1PIXA

Crystal structure of the carboxyltransferase subunit of the bacterial ion pump glutaconyl-coenzyme a decarboxylase
Total Genus 219
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
219
sequence length
586
structure length
586
Chain Sequence
GFYSMPRYFQNMPQVGKPLKKADAANEEQLKKIEEEIHQLIKEAQEAGKADADVNKRGELTALQRIEKLVEPGSWRPLNTLFNPQGNKNGSVAIVKGLGRVNGKWCVVVASDNKKLAGAWVPGQAECLLRASDTAKTLHVPLVYVLNCSGVKFDEQEKVYPNRRGGGTPFFRNAELNQLGIPVIVGIYGTNPAGGGYHSISPTVIIAHEKANMAVGGAGIMGGMNPKGHVDLEYANEIADMVDRTGKTEPPGAVDIHYTETGFMREVYASEEGVLEGIKKYVGMLPKYDPEFFRVDDPKAPAFPADDLYSMVPLNDKRAYDIYNVIARLFDNSELHEYKKGYGPEMVTGLAKVNGLLVGVVANVQGLLMNYPEYKAAGSVGIGGKLYRQGLVKMNEFVTLCARDRLPIVWIQDTTGIDVGNDAEKAELLGLGQSLIYSIQTSHIPQFEITLRKGTAAAHYVLGGPQGNDTNAFSIGTAATEIAVMNGETAATAMYSRRLAKDRKAGKDLQPTIDKMNNLIQAFYTKSRPKVCAELGLVDEIVDMNKIRGYVEAFTEAAYQNPESICPFHQMILPRAIREFETFVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the carboxyltransferase subunit of the bacterial sodium ion pump glutaconyl-coenzyme A decarboxylase
pubmed doi rcsb
source organism Acidaminococcus fermentans
molecule tags Lyase
molecule keywords Glutaconyl-CoA decarboxylase A subunit
total genus 219
structure length 586
sequence length 586
chains with identical sequence B
ec nomenclature ec 4.1.1.70: Transferred entry: 7.2.4.5.
pdb deposition date 2003-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01039 Carboxyl_trans Carboxyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.680 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Helix bin 1pixA01
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1pixA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1pixA03
4IZDA 5DZKA 2Q34A 3GF3A 4FJWD 5DTWA 4WYOB 2ZL4A 3MFMA 3ST9A 4Q1IA 5G1QA 3HINA 2F9YA 4ELXA 4KD6A 2A7SA 1UIYA 5INGA 4NEKA 3VIVA 5DKPA 3Q7HA 2FBMA 2F9YB 1ON9A 2FZSA 5DU4A 1TG6A 4I42A 5G1SA 4U0GH 4RYFA 4FNBA 4K29A 1SG4A 5DUFA 3KTHA 3PEAA 4JVTA 3PGQA 4ZDEA 4G2RA 3RSIA 4U1AA 4NNQA 4LK5A 3R0OA 4FN7A 1W2XA 4ZDBA 1WDLA 5FIFA 3T8AA 3OC7A 4MOUA 2NP9A 4GHNA 4FN8A 2GTRA 2WTBA 3ZW8A 3FDUA 4GM2A 4Q0GA 3T89A 4L6WA 5KDRB 3KQFA 5G1RA 4RYFH 3MYBA 4WCZA 5IKLB 1XNWA 1FC9A 2VSSF 3DORA 1UYRA 1ON3A 2VSUE 1N6EA 1Q52A 3ZWBA 4OG1A 2J5IB 1EY3A 1MJ3A 3T88A 3TRRA 4IZCA 4ZDDA 2ZL2A 4HC8A 1RJMA 2J5II 2VSUF 2W3PA 3Q0JA 3QMJA 3STAA 4WZ8B 3SLLA 3V5EA 3LAOA 3K50A 3LKEA 5JBXA 1HNOA 5C9GA 2Q2XA 2BZRA 4JOTA 3R9SA 1UYTA 1PIXA 1FC7A 3R9QA 5DZKH 2Q35A 2F6QA 1NZYB 3QK8A 4HNKA 1NZYA 1K32A 3QXIA 4F47A 3H0QA 2J5GD 3HE2A 3SWXA 4QIJA 4ZDFA 4FZWA 4JCTA 4JCRA 3TVUA 5MGBA 3KTGA 4L8KA 2QQ3A 5E0NX 4DI1A 5DTPA 3M6NA 1K39A 3V5IA 3MT6A 5E0SH 1JXZA 3FF6A 2DEOA 1XO6A 3NJDA 3QYRA 4FB8A 3IB9A 5DU6A 5INIA 4Z0MA 3H0JA 3KTKA 3QWDA 2F9IA 2VSSA 4JSBA 2CE3A 4ZDCA 1EF8A 4FNDA 3PZKA 3ZW9A 3GF7A 2J5GA 3HLN1 1O8UA 2PG8A 3OT6A 5CTBA 1UYSA 4OLQA 2CBYA 4B3IA 5FUSA 3ZWCA 3GLMA 3MOYA 1HZDA 5KJPA 1XX4A 3JU1A 4U18A 3H0UA 3H81A 2VX2A 3HP0A 3T3WA 3WG5A 4RCNA 3TVWA 1YG8A 1DUBA 2VREA 4MI2A 2IEXA 3TDCA 4U0HA 4U0GA 1WDMA 3BPPA 4IZBA 4KNPA 1DCIA 4B3JA 4JJTA 1WZ8A 2J5SA 2X58A 2VSUA 3R6HA 5C90A 5JBWA 3P2LA 2HW5A 4QIIA 4FZWC 1HNUA 3QREA 2PBPA 3M6MA 4ZU2A 2EJ5A 3BEZA 2ZL0A 1EF9A 2F9IB 4JYLA 4ELSA 3PE8A 3TT6A 3QXZA 3GKBA 5CTCA 3N6RB 2ZQQA 3DJAA 4EMPA 3TV5A 3TLFA 2D3TA 4JCQA 3RSTA 3TT7A 3NJBA 1WDKA 3H02A 1FC6A 3GMAA 4JFCA 1UYVA 3U9RB 4B3HA 3T8BA 3H0SA 3IBBA 4YLHA 1J7XA 4JWVA 3Q0GA 1N6DA 3I47A 2FW2A 5E0SA 2VSUC 3OMEA 3L3SA 2A81A 4ASIA 2UZFA 1Y7OA 2VSSE 4U19A 4EMLA 1N6FA 3R9TA 3U9SB 3P85A 1YG6A 3RRVA 2ZL3A 4JCSA 4I4ZA 4K3WA 2F6IA 3G64A 1Q51A 2PPYA 2DUBA 3HRXA 5DUCA 1OD4A 3K8XA 1TYFA 4KPKA 5INFA 3KTJA 5DL1A 5DU8A 4I52A 3TZ3A 3BF0A 1OD2A 4OMRA 4MXIA 4K2NA 2C8TA 1XNYA 3ISAA 3Q1TA 3QKAA 1X0UA 1PJHA 3IAVA 4EMMA 3U9TB 5KDRA 1RJNA 1SZOA 4JYJA 2A7KA 3ZWAA 1FCFA 4KWBA 4QFEA 1VRGA 2J5IA 4ELWA 2X24A 3KTIA 3P5MA 2ZQRA 1XNVA
chains in the Genus database with same CATH superfamily
