6A 3Q7HA 3K50A 3HE2A 2F9IB 4MI2A 4KWBA 2WTBA 3U9RB 3FDUA 3H0SA 3LKEA 4JCSA 3TZ3A 3V5EA 3H0QA 3U9TB 3VIVA 1TG6A 2BZRA 4FN8A 4Q0GA 4HDTA 5DTPA 5DZKA 1SG4A 1N6EA 3QMJA 4MOUA 4ZDDA 3BF0A 3ISAA 5DZKH 5G1RA 3MOYA 1N6DA 5E0SA 4KD6A 3HLN1 4YLHA 3SLLA 4ELSA 2Q34A 3GMAA 1FCFA 1YG6A 5C90A 4Z0MA 3I47A 3P5MA 3ST9A 2IEXA 3GLMA 1WDMA 4NARA 3L3SA 4JYLA 4DI1A 2VSSE 3HINA 4HC8A 1HZDA 2EJ5A 4JYJA 3IB9A 2PG8A 4ZU2A 1OD2A 1K39A 2A81A 4J2UA 2CBYA 3ZWCA 3PGQA 5G1QA 3QXIA 3MFMA 1PJHA 3R9SA 1TYFA 4FN7A 2A7SA 5DU6A 3H02A 4U19A 1EF8A 3T89A 2ZL4A 3R6HA 3WG5A 1UYSA 4WZ8B 2F6IA 2VSSA 1UYVA 4IZBA 3NJDA 4ASIA 2FW2A 4K3WA 2J5IA 3T3WA 3T8BA 4JJTA 2J5GA 4JVTA 4JWVA 5CTBA 3ZWAA 4ELWA 2ZL3A 2A7KA 4GM2A 3P85A 3RSIA 3ZW8A 1XNWA 1RJNA 1UIYA 4RYFA 2FBMA 4U0HA 1W2XA 3N6RB 1XO6A 4JCQA 5C9GA 1X0UA 3R9QA 3KTIA 3P2LA 3GF7A 4EMLA 2F9IA 1MJ3A 4OLQA 2J5II 3ZW9A 4ZDCA 4QFEA 4B3IA 5HUQA 4U18A 5DTWA 3Q1TA 4I42A 4L6WA 3QYRA 3R0OA 1EY3A 2F9YA 1RJMA 3T88A 2VSUF 1PIXA 2F6QA 3IAVA 1UYRA 4NEKA 4OG1A 4WYOB 4JOTA 3BEZA 4ZDEA 5DL1A 1FC6A 5KDRA 5G1SA 4LK5A 3QXZA 5KDRB 5IKLB 2PBPA 3TDCA 1FC7A
chains in the Genus database with same CATH topology
1J7XA 1VRGA 1ON9A 2CE3A 3TV5A 4FJWD 2VSUE 2F9YB 5INGA 1O8UA 1OD4A 3OT6A 1XNYA 4U1AA 1ON3A 4EMMA 2X24A 3SWXA 3TT7A 3TVWA 3DJAA 3RSTA 4IZDA 4JSBA 1WZ8A 1DUBA 4U0GA 3BPPA 1NZYB 3M6MA 2Q35A 3KTGA 3PEAA 5MGBA 1XX4A 3Q0GA 4RCNA 4Q1IA 3MT6A 3R9TA 3NJBA 1Q51A 1WDKA 3STAA 4FZWA 4FZWC 4ZDFA 2VSUA 3QK8A 2J5GD 2ZL2A 3TVUA 1EF9A 4K2NA 2D3TA 4FNDA 1JXZA 2ZQRA 1K32A 1YG8A 2PPYA 4RYFH 4L8KA 5JBWA 3TRRA 2UZFA 4JCRA 3DORA 3RRVA 1HNOA 5DUCA 2GTRA 4EMPA 2VREA 3KTHA 2VSUC 2YJGA 3BPTA 3QREA 1FC9A 3QWDA 3OMEA 3TLFA 5DU4A 2C8TA 4ELXA 5DKPA 2W3PA 2ZL0A 2J5IB 4NNQA 1DCIA 5DU8A 5E0NX 4JFCA 4KNPA 4I4ZA 4FNBA 1SZOA 4WCZA 5INFA 3IBBA 4FB8A 3OC7A 4QIJA 5FIFA 1NZYA 3KTJA 4B3HA 3HRXA 1WDLA 4KPKA 5JBXA 4IZCA 4ZDBA 2DUBA 2VSSF 1Q52A 3H81A 4F47A 3TT6A 