4EMPA

Crystal structure of the mutant of clpp e137a from staphylococcus aureus
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
189
structure length
189
Chain Sequence
b'IPTVIETTNRGERAYDIYSRLLKDRIIMLGSQIDDNVANSIVSQLLFLQAQDSEKDIYLYINSPGGSVTAGFAIYDTIQHIKPDVQTICIGMAASMGSFLLAAGAKGKRFALPNAEVMIHQPLGGAQGQATEIAIAANHILKTREKLNRILSERTGQSIEKIQKDTDRDNFLTAEEAKEYGLIDEVMVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent Clp protease proteolytic subunit
publication title Helix unfolding/refolding characterizes the functional dynamics of Staphylococcus aureus Clp protease
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 65
structure length 189
sequence length 189
chains with identical sequence B, C, E, F, G, I, K, L, M, N, S, T, V
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4empA00
5DU4A 1XNVA 1XX4A 5INGA 2A7SA 4B3HA 5DU6A 3KTIA 3HP0A 4OMRA 1Q52A 4JCTA 3SLLA 3H81A 3H0JA 1SZOA 3ST9A 1EF8A 4KD6A 4RYFH 3RSIA 1WDKA 3H02A 2CBYA 3PE8A 4U0HA 5DZKH 4QIIA 3U9TB 2Q35A 2VSUC 1K32A 4JJTA 5CTCA 5DUFA 1NZYB 1TG6A 4YLHA 1OD2A 5DTWA 3TDCA 1DCIA 2BZRA 2QQ3A 4U18A 5G1SA 5E0SH 3H0QA 3T8BA 2ZQQA 3PGQA 2A81A 3Q0GA 3R0OA 3R9QA 4LK5A 4K2NA 1UYTA 2J5IA 2EJ5A 4IZBA 4GM2A 3QYRA 4KWBA 3QREA 4B3JA 4JCRA 4WCZA 3KTHA 1WZ8A 5DKPA 1SG4A 3NJDA 1WDMA 3HINA 1FC6A 2FZSA 1DUBA 3R6HA 3BEZA 3GLMA 3P2LA 3H0SA 3K8XA 2DEOA 5KDRB 4HC8A 4QIJA 4K3WA 4JSBA 5C9GA 3KTJA 5JBXA 4JCQA 4Z0MA 3DJAA 2F9IB 4FJWD 3ZW8A 4ZDBA 3HE2A 1UIYA 2PG8A 3WG5A 2F6QA 3TT7A 4ZDFA 3L3SA 3BPPA 1RJMA 4Q0GA 5INIA 2GTRA 3TV5A 3BF0A 5FIFA 5MGBA 4IZDA 1FC9A 3SWXA 2IEXA 4ELWA 1YG8A 5DL1A 3U9RB 3R9TA 3QMJA 5E0NX 3IAVA 4JOTA 4ZDDA 2F9YA 4ZU2A 2ZL4A 3KQFA 4I52A 3Q1TA 3RSTA 3VIVA 4NEKA 3NJBA 3GKBA 4FNBA 1ON3A 2PBPA 3MOYA 1UYSA 4NNQA 3HLN1 4KNPA 5G1RA 2J5II 3FF6A 4U0GA 1NZYA 1X0UA 3RRVA 4ZDCA 4L6WA 3QK8A 4ELSA 3TVWA 3T8AA 3V5IA 5DUCA 2J5IB 2W3PA 3TZ3A 2FW2A 4JWVA 3DORA 3Q0JA 3QKAA 1HZDA 1J7XA 1UYRA 2VSUF 4JCSA 1WDLA 1UYVA 1Y7OA 4EMMA 5C90A 5DU8A 3R9SA 3OMEA 2PPYA 2ZQRA 3PEAA 4FN7A 3GMAA 3ISAA 4QFEA 3H0UA 5KDRA 4FZWC 3QXIA 4U1AA 1N6FA 3M6NA 3V5EA 1MJ3A 5KJPA 1JXZA 1O8UA 1N6DA 4JFCA 3QXZA 2VSSF 4ASIA 2F9IA 3U9SB 2DUBA 3OC7A 3I47A 