3L75D 1Q82Q 1VQLP 4FJWD 2IZ1A 2B87A 5L8RJ 2ZL4A 1S9KE 3H1LE 4PD4I 2IX7C 1FU1A 1M1JC 4Q1IA 2I1KA 2XNXA 2F9YA 1IFDA 2HLOA 4ELXA 2AEFA 4W7YA 1KQGB 2E5YA 5KLVE 1KB9I 3VIVA 3BRTB 2QJKB 4EDFA 2F9YB 3JC22 1ON9A 3RL0C 3FXEA 3BRVB 2FZSA 4PV1C 1TG6A 2IYPA 2E74D 3MHVA 4U0GH 2B87B 2QEXP 3HE5B 3L72D 5DUFA 1L0NE 1D7MA 3VOPA 2QVAA 1QVFO 3BASA 2B88A 4ZDEA 3VN0A 1SQBJ 3ZDMA 4U1AA 3P7KA 1MZ9A 1J2JB 4N78E 2NPSC 4ZDBA 1SQPG 1S9KD 3G4SP 3V4QA 3GHGC 4U3FG 1FZAA 3LW5J 2R5BA 2GTRA 2OYOA 1VQ9P 2MKVA 1P84E 4GM2A 2FYUD 3D70A 3A3YB 3CWBJ 2PAJA 2UWJE 2WPRA 5KDRB 1SQXK 2ZT9C 2A45G 2YKQA 3PHLA 2C9LY 1SQBD 3AE8C 3QH9A 4WCZA 2IDBA 4LGDE 1XNWA 4D6TD 3S9OA 2VSSF 3DORA 3H1IG 1URQD 1SQQD 2W6BA 3L70J 5KLVG 1Y8AA 5AW5B 1KB9E 3HTKB 1L0NK 3H1HJ 3ZWBA 2J5IB 1CW5A 1EY3A 3S1KA 2FXOA 4HC8A 1YJNP 1N7SD 1JOCA 3MZWB 5KKZB 3QMJA 5KLVJ 1VQ5P 1GDTA 4O9BA 1LTAC 1BSNA 3Q3DA 5APQA 1RF1C 5AW3B 1DH3A 2QA4P 2E76B 3R9SA 1W2BO 5DZKH 3CX5E 2YKPA 2JR8A 3QK8A 3L72G 1NZYA 1K32A 1SQQE 2C0WA 1FC2C 1JM0A 3U1CA 2IBZE 3I5CA 1HVVA 3CD6P 3V2QA 2H43A 5BU5A 3HUSA 3RK3D 1IFNA 1S72P 4JCTA 4JCRA 1PP9D 3KTGA 2QQ3A 5H2FE 1JY2O 2OYHB 3V5IA 3V6IA 4IOIH 2Q7CA 1YYCA 2DEOA 1JCDA 4FB8A 2BEQD 5INIA 4I1LA 3H0JA 4BRYB 4YPCA 1KILC 1ZP0C 4QMAA 5GTIH 4ZDCA 1EF8A 3VMAA 2K88A 4U3FE 3HLN1 1NTMG 3E1IA 3TGUE 1Q7YQ 3OT6A 3L73E 2O1KA 4B3IA 5C39A 3ZWCA 4RESB 2V4HA 4IFDK 5KJPA 1JTHA 4H0LD 4J2UA 2GUVA 2AEMA 1PP9E 3L37A 3T3WA 1FE6A 4H44D 2IYOA 4MN4C 3TVWA 3HD7A 2WSSH 1L4AD 1U7JA 2IEXA 1CI6B 1L0NG 1PGPA 4U0GA 1GL2A 3H1LJ 3ABVC 1KORA 1LWUB 2GA1A 2QJPB 1DCIA 1ZW0A 1NKZB 4TLFA 1T3UA 1GMJA 4H13B 2E74C 1EDLA 4FZWC 2OGUA 3OAKA 1A02F 3N7NA 2PBPA 2NPSA 1LJ2A 2F9IB 4NPEA 1RE3C 1KYOE 1U57A 2P7JA 3A5TA 2ZVNB 3C8VA 1L0LJ 3MIWA 1KN7A 1PGOA 3SFEC 1HF9A 1GL2C 1KQLA 1NTZJ 3N6RB 2ZQQA 2YXQB 5KAFH 1EXIA 1S3JA 3TLFA 2W90A 3PJSK 2FFDB 5E79H 5AW8B 3TT7A 3CCQP 2P58A 3NJBA 2E74B 1P84I 1LTGC 3CWBG 2KI7B 2E5TA 4N6JA 2A45I 4JFCA 3EWKA 1W2EA 1KV4A 3RK3B 1S1CX 1SFCA 2Q3EA 1PZQA 4U7JA 1JO5A 1NTKD 4PD4E 3PRJA 1J7XA 3CPWO 4JWVA 3Q0GA 3IN6A 5E0SA 2VSUC 2E76C 1HWTC 1SP4A 5CBOA 4C46A 3L3SA 1NTZD 2A81A 3N4XA 1RF1B 3GG2A 3A0HE 1Y7OA 2WPSA 3KZIH 3BPTA 4U19A 1G1JA 3L74G 3U59A 3VP9A 2KXPB 1DEBA 1WT6A 3Q5SA 2ZL3A 4I4ZA 2F6IA 3L75G 1KFMA 1L0ND 2KOGA 1EDJA 1OD4A 3K8XA 2QJKC 2W83C 5HUQA 3KTJA 5DU8A 2E75B 3TNUB 3H1JJ 4I52A 2OTKE 1DIPA 1OD2A 1J1DB 1IFPA 3WU2E 3TGUG 2FFDC 4K2NA 3H1HG 5B66H 4EI2A 1BGYD 3HD7D 1L4AB 2OYIB 2B89A 1NWQA 1PJHA 2JKVA 1K9MQ 3U9TB 1RJNA 1SQPJ 1X79B 5APWA 1N86A 1S2EA 4OGQD 3LIEA 1FCFA 1OVRA 1QGKB 1SLQA 2JP3A 3HE4A 4KWBA 3V5BA 2X24A 1L0NJ 3L75J 4GOFA 2QM8A 3AE5C 1H0TB 2NZ2A 3TF5A 5M1BA 1VF5C 4I2LC 4HH2A 2YNYA 4R4MA 3AE3C 2Q34A 3L72J 1BE3D 2ZYAA 3M9BA 4IFFA 1SFCC 3CC7P 1EDKA 1YIJP 2A7SA 2LKMA 2AXTH 3I56P 3HE5A 2O01H 3L73G 1YJWP 2Y9YA 5APSA 5DU4A 1QL1A 1LWUC 1A02J 2PGDA 1T2KC 1PP9J 3CXHD 3A0BE 1KZUB 3H1JG 1GW3A 3PEAA 2K3RA 2Y9ZA 1MKMA 3K5BA 3V4WA 5AVWB 3VMZA 1VQ8P 1ZLLA 2BCCD 3RSIA 4NNQA 3R0OA 1W2XA 1K73Q 2KLVA 2C9NY 1Q86Q 2VRSA 3RK2D 3VMYA 5FIFA 2O1JA 2CPBA 3OC7A 3FGAD 5CCGD 4GHNA 3ZW8A 1RQUA 2J58A 3HE4B 2JEEA 2M3BA 4Q0GA 3T89A 4H0LB 1BCCJ 1QL2A 3H32B 4H44B 1SQQG 1NO4A 2L5GB 5AW2B 4RYFH 1JCCA 3PP5A 1FZCA 3HD7C 1AFOA 3MYBA 3EFFK 1NTKK 1PP9G 1JUNA 3SWKA 2OYHC 3CCEP 1FC9A 2E43A 1G1IA 3F89A 1SQVJ 1J1EC 1JB0J 1LTBC 1GW4A 1SQQJ 3CCLP 2P67A 3G9RA 3EFGA 5APUA 4LLHA 5AW0B 2ZT9B 4OG1A 2I1JA 3USSA 1IK7A 2WZ7A 1ZMEC 2GUSA 4ZDDA 2M5AB 2ZL2A 3B71A 1RJMA 1LTJA 1BDDA 4BWNA 3BCCD 1KTMA 2R44A 1HGVA 4YXDC 4L74A 1DEEG 2KS1A 5GTIE 1MFZA 2W27A 5AW9B 3K50A 2YXRB 1SS1A 2HG5D 5JBXA 3CXHI 5AVQB 2FYUK 3SWYA 5GTHH 2Q2XA 5AW4B 2BZRA 4JOTA 1PIXA 3L73J 2JWAA 3AEGC 1VL2A 3D71A 1KB9D 3KPEA 1NZYB 2KIKA 1YQ4C 2IBZG 2FXMA 2O3JA 1PL5A 1M1JA 1J1DC 1U7MA 3RBZA 3HUSC 3VYIA 5APXA 3P8CE 4PD4D 1RY3A 3H0QA 4F47A 3CCSP 1RF0A 2QM7A 4RJTA 2WSFJ 3SWXA 1YTZT 3E7KA 3WUVA 4ZDFA 1NTZK 1N73C 4OWFA 1SQXD 3NXSA 4Y99C 3B5NC 2GM4A 3M6NA 1N2DC 3OW2O 3KXDA 2Q5UA 1N73B 2BEZF 3H1ID 2H7HA 3AE1C 1JY2N 3QYRA 4D6TG 1S5LE 3IB9A 5DU6A 4Z0MA 3II6A 1KYOI 3M06A 2F9IA 1GZLA 2A06E 4JSBA 4FNDA 1SFCD 3AEBC 1YITP 3B5NA 1BCCG 2IBZD 2FXPA 2P1JA 3PTZA 4OLQA 1OVVA 3GLMA 1RF0C 3MOYA 1GK6A 3KQGA 1XX4A 1URQC 2N9YB 3LW5H 1T2KD 3HP0A 1NTKJ 3WG5A 4RCNA 2R3CA 4DT0A 5KAIH 2LXCB 4MI2A 3TDCA 4W80A 3H1HE 1ZRTE 3B5ND 3B8EB 3F5HA 