4EMPA

Crystal structure of the mutant of clpp e137a from staphylococcus aureus
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
189
structure length
189
Chain Sequence
IPTVIETTNRGERAYDIYSRLLKDRIIMLGSQIDDNVANSIVSQLLFLQAQDSEKDIYLYINSPGGSVTAGFAIYDTIQHIKPDVQTICIGMAASMGSFLLAAGAKGKRFALPNAEVMIHQPLGGAQGQATEIAIAANHILKTREKLNRILSERTGQSIEKIQKDTDRDNFLTAEEAKEYGLIDEVMVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Helix unfolding/refolding characterizes the functional dynamics of Staphylococcus aureus Clp protease
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords ATP-dependent Clp protease proteolytic subunit
total genus 65
structure length 189
sequence length 189
chains with identical sequence B, C, E, F, G, I, K, L, M, N, S, T, V
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4empA00
5JBWA 4JFCA 2PBPA 4JCSA 1PJHA 4U19A 3QWDA 4ELXA 3ZWCA 4L6WA 3KTIA 5E0SA 4ZDCA 3OT6A 1Q52A 4FZWC 4I52A 4FNDA 2VSUE 4NNQA 3KTKA 1K32A 3BEZA 3FF6A 5CTBA 2J5GD 3TDCA 4IZCA 4JSBA 1UYSA 4K2NA 3RSIA 3WG5A 3QXZA 3JU1A 3ZWBA 3GF3A 3I47A 4HNKA 1OD2A 2VREA 1NZYA 2ZL2A 2VSSA 4U0HA 3TZ3A 1XNWA 3HLN1 5DZKA 5DU8A 3TRRA 2J5SA 3QKAA 3MOYA 3ST9A 4JCTA 4ELSA 3LAOA 2VSUA 3MFMA 3P5MA 5FUSA 3KQFA 5DL1A 2J5II 3NJDA 4FNBA 4K29A 2PPYA 3HRXA 1EF8A 1SZOA 5DTWA 4IZBA 1DUBA 1FC9A 1WDMA 5KDRB 3SLLA 5KJPA 2Q35A 3OC7A 4RCNA 4EMPA 2PG8A 3SWXA 2A7KA 3H0QA 1YG6A 3STAA 3IAVA 3BPPA 4LK5A 4G2RA 3TT6A 4U0GA 4JYJA 1FC7A 3P2LA 5E0NX 2FBMA 4FJWD 5C90A 2DUBA 5KDRA 5G1RA 5CTCA 4QIIA 3K8XA 4B3IA 3V5EA 1N6EA 1WZ8A 4U18A 2QQ3A 4NEKA 4FB8A 2WTBA 3T8BA 3U9RB 5DU4A 2CBYA 2X58A 3Q0GA 4GM2A 4Q1IA 3OMEA 4GHNA 1XNVA 1X0UA 1UYRA 1O8UA 3TVWA 3KTHA 3T8AA 4EMLA 3Q0JA 3M6MA 1ON3A 3QK8A 3QMJA 4B3HA 3ISAA 3PGQA 1UYTA 5DUFA 4ZDEA 5DU6A 4ZU2A 1NZYB 3Q7HA 3R9QA 4HC8A 2W3PA 2GTRA 1UIYA 2Q34A 3HP0A 4KNPA 2VSSE 3Q1TA 4DI1A 4JWVA 3H0JA 3TLFA 3KTJA 2ZL3A 4OMRA 1VRGA 2Q2XA 4WCZA 4I42A 1RJMA 3FDUA 5C9GA 1PIXA 3H0UA 1WDKA 1HNOA 1W2XA 4JCQA 3H02A 3DORA 3VIVA 2ZL4A 5E0SH 4RYFA 1XO6A 4KWBA 5G1QA 2A7SA 1Q51A 4MXIA 4Q0GA 4FZWA 4ELWA 4RYFH 3N6RB 3T89A 3ZW8A 1XX4A 3TVUA 3K50A 3ZW9A 2A81A 2J5IA 4K3WA 2ZL0A 4YLHA 3U9TB 3BF0A 1Y7OA 3QXIA 3LKEA 