2J5GA 2F6IA 3IB9A 3T3WA 1HNUA 2UZFA 3P85A 1XNWA 1ON9A 4OG1A 5G1QA 3QWDA 2NP9A 3PZKA 3JU1A 3LKEA 4HNKA 4MOUA 1PIXA 3G64A 2F9YB 2X58A 3OT6A 4I42A 4U0GH 4FNDA 4I4ZA 2Q34A 4K29A 4IZCA 2FBMA 2J5GD 4FB8A 2A7KA 1YG6A 2VSUE 2VSUA 4ELXA 2WTBA 3ZWCA 4OLQA 5INFA 1FCFA 4F47A 2C8TA 1PJHA 1FC7A 4DI1A 2VX2A 3K50A 4JVTA 3HRXA 3STAA 4WYOB 2HW5A 2Q2XA 3M6MA 4RYFA 3TT6A 3TLFA 4U19A 3T89A 5DZKA 3T88A 3ZWAA 3FDUA 3KTKA 2VSSE 3Q7HA 2VSSA 3TVUA 2X24A 2ZL2A 5E0SA 1TYFA 3GF7A 1OD4A 1XNYA 2VREA 5DTPA 5CTBA 2ZL3A 3IBBA 1W2XA 4MI2A 4EMLA 1Q51A 4FN8A 4JYLA 3GF3A 3MT6A 1N6EA 3P5MA 4GHNA 4WZ8B 2D3TA 4FZWA 4EMPA 3ZWBA 4MXIA 5IKLB 4L8KA 2ZL0A 5FUSA 3TRRA 4Q1IA 4B3IA 4JYJA 4ZDEA 1EF9A 2J5SA 3MFMA 4G2RA 1VRGA 2CE3A 1EY3A 1K39A 5JBWA 1RJNA 3ZW9A 3N6RB 4RCNA 3LAOA 3KTGA 1HNOA 1XO6A 4KPKA 3MYBA
chains in the Genus database with same CATH superfamily
5DU4A 1XNVA 1XX4A 4HDTA 5INGA 2A7SA 4B3HA 5DU6A 3KTIA 3HP0A 4OMRA 1Q52A 4JCTA 3SLLA 3H81A 3H0JA 1SZOA 3ST9A 1EF8A 4KD6A 4RYFH 3RSIA 1WDKA 3H02A 2CBYA 3PE8A 4U0HA 5DZKH 4QIIA 3U9TB 2Q35A 2VSUC 1K32A 4JJTA 5CTCA 5DUFA 1NZYB 1TG6A 4YLHA 1OD2A 5DTWA 3TDCA 1DCIA 2BZRA 2QQ3A 4U18A 5G1SA 5E0SH 3H0QA 3T8BA 2ZQQA 3PGQA 2A81A 3Q0GA 3R0OA 3R9QA 4LK5A 4K2NA 1UYTA 2J5IA 2EJ5A 4IZBA 4GM2A 3QYRA 4KWBA 3QREA 4B3JA 4JCRA 4WCZA 3KTHA 1WZ8A 5DKPA 1SG4A 3NJDA 1WDMA 3HINA 1FC6A 2FZSA 1DUBA 3R6HA 3BEZA 3GLMA 3P2LA 3H0SA 3K8XA 2DEOA 5KDRB 4HC8A 4QIJA 4K3WA 4JSBA 5C9GA 3KTJA 5JBXA 4JCQA 4Z0MA 3DJAA 2F9IB 4FJWD 3ZW8A 4ZDBA 3HE2A 1UIYA 2PG8A 3WG5A 2F6QA 3TT7A 4ZDFA 3L3SA 3BPPA 1RJMA 4Q0GA 5INIA 2GTRA 3TV5A 3BF0A 5FIFA 5HUQA 5MGBA 4IZDA 1FC9A 3SWXA 2IEXA 4ELWA 1YG8A 5DL1A 3U9RB 3R9TA 3QMJA 5E0NX 3IAVA 4JOTA 4ZDDA 2F9YA 4ZU2A 2ZL4A 3KQFA 4I52A 3Q1TA 3RSTA 3VIVA 4NEKA 3NJBA 3GKBA 4FNBA 1ON3A 2PBPA 3MOYA 1UYSA 4NNQA 3HLN1 4KNPA 5G1RA 2J5II 3FF6A 4U0GA 1NZYA 1X0UA 3RRVA 4ZDCA 4L6WA 3QK8A 4ELSA 3TVWA 3T8AA 3V5IA 5DUCA 2J5IB 2W3PA 3TZ3A 2FW2A 4JWVA 3DORA 3Q0JA 3QKAA 1HZDA 1J7XA 1UYRA 2VSUF 4JCSA 1WDLA 1UYVA 1Y7OA 4EMMA 5C90A 5DU8A 3R9SA 3OMEA 2PPYA 2ZQRA 3PEAA 4FN7A 3GMAA 3ISAA 4QFEA 3H0UA 5KDRA 4FZWC 3QXIA 4U1AA 1N6FA 3M6NA 3V5EA 1MJ3A 5KJPA 1JXZA 1O8UA 1N6DA 4JFCA 3QXZA 2VSSF 