3MUDA 2YJGA 2JWDA 3JSVC 2RH0A 4Y28J 4OVNF 2VSUA 3MD0A 2ZYDA 4AQRD 5DJTB 3S4RA 2KSEA 4DJGA 2HW5A 2XDJA 3P2LA 4DZOA 4QIIA 1VQKP 4I7ZC 1GU4A 4KHXA 3WU2H 4WY4A 4JPZB 3M6MA 4ZU2A 2EJ5A 5K5GB 3M91A 1SQXE 3BEZA 3AEDC 1LTTC 3O6QA 4N78D 1EDIA 1BE3G 4JYLA 1L4AA 1G2CA 2KZIA 4ELSA 1IZNB 1LT9A 1IFMA 1OZHA 1PPJE 2FYNC 5KJ7D 5CTCA 3CCJP 2ZYGA 3TV5A 1BE3J 1LP1A 2A06D 4IL6E 2OTLP 4UB8H 1H89A 2AXTE 3G3ZA 1N73A 4R4LA 1S4XA 3Q5RA 3A2AA 1FJPA 1BSHA 3U9RB 4H44C 1NAFA 2KLUA 4BRYA 4YLHA 1N6DA 1K8AQ 3M0AA 1BGYE 4DCKA 1EC5A 1CZQA 4C7RA 2QG4A 3FX0A 2M5AA 2OYIA 1DD3A 4NPDA 1VF5D 1N6FA 3R9TA 3U9SB 2P2UA 3P85A 2R3SA 1YG6A 1Q90D 5KAFE 2HPCA 1NTZG 4UB6E 4JCSA 2WT7A 3R4YA 1GK4A 4K3WA 3L74D 3G64A 1Q51A 3HRXA 5CCGA 1OXZA 5DUCA 1YQ3C 3A0HH 1TYFA 2Q3IA 4I6MC 2HFED 3AE7C 3IAOA 1GTWA 1BCCE 1EZVI 2C8TA 3Q1TA 1LT9B 1QVGO 3QKAA 1FJKA 2W6JH 2WSFH 4JYBA 1X0UA 5APYA 3A7OA 1RE4A 4JF7A 1OVUA 4EMMA 3WUUA 1DD4A 2R32A 5AVTB 2A7KA 4JQ0D 3ZWAA 4HYTB 1SQVE 2J5UA 3L74J 1NU1E 1NYHA 1NTMD 1VRGA 1KC8Q 2FYNB 4HKZH 3TGUD 1NVOA 3M9HA 4XFJA 4L75A 1VPCA 1JY3P 1OW7A 1SQBK 1M8OB 3CI9A 2FBWC 3BATA 3L70D 4IZDA 1EZVD 5DZKA 2FFDA 2Z4EA 2OQQA 2ZXEB 3O6QB 2G8YA 5CCHD 3CLQA 2OTJP 3HINA 4KD6A 1FOSE 1BDCA 4YTPC 1UIYA 5AVVB 1L0LD 1DX7A 1FZBA 1VQOP 3FWLA 4OGQC 3MTUE 2FBMA 1SQXJ 3KYQA 1AV1A 1LNQA 3RL0D 4I42A 5G1SA 3M9QA 1HGZA 1ZR4A 1FDMA 4RYFA 3AEEC 4FNBA 5CBNA 4K29A 1K05A 1MV8A 4JVTA 5CCHC 3PGQA 1W5CE 2AEJA 2N1TC 3CWBD 4G2RA 2XZRA 2KNCB 4GT1A 4D6TE 1NJIQ 4LK5A 3T97B 2NRGA 1WDLA 1PFIA 3L75E 2QSIA 2NP9A 4GKGA 1NAYA 3LIDA 5H2FH 2FYZA 3QWOC 1VF5B 3FDUA 4M3LA 3AEFC 1P84D 4L6WA 2PRRA 1IFIA 1H0TA 1YJ9P 1EQ7A 5G1RA 1AJYA 5AW1B 5B5EH 3H1IE 5IKLB 2BCCE 4BXLA 3UIAA 2K9JB 3TK1A 3AE2C 3CCRP 1N8RQ 4WBAA 1UYRA 2VSUE 1N6EA 3TGUJ 2YMYA 1SQXG 1HJBA 2ZFCA 3H1KG 1JNMA 1AQTA 1MJ3A 3T88A 3TRRA 3VTPC 4IZCA 1VQ7P 2VSUF 2C0XA 2W3PA 3Q0JA 3STAA 1OX3A 4WZ8B 3SLLA 2JJLA 1KQFB 1FZCC 2QJYC 2WT7B 3PLNA 2Z5HA 1HNOA 2YMKA 1T3JA 5C9GA 1UYTA 3Q1MA 1FC7A 3R9QA 3JCUH 5KLIC 4Y99B 2G3AA 2B9BA 4HNKA 2LXBA 1YBKA 2WQYC 2Q6QA 4WVZA 1ZXGA 2HR3A 1IJDB 3RK2C 2YO2A 2ZXXA 4QIJA 1NU1K 3TYYA 2AXCA 4W7ZA 5TISH 4PD4H 2WSCH 1IFJA 1SQBG 5KLVD 5E0NX 5DTPA 2WSCJ 2JDIH 3L71E 3FF6A 3TDKA 1R8EA 1T6AA 1XO6A 4EOTA 1KYOD 3NJDA 2D2CB 3L70G 3L72E 2OYIC 2ZAEB 2OARA 2VSSA 2CE3A 1ZOYC 2K9YA 3BVHA 2NPSB 1K04A 3H1LD 4K35A 2ITAA 3A0BH 2PG8A 1GL2D 5CTBA 4UB8E 3WUTA 2CK3H 3P8MC 2CBYA 4OH8B 1KB9H 4AUWA 1ZN5A 3C1LA 1SQPD 2DW3A 2E75C 3H0UA 1NTKE 1MUUA 3BCCE 5CCHA 1YHQP 4L73A 3RK3E 1DUBA 2VREA 2N1TD 3HD7B 2I8DA 4ZMDA 4GOEA 1IK9A 4U0HA 1ZRTD 1S5LH 3VMXA 3BPPA 3H1JD 1PGJA 4IZBA 1NGMB 2FKWB 2KNCA 4B3JA 4JJTA 1WZ8A 2ZT9D 2P10A 5KJ7C 5C90A 3GHGA 4PV1D 1KQSO 4GDOA 1JMMA 3U1AA 1HNUA 1NOHA 3ITKA 3FXDA 2Q9IA 1YI2P 1TU3F 2QE7H 2ZL0A 1EF9A 4HJGH 3W68A 1HH0A 1JY2P 3PE8A 1E5WA 3TT6A 3L71D 3C9IA 1VQMP 1M90Q 3MUDC 4WWIA 2YO3A 5CJ4A 3OA7A 2H89C 3DJAA 1GD2E 2V7QH 1LT1A 2D3TA 4XA4A 4JCQA 3RSTA 1FZEA 2IPPA 2XKMA 2Y0CA 3H1HD 3KHUA 1WDKA 1T8ZA 1FC6A 1EXJA 3SFDC 5CJ0A 1M57D 4YXWH 2KYVA 4KJMA 4B3HA 3T8BA 3H0SA 3L71G 1FBMA 1M7LA 1KFNA 2FW2A 4RKUJ 3OMEA 4ASIA 1NTMK 2VSSE 2FYUJ 5KLVK 4Z1MH 1M1KQ 4EMLA 1L0LK 1SFCB 1RF1A 3CX5I 1NKNA 3RGUA 4D6TJ 3RL0g 3IFMA 4PJ0H 3CXHH 2IFNA 5KKZC 1FDOA 4DOJA 2PPYA 2JO1A 2DUBA 2RN0A 1FZCB 4KPKA 5INFA 3G6EP 1OFCX 5DL1A 1SVFA 1URQB 3NMDA 4EIJA 4HDTA 1BGYJ 1XNYA 2KUBA 4C7NA 2N1TA 5CHXA 2KSJA 1M56D 4WY4D 4H0LC 5B66E 3CXHE 3CCMP 1IC2A 3O8ZA 2M3EA 3CC2P 1SZOA 3B4SA 3H1KE 2YKOA 3RK3C 4JYJA 4IL6X 2M8RA 4H13D 3KTIA 5B5EE 4PV1B 1JY3O 2RKLA 1SQBE 1LT9C 3P5MA 3CMAP 1XNVA 2E76D 3V2RA 1S5LX 1YTZI 1HTLC 2HODA 2ZVOB 5APTA 1EZVE 3M0DC 4B86A 1FOSF 1BE3E 3GF3A 3NFQA 5DTWA 2H8PD 4WYOB 3CMEP 2E42A 3MFMA 3ST9A 2POHA 1AQ5A 4GODA 5G1QA 1KILB 2Z5IA 1L0LE 2Y0DA 3CCUP 5INGA 4NEKA 5DKPA 3Q7HA 1KILA 2IZ0A 2WVRA 1JEKA 3KZIE 4AYCA 4TT3H 4PJ0E 1SQPK 3L70E 1PGQA 2HODB 1SG4A 3KTHA 1SQVK 4ASWA 4WB4A 3E1RA 1OWAA 3L74E 5AVYB 1Y9BA 1VQ6P 5AVXB 1AA0A 1NTMJ 4FN7A 2NPSD 3CL3D 1BCCD 1GL2B 1JY3N 2W6AA 3T8AA 4MOUA 1PV3A 2KZJA 5CCGC 4FN8A 3L71J 2WTBA 4XE5B 1HJ0A 4H13C 1PPJG 2L91A 3H1KD 3H1LG 4A7PA 3KQFA 2RMZA 2QIWA 3AE6C 3MP7B 2N1TB 