3GKBA 5INGA 4L8KA 2ZQRA 1EF9A 2C8TA 3R0OA 3T88A 1FCFA 4B3JA 2F9IA 3PEAA 1ON9A 3T3WA 5JBXA 3MYBA 4ZDFA 3PE8A 3GF7A 4FN7A 2EJ5A 3IBBA 2BZRA 5INFA 3GMAA 4JOTA 4JVTA 4FN8A 5IKLB 3IB9A 5DKPA 2F9YB 3ZWAA 2IEXA 3M6NA 1YG8A 1FC6A 3V5IA 4QIJA 1K39A 3R9SA 1N6FA 2NP9A 2FZSA 3P85A 4U0GH 3L3SA 1MJ3A 5INIA 3QYRA 3TT7A 1UYVA 1TYFA 2VSUF 4MOUA 2D3TA 4EMMA 3RSTA 3R9TA 2HW5A 4KD6A 3PZKA 1HZDA 2CE3A 3G64A 2UZFA 1RJNA 4KPKA 1SG4A 2F9YA 1JXZA 4JJTA 1HNUA 4MI2A 3DJAA 2ZQQA 5DZKH 4ASIA 4JYLA 3HE2A 3U9SB 2F6QA 4ZDDA 2J5GA 4I4ZA 2X24A 1OD4A 1EY3A 4Z0MA 4U1AA 2F9IB 3GLMA 4WZ8B 3R6HA 3NJBA 3MT6A 5DTPA 1DCIA 4JCRA 2DEOA 1J7XA 1XNYA 4IZDA 3HINA 1TG6A 3RRVA 4ZDBA 4WYOB 3H0SA 4QFEA 4F47A 5G1SA 2F6IA 2VSUC 2J5IB 3QREA 1WDLA 4OLQA 3H81A 3KTGA 1N6DA 5MGBA 2VSSF 3TV5A 5DUCA 5FIFA 2VX2A 2FW2A 4OG1A
chains in the Genus database with same CATH superfamily
5JBWA 4JFCA 2PBPA 4JCSA 1PJHA 4U19A 3QWDA 4ELXA 3ZWCA 4L6WA 3KTIA 5E0SA 4ZDCA 3OT6A 1Q52A 4FZWC 4I52A 4FNDA 2VSUE 4NNQA 3KTKA 1K32A 3BEZA 3FF6A 5CTBA 2J5GD 3TDCA 4IZCA 4JSBA 1UYSA 4K2NA 3RSIA 3WG5A 3QXZA 3JU1A 3ZWBA 3GF3A 3I47A 4HNKA 1OD2A 2VREA 1NZYA 2ZL2A 2VSSA 4U0HA 3TZ3A 1XNWA 3HLN1 5DZKA 5DU8A 3TRRA 2J5SA 3QKAA 3MOYA 3ST9A 4JCTA 4ELSA 3LAOA 2VSUA 3MFMA 3P5MA 5FUSA 3KQFA 5DL1A 2J5II 3NJDA 4FNBA 4K29A 2PPYA 3HRXA 1EF8A 1SZOA 5DTWA 4IZBA 1DUBA 1FC9A 5HUQA 1WDMA 5KDRB 3SLLA 5KJPA 2Q35A 3OC7A 4RCNA 4EMPA 2PG8A 3SWXA 2A7KA 3H0QA 1YG6A 3STAA 3IAVA 3BPPA 4LK5A 4G2RA 3TT6A 4U0GA 4JYJA 1FC7A 3P2LA 5E0NX 2FBMA 4FJWD 5C90A 2DUBA 5KDRA 5G1RA 5CTCA 4QIIA 3K8XA 4B3IA 3V5EA 1N6EA 1WZ8A 4U18A 2QQ3A 4NEKA 4FB8A 2WTBA 3T8BA 3U9RB 5DU4A 2CBYA 2X58A 3Q0GA 4GM2A 4Q1IA 3OMEA 4GHNA 1XNVA 1X0UA 1UYRA 1O8UA 3TVWA 3KTHA 3T8AA 4EMLA 3Q0JA 3M6MA 1ON3A 3QK8A 3QMJA 4NARA 4B3HA 3ISAA 3PGQA 1UYTA 5DUFA 4ZDEA 5DU6A 4ZU2A 1NZYB 3Q7HA 3R9QA 4HC8A 2W3PA 2GTRA 1UIYA 2Q34A 3HP0A 4KNPA 2VSSE 3Q1TA 4DI1A 4JWVA 3H0JA 3TLFA 3KTJA 2ZL3A 4OMRA 1VRGA 2Q2XA 4WCZA 4I42A 1RJMA 3FDUA 5C9GA 1PIXA 3H0UA 1WDKA 1HNOA 1W2XA 4JCQA 3H02A 3DORA 3VIVA 2ZL4A 5E0SH 4RYFA 1XO6A 4KWBA 5G1QA 2A7SA 1Q51A 4MXIA 4Q0GA 4FZWA 4ELWA 4RYFH 3N6RB 3T89A 3ZW8A 1XX4A 3TVUA 4HDTA 3K50A 3ZW9A 2A81A 2J5IA 4K3WA 2ZL0A 