4EMPA

Crystal structure of the mutant of clpp e137a from staphylococcus aureus
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
189
structure length
189
Chain Sequence
IPTVIETTNRGERAYDIYSRLLKDRIIMLGSQIDDNVANSIVSQLLFLQAQDSEKDIYLYINSPGGSVTAGFAIYDTIQHIKPDVQTICIGMAASMGSFLLAAGAKGKRFALPNAEVMIHQPLGGAQGQATEIAIAANHILKTREKLNRILSERTGQSIEKIQKDTDRDNFLTAEEAKEYGLIDEVMVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent Clp protease proteolytic subunit
publication title Helix unfolding/refolding characterizes the functional dynamics of Staphylococcus aureus Clp protease
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 65
structure length 189
sequence length 189
chains with identical sequence B, C, E, F, G, I, K, L, M, N, S, T, V
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4empA00
3P85A 4FN8A 4OLQA 4I42A 4U19A 4JWVA 1Y7OA 5CTCA 2F9IA 1N6FA 4JFCA 3ST9A 5KDRA 2FZSA 3MYBA 1N6DA 3KTKA 3VIVA 4JCQA 4EMLA 1FC9A 4OG1A 1HNUA 2F9YB 4QIIA 4WYOB 4MOUA 5DL1A 4HC8A 5JBXA 3NJDA 3G64A 2ZQRA 4ZDFA 4ZU2A 4KWBA 1DUBA 4JOTA 4FZWC 3U9RB 2EJ5A 4JCRA 4NEKA 3K50A 2ZL4A 3STAA 5G1SA 3T88A 2ZL2A 3K8XA 4QIJA 2X24A 2J5SA 4JCSA 2D3TA 4U18A 3T89A 2ZQQA 3GF7A 3U9SB 3HE2A 4ZDCA 3PGQA 2VSSA 3U9TB 3M6NA 4RCNA 5JBWA 4K29A 4F47A 3QKAA 1ON3A 3WG5A 4RYFH 4L8KA 2J5GA 3OT6A 3BEZA 5G1RA 5INGA 3T8AA 3FF6A 5DZKA 3ZW9A 2IEXA 4B3IA 2F9IB 4NNQA 5KDRB 4LK5A 2HW5A 3L3SA 5E0SA 3QYRA 3KTGA 5E0SH 3H0SA 3TLFA 2VSUC 2W3PA 3N6RB 2VSUE 1WDMA 4FZWA 5C90A 4MXIA 5KJPA 4ZDEA 1OD2A 3MT6A 3GMAA 5FUSA 3KTHA 1UYTA 3LKEA 2C8TA 1WDLA 3QREA 3Q7HA 4JJTA 4KNPA 2F6IA 2FW2A 4EMMA 1X0UA 1J7XA 4ASIA 1XNYA 3RSIA 2NP9A 1YG8A 1Q51A 1YG6A 5DTPA 1OD4A 3R9QA 5DUCA 3BF0A 3HINA 3M6MA 2J5GD 2QQ3A 4FN7A 2CBYA 3V5EA 2VSSF 5C9GA 3IB9A 2VSUA 3HP0A 4FB8A 1FCFA 1RJMA 1XX4A 1Q52A 3R6HA 4FNBA 3R9TA 3HLN1 4FNDA 1MJ3A 3TVWA 5FIFA 2X58A 2F6QA 4ELWA 1XNVA 3RRVA 4RYFA 2J5IA 3ZWCA 4Q0GA 3MFMA 3H81A 1VRGA 3DJAA 1FC7A 3PE8A 3DORA 2Q35A 4WZ8B 3LAOA 2ZL0A 3OC7A 3TT7A 4ELSA 4K2NA 4IZCA 1UYVA 1XO6A 2WTBA 4L6WA 1HZDA 4U0HA 2PG8A 3QXZA 4IZBA 3QK8A 3H0UA 1TYFA 3TVUA 1UYSA 1ON9A 2GTRA 3QXIA 4Q1IA 1K32A 3RSTA 2VREA 1JXZA 3JU1A 2VX2A 1NZYA 1PIXA 2A7KA 