4C7NB 3IF4A 4IFMA 1VQ4P 2E75D 3B5NB 1ON3A 1UIXA 2BASA 3G71P 1Q81Q 4HB1A 2FY8A 5EFWB 1Q52A 1IO4A 2FYUG 3HUSB 1RHZB 2MJZA 3SWFA 1H8AA 3TNUA 2J5II 2OYHA 5AVZB 2WWWA 3V5EA 1OW8A 3LAOA 5BVZA 2W8ZA 3EQ2A 1NH4A 3LKEA 1KD1Q 5AVSB 4L76A 2Q1KA 4NPFX 2K1AA 2Q35A 2F6QA 4IL6H 1RE3A 3CWBE 1OW6A 1KILD 1LTJB 3JCUE 3QXIA 4WY4C 2HPCB 1SQQK 1HUCA 2XV5A 5GTHE 1VDFA 2J5GD 3HE2A 2QRXA 4K3AA 4FZWA 2R5DA 4ZNCA 1H88A 3TVUA 5MGBA 1NHLA 3HTKA 3H25A 4L8KA 4DI1A 3L36A 4CPGA 5AVUB 1L2PA 5CMZA 1K39A 3MT6A 5E0SH 2KK7A 1JXZA 3CC4P 1UIIA 3KTKA 3QWDA 3L35A 2J59M 1LP1B 2YIUB 3HRNA 1PPJD 2CPSA 1E79H 3PZKA 4ASVA 1GU5A 3ZW9A 3GF7A 2J5GA 1LTIC 1O8UA 1USDA 3RK2B 2O01J 1FDIA 3P32A 2WMMA 2A45H 4LC1A 1UYSA 1G2CB 2BCCG 2LR2A 5FUSA 3I55P 1HZDA 1Q2NA 5KLIB 3H1IJ 3JU1A 4U18A 1USEA 1N7SA 1XTCC 3H81A 2VX2A 3T97A 1NTZE 2D2CC 1RQVA 4NARA 1Y47A 1QEXA 1CI6A 1YG8A 4JBZA 3BCCG 1AVOA 3NTNA 3CX5D 2ZJSE 3OJAB 1X22A 4WY4B 3AE9C 4JYCA 2K37A 2XNDH 1WDMA 5BU8B 4UB6H 1RH5B 1NU1G 1R5LA 1LWUA 4KNPA 2N9BA 1FZFA 1JTHB 1VQNP 3V2PA 4OGQB 1N7LA 2J5SA 3VP8A 1KYOH 3P8CD 4N3YB 2X58A 1AVYA 3R6HA 1KILE 5JBWA 3L73D 3FWNA 1L0LG 1N7SB 2WSEJ 3QREA 3PH0A 1JMBA 5AW6B 3D6ZA 1WMKA 3SSUA 4KT0J 3L4FA 3R2PA 3BCCJ 5APVA 2QJYB 1Z56A 2Y0EA 3QXZA 3GKBA 1ZR2A 5KTBA 2PFXA 2WSEH 4EMPA 4U3FD 2M0BA 3KDPB 3RL0B 4EYYQ 1ZV8A 1FZGA 1RE4C 3AECC 2YIUC 1LTJC 1X0TA 3H02A 3H1JE 2WTYA 1URQA 3GMAA 1L4AC 1X9VA 3CCVP 3W67A 1N7SC 1UYVA 2WPQA 2H88C 1M1JB 4U3FJ 3IR9A 1XTGB 3IBBA 3M0DA 1SQPE 3I47A 1SQVG 5KJ7A 3Q2YA 3RBXA 2PP6A 2QJPC 1LTSC 3GW6A 2UZFA 2D2CD 2SPZA 3H1KJ 1LGHB 5TISE 3Q5PA 2WPVB 1CSBA 2IFMA 2O01N 3RRVA 4ZKPA 2KB7P 1FS0E 3D6YA 1SQVD 2K9JA 1NU1D 1EZVG 5AVRB 1MFTA 2XU6A 3H6PA 1KMIZ 1J1EB 4RO0A 1NU1J 3TZ3A 1X8YA 3BF0A 4OMRA 5DJUB 4MXIA 1HBWA 3ISAA 1NTKG 1OIPA 2IBZI 1VQPP 2A06G 2KS1B 3MGNA 3IAVA 5AW7B 2WITA 1FAVA 5KDRA 1QX8A 2FYUE 3TSIA 2V7QJ 5TJHA 3WMM0 1BGYG 1P84H 4QFEA 3AE4C 4ZKUA 2J5IA 4GIFA 4ELWA 1NTME 3GHGB 5E79E 2BCCJ 1R5SA 5KAIE 3H32A 2KP8A 4I7ZB 1OMIA 3V2NA 3CX5H 2ZQRA 1QLED 1WRGA 3AEAC 2HYNA
chains in the Genus database with same CATH topology
4IZDA 5DZKA 4R4MA 3AE3C 2Q34A 3GF3A 4FJWD 5DTWA 4WYOB 5L8RJ 2ZL4A 2OQQA 3MFMA 2G8YA 3ST9A 4Q1IA 5G1QA 3HINA 2F9YA 4ELXA 4KD6A 2A7SA 1KQGB 4YTPC 1UIYA 5INGA 4NEKA 3VIVA 5DKPA 3Q7HA 4OGQC 2FBMA 2F9YB 1ON9A 2FZSA 5DU4A 4PV1C 1TG6A 4I42A 5G1SA 2E74D 4TT3H 4U0GH 4RYFA 3AEEC 4FNBA 4K29A 1K05A 1SG4A 3KTHA 3PEAA 5DUFA 4JVTA 1MKMA 3PGQA 1Y9BA 4ZDEA 4G2RA 3RSIA 4U1AA 4NNQA 4LK5A 3R0OA 4FN7A 3T97B 1W2XA 4ZDBA 1WDLA 5FIFA 3T8AA 3OC7A 4MOUA 1PV3A 2QSIA 2NP9A 3LW5J 3FGAD 4GHNA 4FN8A 2GTRA 2WTBA 1HJ0A 1RQUA 3ZW8A 1VF5B 3FDUA 4H13C 3AEFC 2MKVA 4GM2A 4Q0GA 3D70A 3T89A 4H0LB 4L6WA 5KDRB 2ZT9C 3KQFA 4H44B 5G1RA 1AJYA 4RYFH 2QIWA 3AE6C 3MYBA 3AE8C 4WCZA 5IKLB 2IDBA 1XNWA 3S9OA 1FC9A 2VSSF 3DORA 2E75D 3AE2C 1JB0J 1UYRA 1ON3A 2VSUE 1UIXA 1N6EA 3G9RA 1Q52A 3ZWBA 2ZT9B 4OG1A 2J5IB 1EY3A 1MJ3A 3T88A 1IK7A 3TRRA 1ZMEC 4IZCA 4ZDDA 2ZL2A 4HC8A 3B71A 1RJMA 2J5II 2VSUF 2W3PA 3Q0JA 3QMJA 3STAA 1KTMA 4WZ8B 3SLLA 4YXDC 3V5EA 1OW8A 3LAOA 1KQFB 3Q3DA 3K50A 2QJYC 3LKEA 5JBXA 1HNOA 2YMKA 5C9GA 2Q2XA 2E76B 2BZRA 4JOTA 3R9SA 1UYTA 1PIXA 3Q1MA 1FC7A 3R9QA 3AEGC 5DZKH 1VL2A 5KLIC 3D71A 2G3AA 2Q35A 2F6QA 1NZYB 3QK8A 4HNKA 1NZYA 1YQ4C 2WQYC 1OW6A 1PL5A 1K32A 3QXIA 4F47A 3H0QA 2J5GD 3HE2A 2WSFJ 3SWXA 4QIJA 4ZDFA 4FZWA 4JCTA 4JCRA 3TVUA 5MGBA 3KTGA 3H25A 4L8KA 2QQ3A 5E0NX 4DI1A 5DTPA 3M6NA 2WSCJ 1K39A 3V5IA 3MT6A 5E0SH 1JXZA 3FF6A 2BEZF 2DEOA 1R8EA 1XO6A 3AE1C 3NJDA 3QYRA 4FB8A 2BEQD 3IB9A 5DU6A 5INIA 2D2CB 4Z0MA 3H0JA 3KTKA 3QWDA 2F9IA 1ZP0C 2VSSA 4JSBA 2CE3A 4ZDCA 1ZOYC 1EF8A 2K9YA 4FNDA 3PZKA 3ZW9A 3GF7A 2J5GA 3AEBC 1K04A 1O8UA 3HLN1 2O01J 1FDIA 2PG8A 2FXPA 3OT6A 5CTBA 1UYSA 4OLQA 2CBYA 4B3IA 5FUSA 3ZWCA 3GLMA 3MOYA 1HZDA 5KJPA 1XX4A 3JU1A 4U18A 4H0LD 4J2UA 2E75C 3H0UA 3H81A 2VX2A 3HP0A 3T3WA 4H44D 2D2CC 1RQVA 3WG5A 4NARA 4RCNA 3TVWA 3RK3E 1DUBA 1YG8A 2VREA 4MI2A 2IEXA 3TDCA 4U0HA 3AE9C 4U0GA 1ZRTE 1WDMA 3BPPA 3ABVC 2YJGA 1KORA 4IZBA 4KNPA 1DCIA 1NGMB 4B3JA 4Y28J 4OGQB 4JJTA 1WZ8A 2J5SA 1GMJA 4H13B 2ZT9D 2P10A 2VSUA 2X58A 2E74C 3R6HA 5C90A 