4YLHA 3U9TB 3BF0A 1Y7OA 3QXIA 3LKEA 3GKBA 5INGA 2YJGA 4L8KA 2ZQRA 1EF9A 2C8TA 3R0OA 3T88A 1FCFA 4B3JA 2F9IA 3PEAA 1ON9A 3T3WA 5JBXA 3MYBA 4ZDFA 3PE8A 3GF7A 4FN7A 2EJ5A 3IBBA 2BZRA 5INFA 3GMAA 4JOTA 4JVTA 4FN8A 5IKLB 3IB9A 5DKPA 2F9YB 3ZWAA 2IEXA 3M6NA 1YG8A 1FC6A 3V5IA 4QIJA 1K39A 3BPTA 3R9SA 1N6FA 2NP9A 2FZSA 3P85A 4U0GH 3L3SA 1MJ3A 5INIA 3QYRA 3TT7A 1UYVA 1TYFA 2VSUF 4MOUA 2D3TA 4EMMA 3RSTA 3R9TA 2HW5A 4KD6A 3PZKA 1HZDA 2CE3A 3G64A 2UZFA 1RJNA 4KPKA 1SG4A 2F9YA 1JXZA 4JJTA 1HNUA 4MI2A 3DJAA 2ZQQA 5DZKH 4ASIA 4JYLA 3HE2A 3U9SB 2F6QA 4ZDDA 2J5GA 4I4ZA 2X24A 1OD4A 1EY3A 4Z0MA 4U1AA 2F9IB 3GLMA 4WZ8B 3R6HA 3NJBA 3MT6A 5DTPA 1DCIA 4JCRA 2DEOA 1J7XA 1XNYA 4IZDA 3HINA 1TG6A 3RRVA 4ZDBA 4WYOB 3H0SA 4QFEA 4F47A 5G1SA 2F6IA 2VSUC 2J5IB 3QREA 1WDLA 4OLQA 3H81A 3KTGA 1N6DA 5MGBA 4J2UA 2VSSF 3TV5A 5DUCA 5FIFA 2VX2A 2FW2A 4OG1A
chains in the Genus database with same CATH topology
5JBWA 4JFCA 2PBPA 4JCSA 1PJHA 4U19A 3QWDA 4ELXA 3ZWCA 4L6WA 3KTIA 5E0SA 4ZDCA 3OT6A 1Q52A 4FZWC 4I52A 4FNDA 2VSUE 4NNQA 3KTKA 1K32A 3BEZA 3FF6A 5CTBA 2J5GD 3TDCA 4IZCA 4JSBA 1UYSA 4K2NA 3RSIA 3WG5A 3QXZA 3JU1A 3ZWBA 3GF3A 3I47A 4HNKA 1OD2A 2VREA 1NZYA 2ZL2A 2VSSA 4U0HA 3TZ3A 1XNWA 3HLN1 5DZKA 5DU8A 3TRRA 2J5SA 3QKAA 3MOYA 3ST9A 4JCTA 4ELSA 3LAOA 2VSUA 3MFMA 3P5MA 5FUSA 3KQFA 5DL1A 2J5II 3NJDA 4FNBA 4K29A 2PPYA 3HRXA 1EF8A 1SZOA 5DTWA 4IZBA 1DUBA 1FC9A 5HUQA 1WDMA 5KDRB 3SLLA 5KJPA 2Q35A 3OC7A 4RCNA 4EMPA 2PG8A 3SWXA 2A7KA 3H0QA 1YG6A 3STAA 3IAVA 3BPPA 4LK5A 4G2RA 3TT6A 4U0GA 4JYJA 1FC7A 3P2LA 5E0NX 2FBMA 4FJWD 5C90A 2DUBA 5KDRA 5G1RA 5CTCA 4QIIA 3K8XA 4B3IA 3V5EA 1N6EA 1WZ8A 4U18A 2QQ3A 4NEKA 4FB8A 2WTBA 3T8BA 3U9RB 5DU4A 2CBYA 2X58A 3Q0GA 4GM2A 4Q1IA 3OMEA 4GHNA 1XNVA 1X0UA 1UYRA 1O8UA 3TVWA 3KTHA 3T8AA 4EMLA 3Q0JA 3M6MA 1ON3A 3QK8A 3QMJA 4NARA 4B3HA 3ISAA 3PGQA 1UYTA 5DUFA 4ZDEA 5DU6A 4ZU2A 1NZYB 3Q7HA 3R9QA 4HC8A 2W3PA 2GTRA 1UIYA 2Q34A 3HP0A 4KNPA 2VSSE 3Q1TA 4DI1A 4JWVA 3H0JA 3TLFA 3KTJA 2ZL3A 4OMRA 1VRGA 2Q2XA 4WCZA 4I42A 1RJMA 3FDUA 5C9GA 1PIXA 3H0UA 1WDKA 1HNOA 1W2XA 4JCQA 3H02A 3DORA 3VIVA 2ZL4A 5E0SH 4RYFA 1XO6A 4KWBA 5G1QA 2A7SA 1Q51A 4MXIA 4Q0GA 4FZWA 4ELWA 4RYFH 3N6RB 3T89A 