3SLLA 2BZRA 1HNOA 3OMEA 4MI2A 4GM2A 3HRXA 3KTIA 1TG6A 3T8BA 1XNWA 4WCZA 4IZDA 4HNKA 1RJNA 5DUFA 3GKBA 3H02A 3FDUA 4JYLA 4QFEA 3ISAA 2DUBA 5CTBA 1O8UA 2A81A 3T3WA 5DU4A 3ZW8A 4G2RA 2VSUF 3R9SA 1PJHA 3MOYA 3PEAA 4ZDDA 2PBPA 3NJBA 4ELXA 3IBBA 3TT6A 3TRRA 3P5MA 4U1AA 3V5IA 1W2XA 4KPKA 4YLHA 4U0GA 4JCTA 3KQFA 3KTJA 4U0GH 1K39A 3PZKA 1DCIA 2FBMA 4DI1A 3H0JA 1SG4A 4OMRA 1EY3A 4KD6A 1NZYB 3P2LA 2CE3A 3BPPA 3TZ3A 2J5II 4EMPA 5DU6A 4FJWD 4B3HA 4B3JA 5INIA 2ZL3A 3GF3A 5DU8A 1SZOA 3QMJA 4JVTA 3Q0GA 3IAVA 4JSBA 5IKLB 2Q2XA 5DKPA 3QWDA 4I52A 3H0QA 5INFA 5G1QA 1EF8A 2A7SA 5E0NX 2F9YA 3TDCA 3SWXA 4ZDBA 3ZWAA 5DTWA 5MGBA 4K3WA 2PPYA 4JYJA 5DZKH 3ZWBA 3I47A 1FC6A 3Q1TA 1EF9A 1WDKA 3R0OA 4Z0MA 3Q0JA 2UZFA 3TV5A 1N6EA 1UYRA 2Q34A 2DEOA 4GHNA 2J5IB 4I4ZA 1WZ8A 2VSSE 1UIYA 3GLMA
chains in the Genus database with same CATH superfamily
3P85A 4FN8A 4OLQA 4I42A 4U19A 4JWVA 1Y7OA 5CTCA 2F9IA 1N6FA 4JFCA 3ST9A 5KDRA 2FZSA 3MYBA 1N6DA 3KTKA 3VIVA 4JCQA 4EMLA 1FC9A 4OG1A 1HNUA 2F9YB 4QIIA 4WYOB 4MOUA 4NARA 5DL1A 4HC8A 5JBXA 3NJDA 3G64A 2ZQRA 4ZDFA 4ZU2A 4KWBA 1DUBA 4JOTA 4FZWC 3U9RB 2EJ5A 4JCRA 4NEKA 3K50A 2ZL4A 3STAA 5G1SA 3T88A 2ZL2A 3K8XA 4QIJA 2X24A 2J5SA 4JCSA 2D3TA 4U18A 3T89A 2ZQQA 3GF7A 3U9SB 3HE2A 4ZDCA 3PGQA 2VSSA 3U9TB 3M6NA 4RCNA 5JBWA 4K29A 4F47A 3QKAA 1ON3A 3WG5A 4RYFH 4L8KA 2J5GA 3OT6A 3BEZA 5G1RA 5INGA 3T8AA 3FF6A 5DZKA 3ZW9A 2IEXA 4B3IA 2F9IB 4NNQA 5KDRB 4LK5A 2HW5A 3L3SA 5E0SA 3QYRA 3KTGA 5E0SH 3H0SA 3TLFA 2VSUC 2W3PA 3N6RB 2VSUE 1WDMA 4FZWA 5C90A 4MXIA 5KJPA 4ZDEA 1OD2A 3MT6A 3GMAA 5FUSA 3KTHA 1UYTA 3LKEA 2C8TA 1WDLA 3QREA 3Q7HA 4JJTA 2YJGA 4KNPA 2F6IA 2FW2A 4EMMA 1X0UA 1J7XA 4ASIA 1XNYA 3RSIA 2NP9A 1YG8A 1Q51A 1YG6A 5DTPA 1OD4A 3R9QA 5DUCA 3BF0A 3HINA 3M6MA 2J5GD 2QQ3A 4FN7A 2CBYA 3V5EA 2VSSF 5C9GA 3IB9A 2VSUA 3HP0A 4FB8A 1FCFA 1RJMA 1XX4A 1Q52A 3R6HA 4FNBA 3R9TA 3HLN1 4FNDA 1MJ3A 3TVWA 5FIFA 2X58A 2F6QA 4ELWA 1XNVA 3RRVA 4RYFA 2J5IA 3ZWCA 4Q0GA 3MFMA 3H81A 1VRGA 3DJAA 1FC7A 3PE8A 3DORA 2Q35A 4WZ8B 3LAOA 2ZL0A 3OC7A 3TT7A 4ELSA 4K2NA 4IZCA 1UYVA 1XO6A 2WTBA 4L6WA 1HZDA 4U0HA 2PG8A 3QXZA 4IZBA 3QK8A 3H0UA 4HDTA 1TYFA 3TVUA 1UYSA 1ON9A 2GTRA 3QXIA 4Q1IA 1K32A 3RSTA 2VREA 