3GF3A 1UYTA 3H0JA 4QIIA 3T8AA 2Q2XA 3KTKA 3K8XA 2DEOA 2VX2A 1N6FA 5KJPA 3V5IA 2NP9A 3U9SB 3HP0A 5FUSA 3Q0JA 3M6NA 5E0SH 3PZKA 4MXIA 1HNUA 4B3JA 4U0GH 4K29A 1XNVA 2HW5A 3QKAA 3MYBA 3KQFA 3GKBA 2J5SA 2X58A 3H0UA 4OMRA 5INIA 2FZSA 3JU1A 3PE8A 1Y7OA 4I52A 3ZWBA 5CTCA 3G64A 4G2RA 2QQ3A 5DUFA 2ZQQA 4HNKA 4GHNA 3LAOA 4JCTA 3FF6A 3Q7HA 3K50A 3HE2A 2F9IB 4MI2A 4KWBA 2WTBA 3U9RB 3FDUA 3H0SA 3LKEA 4JCSA 3TZ3A 3V5EA 3H0QA 3U9TB 3VIVA 1TG6A 2BZRA 4FN8A 4Q0GA 4HDTA 5DTPA 5DZKA 1SG4A 1N6EA 3QMJA 4MOUA 4ZDDA 3BF0A 3ISAA 5DZKH 5G1RA 3MOYA 1N6DA 5E0SA 4KD6A 3HLN1 4YLHA 3SLLA 4ELSA 2Q34A 3GMAA 1FCFA 1YG6A 5C90A 4Z0MA 3I47A 3P5MA 3ST9A 2IEXA 3GLMA 1WDMA 4NARA 3L3SA 4JYLA 4DI1A 2VSSE 3HINA 4HC8A 1HZDA 2EJ5A 4JYJA 3IB9A 2PG8A 4ZU2A 1OD2A 1K39A 2A81A 4J2UA 2CBYA 3ZWCA 3PGQA 5G1QA 3QXIA 3MFMA 1PJHA 3R9SA 1TYFA 4FN7A 2A7SA 5DU6A 3H02A 4U19A 1EF8A 3T89A 2ZL4A 3R6HA 3WG5A 1UYSA 4WZ8B 2F6IA 2VSSA 1UYVA 4IZBA 3NJDA 4ASIA 2FW2A 4K3WA 2J5IA 3T3WA 3T8BA 4JJTA 2J5GA 4JVTA 4JWVA 5CTBA 3ZWAA 4ELWA 2ZL3A 2A7KA 4GM2A 3P85A 3RSIA 3ZW8A 1XNWA 1RJNA 1UIYA 4RYFA 2FBMA 4U0HA 1W2XA 3N6RB 1XO6A 4JCQA 5C9GA 1X0UA 3R9QA 3KTIA 3P2LA 3GF7A 4EMLA 2F9IA 1MJ3A 4OLQA 2J5II 3ZW9A 4ZDCA 4QFEA 4B3IA 5HUQA 4U18A 5DTWA 3Q1TA 4I42A 4L6WA 3QYRA 3R0OA 1EY3A 2F9YA 1RJMA 3T88A 2VSUF 1PIXA 2F6QA 3IAVA 1UYRA 4NEKA 4OG1A 4WYOB 4JOTA 3BEZA 4ZDEA 5DL1A 1FC6A 5KDRA 5G1SA 4LK5A 3QXZA 5KDRB 5IKLB 2PBPA 3TDCA 1FC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J7X A;  1VRG A;  1ON9 A;  2CE3 A;  3TV5 A;  4FJW D;  2VSU E;  2F9Y B;  5ING A;  1O8U A;  1OD4 A;  3OT6 A;  1XNY A;  4U1A A;  1ON3 A;  4EMM A;  2X24 A;  3SWX A;  3TT7 A;  3TVW A;  3DJA A;  3RST A;  4IZD A;  4JSB A;  1WZ8 A;  1DUB A;  4U0G A;  3BPP A;  1NZY B;  3M6M A;  2Q35 A;  3KTG A;  3PEA A;  5MGB A;  1XX4 A;  3Q0G A;  4RCN A;  4Q1I A;  3MT6 A;  3R9T A;  3NJB A;  1Q51 A;  1WDK A;  3STA A;  4FZW A;  