3ZW8A 1XX4A 3TVUA 4HDTA 3K50A 3ZW9A 2A81A 2J5IA 4K3WA 2ZL0A 4YLHA 3U9TB 3BF0A 1Y7OA 3QXIA 3LKEA 3GKBA 5INGA 2YJGA 4L8KA 2ZQRA 1EF9A 2C8TA 3R0OA 3T88A 1FCFA 4B3JA 2F9IA 3PEAA 1ON9A 3T3WA 5JBXA 3MYBA 4ZDFA 3PE8A 3GF7A 4FN7A 2EJ5A 3IBBA 2BZRA 5INFA 3GMAA 4JOTA 4JVTA 4FN8A 5IKLB 3IB9A 5DKPA 2F9YB 3ZWAA 2IEXA 3M6NA 1YG8A 1FC6A 3V5IA 4QIJA 1K39A 3BPTA 3R9SA 1N6FA 2NP9A 2FZSA 3P85A 4U0GH 3L3SA 1MJ3A 5INIA 3QYRA 3TT7A 1UYVA 1TYFA 2VSUF 4MOUA 2D3TA 4EMMA 3RSTA 3R9TA 2HW5A 4KD6A 3PZKA 1HZDA 2CE3A 3G64A 2UZFA 1RJNA 4KPKA 1SG4A 2F9YA 1JXZA 4JJTA 1HNUA 4MI2A 3DJAA 2ZQQA 5DZKH 4ASIA 4JYLA 3HE2A 3U9SB 2F6QA 4ZDDA 2J5GA 4I4ZA 2X24A 1OD4A 1EY3A 4Z0MA 4U1AA 2F9IB 3GLMA 4WZ8B 3R6HA 3NJBA 3MT6A 5DTPA 1DCIA 4JCRA 2DEOA 1J7XA 1XNYA 4IZDA 3HINA 1TG6A 3RRVA 4ZDBA 4WYOB 3H0SA 4QFEA 4F47A 5G1SA 2F6IA 2VSUC 2J5IB 3QREA 1WDLA 4OLQA 3H81A 3KTGA 1N6DA 5MGBA 4J2UA 2VSSF 3TV5A 5DUCA 5FIFA 2VX2A 2FW2A 4OG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JBW A;  4JFC A;  2PBP A;  4JCS A;  1PJH A;  4U19 A;  3QWD A;  4ELX A;  3ZWC A;  4L6W A;  3KTI A;  5E0S A;  4ZDC A;  3OT6 A;  1Q52 A;  4FZW C;  4I52 A;  4FND A;  2VSU E;  4NNQ A;  3KTK A;  1K32 A;  3BEZ A;  3FF6 A;  5CTB A;  2J5G D;  3TDC A;  4IZC A;  4JSB A;  1UYS A;  4K2N A;  3RSI A;  3WG5 A;  3QXZ A;  3JU1 A;  3ZWB A;  3GF3 A;  3I47 A;  4HNK A;  1OD2 A;  2VRE A;  1NZY A;  2ZL2 A;  2VSS A;  4U0H A;  3TZ3 A;  1XNW A;  3HLN 1;  5DZK A;  5DU8 A;  3TRR A;  2J5S A;  3QKA A;  3MOY A;  3ST9 A;  4JCT A;  4ELS A;  3LAO A;  2VSU A;  3MFM A;  3P5M A;  5FUS A;  3KQF A;  5DL1 A;  2J5I I;  3NJD A;  4FNB A;  4K29 A;  2PPY A;  3HRX A;  1EF8 A;  1SZO A;  5DTW A;  4IZB A;  1DUB A;  1FC9 A;  1WDM A;  5KDR B;  3SLL A;  5KJP A;  2Q35 A;  3OC7 A;  4RCN A;  4EMP A;  2PG8 A;  3SWX A;  2A7K A;  3H0Q A;  1YG6 A;  3STA A;  3IAV A;  3BPP A;  4LK5 A;  4G2R A;  3TT6 A;  4U0G A;  4JYJ A;  1FC7 A;  3P2L A;  5E0N X;  2FBM A;  4FJW D;  5C90 A;  2DUB A;  5KDR A;  5G1R A;  5CTC A;  4QII A;  3K8X A;  4B3I A;  3V5E A;  1N6E A;  1WZ8 A;  4U18 A;  2QQ3 A;  4NEK A;  4FB8 A;  2WTB A;  3T8B A;  3U9R B;  5DU4 A;  2CBY A;  2X58 A;  3Q0G A;  4GM2 A;  4Q1I A;  3OME A;  4GHN A;  1XNV