1JXZA 3JU1A 2VX2A 1NZYA 1PIXA 2A7KA 3SLLA 2BZRA 1HNOA 3OMEA 4MI2A 4GM2A 3HRXA 3KTIA 1TG6A 3T8BA 1XNWA 4WCZA 4IZDA 4HNKA 1RJNA 5DUFA 3GKBA 3H02A 3FDUA 4JYLA 4QFEA 3ISAA 2DUBA 5CTBA 1O8UA 2A81A 3T3WA 5DU4A 3ZW8A 4G2RA 2VSUF 3R9SA 1PJHA 3MOYA 3PEAA 4ZDDA 2PBPA 3NJBA 4ELXA 3IBBA 3TT6A 3TRRA 3P5MA 4U1AA 3V5IA 1W2XA 4KPKA 4YLHA 4U0GA 4JCTA 3KQFA 3KTJA 4U0GH 1K39A 3PZKA 1DCIA 2FBMA 4DI1A 3H0JA 1SG4A 4OMRA 1EY3A 4KD6A 1NZYB 3P2LA 2CE3A 3BPPA 3TZ3A 2J5II 4EMPA 5HUQA 5DU6A 4FJWD 4B3HA 4B3JA 5INIA 2ZL3A 3GF3A 5DU8A 1SZOA 3QMJA 4JVTA 3BPTA 3Q0GA 3IAVA 4JSBA 5IKLB 2Q2XA 5DKPA 3QWDA 4I52A 3H0QA 5INFA 5G1QA 1EF8A 2A7SA 5E0NX 2F9YA 3TDCA 3SWXA 4ZDBA 3ZWAA 5DTWA 5MGBA 4K3WA 2PPYA 4JYJA 5DZKH 3ZWBA 3I47A 1FC6A 3Q1TA 1EF9A 1WDKA 3R0OA 4Z0MA 3Q0JA 2UZFA 3TV5A 1N6EA 4J2UA 1UYRA 2Q34A 2DEOA 4GHNA 2J5IB 4I4ZA 1WZ8A 2VSSE 1UIYA 3GLMA
chains in the Genus database with same CATH topology
3P85A 4FN8A 4OLQA 4I42A 4U19A 4JWVA 1Y7OA 5CTCA 2F9IA 1N6FA 4JFCA 3ST9A 5KDRA 2FZSA 3MYBA 1N6DA 3KTKA 3VIVA 4JCQA 4EMLA 1FC9A 4OG1A 1HNUA 2F9YB 4QIIA 4WYOB 4MOUA 4NARA 5DL1A 4HC8A 5JBXA 3NJDA 3G64A 2ZQRA 4ZDFA 4ZU2A 4KWBA 1DUBA 4JOTA 4FZWC 3U9RB 2EJ5A 4JCRA 4NEKA 3K50A 2ZL4A 3STAA 5G1SA 3T88A 2ZL2A 3K8XA 4QIJA 2X24A 2J5SA 4JCSA 2D3TA 4U18A 3T89A 2ZQQA 3GF7A 3U9SB 3HE2A 4ZDCA 3PGQA 2VSSA 3U9TB 3M6NA 4RCNA 5JBWA 4K29A 4F47A 3QKAA 1ON3A 3WG5A 4RYFH 4L8KA 2J5GA 3OT6A 3BEZA 5G1RA 5INGA 3T8AA 3FF6A 5DZKA 3ZW9A 2IEXA 4B3IA 2F9IB 4NNQA 5KDRB 4LK5A 2HW5A 3L3SA 5E0SA 3QYRA 3KTGA 5E0SH 3H0SA 3TLFA 2VSUC 2W3PA 3N6RB 2VSUE 1WDMA 4FZWA 5C90A 4MXIA 5KJPA 4ZDEA 1OD2A 3MT6A 3GMAA 5FUSA 3KTHA 1UYTA 3LKEA 2C8TA 1WDLA 3QREA 3Q7HA 4JJTA 2YJGA 4KNPA 2F6IA 2FW2A 4EMMA 1X0UA 1J7XA 4ASIA 1XNYA 3RSIA 2NP9A 1YG8A 1Q51A 1YG6A 5DTPA 1OD4A 3R9QA 5DUCA 3BF0A 3HINA 3M6MA 2J5GD 2QQ3A 4FN7A 2CBYA 3V5EA 2VSSF 5C9GA 3IB9A 2VSUA 3HP0A 4FB8A 1FCFA 1RJMA 1XX4A 1Q52A 3R6HA 4FNBA 3R9TA 3HLN1 4FNDA 1MJ3A 3TVWA 5FIFA 2X58A 2F6QA 4ELWA 1XNVA 3RRVA 4RYFA 2J5IA 3ZWCA 4Q0GA 3MFMA 3H81A 1VRGA 3DJAA 1FC7A 3PE8A 3DORA 2Q35A 4WZ8B 3LAOA 2ZL0A 3OC7A 3TT7A 4ELSA 4K2NA 4IZCA 1UYVA 1XO6A 2WTBA 4L6WA 1HZDA 4U0HA 2PG8A 3QXZA 4IZBA 3QK8A 3H0UA 4HDTA 