4FZW C;  4ZDF A;  2VSU A;  3QK8 A;  2J5G D;  2ZL2 A;  3TVU A;  1EF9 A;  4K2N A;  2D3T A;  4FND A;  1JXZ A;  2ZQR A;  1K32 A;  1YG8 A;  2PPY A;  4RYF H;  4L8K A;  5JBW A;  3TRR A;  2UZF A;  4JCR A;  3DOR A;  3RRV A;  1HNO A;  5DUC A;  2GTR A;  4EMP A;  2VRE A;  3KTH A;  2VSU C;  3QRE A;  1FC9 A;  3QWD A;  3OME A;  3TLF A;  5DU4 A;  2C8T A;  4ELX A;  5DKP A;  2W3P A;  2ZL0 A;  2J5I B;  4NNQ A;  1DCI A;  5DU8 A;  5E0N X;  4JFC A;  4KNP A;  4I4Z A;  4FNB A;  1SZO A;  4WCZ A;  5INF A;  3IBB A;  4FB8 A;  3OC7 A;  4QIJ A;  5FIF A;  1NZY A;  3KTJ A;  4B3H A;  3HRX A;  1WDL A;  4KPK A;  5JBX A;  4IZC A;  4ZDB A;  2DUB A;  2VSS F;  1Q52 A;  3H81 A;  4F47 A;  3TT6 A;  3GF3 A;  1UYT A;  3H0J A;  4QII A;  3T8A A;  2Q2X A;  3KTK A;  3K8X A;  2DEO A;  2VX2 A;  1N6F A;  5KJP A;  3V5I A;  2NP9 A;  3U9S B;  3HP0 A;  5FUS A;  3Q0J A;  3M6N A;  5E0S H;  3PZK A;  4MXI A;  1HNU A;  4B3J A;  4U0G H;  4K29 A;  1XNV A;  2HW5 A;  3QKA A;  3MYB A;  3KQF A;  3GKB A;  2J5S A;  2X58 A;  3H0U A;  4OMR A;  5INI A;  2FZS A;  3JU1 A;  3PE8 A;  1Y7O A;  4I52 A;  3ZWB A;  5CTC A;  3G64 A;  4G2R A;  2QQ3 A;  5DUF A;  2ZQQ A;  4HNK A;  4GHN A;  3LAO A;  4JCT A;  3FF6 A;  3Q7H A;  3K50 A;  3HE2 A;  2F9I B;  4MI2 A;  4KWB A;  2WTB A;  3U9R B;  3FDU A;  3H0S A;  3LKE A;  4JCS A;  3TZ3 A;  3V5E A;  3H0Q A;  3U9T B;  3VIV A;  1TG6 A;  2BZR A;  4FN8 A;  4Q0G A;  5DTP A;  5DZK A;  1SG4 A;  1N6E A;  3QMJ A;  4MOU A;  4ZDD A;  3BF0 A;  3ISA A;  5DZK H;  5G1R A;  3MOY A;  1N6D A;  5E0S A;  4KD6 A;  3HLN 1;  4YLH A;  3SLL A;  4ELS A;  2Q34 A;  3GMA A;  1FCF A;  1YG6 A;  5C90 A;  4Z0M A;  3I47 A;  3P5M A;  3ST9 A;  2IEX A;  3GLM A;  1WDM A;  3L3S A;  4JYL A;  4DI1 A;  2VSS E;  3HIN A;  4HC8 A;  1HZD A;  2EJ5 A;  4JYJ A;  3IB9 A;  2PG8 A;  4ZU2 A;  1OD2 A;  1K39 A;  2A81 A;  2CBY A;  3ZWC A;  3PGQ A;  5G1Q A;  3QXI A;  3MFM A;  1PJH A;  3R9S A;  