4ASIA 2F9IA 3U9SB 2DUBA 3OC7A 3I47A 2J5GA 2F6IA 3IB9A 3T3WA 1HNUA 2UZFA 3P85A 1XNWA 1ON9A 4OG1A 5G1QA 3QWDA 2NP9A 3PZKA 3JU1A 3LKEA 4HNKA 4MOUA 1PIXA 3G64A 2F9YB 2X58A 3OT6A 4I42A 4U0GH 2YJGA 4FNDA 4I4ZA 2Q34A 4K29A 4IZCA 2FBMA 2J5GD 4FB8A 2A7KA 1YG6A 2VSUE 2VSUA 4ELXA 2WTBA 3ZWCA 4OLQA 5INFA 1FCFA 4F47A 2C8TA 3BPTA 1PJHA 1FC7A 4DI1A 2VX2A 3K50A 4JVTA 3HRXA 3STAA 4WYOB 2HW5A 2Q2XA 3M6MA 4RYFA 3TT6A 3TLFA 4U19A 3T89A 5DZKA 3T88A 3ZWAA 3FDUA 3KTKA 4NARA 2VSSE 3Q7HA 2VSSA 3TVUA 2X24A 2ZL2A 5E0SA 1TYFA 3GF7A 1OD4A 1XNYA 2VREA 5DTPA 5CTBA 2ZL3A 3IBBA 1W2XA 4MI2A 4EMLA 1Q51A 4FN8A 4JYLA 3GF3A 3MT6A 4J2UA 1N6EA 3P5MA 4GHNA 4WZ8B 2D3TA 4FZWA 4EMPA 3ZWBA 4MXIA 5IKLB 4L8KA 2ZL0A 5FUSA 3TRRA 4Q1IA 4B3IA 4JYJA 4ZDEA 1EF9A 2J5SA 3MFMA 4G2RA 1VRGA 2CE3A 1EY3A 1K39A 5JBWA 1RJNA 3ZW9A 3N6RB 4RCNA 3LAOA 3KTGA 1HNOA 1XO6A 4KPKA 3MYBA
chains in the Genus database with same CATH topology
5DU4A 1XNVA 1XX4A 4HDTA 5INGA 2A7SA 4B3HA 5DU6A 3KTIA 3HP0A 4OMRA 1Q52A 4JCTA 3SLLA 3H81A 3H0JA 1SZOA 3ST9A 1EF8A 4KD6A 4RYFH 3RSIA 1WDKA 3H02A 2CBYA 3PE8A 4U0HA 5DZKH 4QIIA 3U9TB 2Q35A 2VSUC 1K32A 4JJTA 5CTCA 5DUFA 1NZYB 1TG6A 4YLHA 1OD2A 5DTWA 3TDCA 1DCIA 2BZRA 2QQ3A 4U18A 5G1SA 5E0SH 3H0QA 3T8BA 2ZQQA 3PGQA 2A81A 3Q0GA 3R0OA 3R9QA 4LK5A 4K2NA 1UYTA 2J5IA 2EJ5A 4IZBA 4GM2A 3QYRA 4KWBA 3QREA 4B3JA 4JCRA 4WCZA 3KTHA 1WZ8A 5DKPA 1SG4A 3NJDA 1WDMA 3HINA 1FC6A 2FZSA 1DUBA 3R6HA 3BEZA 3GLMA 3P2LA 3H0SA 3K8XA 2DEOA 5KDRB 4HC8A 4QIJA 4K3WA 4JSBA 5C9GA 3KTJA 5JBXA 4JCQA 4Z0MA 3DJAA 2F9IB 4FJWD 3ZW8A 4ZDBA 3HE2A 1UIYA 2PG8A 3WG5A 2F6QA 3TT7A 4ZDFA 3L3SA 3BPPA 1RJMA 4Q0GA 5INIA 2GTRA 3TV5A 3BF0A 5FIFA 5HUQA 5MGBA 4IZDA 1FC9A 3SWXA 2IEXA 4ELWA 1YG8A 5DL1A 3U9RB 3R9TA 3QMJA 5E0NX 3IAVA 4JOTA 4ZDDA 2F9YA 4ZU2A 2ZL4A 3KQFA 4I52A 3Q1TA 3RSTA 3VIVA 4NEKA 3NJBA 3GKBA 4FNBA 1ON3A 2PBPA 3MOYA 1UYSA 4NNQA 3HLN1 4KNPA 5G1RA 2J5II 3FF6A 4U0GA 1NZYA 1X0UA 3RRVA 4ZDCA 4L6WA 3QK8A 4ELSA 3TVWA 3T8AA 3V5IA 5DUCA 2J5IB 2W3PA 3TZ3A 2FW2A 4JWVA 3DORA 3Q0JA 3QKAA 1HZDA 1J7XA 1UYRA 2VSUF 4JCSA 1WDLA 1UYVA 1Y7OA 4EMMA 5C90A 5DU8A 3R9SA 3OMEA 2PPYA 2ZQRA 3PEAA 4FN7A 3GMAA 3ISAA 4QFEA 3H0UA 5KDRA 4FZWC 3QXIA 4U1AA 1N6FA 3M6NA 