1TYFA 3TVUA 1UYSA 1ON9A 2GTRA 3QXIA 4Q1IA 1K32A 3RSTA 2VREA 1JXZA 3JU1A 2VX2A 1NZYA 1PIXA 2A7KA 3SLLA 2BZRA 1HNOA 3OMEA 4MI2A 4GM2A 3HRXA 3KTIA 1TG6A 3T8BA 1XNWA 4WCZA 4IZDA 4HNKA 1RJNA 5DUFA 3GKBA 3H02A 3FDUA 4JYLA 4QFEA 3ISAA 2DUBA 5CTBA 1O8UA 2A81A 3T3WA 5DU4A 3ZW8A 4G2RA 2VSUF 3R9SA 1PJHA 3MOYA 3PEAA 4ZDDA 2PBPA 3NJBA 4ELXA 3IBBA 3TT6A 3TRRA 3P5MA 4U1AA 3V5IA 1W2XA 4KPKA 4YLHA 4U0GA 4JCTA 3KQFA 3KTJA 4U0GH 1K39A 3PZKA 1DCIA 2FBMA 4DI1A 3H0JA 1SG4A 4OMRA 1EY3A 4KD6A 1NZYB 3P2LA 2CE3A 3BPPA 3TZ3A 2J5II 4EMPA 5HUQA 5DU6A 4FJWD 4B3HA 4B3JA 5INIA 2ZL3A 3GF3A 5DU8A 1SZOA 3QMJA 4JVTA 3BPTA 3Q0GA 3IAVA 4JSBA 5IKLB 2Q2XA 5DKPA 3QWDA 4I52A 3H0QA 5INFA 5G1QA 1EF8A 2A7SA 5E0NX 2F9YA 3TDCA 3SWXA 4ZDBA 3ZWAA 5DTWA 5MGBA 4K3WA 2PPYA 4JYJA 5DZKH 3ZWBA 3I47A 1FC6A 3Q1TA 1EF9A 1WDKA 3R0OA 4Z0MA 3Q0JA 2UZFA 3TV5A 1N6EA 4J2UA 1UYRA 2Q34A 2DEOA 4GHNA 2J5IB 4I4ZA 1WZ8A 2VSSE 1UIYA 3GLMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P85 A;  4FN8 A;  4OLQ A;  4I42 A;  4U19 A;  4JWV A;  1Y7O A;  5CTC A;  2F9I A;  1N6F A;  4JFC A;  3ST9 A;  5KDR A;  2FZS A;  3MYB A;  1N6D A;  3KTK A;  3VIV A;  4JCQ A;  4EML A;  1FC9 A;  4OG1 A;  1HNU A;  2F9Y B;  4QII A;  4WYO B;  4MOU A;  5DL1 A;  4HC8 A;  5JBX A;  3NJD A;  3G64 A;  2ZQR A;  4ZDF A;  4ZU2 A;  4KWB A;  1DUB A;  4JOT A;  4FZW C;  3U9R B;  2EJ5 A;  4JCR A;  4NEK A;  3K50 A;  2ZL4 A;  3STA A;  5G1S A;  3T88 A;  2ZL2 A;  3K8X A;  4QIJ A;  2X24 A;  2J5S A;  4JCS A;  2D3T A;  4U18 A;  3T89 A;  2ZQQ A;  3GF7 A;  3U9S B;  3HE2 A;  4ZDC A;  3PGQ A;  2VSS A;  3U9T B;  3M6N A;  4RCN A;  5JBW A;  4K29 A;  4F47 A;  3QKA A;  1ON3 A;  3WG5 A;  4RYF H;  4L8K A;  2J5G A;  3OT6 A;  3BEZ A;  5G1R A;  5ING A;  3T8A A;  3FF6 A;  5DZK A;  3ZW9 A;  2IEX A;  4B3I A;  2F9I B;  4NNQ A;  5KDR B;  4LK5 A;  2HW5 A;  3L3S A;  5E0S A;  3QYR A;  3KTG A;  5E0S H;  3H0S A;  3TLF A;  2VSU C;  2W3P A;  3N6R B;  2VSU E;  1WDM A;  4FZW A;  5C90 A;  4MXI A;  5KJP A;  4ZDE A;  1OD2 A;  3MT6 A;  3GMA A;  5FUS A;  3KTH A;  1UYT A;  3LKE A;  2C8T A;  1WDL A;  3QRE A;  3Q7H A;  4JJT A;  4KNP A;  2F6I A;  2FW2 A;  4EMM A;  1X0U A;  1J7X A;  4ASI A;  1XNY A;  3RSI A;  