4PV1D 1KILE 5JBWA 3P2LA 2HW5A 4QIIA 4GDOA 4FZWC 4I7ZC 1HNUA 2WSEJ 3QREA 2PBPA 3D6ZA 3M6MA 1TU3F 1WMKA 4ZU2A 2EJ5A 3BEZA 3AEDC 3O6QA 2ZL0A 1EF9A 2F9IB 4KT0J 4JYLA 1U57A 4ELSA 3PE8A 3TT6A 3C8VA 3QXZA 3SFEC 1HF9A 3GKBA 2FYNC 5CTCA 3N6RB 2ZQQA 1EXIA 2H89C 3DJAA 4EMPA 3TV5A 3TLFA 2D3TA 4JCQA 3RSTA 3TT7A 3NJBA 2E74B 3AECC 2YIUC 1WDKA 3H02A 1FC6A 3GMAA 1EXJA 3SFDC 4JFCA 4R4LA 3EWKA 1UYVA 3Q5RA 2H88C 1S1CX 3U9RB 4U7JA 4H44C 3T8BA 4B3HA 3H0SA 3IBBA 4YLHA 1J7XA 4JWVA 3Q0GA 1N6DA 3IN6A 3I47A 2FW2A 5E0SA 2VSUC 3Q2YA 2E76C 2QJPC 4RKUJ 3OMEA 3L3SA 2A81A 4ASIA 2UZFA 2D2CD 1Y7OA 2VSSE 4U19A 3BPTA 1DD3A 4Z1MH 1VF5D 4EMLA 1N6FA 3R9TA 3U9SB 3Q5PA 3P85A 2WPVB 1YG6A 1Q90D 3RRVA 3RL0g 3Q5SA 3D6YA 2ZL3A 4I4ZA 4JCSA 3R4YA 4K3WA 5KKZC 1FDOA 2F6IA 3G64A 1Q51A 2PPYA 2JO1A 2DUBA 3HRXA 5DUCA 1OD4A 1YQ3C 3K8XA 2QJKC 1TYFA 4KPKA 1KMIZ 5INFA 5HUQA 3KTJA 5DL1A 5DU8A 2E75B 4I52A 3AE7C 3IAOA 3TZ3A 3BF0A 1DIPA 1OD2A 4OMRA 4MXIA 4K2NA 4HDTA 2C8TA 1XNYA 3ISAA 3Q1TA 3QKAA 1X0UA 4H0LC 1PJHA 3IAVA 4EMMA 3U9TB 5KDRA 1RJNA 1SZOA 1DD4A 4JYJA 2A7KA 3ZWAA 2V7QJ 4OGQD 2J5UA 1FCFA 4IL6X 4H13D 1NYHA 2JP3A 4KWBA 4QFEA 3AE4C 1VRGA 2J5IA 4ELWA 2X24A 3KTIA 4XFJA 4PV1B 1OW7A 3AE5C 4I7ZB 3P5MA 1OMIA 2NZ2A 2ZQRA 2FBWC 1XNVA 2E76D 1S5LX 5M1BA 1VF5C 3AEAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IZD A;  5DZK A;  2Q34 A;  3GF3 A;  4FJW D;  5DTW A;  4WYO B;  2ZL4 A;  3MFM A;  3ST9 A;  4Q1I A;  5G1Q A;  3HIN A;  2F9Y A;  4ELX A;  4KD6 A;  2A7S A;  1UIY A;  5ING A;  4NEK A;  3VIV A;  5DKP A;  3Q7H A;  2FBM A;  2F9Y B;  1ON9 A;  2FZS A;  5DU4 A;  1TG6 A;  4I42 A;  5G1S A;  4U0G H;  4RYF A;  4FNB A;  4K29 A;  1SG4 A;  5DUF A;  3KTH A;  3PEA A;  4JVT A;  3PGQ A;  4ZDE A;  4G2R A;  3RSI A;  4U1A A;  4NNQ A;  4LK5 A;  3R0O A;  4FN7 A;  1W2X A;  4ZDB A;  1WDL A;  5FIF A;  3T8A A;  3OC7 A;  4MOU A;  2NP9 A;  4GHN A;  4FN8 A;  2GTR A;  2WTB A;  3ZW8 A;  3FDU A;  4GM2 A;  4Q0G A;  3T89 A;  4L6W A;  5KDR B;  3KQF A;  5G1R A;  4RYF H;  3MYB A;  4WCZ A;  5IKL B;  1XNW A;  1FC9 A;  2VSS F;  3DOR A;  1UYR A;  1ON3 A;  2VSU E;  1N6E A;  1Q52 A;  3ZWB A;  4OG1 A;  2J5I B;  1EY3 A;  1MJ3 A;  3T88 A;  3TRR A;  4IZC A;  4ZDD A;  2ZL2 A;  4HC8 A;  1RJM A;  2J5I I;  2VSU F;  2W3P A;  3Q0J A;  3QMJ A;  3STA A;  4WZ8 B;  3SLL A;  3V5E A;  3LAO A;  3K50 A;  3LKE A;  5JBX A;  1HNO A;  5C9G A;  2Q2X A;  2BZR A;  4JOT A;  3R9S A;  1UYT A;  1PIX A;  1FC7 A;  3R9Q A;  5DZK H;  2Q35 A;  2F6Q A;  1NZY B;  3QK8 A;  4HNK A;  1NZY A;  1K32 A;  3QXI A;  4F47 A;  3H0Q A;  2J5G D;  3HE2 A;  3SWX A;  4QIJ A;  4ZDF A;  4FZW A;  4JCT A;  4JCR A;  3TVU A;  5MGB A;  3KTG A;  4L8K A;  2QQ3 A;  5E0N X;  4DI1 A;  5DTP A;  3M6N A;  1K39 A;  3V5I A;  3MT6 A;  5E0S H;  1JXZ A;  3FF6 A;  2DEO A;  1XO6 A;  3NJD A;  3QYR A;  4FB8 A;  3IB9 A;  5DU6 A;  5INI A;  4Z0M A;  3H0J A;  3KTK A;  3QWD A;  2F9I A;  2VSS A;  4JSB A;  2CE3 A;  4ZDC A;  1EF8 A;  4FND A;  3PZK A;  3ZW9 A;  3GF7 A;  2J5G A;  3HLN 1;  1O8U A;  2PG8 A;  3OT6 A;  5CTB A;  1UYS A;  4OLQ A;  2CBY A;  4B3I A;  5FUS A;  3ZWC A;  3GLM A;  3MOY A;  1HZD A;  5KJP A;  1XX4 A;  3JU1 A;  4U18 A;  3H0U A;  3H81 A;  2VX2 A;  3HP0 A;  3T3W A;  3WG5 A;  4RCN A;  3TVW A;  1YG8 A;  1DUB A;  2VRE A;  4MI2 A;  2IEX A;  3TDC A;  4U0H A;  4U0G A;  1WDM A;  3BPP A;  4IZB A;  4KNP A;  1DCI A;  4B3J A;  4JJT A;  1WZ8 A;  2J5S A;  2X58 A;  2VSU A;  3R6H A;  5C90 A;  5JBW A;  3P2L A;  2HW5 A;  4QII A;  4FZW C;  1HNU A;  3QRE A;  2PBP A;  3M6M A;  4ZU2 A;  2EJ5 A;  3BEZ A;  2ZL0 A;  1EF9 A;  2F9I B;  4JYL A;  4ELS A;  3PE8 A;  3TT6 A;  3QXZ A;  3GKB A;  5CTC A;  3N6R B;  2ZQQ A;  3DJA A;  4EMP A;  3TV5 A;  3TLF A;  2D3T A;  4JCQ A;  3RST A;  3TT7 A;  3NJB A;  1WDK A;  3H02 A;  1FC6 A;  3GMA A;  4JFC A;  1UYV A;  3U9R B;  4B3H A;  3T8B A;  3H0S A;  3IBB A;  4YLH A;  1J7X A;  4JWV A;  3Q0G A;  1N6D A;  3I47 A;  2FW2 A;  5E0S A;  2VSU C;  3OME A;  3L3S A;  2A81 A;  4ASI A;  2UZF A;  1Y7O A;  2VSS E;  4U19 A;  4EML A;  1N6F A;  3R9T A;  3U9S B;  3P85 A;  1YG6 A;  3RRV A;  2ZL3 A;  4JCS A;  4I4Z A;  4K3W A;  2F6I A;  3G64 A;  1Q51 A;  2PPY A;  2DUB A;  3HRX A;  5DUC A;  1OD4 A;  3K8X A;  1TYF A;  4KPK A;  5INF A;  3KTJ A;  5DL1 A;  5DU8 A;  4I52 A;  3TZ3 A;  3BF0 A;  1OD2 A;  4OMR A;  4MXI A;  4K2N A;  2C8T A;  1XNY A;  3ISA A;  3Q1T A;  3QKA A;  1X0U A;  1PJH A;  3IAV A;  4EMM A;  3U9T B;  5KDR A;  1RJN A;  1SZO A;  4JYJ A;  2A7K A;  3ZWA A;  1FCF A;  4KWB A;  4QFE A;  1VRG A;  2J5I A;  4ELW A;  2X24 A;  3KTI A;  3P5M A;  2ZQR A;  1XNV A; 