3V5EA 1MJ3A 5KJPA 1JXZA 1O8UA 1N6DA 4JFCA 3QXZA 2VSSF 4ASIA 2F9IA 3U9SB 2DUBA 3OC7A 3I47A 2J5GA 2F6IA 3IB9A 3T3WA 1HNUA 2UZFA 3P85A 1XNWA 1ON9A 4OG1A 5G1QA 3QWDA 2NP9A 3PZKA 3JU1A 3LKEA 4HNKA 4MOUA 1PIXA 3G64A 2F9YB 2X58A 3OT6A 4I42A 4U0GH 2YJGA 4FNDA 4I4ZA 2Q34A 4K29A 4IZCA 2FBMA 2J5GD 4FB8A 2A7KA 1YG6A 2VSUE 2VSUA 4ELXA 2WTBA 3ZWCA 4OLQA 5INFA 1FCFA 4F47A 2C8TA 3BPTA 1PJHA 1FC7A 4DI1A 2VX2A 3K50A 4JVTA 3HRXA 3STAA 4WYOB 2HW5A 2Q2XA 3M6MA 4RYFA 3TT6A 3TLFA 4U19A 3T89A 5DZKA 3T88A 3ZWAA 3FDUA 3KTKA 4NARA 2VSSE 3Q7HA 2VSSA 3TVUA 2X24A 2ZL2A 5E0SA 1TYFA 3GF7A 1OD4A 1XNYA 2VREA 5DTPA 5CTBA 2ZL3A 3IBBA 1W2XA 4MI2A 4EMLA 1Q51A 4FN8A 4JYLA 3GF3A 3MT6A 4J2UA 1N6EA 3P5MA 4GHNA 4WZ8B 2D3TA 4FZWA 4EMPA 3ZWBA 4MXIA 5IKLB 4L8KA 2ZL0A 5FUSA 3TRRA 4Q1IA 4B3IA 4JYJA 4ZDEA 1EF9A 2J5SA 3MFMA 4G2RA 1VRGA 2CE3A 1EY3A 1K39A 5JBWA 1RJNA 3ZW9A 3N6RB 4RCNA 3LAOA 3KTGA 1HNOA 1XO6A 4KPKA 3MYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DU4 A;  1XNV A;  1XX4 A;  5ING A;  2A7S A;  4B3H A;  5DU6 A;  3KTI A;  3HP0 A;  4OMR A;  1Q52 A;  4JCT A;  3SLL A;  3H81 A;  3H0J A;  1SZO A;  3ST9 A;  1EF8 A;  4KD6 A;  4RYF H;  3RSI A;  1WDK A;  3H02 A;  2CBY A;  3PE8 A;  4U0H A;  5DZK H;  4QII A;  3U9T B;  2Q35 A;  2VSU C;  1K32 A;  4JJT A;  5CTC A;  5DUF A;  1NZY B;  1TG6 A;  4YLH A;  1OD2 A;  5DTW A;  3TDC A;  1DCI A;  2BZR A;  2QQ3 A;  4U18 A;  5G1S A;  5E0S H;  3H0Q A;  3T8B A;  2ZQQ A;  3PGQ A;  2A81 A;  3Q0G A;  3R0O A;  3R9Q A;  4LK5 A;  4K2N A;  1UYT A;  2J5I A;  2EJ5 A;  4IZB A;  4GM2 A;  3QYR A;  4KWB A;  3QRE A;  4B3J A;  4JCR A;  4WCZ A;  3KTH A;  1WZ8 A;  5DKP A;  1SG4 A;  3NJD A;  1WDM A;  3HIN A;  1FC6 A;  2FZS A;  1DUB A;  3R6H A;  3BEZ A;  3GLM A;  3P2L A;  3H0S A;  3K8X A;  2DEO A;  5KDR B;  4HC8 A;  4QIJ A;  4K3W A;  4JSB A;  5C9G A;  3KTJ A;  5JBX A;  4JCQ A;  4Z0M A;  3DJA A;  2F9I B;  4FJW D;  3ZW8 A;  4ZDB A;  3HE2 A;  1UIY A;  2PG8 A;  3WG5 A;  2F6Q A;  3TT7 A;  4ZDF A;  3L3S A;  3BPP A;  1RJM A;  4Q0G A;  5INI A;  2GTR A;  3TV5 A;  3BF0 A;  5FIF A;  5MGB A;  4IZD A;  1FC9 A;  3SWX A;  2IEX A;  4ELW A;  1YG8 A;  5DL1 A;  3U9R B;  3R9T A;  3QMJ A;  5E0N X;  3IAV A;  