2NP9 A;  1YG8 A;  1Q51 A;  1YG6 A;  5DTP A;  1OD4 A;  3R9Q A;  5DUC A;  3BF0 A;  3HIN A;  3M6M A;  2J5G D;  2QQ3 A;  4FN7 A;  2CBY A;  3V5E A;  2VSS F;  5C9G A;  3IB9 A;  2VSU A;  3HP0 A;  4FB8 A;  1FCF A;  1RJM A;  1XX4 A;  1Q52 A;  3R6H A;  4FNB A;  3R9T A;  3HLN 1;  4FND A;  1MJ3 A;  3TVW A;  5FIF A;  2X58 A;  2F6Q A;  4ELW A;  1XNV A;  3RRV A;  4RYF A;  2J5I A;  3ZWC A;  4Q0G A;  3MFM A;  3H81 A;  1VRG A;  3DJA A;  1FC7 A;  3PE8 A;  3DOR A;  2Q35 A;  4WZ8 B;  3LAO A;  2ZL0 A;  3OC7 A;  3TT7 A;  4ELS A;  4K2N A;  4IZC A;  1UYV A;  1XO6 A;  2WTB A;  4L6W A;  1HZD A;  4U0H A;  2PG8 A;  3QXZ A;  4IZB A;  3QK8 A;  3H0U A;  1TYF A;  3TVU A;  1UYS A;  1ON9 A;  2GTR A;  3QXI A;  4Q1I A;  1K32 A;  3RST A;  2VRE A;  1JXZ A;  3JU1 A;  2VX2 A;  1NZY A;  1PIX A;  2A7K A;  3SLL A;  2BZR A;  1HNO A;  3OME A;  4MI2 A;  4GM2 A;  3HRX A;  3KTI A;  1TG6 A;  3T8B A;  1XNW A;  4WCZ A;  4IZD A;  4HNK A;  1RJN A;  5DUF A;  3GKB A;  3H02 A;  3FDU A;  4JYL A;  4QFE A;  3ISA A;  2DUB A;  5CTB A;  1O8U A;  2A81 A;  3T3W A;  5DU4 A;  3ZW8 A;  4G2R A;  2VSU F;  3R9S A;  1PJH A;  3MOY A;  3PEA A;  4ZDD A;  2PBP A;  3NJB A;  4ELX A;  3IBB A;  3TT6 A;  3TRR A;  3P5M A;  4U1A A;  3V5I A;  1W2X A;  4KPK A;  4YLH A;  4U0G A;  4JCT A;  3KQF A;  3KTJ A;  4U0G H;  1K39 A;  3PZK A;  1DCI A;  2FBM A;  4DI1 A;  3H0J A;  1SG4 A;  4OMR A;  1EY3 A;  4KD6 A;  1NZY B;  3P2L A;  2CE3 A;  3BPP A;  3TZ3 A;  2J5I I;  4EMP A;  5DU6 A;  4FJW D;  4B3H A;  4B3J A;  5INI A;  2ZL3 A;  3GF3 A;  5DU8 A;  1SZO A;  3QMJ A;  4JVT A;  3Q0G A;  3IAV A;  4JSB A;  5IKL B;  2Q2X A;  5DKP A;  3QWD A;  4I52 A;  3H0Q A;  5INF A;  5G1Q A;  1EF8 A;  2A7S A;  5E0N X;  2F9Y A;  3TDC A;  3SWX A;  4ZDB A;  3ZWA A;  5DTW A;  5MGB A;  4K3W A;  2PPY A;  4JYJ A;  5DZK H;  3ZWB A;  3I47 A;  1FC6 A;  3Q1T A;  1EF9 A;  1WDK A;  3R0O A;  4Z0M A;  3Q0J A;  2UZF A;  3TV5 A;  1N6E A;  1UYR A;  2Q34 A;  2DEO A;  4GHN A;  2J5I B;  4I4Z A;  1WZ8 A;  2VSS E;  1UIY A;  3GLM A; 
#chains in the Genus database with same CATH topology