#chains in the Genus database with same CATH topology
 3L75 D;  1Q82 Q;  1VQL P;  4FJW D;  2IZ1 A;  2B87 A;  5L8R J;  2ZL4 A;  1S9K E;  3H1L E;  4PD4 I;  2IX7 C;  1FU1 A;  1M1J C;  4Q1I A;  2I1K A;  2XNX A;  2F9Y A;  1IFD A;  2HLO A;  4ELX A;  2AEF A;  4W7Y A;  1KQG B;  2E5Y A;  5KLV E;  1KB9 I;  3VIV A;  3BRT B;  2QJK B;  4EDF A;  2F9Y B;  3JC2 2;  1ON9 A;  3RL0 C;  3FXE A;  3BRV B;  2FZS A;  4PV1 C;  1TG6 A;  2IYP A;  2E74 D;  3MHV A;  4U0G H;  2B87 B;  2QEX P;  3HE5 B;  3L72 D;  5DUF A;  1L0N E;  1D7M A;  3VOP A;  2QVA A;  1QVF O;  3BAS A;  2B88 A;  4ZDE A;  3VN0 A;  1SQB J;  3ZDM A;  4U1A A;  3P7K A;  1MZ9 A;  1J2J B;  4N78 E;  2NPS C;  4ZDB A;  1SQP G;  1S9K D;  3G4S P;  3V4Q A;  3GHG C;  4U3F G;  1FZA A;  3LW5 J;  2R5B A;  2GTR A;  2OYO A;  1VQ9 P;  2MKV A;  1P84 E;  4GM2 A;  2FYU D;  3D70 A;  3A3Y B;  3CWB J;  2PAJ A;  2UWJ E;  2WPR A;  5KDR B;  1SQX K;  2ZT9 C;  2A45 G;  2YKQ A;  3PHL A;  2C9L Y;  1SQB D;  3AE8 C;  3QH9 A;  4WCZ A;  2IDB A;  4LGD E;  1XNW A;  4D6T D;  3S9O A;  2VSS F;  3DOR A;  3H1I G;  1URQ D;  1SQQ D;  2W6B A;  3L70 J;  5KLV G;  1Y8A A;  5AW5 B;  1KB9 E;  3HTK B;  1L0N K;  3H1H J;  3ZWB A;  2J5I B;  1CW5 A;  1EY3 A;  3S1K A;  2FXO A;  4HC8 A;  1YJN P;  1N7S D;  1JOC A;  3MZW B;  5KKZ B;  3QMJ A;  5KLV J;  1VQ5 P;  1GDT A;  4O9B A;  1LTA C;  1BSN A;  3Q3D A;  5APQ A;  1RF1 C;  5AW3 B;  1DH3 A;  2QA4 P;  2E76 B;  3R9S A;  1W2B O;  5DZK H;  3CX5 E;  2YKP A;  2JR8 A;  3QK8 A;  3L72 G;  1NZY A;  1K32 A;  1SQQ E;  2C0W A;  1FC2 C;  1JM0 A;  3U1C A;  2IBZ E;  3I5C A;  1HVV A;  3CD6 P;  3V2Q A;  2H43 A;  5BU5 A;  3HUS A;  3RK3 D;  1IFN A;  1S72 P;  4JCT A;  4JCR A;  1PP9 D;  3KTG A;  2QQ3 A;  5H2F E;  1JY2 O;  2OYH B;  3V5I A;  3V6I A;  4IOI H;  2Q7C A;  1YYC A;  2DEO A;  1JCD A;  4FB8 A;  2BEQ D;  5INI A;  4I1L A;  3H0J A;  4BRY B;  4YPC A;  1KIL C;  1ZP0 C;  4QMA A;  5GTI H;  4ZDC A;  1EF8 A;  3VMA A;  2K88 A;  4U3F E;  3HLN 1;  1NTM G;  3E1I A;  3TGU E;  1Q7Y Q;  3OT6 A;  3L73 E;  2O1K A;  4B3I A;  5C39 A;  3ZWC A;  4RES B;  2V4H A;  4IFD K;  5KJP A;  1JTH A;  4H0L D;  4J2U A;  2GUV A;  2AEM A;  1PP9 E;  3L37 A;  3T3W A;  1FE6 A;  4H44 D;  2IYO A;  4MN4 C;  3TVW A;  3HD7 A;  2WSS H;  1L4A D;  1U7J A;  2IEX A;  1CI6 B;  1L0N G;  1PGP A;  4U0G A;  1GL2 A;  3H1L J;  3ABV C;  1KOR A;  1LWU B;  2GA1 A;  2QJP B;  1DCI A;  1ZW0 A;  1NKZ B;  4TLF A;  1T3U A;  1GMJ A;  4H13 B;  2E74 C;  1EDL A;  4FZW C;  2OGU A;  3OAK A;  1A02 F;  3N7N A;  2PBP A;  2NPS A;  1LJ2 A;  2F9I B;  4NPE A;  1RE3 C;  1KYO E;  1U57 A;  2P7J A;  3A5T A;  2ZVN B;  3C8V A;  1L0L J;  3MIW A;  1KN7 A;  1PGO A;  3SFE C;  1HF9 A;  1GL2 C;  1KQL A;  1NTZ J;  3N6R B;  2ZQQ A;  2YXQ B;  5KAF H;  1EXI A;  1S3J A;  3TLF A;  2W90 A;  3PJS K;  2FFD B;  5E79 H;  5AW8 B;  3TT7 A;  3CCQ P;  2P58 A;  3NJB A;  2E74 B;  1P84 I;  1LTG C;  3CWB G;  2KI7 B;  2E5T A;  4N6J A;  2A45 I;  4JFC A;  3EWK A;  1W2E A;  1KV4 A;  3RK3 B;  1S1C X;  1SFC A;  2Q3E A;  1PZQ A;  4U7J A;  1JO5 A;  1NTK D;  4PD4 E;  3PRJ A;  1J7X A;  3CPW O;  4JWV A;  3Q0G A;  3IN6 A;  5E0S A;  2VSU C;  2E76 C;  1HWT C;  1SP4 A;  5CBO A;  4C46 A;  3L3S A;  1NTZ D;  2A81 A;  3N4X A;  1RF1 B;  3GG2 A;  3A0H E;  1Y7O A;  2WPS A;  3KZI H;  3BPT A;  4U19 A;  1G1J A;  3L74 G;  3U59 A;  3VP9 A;  2KXP B;  1DEB A;  1WT6 A;  3Q5S A;  2ZL3 A;  4I4Z A;  2F6I A;  3L75 G;  1KFM A;  1L0N D;  2KOG A;  1EDJ A;  1OD4 A;  3K8X A;  2QJK C;  2W83 C;  5HUQ A;  3KTJ A;  5DU8 A;  2E75 B;  3TNU B;  3H1J J;  4I52 A;  2OTK E;  1DIP A;  1OD2 A;  1J1D B;  1IFP A;  3WU2 E;  3TGU G;  2FFD C;  4K2N A;  3H1H G;  5B66 H;  