4JOT A;  4ZDD A;  2F9Y A;  4ZU2 A;  2ZL4 A;  3KQF A;  4I52 A;  3Q1T A;  3RST A;  3VIV A;  4NEK A;  3NJB A;  3GKB A;  4FNB A;  1ON3 A;  2PBP A;  3MOY A;  1UYS A;  4NNQ A;  3HLN 1;  4KNP A;  5G1R A;  2J5I I;  3FF6 A;  4U0G A;  1NZY A;  1X0U A;  3RRV A;  4ZDC A;  4L6W A;  3QK8 A;  4ELS A;  3TVW A;  3T8A A;  3V5I A;  5DUC A;  2J5I B;  2W3P A;  3TZ3 A;  2FW2 A;  4JWV A;  3DOR A;  3Q0J A;  3QKA A;  1HZD A;  1J7X A;  1UYR A;  2VSU F;  4JCS A;  1WDL A;  1UYV A;  1Y7O A;  4EMM A;  5C90 A;  5DU8 A;  3R9S A;  3OME A;  2PPY A;  2ZQR A;  3PEA A;  4FN7 A;  3GMA A;  3ISA A;  4QFE A;  3H0U A;  5KDR A;  4FZW C;  3QXI A;  4U1A A;  1N6F A;  3M6N A;  3V5E A;  1MJ3 A;  5KJP A;  1JXZ A;  1O8U A;  1N6D A;  4JFC A;  3QXZ A;  2VSS F;  4ASI A;  2F9I A;  3U9S B;  2DUB A;  3OC7 A;  3I47 A;  2J5G A;  2F6I A;  3IB9 A;  3T3W A;  1HNU A;  2UZF A;  3P85 A;  1XNW A;  1ON9 A;  4OG1 A;  5G1Q A;  3QWD A;  2NP9 A;  3PZK A;  3JU1 A;  3LKE A;  4HNK A;  4MOU A;  1PIX A;  3G64 A;  2F9Y B;  2X58 A;  3OT6 A;  4I42 A;  4U0G H;  4FND A;  4I4Z A;  2Q34 A;  4K29 A;  4IZC A;  2FBM A;  2J5G D;  4FB8 A;  2A7K A;  1YG6 A;  2VSU E;  2VSU A;  4ELX A;  2WTB A;  3ZWC A;  4OLQ A;  5INF A;  1FCF A;  4F47 A;  2C8T A;  1PJH A;  1FC7 A;  4DI1 A;  2VX2 A;  3K50 A;  4JVT A;  3HRX A;  3STA A;  4WYO B;  2HW5 A;  2Q2X A;  3M6M A;  4RYF A;  3TT6 A;  3TLF A;  4U19 A;  3T89 A;  5DZK A;  3T88 A;  3ZWA A;  3FDU A;  3KTK A;  2VSS E;  3Q7H A;  2VSS A;  3TVU A;  2X24 A;  2ZL2 A;  5E0S A;  1TYF A;  3GF7 A;  1OD4 A;  1XNY A;  2VRE A;  5DTP A;  5CTB A;  2ZL3 A;  3IBB A;  1W2X A;  4MI2 A;  4EML A;  1Q51 A;  4FN8 A;  4JYL A;  3GF3 A;  3MT6 A;  1N6E A;  3P5M A;  4GHN A;  4WZ8 B;  2D3T A;  4FZW A;  4EMP A;  3ZWB A;  4MXI A;  5IKL B;  4L8K A;  2ZL0 A;  5FUS A;  3TRR A;  4Q1I A;  4B3I A;  4JYJ A;  4ZDE A;  1EF9 A;  2J5S A;  3MFM A;  4G2R A;  1VRG A;  2CE3 A;  1EY3 A;  1K39 A;  5JBW A;  1RJN A;  3ZW9 A;  3N6R B;  4RCN A;  3LAO A;  3KTG A;  1HNO A;  1XO6 A;  4KPK A;  3MYB A; 
#chains in the Genus database with same CATH topology