 3P85 A;  4FN8 A;  4OLQ A;  4I42 A;  4U19 A;  4JWV A;  1Y7O A;  5CTC A;  2F9I A;  1N6F A;  4JFC A;  3ST9 A;  5KDR A;  2FZS A;  3MYB A;  1N6D A;  3KTK A;  3VIV A;  4JCQ A;  4EML A;  1FC9 A;  4OG1 A;  1HNU A;  2F9Y B;  4QII A;  4WYO B;  4MOU A;  4NAR A;  5DL1 A;  4HC8 A;  5JBX A;  3NJD A;  3G64 A;  2ZQR A;  4ZDF A;  4ZU2 A;  4KWB A;  1DUB A;  4JOT A;  4FZW C;  3U9R B;  2EJ5 A;  4JCR A;  4NEK A;  3K50 A;  2ZL4 A;  3STA A;  5G1S A;  3T88 A;  2ZL2 A;  3K8X A;  4QIJ A;  2X24 A;  2J5S A;  4JCS A;  2D3T A;  4U18 A;  3T89 A;  2ZQQ A;  3GF7 A;  3U9S B;  3HE2 A;  4ZDC A;  3PGQ A;  2VSS A;  3U9T B;  3M6N A;  4RCN A;  5JBW A;  4K29 A;  4F47 A;  3QKA A;  1ON3 A;  3WG5 A;  4RYF H;  4L8K A;  2J5G A;  3OT6 A;  3BEZ A;  5G1R A;  5ING A;  3T8A A;  3FF6 A;  5DZK A;  3ZW9 A;  2IEX A;  4B3I A;  2F9I B;  4NNQ A;  5KDR B;  4LK5 A;  2HW5 A;  3L3S A;  5E0S A;  3QYR A;  3KTG A;  5E0S H;  3H0S A;  3TLF A;  2VSU C;  2W3P A;  3N6R B;  2VSU E;  1WDM A;  4FZW A;  5C90 A;  4MXI A;  5KJP A;  4ZDE A;  1OD2 A;  3MT6 A;  3GMA A;  5FUS A;  3KTH A;  1UYT A;  3LKE A;  2C8T A;  1WDL A;  3QRE A;  3Q7H A;  4JJT A;  2YJG A;  4KNP A;  2F6I A;  2FW2 A;  4EMM A;  1X0U A;  1J7X A;  4ASI A;  1XNY A;  3RSI A;  2NP9 A;  1YG8 A;  1Q51 A;  1YG6 A;  5DTP A;  1OD4 A;  3R9Q A;  5DUC A;  3BF0 A;  3HIN A;  3M6M A;  2J5G D;  2QQ3 A;  4FN7 A;  2CBY A;  3V5E A;  2VSS F;  5C9G A;  3IB9 A;  2VSU A;  3HP0 A;  4FB8 A;  1FCF A;  1RJM A;  1XX4 A;  1Q52 A;  3R6H A;  4FNB A;  3R9T A;  3HLN 1;  4FND A;  1MJ3 A;  3TVW A;  5FIF A;  2X58 A;  2F6Q A;  4ELW A;  1XNV A;  3RRV A;  4RYF A;  2J5I A;  3ZWC A;  4Q0G A;  3MFM A;  3H81 A;  1VRG A;  3DJA A;  1FC7 A;  3PE8 A;  3DOR A;  2Q35 A;  4WZ8 B;  3LAO A;  2ZL0 A;  3OC7 A;  3TT7 A;  4ELS A;  4K2N A;  4IZC A;  1UYV A;  1XO6 A;  2WTB A;  4L6W A;  1HZD A;  4U0H A;  2PG8 A;  3QXZ A;  4IZB A;  3QK8 A;  3H0U A;  4HDT A;  1TYF A;  3TVU A;  1UYS A;  1ON9 A;  2GTR A;  3QXI A;  4Q1I A;  1K32 A;  3RST A;  2VRE A;  1JXZ A;  3JU1 A;  2VX2 A;  1NZY A;  1PIX A;  2A7K A;  3SLL A;  2BZR A;  1HNO A;  3OME A;  4MI2 A;  4GM2 A;  3HRX A;  3KTI A;  1TG6 A;  3T8B A;  1XNW A;  4WCZ A;  4IZD A;  4HNK A;  1RJN A;  5DUF A;  3GKB A;  3H02 A;  3FDU A;  4JYL A;  4QFE A;  3ISA A;  2DUB A;  5CTB A;  1O8U A;  2A81 A;  3T3W A;  