1TYF A;  4FN7 A;  2A7S A;  5DU6 A;  3H02 A;  4U19 A;  1EF8 A;  3T89 A;  2ZL4 A;  3R6H A;  3WG5 A;  1UYS A;  4WZ8 B;  2F6I A;  2VSS A;  1UYV A;  4IZB A;  3NJD A;  4ASI A;  2FW2 A;  4K3W A;  2J5I A;  3T3W A;  3T8B A;  4JJT A;  2J5G A;  4JVT A;  4JWV A;  5CTB A;  3ZWA A;  4ELW A;  2ZL3 A;  2A7K A;  4GM2 A;  3P85 A;  3RSI A;  3ZW8 A;  1XNW A;  1RJN A;  1UIY A;  4RYF A;  2FBM A;  4U0H A;  1W2X A;  3N6R B;  1XO6 A;  4JCQ A;  5C9G A;  1X0U A;  3R9Q A;  3KTI A;  3P2L A;  3GF7 A;  4EML A;  2F9I A;  1MJ3 A;  4OLQ A;  2J5I I;  3ZW9 A;  4ZDC A;  4QFE A;  4B3I A;  4U18 A;  5DTW A;  3Q1T A;  4I42 A;  4L6W A;  3QYR A;  3R0O A;  1EY3 A;  2F9Y A;  1RJM A;  3T88 A;  2VSU F;  1PIX A;  2F6Q A;  3IAV A;  1UYR A;  4NEK A;  4OG1 A;  4WYO B;  4JOT A;  3BEZ A;  4ZDE A;  5DL1 A;  1FC6 A;  5KDR A;  5G1S A;  4LK5 A;  3QXZ A;  5KDR B;  5IKL B;  2PBP A;  3TDC A;  1FC7 A; 
#chains in the Genus database with same CATH topology
 1J7X A;  1VRG A;  1ON9 A;  2CE3 A;  3TV5 A;  4FJW D;  2VSU E;  2F9Y B;  5ING A;  1O8U A;  1OD4 A;  3OT6 A;  1XNY A;  4U1A A;  1ON3 A;  4EMM A;  2X24 A;  3SWX A;  3TT7 A;  3TVW A;  3DJA A;  3RST A;  4IZD A;  4JSB A;  1WZ8 A;  1DUB A;  4U0G A;  3BPP A;  1NZY B;  3M6M A;  2Q35 A;  3KTG A;  3PEA A;  5MGB A;  1XX4 A;  3Q0G A;  4RCN A;  4Q1I A;  3MT6 A;  3R9T A;  3NJB A;  1Q51 A;  1WDK A;  3STA A;  4FZW A;  4FZW C;  4ZDF A;  2VSU A;  3QK8 A;  2J5G D;  2ZL2 A;  3TVU A;  1EF9 A;  4K2N A;  2D3T A;  4FND A;  1JXZ A;  2ZQR A;  1K32 A;  1YG8 A;  2PPY A;  4RYF H;  4L8K A;  5JBW A;  3TRR A;  2UZF A;  4JCR A;  3DOR A;  3RRV A;  1HNO A;  5DUC A;  2GTR A;  4EMP A;  2VRE A;  3KTH A;  2VSU C;  2YJG A;  3BPT A;  3QRE A;  1FC9 A;  3QWD A;  3OME A;  3TLF A;  5DU4 A;  2C8T A;  4ELX A;  5DKP A;  2W3P A;  2ZL0 A;  2J5I B;  4NNQ A;  1DCI A;  5DU8 A;  5E0N X;  4JFC A;  4KNP A;  4I4Z A;  4FNB A;  1SZO A;  4WCZ A;  5INF A;  3IBB