 5DU4 A;  1XNV A;  1XX4 A;  4HDT A;  5ING A;  2A7S A;  4B3H A;  5DU6 A;  3KTI A;  3HP0 A;  4OMR A;  1Q52 A;  4JCT A;  3SLL A;  3H81 A;  3H0J A;  1SZO A;  3ST9 A;  1EF8 A;  4KD6 A;  4RYF H;  3RSI A;  1WDK A;  3H02 A;  2CBY A;  3PE8 A;  4U0H A;  5DZK H;  4QII A;  3U9T B;  2Q35 A;  2VSU C;  1K32 A;  4JJT A;  5CTC A;  5DUF A;  1NZY B;  1TG6 A;  4YLH A;  1OD2 A;  5DTW A;  3TDC A;  1DCI A;  2BZR A;  2QQ3 A;  4U18 A;  5G1S A;  5E0S H;  3H0Q A;  3T8B A;  2ZQQ A;  3PGQ A;  2A81 A;  3Q0G A;  3R0O A;  3R9Q A;  4LK5 A;  4K2N A;  1UYT A;  2J5I A;  2EJ5 A;  4IZB A;  4GM2 A;  3QYR A;  4KWB A;  3QRE A;  4B3J A;  4JCR A;  4WCZ A;  3KTH A;  1WZ8 A;  5DKP A;  1SG4 A;  3NJD A;  1WDM A;  3HIN A;  1FC6 A;  2FZS A;  1DUB A;  3R6H A;  3BEZ A;  3GLM A;  3P2L A;  3H0S A;  3K8X A;  2DEO A;  5KDR B;  4HC8 A;  4QIJ A;  4K3W A;  4JSB A;  5C9G A;  3KTJ A;  5JBX A;  4JCQ A;  4Z0M A;  3DJA A;  2F9I B;  4FJW D;  3ZW8 A;  4ZDB A;  3HE2 A;  1UIY A;  2PG8 A;  3WG5 A;  2F6Q A;  3TT7 A;  4ZDF A;  3L3S A;  3BPP A;  1RJM A;  4Q0G A;  5INI A;  2GTR A;  3TV5 A;  3BF0 A;  5FIF A;  5HUQ A;  5MGB A;  4IZD A;  1FC9 A;  3SWX A;  2IEX A;  4ELW A;  1YG8 A;  5DL1 A;  3U9R B;  3R9T A;  3QMJ A;  5E0N X;  3IAV A;  4JOT A;  4ZDD A;  2F9Y A;  4ZU2 A;  2ZL4 A;  3KQF A;  4I52 A;  3Q1T A;  3RST A;  3VIV A;  4NEK A;  3NJB A;  3GKB A;  4FNB A;  1ON3 A;  2PBP A;  3MOY A;  1UYS A;  4NNQ A;  3HLN 1;  4KNP A;  5G1R A;  2J5I I;  3FF6 A;  4U0G A;  1NZY A;  1X0U A;  3RRV A;  4ZDC A;  4L6W A;  3QK8 A;  4ELS A;  3TVW A;  3T8A A;  3V5I A;  5DUC A;  2J5I B;  2W3P A;  3TZ3 A;  2FW2 A;  4JWV A;  3DOR A;  3Q0J A;  3QKA A;  1HZD A;  1J7X A;  1UYR A;  2VSU F;  4JCS A;  1WDL A;  1UYV A;  1Y7O A;  4EMM A;  5C90 A;  5DU8 A;  3R9S A;  3OME A;  2PPY A;  2ZQR A;  3PEA A;  4FN7 A;  3GMA A;  3ISA A;  4QFE A;  3H0U A;  5KDR A;  4FZW C;  3QXI A;  4U1A A;  1N6F A;  3M6N A;  3V5E A;  1MJ3 A;  5KJP A;  1JXZ A;  1O8U A;  1N6D A;  4JFC A;  3QXZ A;  2VSS F;  4ASI A;  2F9I A;  3U9S B;  2DUB A;  3OC7 A;  3I47 A;  2J5G A;  2F6I A;  3IB9 A;  3T3W A;  1HNU A;  2UZF A;  3P85 A;  1XNW A;  1ON9 A;  4OG1 A;  5G1Q A;  3QWD A;  2NP9 A;  3PZK A;  3JU1 A;  3LKE A;  4HNK A;  4MOU A;  1PIX A;  3G64 A;  2F9Y B;  2X58 A;  3OT6 A;  4I42 A;  4U0G H;  2YJG A;  4FND A;  4I4Z A;  