A;  1X0U A;  1UYR A;  1O8U A;  3TVW A;  3KTH A;  3T8A A;  4EML A;  3Q0J A;  3M6M A;  1ON3 A;  3QK8 A;  3QMJ A;  4B3H A;  3ISA A;  3PGQ A;  1UYT A;  5DUF A;  4ZDE A;  5DU6 A;  4ZU2 A;  1NZY B;  3Q7H A;  3R9Q A;  4HC8 A;  2W3P A;  2GTR A;  1UIY A;  2Q34 A;  3HP0 A;  4KNP A;  2VSS E;  3Q1T A;  4DI1 A;  4JWV A;  3H0J A;  3TLF A;  3KTJ A;  2ZL3 A;  4OMR A;  1VRG A;  2Q2X A;  4WCZ A;  4I42 A;  1RJM A;  3FDU A;  5C9G A;  1PIX A;  3H0U A;  1WDK A;  1HNO A;  1W2X A;  4JCQ A;  3H02 A;  3DOR A;  3VIV A;  2ZL4 A;  5E0S H;  4RYF A;  1XO6 A;  4KWB A;  5G1Q A;  2A7S A;  1Q51 A;  4MXI A;  4Q0G A;  4FZW A;  4ELW A;  4RYF H;  3N6R B;  3T89 A;  3ZW8 A;  1XX4 A;  3TVU A;  3K50 A;  3ZW9 A;  2A81 A;  2J5I A;  4K3W A;  2ZL0 A;  4YLH A;  3U9T B;  3BF0 A;  1Y7O A;  3QXI A;  3LKE A;  3GKB A;  5ING A;  4L8K A;  2ZQR A;  1EF9 A;  2C8T A;  3R0O A;  3T88 A;  1FCF A;  4B3J A;  2F9I A;  3PEA A;  1ON9 A;  3T3W A;  5JBX A;  3MYB A;  4ZDF A;  3PE8 A;  3GF7 A;  4FN7 A;  2EJ5 A;  3IBB A;  2BZR A;  5INF A;  3GMA A;  4JOT A;  4JVT A;  4FN8 A;  5IKL B;  3IB9 A;  5DKP A;  2F9Y B;  3ZWA A;  2IEX A;  3M6N A;  1YG8 A;  1FC6 A;  3V5I A;  4QIJ A;  1K39 A;  3R9S A;  1N6F A;  2NP9 A;  2FZS A;  3P85 A;  4U0G H;  3L3S A;  1MJ3 A;  5INI A;  3QYR A;  3TT7 A;  1UYV A;  1TYF A;  2VSU F;  4MOU A;  2D3T A;  4EMM A;  3RST A;  3R9T A;  2HW5 A;  4KD6 A;  3PZK A;  1HZD A;  2CE3 A;  3G64 A;  2UZF A;  1RJN A;  4KPK A;  1SG4 A;  2F9Y A;  1JXZ A;  4JJT A;  1HNU A;  4MI2 A;  3DJA A;  2ZQQ A;  5DZK H;  4ASI A;  4JYL A;  3HE2 A;  3U9S B;  2F6Q A;  4ZDD A;  2J5G A;  4I4Z A;  2X24 A;  1OD4 A;  1EY3 A;  4Z0M A;  4U1A A;  2F9I B;  3GLM A;  4WZ8 B;  3R6H A;  3NJB A;  3MT6 A;  5DTP A;  1DCI A;  4JCR A;  2DEO A;  1J7X A;  1XNY A;  4IZD A;  3HIN A;  1TG6 A;  3RRV A;  4ZDB A;  4WYO B;  3H0S A;  4QFE A;  4F47 A;  5G1S A;  2F6I A;  2VSU C;  2J5I B;  3QRE A;  1WDL A;  4OLQ A;  3H81 A;  3KTG A;  1N6D A;  5MGB A;  2VSS F;  3TV5 A;  5DUC A;  5FIF A;  2VX2 A;  2FW2 A;  4OG1 A; 
#chains in the Genus database with same CATH topology