A;  4FB8 A;  3OC7 A;  4QIJ A;  5FIF A;  1NZY A;  3KTJ A;  4B3H A;  3HRX A;  1WDL A;  4KPK A;  5JBX A;  4IZC A;  4ZDB A;  2DUB A;  2VSS F;  1Q52 A;  3H81 A;  4F47 A;  3TT6 A;  3GF3 A;  1UYT A;  3H0J A;  4QII A;  3T8A A;  2Q2X A;  3KTK A;  3K8X A;  2DEO A;  2VX2 A;  1N6F A;  5KJP A;  3V5I A;  2NP9 A;  3U9S B;  3HP0 A;  5FUS A;  3Q0J A;  3M6N A;  5E0S H;  3PZK A;  4MXI A;  1HNU A;  4B3J A;  4U0G H;  4K29 A;  1XNV A;  2HW5 A;  3QKA A;  3MYB A;  3KQF A;  3GKB A;  2J5S A;  2X58 A;  3H0U A;  4OMR A;  5INI A;  2FZS A;  3JU1 A;  3PE8 A;  1Y7O A;  4I52 A;  3ZWB A;  5CTC A;  3G64 A;  4G2R A;  2QQ3 A;  5DUF A;  2ZQQ A;  4HNK A;  4GHN A;  3LAO A;  4JCT A;  3FF6 A;  3Q7H A;  3K50 A;  3HE2 A;  2F9I B;  4MI2 A;  4KWB A;  2WTB A;  3U9R B;  3FDU A;  3H0S A;  3LKE A;  4JCS A;  3TZ3 A;  3V5E A;  3H0Q A;  3U9T B;  3VIV A;  1TG6 A;  2BZR A;  4FN8 A;  4Q0G A;  4HDT A;  5DTP A;  5DZK A;  1SG4 A;  1N6E A;  3QMJ A;  4MOU A;  4ZDD A;  3BF0 A;  3ISA A;  5DZK H;  5G1R A;  3MOY A;  1N6D A;  5E0S A;  4KD6 A;  3HLN 1;  4YLH A;  3SLL A;  4ELS A;  2Q34 A;  3GMA A;  1FCF A;  1YG6 A;  5C90 A;  4Z0M A;  3I47 A;  3P5M A;  3ST9 A;  2IEX A;  3GLM A;  1WDM A;  4NAR A;  3L3S A;  4JYL A;  4DI1 A;  2VSS E;  3HIN A;  4HC8 A;  1HZD A;  2EJ5 A;  4JYJ A;  3IB9 A;  2PG8 A;  4ZU2 A;  1OD2 A;  1K39 A;  2A81 A;  4J2U A;  2CBY A;  3ZWC A;  3PGQ A;  5G1Q A;  3QXI A;  3MFM A;  1PJH A;  3R9S A;  1TYF A;  4FN7 A;  2A7S A;  5DU6 A;  3H02 A;  4U19 A;  1EF8 A;  3T89 A;  2ZL4 A;  3R6H A;  3WG5 A;  1UYS A;  4WZ8 B;  2F6I A;  2VSS A;  1UYV A;  4IZB A;  3NJD A;  4ASI A;  2FW2 A;  4K3W A;  2J5I A;  3T3W A;  3T8B A;  4JJT A;  2J5G A;  4JVT A;  4JWV A;  5CTB A;  3ZWA A;  4ELW A;  2ZL3 A;  2A7K A;  4GM2 A;  3P85 A;  3RSI A;  3ZW8 A;  1XNW A;  1RJN A;  1UIY A;  4RYF A;  2FBM A;  4U0H A;  1W2X A;  3N6R B;  1XO6 A;  4JCQ A;  5C9G A;  1X0U A;  3R9Q A;  3KTI A;  