5DU4 A;  3ZW8 A;  4G2R A;  2VSU F;  3R9S A;  1PJH A;  3MOY A;  3PEA A;  4ZDD A;  2PBP A;  3NJB A;  4ELX A;  3IBB A;  3TT6 A;  3TRR A;  3P5M A;  4U1A A;  3V5I A;  1W2X A;  4KPK A;  4YLH A;  4U0G A;  4JCT A;  3KQF A;  3KTJ A;  4U0G H;  1K39 A;  3PZK A;  1DCI A;  2FBM A;  4DI1 A;  3H0J A;  1SG4 A;  4OMR A;  1EY3 A;  4KD6 A;  1NZY B;  3P2L A;  2CE3 A;  3BPP A;  3TZ3 A;  2J5I I;  4EMP A;  5HUQ A;  5DU6 A;  4FJW D;  4B3H A;  4B3J A;  5INI A;  2ZL3 A;  3GF3 A;  5DU8 A;  1SZO A;  3QMJ A;  4JVT A;  3BPT A;  3Q0G A;  3IAV A;  4JSB A;  5IKL B;  2Q2X A;  5DKP A;  3QWD A;  4I52 A;  3H0Q A;  5INF A;  5G1Q A;  1EF8 A;  2A7S A;  5E0N X;  2F9Y A;  3TDC A;  3SWX A;  4ZDB A;  3ZWA A;  5DTW A;  5MGB A;  4K3W A;  2PPY A;  4JYJ A;  5DZK H;  3ZWB A;  3I47 A;  1FC6 A;  3Q1T A;  1EF9 A;  1WDK A;  3R0O A;  4Z0M A;  3Q0J A;  2UZF A;  3TV5 A;  1N6E A;  4J2U A;  1UYR A;  2Q34 A;  2DEO A;  4GHN A;  2J5I B;  4I4Z A;  1WZ8 A;  2VSS E;  1UIY A;  3GLM A; 
#chains in the Genus database with same CATH homology
 3P85 A;  4FN8 A;  4OLQ A;  4I42 A;  4U19 A;  4JWV A;  1Y7O A;  5CTC A;  2F9I A;  1N6F A;  4JFC A;  3ST9 A;  5KDR A;  2FZS A;  3MYB A;  1N6D A;  3KTK A;  3VIV A;  4JCQ A;  4EML A;  1FC9 A;  4OG1 A;  1HNU A;  2F9Y B;  4QII A;  4WYO B;  4MOU A;  4NAR A;  5DL1 A;  4HC8 A;  5JBX A;  3NJD A;  3G64 A;  2ZQR A;  4ZDF A;  4ZU2 A;  4KWB A;  1DUB A;  4JOT A;  4FZW C;  3U9R B;  2EJ5 A;  4JCR A;  4NEK A;  3K50 A;  2ZL4 A;  3STA A;  5G1S A;  3T88 A;  2ZL2 A;  3K8X A;  4QIJ A;  2X24 A;  2J5S A;  4JCS A;  2D3T A;  4U18 A;  3T89 A;  2ZQQ A;  3GF7 A;  3U9S B;  3HE2 A;  4ZDC A;  3PGQ A;  2VSS A;  3U9T B;  3M6N A;  4RCN A;  5JBW A;  4K29 A;  4F47 A;  3QKA A;  1ON3 A;  3WG5 A;  4RYF H;  4L8K A;  2J5G A;  3OT6 A;  3BEZ A;  5G1R A;  5ING A;  3T8A A;  3FF6 A;  5DZK A;  3ZW9 A;  2IEX A;  4B3I A;  2F9I B;  4NNQ A;  5KDR B;  4LK5 A;  2HW5 A;  3L3S A;  5E0S A;  3QYR A;  3KTG A;  5E0S H;  3H0S A;  3TLF A;  2VSU C;  2W3P A;  3N6R B;  2VSU E;  1WDM A;  4FZW A;  5C90 A;  4MXI A;  5KJP A;  4ZDE A;  1OD2 A;  3MT6 A;  3GMA A;  5FUS A;  3KTH A;  1UYT A;  3LKE A;  2C8T A;  1WDL A;  3QRE A;  3Q7H A;  4JJT A;  2YJG A;  