 5JBW A;  4JFC A;  2PBP A;  4JCS A;  1PJH A;  4U19 A;  3QWD A;  4ELX A;  3ZWC A;  4L6W A;  3KTI A;  5E0S A;  4ZDC A;  3OT6 A;  1Q52 A;  4FZW C;  4I52 A;  4FND A;  2VSU E;  4NNQ A;  3KTK A;  1K32 A;  3BEZ A;  3FF6 A;  5CTB A;  2J5G D;  3TDC A;  4IZC A;  4JSB A;  1UYS A;  4K2N A;  3RSI A;  3WG5 A;  3QXZ A;  3JU1 A;  3ZWB A;  3GF3 A;  3I47 A;  4HNK A;  1OD2 A;  2VRE A;  1NZY A;  2ZL2 A;  2VSS A;  4U0H A;  3TZ3 A;  1XNW A;  3HLN 1;  5DZK A;  5DU8 A;  3TRR A;  2J5S A;  3QKA A;  3MOY A;  3ST9 A;  4JCT A;  4ELS A;  3LAO A;  2VSU A;  3MFM A;  3P5M A;  5FUS A;  3KQF A;  5DL1 A;  2J5I I;  3NJD A;  4FNB A;  4K29 A;  2PPY A;  3HRX A;  1EF8 A;  1SZO A;  5DTW A;  4IZB A;  1DUB A;  1FC9 A;  5HUQ A;  1WDM A;  5KDR B;  3SLL A;  5KJP A;  2Q35 A;  3OC7 A;  4RCN A;  4EMP A;  2PG8 A;  3SWX A;  2A7K A;  3H0Q A;  1YG6 A;  3STA A;  3IAV A;  3BPP A;  4LK5 A;  4G2R A;  3TT6 A;  4U0G A;  4JYJ A;  1FC7 A;  3P2L A;  5E0N X;  2FBM A;  4FJW D;  5C90 A;  2DUB A;  5KDR A;  5G1R A;  5CTC A;  4QII A;  3K8X A;  4B3I A;  3V5E A;  1N6E A;  1WZ8 A;  4U18 A;  2QQ3 A;  4NEK A;  4FB8 A;  2WTB A;  3T8B A;  3U9R B;  5DU4 A;  2CBY A;  2X58 A;  3Q0G A;  4GM2 A;  4Q1I A;  3OME A;  4GHN A;  1XNV A;  1X0U A;  1UYR A;  1O8U A;  3TVW A;  3KTH A;  3T8A A;  4EML A;  3Q0J A;  3M6M A;  1ON3 A;  3QK8 A;  3QMJ A;  4NAR A;  4B3H A;  3ISA A;  3PGQ A;  1UYT A;  5DUF A;  4ZDE A;  5DU6 A;  4ZU2 A;  1NZY B;  3Q7H A;  3R9Q A;  4HC8 A;  2W3P A;  2GTR A;  1UIY A;  2Q34 A;  3HP0 A;  4KNP A;  2VSS E;  3Q1T A;  4DI1 A;  4JWV A;  3H0J A;  3TLF A;  3KTJ A;  2ZL3 A;  4OMR A;  1VRG A;  2Q2X A;  4WCZ A;  4I42 A;  1RJM A;  3FDU A;  5C9G A;  1PIX A;  3H0U A;  1WDK A;  1HNO A;  1W2X A;  4JCQ A;  3H02 A;  3DOR A;  3VIV A;  2ZL4 A;  5E0S H;  4RYF A;  1XO6 A;  4KWB A;  5G1Q A;  2A7S A;  1Q51 A;  4MXI A;  4Q0G A;  4FZW A;  4ELW A;  4RYF H;  3N6R B;  3T89 A;  3ZW8 A;  1XX4 A;  3TVU A;  4HDT A;  3K50 A;  3ZW9 A;  2A81 A;  2J5I A;  4K3W A;  2ZL0 A;  4YLH A;  3U9T B;  3BF0 A;  1Y7O A;  3QXI A;  3LKE A;  3GKB A;  5ING A;  2YJG A;  4L8K A;  2ZQR A;  1EF9 A;  2C8T A;  3R0O A;  3T88 A;  1FCF A;  4B3J A;  2F9I A;  3PEA A;  1ON9 A;  3T3W A;  5JBX A;  3MYB A;  4ZDF A;  3PE8 A;  3GF7 A;  4FN7 A;  2EJ5 A;  3IBB A;  2BZR A;  5INF A;  3GMA A;  4JOT A;  4JVT