3P2L A;  3GF7 A;  4EML A;  2F9I A;  1MJ3 A;  4OLQ A;  2J5I I;  3ZW9 A;  4ZDC A;  4QFE A;  4B3I A;  5HUQ A;  4U18 A;  5DTW A;  3Q1T A;  4I42 A;  4L6W A;  3QYR A;  3R0O A;  1EY3 A;  2F9Y A;  1RJM A;  3T88 A;  2VSU F;  1PIX A;  2F6Q A;  3IAV A;  1UYR A;  4NEK A;  4OG1 A;  4WYO B;  4JOT A;  3BEZ A;  4ZDE A;  5DL1 A;  1FC6 A;  5KDR A;  5G1S A;  4LK5 A;  3QXZ A;  5KDR B;  5IKL B;  2PBP A;  3TDC A;  1FC7 A; 
#chains in the Genus database with same CATH homology
 1J7X A;  1VRG A;  1ON9 A;  2CE3 A;  3TV5 A;  4FJW D;  2VSU E;  2F9Y B;  5ING A;  1O8U A;  1OD4 A;  3OT6 A;  1XNY A;  4U1A A;  1ON3 A;  4EMM A;  2X24 A;  3SWX A;  3TT7 A;  3TVW A;  3DJA A;  3RST A;  4IZD A;  4JSB A;  1WZ8 A;  1DUB A;  4U0G A;  3BPP A;  1NZY B;  3M6M A;  2Q35 A;  3KTG A;  3PEA A;  5MGB A;  1XX4 A;  3Q0G A;  4RCN A;  4Q1I A;  3MT6 A;  3R9T A;  3NJB A;  1Q51 A;  1WDK A;  3STA A;  4FZW A;  4FZW C;  4ZDF A;  2VSU A;  3QK8 A;  2J5G D;  2ZL2 A;  3TVU A;  1EF9 A;  4K2N A;  2D3T A;  4FND A;  1JXZ A;  2ZQR A;  1K32 A;  1YG8 A;  2PPY A;  4RYF H;  4L8K A;  5JBW A;  3TRR A;  2UZF A;  4JCR A;  3DOR A;  3RRV A;  1HNO A;  5DUC A;  2GTR A;  4EMP A;  2VRE A;  3KTH A;  2VSU C;  2YJG A;  3BPT A;  3QRE A;  1FC9 A;  3QWD A;  3OME A;  3TLF A;  5DU4 A;  2C8T A;  4ELX A;  5DKP A;  2W3P A;  2ZL0 A;  2J5I B;  4NNQ A;  1DCI A;  5DU8 A;  5E0N X;  4JFC A;  4KNP A;  4I4Z A;  4FNB A;  1SZO A;  4WCZ A;  5INF A;  3IBB A;  4FB8 A;  3OC7 A;  4QIJ A;  5FIF A;  1NZY A;  3KTJ A;  4B3H A;  3HRX A;  1WDL A;  4KPK A;  5JBX A;  4IZC A;  4ZDB A;  2DUB A;  2VSS F;  1Q52 A;  3H81 A;  4F47 A;  3TT6 A;  3GF3 A;  1UYT A;  3H0J A;  4QII A;  3T8A A;  2Q2X A;  3KTK A;  3K8X A;  2DEO A;  2VX2 A;  1N6F A;  5KJP A;  3V5I A;  2NP9 A;  3U9S B;  3HP0 A;  5FUS A;  3Q0J A;  3M6N A;  5E0S H;  3PZK A;  4MXI A;  1HNU A;  4B3J A;  4U0G H;  4K29 A;  1XNV A;  2HW5 A;  3QKA A;  3MYB A;  3KQF A;  