4KNP A;  2F6I A;  2FW2 A;  4EMM A;  1X0U A;  1J7X A;  4ASI A;  1XNY A;  3RSI A;  2NP9 A;  1YG8 A;  1Q51 A;  1YG6 A;  5DTP A;  1OD4 A;  3R9Q A;  5DUC A;  3BF0 A;  3HIN A;  3M6M A;  2J5G D;  2QQ3 A;  4FN7 A;  2CBY A;  3V5E A;  2VSS F;  5C9G A;  3IB9 A;  2VSU A;  3HP0 A;  4FB8 A;  1FCF A;  1RJM A;  1XX4 A;  1Q52 A;  3R6H A;  4FNB A;  3R9T A;  3HLN 1;  4FND A;  1MJ3 A;  3TVW A;  5FIF A;  2X58 A;  2F6Q A;  4ELW A;  1XNV A;  3RRV A;  4RYF A;  2J5I A;  3ZWC A;  4Q0G A;  3MFM A;  3H81 A;  1VRG A;  3DJA A;  1FC7 A;  3PE8 A;  3DOR A;  2Q35 A;  4WZ8 B;  3LAO A;  2ZL0 A;  3OC7 A;  3TT7 A;  4ELS A;  4K2N A;  4IZC A;  1UYV A;  1XO6 A;  2WTB A;  4L6W A;  1HZD A;  4U0H A;  2PG8 A;  3QXZ A;  4IZB A;  3QK8 A;  3H0U A;  4HDT A;  1TYF A;  3TVU A;  1UYS A;  1ON9 A;  2GTR A;  3QXI A;  4Q1I A;  1K32 A;  3RST A;  2VRE A;  1JXZ A;  3JU1 A;  2VX2 A;  1NZY A;  1PIX A;  2A7K A;  3SLL A;  2BZR A;  1HNO A;  3OME A;  4MI2 A;  4GM2 A;  3HRX A;  3KTI A;  1TG6 A;  3T8B A;  1XNW A;  4WCZ A;  4IZD A;  4HNK A;  1RJN A;  5DUF A;  3GKB A;  3H02 A;  3FDU A;  4JYL A;  4QFE A;  3ISA A;  2DUB A;  5CTB A;  1O8U A;  2A81 A;  3T3W A;  5DU4 A;  3ZW8 A;  4G2R A;  2VSU F;  3R9S A;  1PJH A;  3MOY A;  3PEA A;  4ZDD A;  2PBP A;  3NJB A;  4ELX A;  3IBB A;  3TT6 A;  3TRR A;  3P5M A;  4U1A A;  3V5I A;  1W2X A;  4KPK A;  4YLH A;  4U0G A;  4JCT A;  3KQF A;  3KTJ A;  4U0G H;  1K39 A;  3PZK A;  1DCI A;  2FBM A;  4DI1 A;  3H0J A;  1SG4 A;  4OMR A;  1EY3 A;  4KD6 A;  1NZY B;  3P2L A;  2CE3 A;  3BPP A;  3TZ3 A;  2J5I I;  4EMP A;  5HUQ A;  5DU6 A;  4FJW D;  4B3H A;  4B3J A;  5INI A;  2ZL3 A;  3GF3 A;  5DU8 A;  1SZO A;  3QMJ A;  4JVT A;  3BPT A;  3Q0G A;  3IAV A;  4JSB A;  5IKL B;  2Q2X A;  5DKP A;  3QWD A;  4I52 A;  3H0Q A;  5INF A;  5G1Q A;  1EF8 A;  2A7S A;  5E0N X;  2F9Y A;  3TDC A;  3SWX A;  4ZDB A;  3ZWA A;  5DTW A;  5MGB A;  4K3W A;  2PPY A;  4JYJ A;  5DZK H;  3ZWB A;  3I47 A;  1FC6 A;  3Q1T A;  1EF9 A;  1WDK A;  3R0O A;  4Z0M A;  3Q0J A;  2UZF A;  3TV5 A;  1N6E A;  4J2U A;  1UYR A;  2Q34 A;  2DEO A;  4GHN A;  2J5I B;  4I4Z A;  1WZ8 A;  2VSS E;  1UIY A;  3GLM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...