A;  4FN8 A;  5IKL B;  3IB9 A;  5DKP A;  2F9Y B;  3ZWA A;  2IEX A;  3M6N A;  1YG8 A;  1FC6 A;  3V5I A;  4QIJ A;  1K39 A;  3BPT A;  3R9S A;  1N6F A;  2NP9 A;  2FZS A;  3P85 A;  4U0G H;  3L3S A;  1MJ3 A;  5INI A;  3QYR A;  3TT7 A;  1UYV A;  1TYF A;  2VSU F;  4MOU A;  2D3T A;  4EMM A;  3RST A;  3R9T A;  2HW5 A;  4KD6 A;  3PZK A;  1HZD A;  2CE3 A;  3G64 A;  2UZF A;  1RJN A;  4KPK A;  1SG4 A;  2F9Y A;  1JXZ A;  4JJT A;  1HNU A;  4MI2 A;  3DJA A;  2ZQQ A;  5DZK H;  4ASI A;  4JYL A;  3HE2 A;  3U9S B;  2F6Q A;  4ZDD A;  2J5G A;  4I4Z A;  2X24 A;  1OD4 A;  1EY3 A;  4Z0M A;  4U1A A;  2F9I B;  3GLM A;  4WZ8 B;  3R6H A;  3NJB A;  3MT6 A;  5DTP A;  1DCI A;  4JCR A;  2DEO A;  1J7X A;  1XNY A;  4IZD A;  3HIN A;  1TG6 A;  3RRV A;  4ZDB A;  4WYO B;  3H0S A;  4QFE A;  4F47 A;  5G1S A;  2F6I A;  2VSU C;  2J5I B;  3QRE A;  1WDL A;  4OLQ A;  3H81 A;  3KTG A;  1N6D A;  5MGB A;  4J2U A;  2VSS F;  3TV5 A;  5DUC A;  5FIF A;  2VX2 A;  2FW2 A;  4OG1 A; 
#chains in the Genus database with same CATH homology
 5JBW A;  4JFC A;  2PBP A;  4JCS A;  1PJH A;  4U19 A;  3QWD A;  4ELX A;  3ZWC A;  4L6W A;  3KTI A;  5E0S A;  4ZDC A;  3OT6 A;  1Q52 A;  4FZW C;  4I52 A;  4FND A;  2VSU E;  4NNQ A;  3KTK A;  1K32 A;  3BEZ A;  3FF6 A;  5CTB A;  2J5G D;  3TDC A;  4IZC A;  4JSB A;  1UYS A;  4K2N A;  3RSI A;  3WG5 A;  3QXZ A;  3JU1 A;  3ZWB A;  3GF3 A;  3I47 A;  4HNK A;  1OD2 A;  2VRE A;  1NZY A;  2ZL2 A;  2VSS A;  4U0H A;  3TZ3 A;  1XNW A;  3HLN 1;  5DZK A;  5DU8 A;  3TRR A;  2J5S A;  3QKA A;  3MOY A;  3ST9 A;  4JCT A;  4ELS A;  3LAO A;  2VSU A;  3MFM A;  3P5M A;  5FUS A;  3KQF A;  5DL1 A;  2J5I I;  3NJD A;  4FNB A;  4K29 A;  2PPY A;  3HRX A;  1EF8 A;  1SZO A;  5DTW A;  4IZB A;  1DUB A;  1FC9 A;  5HUQ A;  1WDM A;  5KDR B;  3SLL A;  5KJP A;  2Q35 A;  3OC7 A;  4RCN A;  4EMP A;  2PG8 A;  3SWX A;  2A7K A;  3H0Q A;  1YG6 A;  3STA A;  3IAV A;  3BPP A;  4LK5 A;  4G2R A;  3TT6 A;  4U0G A;  4JYJ A;  1FC7 A;  3P2L A;  5E0N X;  2FBM A;  4FJW D;  5C90 A;  2DUB A;  5KDR A;  5G1R A;  5CTC A;  4QII A;  3K8X A;  4B3I A;  3V5E A;  1N6E A;  1WZ8 A;  4U18 A;  2QQ3 A;  4NEK A;  4FB8 A;  2WTB A;  3T8B A;  3U9R B;  5DU4 A;  