2Q34 A;  4K29 A;  4IZC A;  2FBM A;  2J5G D;  4FB8 A;  2A7K A;  1YG6 A;  2VSU E;  2VSU A;  4ELX A;  2WTB A;  3ZWC A;  4OLQ A;  5INF A;  1FCF A;  4F47 A;  2C8T A;  3BPT A;  1PJH A;  1FC7 A;  4DI1 A;  2VX2 A;  3K50 A;  4JVT A;  3HRX A;  3STA A;  4WYO B;  2HW5 A;  2Q2X A;  3M6M A;  4RYF A;  3TT6 A;  3TLF A;  4U19 A;  3T89 A;  5DZK A;  3T88 A;  3ZWA A;  3FDU A;  3KTK A;  4NAR A;  2VSS E;  3Q7H A;  2VSS A;  3TVU A;  2X24 A;  2ZL2 A;  5E0S A;  1TYF A;  3GF7 A;  1OD4 A;  1XNY A;  2VRE A;  5DTP A;  5CTB A;  2ZL3 A;  3IBB A;  1W2X A;  4MI2 A;  4EML A;  1Q51 A;  4FN8 A;  4JYL A;  3GF3 A;  3MT6 A;  4J2U A;  1N6E A;  3P5M A;  4GHN A;  4WZ8 B;  2D3T A;  4FZW A;  4EMP A;  3ZWB A;  4MXI A;  5IKL B;  4L8K A;  2ZL0 A;  5FUS A;  3TRR A;  4Q1I A;  4B3I A;  4JYJ A;  4ZDE A;  1EF9 A;  2J5S A;  3MFM A;  4G2R A;  1VRG A;  2CE3 A;  1EY3 A;  1K39 A;  5JBW A;  1RJN A;  3ZW9 A;  3N6R B;  4RCN A;  3LAO A;  3KTG A;  1HNO A;  1XO6 A;  4KPK A;  3MYB A; 
#chains in the Genus database with same CATH homology
 5DU4 A;  1XNV A;  1XX4 A;  4HDT A;  5ING A;  2A7S A;  4B3H A;  5DU6 A;  3KTI A;  3HP0 A;  4OMR A;  1Q52 A;  4JCT A;  3SLL A;  3H81 A;  3H0J A;  1SZO A;  3ST9 A;  1EF8 A;  4KD6 A;  4RYF H;  3RSI A;  1WDK A;  3H02 A;  2CBY A;  3PE8 A;  4U0H A;  5DZK H;  4QII A;  3U9T B;  2Q35 A;  2VSU C;  1K32 A;  4JJT A;  5CTC A;  5DUF A;  1NZY B;  1TG6 A;  4YLH A;  1OD2 A;  5DTW A;  3TDC A;  1DCI A;  2BZR A;  2QQ3 A;  4U18 A;  5G1S A;  5E0S H;  3H0Q A;  3T8B A;  2ZQQ A;  3PGQ A;  2A81 A;  3Q0G A;  3R0O A;  3R9Q A;  4LK5 A;  4K2N A;  1UYT A;  2J5I A;  2EJ5 A;  4IZB A;  4GM2 A;  3QYR A;  4KWB A;  3QRE A;  4B3J A;  4JCR A;  4WCZ A;  3KTH A;  1WZ8 A;  5DKP A;  1SG4 A;  3NJD A;  1WDM A;  3HIN A;  1FC6 A;  2FZS A;  1DUB A;  3R6H A;  3BEZ A;  3GLM A;  3P2L A;  3H0S A;  3K8X A;  2DEO A;  5KDR B;  4HC8 A;  4QIJ A;  4K3W A;  4JSB A;  5C9G A;  3KTJ A;  5JBX A;  4JCQ A;  4Z0M A;  3DJA A;  2F9I B;  4FJW D;  3ZW8 A;  4ZDB A;  3HE2 A;  1UIY A;  2PG8 A;  3WG5 A;  2F6Q A;  3TT7 A;  4ZDF A;  3L3S A;  3BPP A;  1RJM A;  4Q0G A;  5INI A;  2GTR A;  3TV5 A;  3BF0 A;  5FIF A;  5HUQ A;  5MGB A;  4IZD A;  1FC9 A;  3SWX A;  