4EI2 A;  1BGY D;  3HD7 D;  1L4A B;  2OYI B;  2B89 A;  1NWQ A;  1PJH A;  2JKV A;  1K9M Q;  3U9T B;  1RJN A;  1SQP J;  1X79 B;  5APW A;  1N86 A;  1S2E A;  4OGQ D;  3LIE A;  1FCF A;  1OVR A;  1QGK B;  1SLQ A;  2JP3 A;  3HE4 A;  4KWB A;  3V5B A;  2X24 A;  1L0N J;  3L75 J;  4GOF A;  2QM8 A;  3AE5 C;  1H0T B;  2NZ2 A;  3TF5 A;  5M1B A;  1VF5 C;  4I2L C;  4HH2 A;  2YNY A;  4R4M A;  3AE3 C;  2Q34 A;  3L72 J;  1BE3 D;  2ZYA A;  3M9B A;  4IFF A;  1SFC C;  3CC7 P;  1EDK A;  1YIJ P;  2A7S A;  2LKM A;  2AXT H;  3I56 P;  3HE5 A;  2O01 H;  3L73 G;  1YJW P;  2Y9Y A;  5APS A;  5DU4 A;  1QL1 A;  1LWU C;  1A02 J;  2PGD A;  1T2K C;  1PP9 J;  3CXH D;  3A0B E;  1KZU B;  3H1J G;  1GW3 A;  3PEA A;  2K3R A;  2Y9Z A;  1MKM A;  3K5B A;  3V4W A;  5AVW B;  3VMZ A;  1VQ8 P;  1ZLL A;  2BCC D;  3RSI A;  4NNQ A;  3R0O A;  1W2X A;  1K73 Q;  2KLV A;  2C9N Y;  1Q86 Q;  2VRS A;  3RK2 D;  3VMY A;  5FIF A;  2O1J A;  2CPB A;  3OC7 A;  3FGA D;  5CCG D;  4GHN A;  3ZW8 A;  1RQU A;  2J58 A;  3HE4 B;  2JEE A;  2M3B A;  4Q0G A;  3T89 A;  4H0L B;  1BCC J;  1QL2 A;  3H32 B;  4H44 B;  1SQQ G;  1NO4 A;  2L5G B;  5AW2 B;  4RYF H;  1JCC A;  3PP5 A;  1FZC A;  3HD7 C;  1AFO A;  3MYB A;  3EFF K;  1NTK K;  1PP9 G;  1JUN A;  3SWK A;  2OYH C;  3CCE P;  1FC9 A;  2E43 A;  1G1I A;  3F89 A;  1SQV J;  1J1E C;  1JB0 J;  1LTB C;  1GW4 A;  1SQQ J;  3CCL P;  2P67 A;  3G9R A;  3EFG A;  5APU A;  4LLH A;  5AW0 B;  2ZT9 B;  4OG1 A;  2I1J A;  3USS A;  1IK7 A;  2WZ7 A;  1ZME C;  2GUS A;  4ZDD A;  2M5A B;  2ZL2 A;  3B71 A;  1RJM A;  1LTJ A;  1BDD A;  4BWN A;  3BCC D;  1KTM A;  2R44 A;  1HGV A;  4YXD C;  4L74 A;  1DEE G;  2KS1 A;  5GTI E;  1MFZ A;  2W27 A;  5AW9 B;  3K50 A;  2YXR B;  1SS1 A;  2HG5 D;  5JBX A;  3CXH I;  5AVQ B;  2FYU K;  3SWY A;  5GTH H;  2Q2X A;  5AW4 B;  2BZR A;  4JOT A;  1PIX A;  3L73 J;  2JWA A;  3AEG C;  1VL2 A;  3D71 A;  1KB9 D;  3KPE A;  1NZY B;  2KIK A;  1YQ4 C;  2IBZ G;  2FXM A;  2O3J A;  1PL5 A;  1M1J A;  1J1D C;  1U7M A;  3RBZ A;  3HUS C;  3VYI A;  5APX A;  3P8C E;  4PD4 D;  1RY3 A;  3H0Q A;  4F47 A;  3CCS P;  1RF0 A;  2QM7 A;  4RJT A;  2WSF J;  3SWX A;  1YTZ T;  3E7K A;  3WUV A;  4ZDF A;  1NTZ K;  1N73 C;  4OWF A;  1SQX D;  3NXS A;  4Y99 C;  3B5N C;  2GM4 A;  3M6N A;  1N2D C;  3OW2 O;  3KXD A;  2Q5U A;  1N73 B;  2BEZ F;  3H1I D;  2H7H A;  3AE1 C;  1JY2 N;  3QYR A;  4D6T G;  1S5L E;  3IB9 A;  5DU6 A;  4Z0M A;  3II6 A;  1KYO I;  3M06 A;  2F9I A;  1GZL A;  2A06 E;  4JSB A;  4FND A;  1SFC D;  3AEB C;  1YIT P;  3B5N A;  1BCC G;  2IBZ D;  2FXP A;  2P1J A;  3PTZ A;  4OLQ A;  1OVV A;  3GLM A;  1RF0 C;  3MOY A;  1GK6 A;  3KQG A;  1XX4 A;  1URQ C;  2N9Y B;  3LW5 H;  1T2K D;  3HP0 A;  1NTK J;  3WG5 A;  4RCN A;  2R3C A;  4DT0 A;  5KAI H;  2LXC B;  4MI2 A;  3TDC A;  4W80 A;  3H1H E;  1ZRT E;  3B5N D;  3B8E B;  3F5H A;  3MUD A;  2YJG A;  2JWD A;  3JSV C;  2RH0 A;  4Y28 J;  4OVN F;  2VSU A;  3MD0 A;  2ZYD A;  4AQR D;  5DJT B;  3S4R A;  2KSE A;  4DJG A;  2HW5 A;  2XDJ A;  3P2L A;  4DZO A;  4QII A;  1VQK P;  4I7Z C;  1GU4 A;  4KHX A;  3WU2 H;  4WY4 A;  4JPZ B;  3M6M A;  4ZU2 A;  2EJ5 A;  5K5G B;  3M91 A;  1SQX E;  3BEZ A;  3AED C;  1LTT C;  3O6Q A;  4N78 D;  1EDI A;  1BE3 G;  4JYL A;  1L4A A;  1G2C A;  2KZI A;  4ELS A;  1IZN B;  1LT9 A;  1IFM A;  1OZH A;  1PPJ E;  2FYN C;  5KJ7 D;  5CTC A;  3CCJ P;  2ZYG A;  3TV5 A;  1BE3 J;  1LP1 A;  2A06 D;  4IL6 E;  2OTL P;  4UB8 H;  1H89 A;  2AXT E;  3G3Z A;  1N73 A;  4R4L A;  1S4X A;  3Q5R A;  3A2A A;  1FJP A;  1BSH A;  3U9R B;  4H44 C;  1NAF A;  2KLU A;  4BRY A;  4YLH A;  1N6D A;  1K8A Q;  3M0A A;  1BGY E;  4DCK A;  1EC5 A;  1CZQ A;  4C7R A;  2QG4 A;  3FX0 A;  2M5A A;  2OYI A;  1DD3 A;  4NPD A;  1VF5 D;  1N6F A;  3R9T A;  3U9S B;  2P2U A;  3P85 A;  2R3S A;  1YG6 A;  1Q90 D;  5KAF E;  2HPC A;  1NTZ G;  4UB6 E;  4JCS A;  2WT7 A;  3R4Y A;  1GK4 A;  4K3W A;  3L74 D;  3G64 A;  1Q51 A;  3HRX A;  5CCG A;  1OXZ A;  5DUC A;  1YQ3 C;  3A0H H;  1TYF A;  2Q3I A;  4I6M C;  2HFE D;  3AE7 C;  3IAO A;  1GTW A;  1BCC E;  1EZV I;  2C8T A;  3Q1T A;  1LT9 B;  1QVG O;  3QKA A;  1FJK A;  