3GKB A;  2J5S A;  2X58 A;  3H0U A;  4OMR A;  5INI A;  2FZS A;  3JU1 A;  3PE8 A;  1Y7O A;  4I52 A;  3ZWB A;  5CTC A;  3G64 A;  4G2R A;  2QQ3 A;  5DUF A;  2ZQQ A;  4HNK A;  4GHN A;  3LAO A;  4JCT A;  3FF6 A;  3Q7H A;  3K50 A;  3HE2 A;  2F9I B;  4MI2 A;  4KWB A;  2WTB A;  3U9R B;  3FDU A;  3H0S A;  3LKE A;  4JCS A;  3TZ3 A;  3V5E A;  3H0Q A;  3U9T B;  3VIV A;  1TG6 A;  2BZR A;  4FN8 A;  4Q0G A;  4HDT A;  5DTP A;  5DZK A;  1SG4 A;  1N6E A;  3QMJ A;  4MOU A;  4ZDD A;  3BF0 A;  3ISA A;  5DZK H;  5G1R A;  3MOY A;  1N6D A;  5E0S A;  4KD6 A;  3HLN 1;  4YLH A;  3SLL A;  4ELS A;  2Q34 A;  3GMA A;  1FCF A;  1YG6 A;  5C90 A;  4Z0M A;  3I47 A;  3P5M A;  3ST9 A;  2IEX A;  3GLM A;  1WDM A;  4NAR A;  3L3S A;  4JYL A;  4DI1 A;  2VSS E;  3HIN A;  4HC8 A;  1HZD A;  2EJ5 A;  4JYJ A;  3IB9 A;  2PG8 A;  4ZU2 A;  1OD2 A;  1K39 A;  2A81 A;  4J2U A;  2CBY A;  3ZWC A;  3PGQ A;  5G1Q A;  3QXI A;  3MFM A;  1PJH A;  3R9S A;  1TYF A;  4FN7 A;  2A7S A;  5DU6 A;  3H02 A;  4U19 A;  1EF8 A;  3T89 A;  2ZL4 A;  3R6H A;  3WG5 A;  1UYS A;  4WZ8 B;  2F6I A;  2VSS A;  1UYV A;  4IZB A;  3NJD A;  4ASI A;  2FW2 A;  4K3W A;  2J5I A;  3T3W A;  3T8B A;  4JJT A;  2J5G A;  4JVT A;  4JWV A;  5CTB A;  3ZWA A;  4ELW A;  2ZL3 A;  2A7K A;  4GM2 A;  3P85 A;  3RSI A;  3ZW8 A;  1XNW A;  1RJN A;  1UIY A;  4RYF A;  2FBM A;  4U0H A;  1W2X A;  3N6R B;  1XO6 A;  4JCQ A;  5C9G A;  1X0U A;  3R9Q A;  3KTI A;  3P2L A;  3GF7 A;  4EML A;  2F9I A;  1MJ3 A;  4OLQ A;  2J5I I;  3ZW9 A;  4ZDC A;  4QFE A;  4B3I A;  5HUQ A;  4U18 A;  5DTW A;  3Q1T A;  4I42 A;  4L6W A;  3QYR A;  3R0O A;  1EY3 A;  2F9Y A;  1RJM A;  3T88 A;  2VSU F;  1PIX A;  2F6Q A;  3IAV A;  1UYR A;  4NEK A;  4OG1 A;  4WYO B;  4JOT A;  3BEZ A;  4ZDE A;  5DL1 A;  1FC6 A;  5KDR A;  5G1S A;  4LK5 A;  3QXZ A;  5KDR B;  5IKL B;  2PBP A;  3TDC A;  1FC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...