2CBY A;  2X58 A;  3Q0G A;  4GM2 A;  4Q1I A;  3OME A;  4GHN A;  1XNV A;  1X0U A;  1UYR A;  1O8U A;  3TVW A;  3KTH A;  3T8A A;  4EML A;  3Q0J A;  3M6M A;  1ON3 A;  3QK8 A;  3QMJ A;  4NAR A;  4B3H A;  3ISA A;  3PGQ A;  1UYT A;  5DUF A;  4ZDE A;  5DU6 A;  4ZU2 A;  1NZY B;  3Q7H A;  3R9Q A;  4HC8 A;  2W3P A;  2GTR A;  1UIY A;  2Q34 A;  3HP0 A;  4KNP A;  2VSS E;  3Q1T A;  4DI1 A;  4JWV A;  3H0J A;  3TLF A;  3KTJ A;  2ZL3 A;  4OMR A;  1VRG A;  2Q2X A;  4WCZ A;  4I42 A;  1RJM A;  3FDU A;  5C9G A;  1PIX A;  3H0U A;  1WDK A;  1HNO A;  1W2X A;  4JCQ A;  3H02 A;  3DOR A;  3VIV A;  2ZL4 A;  5E0S H;  4RYF A;  1XO6 A;  4KWB A;  5G1Q A;  2A7S A;  1Q51 A;  4MXI A;  4Q0G A;  4FZW A;  4ELW A;  4RYF H;  3N6R B;  3T89 A;  3ZW8 A;  1XX4 A;  3TVU A;  4HDT A;  3K50 A;  3ZW9 A;  2A81 A;  2J5I A;  4K3W A;  2ZL0 A;  4YLH A;  3U9T B;  3BF0 A;  1Y7O A;  3QXI A;  3LKE A;  3GKB A;  5ING A;  2YJG A;  4L8K A;  2ZQR A;  1EF9 A;  2C8T A;  3R0O A;  3T88 A;  1FCF A;  4B3J A;  2F9I A;  3PEA A;  1ON9 A;  3T3W A;  5JBX A;  3MYB A;  4ZDF A;  3PE8 A;  3GF7 A;  4FN7 A;  2EJ5 A;  3IBB A;  2BZR A;  5INF A;  3GMA A;  4JOT A;  4JVT A;  4FN8 A;  5IKL B;  3IB9 A;  5DKP A;  2F9Y B;  3ZWA A;  2IEX A;  3M6N A;  1YG8 A;  1FC6 A;  3V5I A;  4QIJ A;  1K39 A;  3BPT A;  3R9S A;  1N6F A;  2NP9 A;  2FZS A;  3P85 A;  4U0G H;  3L3S A;  1MJ3 A;  5INI A;  3QYR A;  3TT7 A;  1UYV A;  1TYF A;  2VSU F;  4MOU A;  2D3T A;  4EMM A;  3RST A;  3R9T A;  2HW5 A;  4KD6 A;  3PZK A;  1HZD A;  2CE3 A;  3G64 A;  2UZF A;  1RJN A;  4KPK A;  1SG4 A;  2F9Y A;  1JXZ A;  4JJT A;  1HNU A;  4MI2 A;  3DJA A;  2ZQQ A;  5DZK H;  4ASI A;  4JYL A;  3HE2 A;  3U9S B;  2F6Q A;  4ZDD A;  2J5G A;  4I4Z A;  2X24 A;  1OD4 A;  1EY3 A;  4Z0M A;  4U1A A;  2F9I B;  3GLM A;  4WZ8 B;  3R6H A;  3NJB A;  3MT6 A;  5DTP A;  1DCI A;  4JCR A;  2DEO A;  1J7X A;  1XNY A;  4IZD A;  3HIN A;  1TG6 A;  3RRV A;  4ZDB A;  4WYO B;  3H0S A;  4QFE A;  4F47 A;  5G1S A;  2F6I A;  2VSU C;  2J5I B;  3QRE A;  1WDL A;  4OLQ A;  3H81 A;  3KTG A;  1N6D A;  5MGB A;  4J2U A;  2VSS F;  3TV5 A;  5DUC A;  5FIF A;  2VX2 A;  2FW2 A;  4OG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...