2IEX A;  4ELW A;  1YG8 A;  5DL1 A;  3U9R B;  3R9T A;  3QMJ A;  5E0N X;  3IAV A;  4JOT A;  4ZDD A;  2F9Y A;  4ZU2 A;  2ZL4 A;  3KQF A;  4I52 A;  3Q1T A;  3RST A;  3VIV A;  4NEK A;  3NJB A;  3GKB A;  4FNB A;  1ON3 A;  2PBP A;  3MOY A;  1UYS A;  4NNQ A;  3HLN 1;  4KNP A;  5G1R A;  2J5I I;  3FF6 A;  4U0G A;  1NZY A;  1X0U A;  3RRV A;  4ZDC A;  4L6W A;  3QK8 A;  4ELS A;  3TVW A;  3T8A A;  3V5I A;  5DUC A;  2J5I B;  2W3P A;  3TZ3 A;  2FW2 A;  4JWV A;  3DOR A;  3Q0J A;  3QKA A;  1HZD A;  1J7X A;  1UYR A;  2VSU F;  4JCS A;  1WDL A;  1UYV A;  1Y7O A;  4EMM A;  5C90 A;  5DU8 A;  3R9S A;  3OME A;  2PPY A;  2ZQR A;  3PEA A;  4FN7 A;  3GMA A;  3ISA A;  4QFE A;  3H0U A;  5KDR A;  4FZW C;  3QXI A;  4U1A A;  1N6F A;  3M6N A;  3V5E A;  1MJ3 A;  5KJP A;  1JXZ A;  1O8U A;  1N6D A;  4JFC A;  3QXZ A;  2VSS F;  4ASI A;  2F9I A;  3U9S B;  2DUB A;  3OC7 A;  3I47 A;  2J5G A;  2F6I A;  3IB9 A;  3T3W A;  1HNU A;  2UZF A;  3P85 A;  1XNW A;  1ON9 A;  4OG1 A;  5G1Q A;  3QWD A;  2NP9 A;  3PZK A;  3JU1 A;  3LKE A;  4HNK A;  4MOU A;  1PIX A;  3G64 A;  2F9Y B;  2X58 A;  3OT6 A;  4I42 A;  4U0G H;  2YJG A;  4FND A;  4I4Z A;  2Q34 A;  4K29 A;  4IZC A;  2FBM A;  2J5G D;  4FB8 A;  2A7K A;  1YG6 A;  2VSU E;  2VSU A;  4ELX A;  2WTB A;  3ZWC A;  4OLQ A;  5INF A;  1FCF A;  4F47 A;  2C8T A;  3BPT A;  1PJH A;  1FC7 A;  4DI1 A;  2VX2 A;  3K50 A;  4JVT A;  3HRX A;  3STA A;  4WYO B;  2HW5 A;  2Q2X A;  3M6M A;  4RYF A;  3TT6 A;  3TLF A;  4U19 A;  3T89 A;  5DZK A;  3T88 A;  3ZWA A;  3FDU A;  3KTK A;  4NAR A;  2VSS E;  3Q7H A;  2VSS A;  3TVU A;  2X24 A;  2ZL2 A;  5E0S A;  1TYF A;  3GF7 A;  1OD4 A;  1XNY A;  2VRE A;  5DTP A;  5CTB A;  2ZL3 A;  3IBB A;  1W2X A;  4MI2 A;  4EML A;  1Q51 A;  4FN8 A;  4JYL A;  3GF3 A;  3MT6 A;  4J2U A;  1N6E A;  3P5M A;  4GHN A;  4WZ8 B;  2D3T A;  4FZW A;  4EMP A;  3ZWB A;  4MXI A;  5IKL B;  4L8K A;  2ZL0 A;  5FUS A;  3TRR A;  4Q1I A;  4B3I A;  4JYJ A;  4ZDE A;  1EF9 A;  2J5S A;  3MFM A;  4G2R A;  1VRG A;  2CE3 A;  1EY3 A;  1K39 A;  5JBW A;  1RJN A;  3ZW9 A;  3N6R B;  4RCN A;  3LAO A;  3KTG A;  1HNO A;  1XO6 A;  4KPK A;  3MYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...