2W6J H;  2WSF H;  4JYB A;  1X0U A;  5APY A;  3A7O A;  1RE4 A;  4JF7 A;  1OVU A;  4EMM A;  3WUU A;  1DD4 A;  2R32 A;  5AVT B;  2A7K A;  4JQ0 D;  3ZWA A;  4HYT B;  1SQV E;  2J5U A;  3L74 J;  1NU1 E;  1NYH A;  1NTM D;  1VRG A;  1KC8 Q;  2FYN B;  4HKZ H;  3TGU D;  1NVO A;  3M9H A;  4XFJ A;  4L75 A;  1VPC A;  1JY3 P;  1OW7 A;  1SQB K;  1M8O B;  3CI9 A;  2FBW C;  3BAT A;  3L70 D;  4IZD A;  1EZV D;  5DZK A;  2FFD A;  2Z4E A;  2OQQ A;  2ZXE B;  3O6Q B;  2G8Y A;  5CCH D;  3CLQ A;  2OTJ P;  3HIN A;  4KD6 A;  1FOS E;  1BDC A;  4YTP C;  1UIY A;  5AVV B;  1L0L D;  1DX7 A;  1FZB A;  1VQO P;  3FWL A;  4OGQ C;  3MTU E;  2FBM A;  1SQX J;  3KYQ A;  1AV1 A;  1LNQ A;  3RL0 D;  4I42 A;  5G1S A;  3M9Q A;  1HGZ A;  1ZR4 A;  1FDM A;  4RYF A;  3AEE C;  4FNB A;  5CBN A;  4K29 A;  1K05 A;  1MV8 A;  4JVT A;  5CCH C;  3PGQ A;  1W5C E;  2AEJ A;  2N1T C;  3CWB D;  4G2R A;  2XZR A;  2KNC B;  4GT1 A;  4D6T E;  1NJI Q;  4LK5 A;  3T97 B;  2NRG A;  1WDL A;  1PFI A;  3L75 E;  2QSI A;  2NP9 A;  4GKG A;  1NAY A;  3LID A;  5H2F H;  2FYZ A;  3QWO C;  1VF5 B;  3FDU A;  4M3L A;  3AEF C;  1P84 D;  4L6W A;  2PRR A;  1IFI A;  1H0T A;  1YJ9 P;  1EQ7 A;  5G1R A;  1AJY A;  5AW1 B;  5B5E H;  3H1I E;  5IKL B;  2BCC E;  4BXL A;  3UIA A;  2K9J B;  3TK1 A;  3AE2 C;  3CCR P;  1N8R Q;  4WBA A;  1UYR A;  2VSU E;  1N6E A;  3TGU J;  2YMY A;  1SQX G;  1HJB A;  2ZFC A;  3H1K G;  1JNM A;  1AQT A;  1MJ3 A;  3T88 A;  3TRR A;  3VTP C;  4IZC A;  1VQ7 P;  2VSU F;  2C0X A;  2W3P A;  3Q0J A;  3STA A;  1OX3 A;  4WZ8 B;  3SLL A;  2JJL A;  1KQF B;  1FZC C;  2QJY C;  2WT7 B;  3PLN A;  2Z5H A;  1HNO A;  2YMK A;  1T3J A;  5C9G A;  1UYT A;  3Q1M A;  1FC7 A;  3R9Q A;  3JCU H;  5KLI C;  4Y99 B;  2G3A A;  2B9B A;  4HNK A;  2LXB A;  1YBK A;  2WQY C;  2Q6Q A;  4WVZ A;  1ZXG A;  2HR3 A;  1IJD B;  3RK2 C;  2YO2 A;  2ZXX A;  4QIJ A;  1NU1 K;  3TYY A;  2AXC A;  4W7Z A;  5TIS H;  4PD4 H;  2WSC H;  1IFJ A;  1SQB G;  5KLV D;  5E0N X;  5DTP A;  2WSC J;  2JDI H;  3L71 E;  3FF6 A;  3TDK A;  1R8E A;  1T6A A;  1XO6 A;  4EOT A;  1KYO D;  3NJD A;  2D2C B;  3L70 G;  3L72 E;  2OYI C;  2ZAE B;  2OAR A;  2VSS A;  2CE3 A;  1ZOY C;  2K9Y A;  3BVH A;  2NPS B;  1K04 A;  3H1L D;  4K35 A;  2ITA A;  3A0B H;  2PG8 A;  1GL2 D;  5CTB A;  4UB8 E;  3WUT A;  2CK3 H;  3P8M C;  2CBY A;  4OH8 B;  1KB9 H;  4AUW A;  1ZN5 A;  3C1L A;  1SQP D;  2DW3 A;  2E75 C;  3H0U A;  1NTK E;  1MUU A;  3BCC E;  5CCH A;  1YHQ P;  4L73 A;  3RK3 E;  1DUB A;  2VRE A;  2N1T D;  3HD7 B;  2I8D A;  4ZMD A;  4GOE A;  1IK9 A;  4U0H A;  1ZRT D;  1S5L H;  3VMX A;  3BPP A;  3H1J D;  1PGJ A;  4IZB A;  1NGM B;  2FKW B;  2KNC A;  4B3J A;  4JJT A;  1WZ8 A;  2ZT9 D;  2P10 A;  5KJ7 C;  5C90 A;  3GHG A;  4PV1 D;  1KQS O;  4GDO A;  1JMM A;  3U1A A;  1HNU A;  1NOH A;  3ITK A;  3FXD A;  2Q9I A;  1YI2 P;  1TU3 F;  2QE7 H;  2ZL0 A;  1EF9 A;  4HJG H;  3W68 A;  1HH0 A;  1JY2 P;  3PE8 A;  1E5W A;  3TT6 A;  3L71 D;  3C9I A;  1VQM P;  1M90 Q;  3MUD C;  4WWI A;  2YO3 A;  5CJ4 A;  3OA7 A;  2H89 C;  3DJA A;  1GD2 E;  2V7Q H;  1LT1 A;  2D3T A;  4XA4 A;  4JCQ A;  3RST A;  1FZE A;  2IPP A;  2XKM A;  2Y0C A;  3H1H D;  3KHU A;  1WDK A;  1T8Z A;  1FC6 A;  1EXJ A;  3SFD C;  5CJ0 A;  1M57 D;  4YXW H;  2KYV A;  4KJM A;  4B3H A;  3T8B A;  3H0S A;  3L71 G;  1FBM A;  1M7L A;  1KFN A;  2FW2 A;  4RKU J;  3OME A;  4ASI A;  1NTM K;  2VSS E;  2FYU J;  5KLV K;  4Z1M H;  1M1K Q;  4EML A;  1L0L K;  1SFC B;  1RF1 A;  3CX5 I;  1NKN A;  3RGU A;  4D6T J;  3RL0 g;  3IFM A;  4PJ0 H;  3CXH H;  2IFN A;  5KKZ C;  1FDO A;  4DOJ A;  2PPY A;  2JO1 A;  2DUB A;  2RN0 A;  1FZC B;  4KPK A;  5INF A;  3G6E P;  1OFC X;  5DL1 A;  1SVF A;  1URQ B;  3NMD A;  4EIJ A;  4HDT A;  1BGY J;  1XNY A;  2KUB A;  4C7N A;  2N1T A;  5CHX A;  2KSJ A;  1M56 D;  4WY4 D;  4H0L C;  5B66 E;  3CXH E;  3CCM P;  1IC2 A;  3O8Z A;  2M3E A;  3CC2 P;  1SZO A;  3B4S A;  3H1K E;  2YKO A;  3RK3 C;  4JYJ A;  4IL6 X;  2M8R A;  4H13 D;  3KTI A;  5B5E E;  4PV1 B;  1JY3 O;  2RKL A;  1SQB E;  1LT9 C;  3P5M A;  3CMA P;  1XNV A;  2E76 D;  3V2R A;  1S5L X;  1YTZ I;  1HTL C;  2HOD A;  2ZVO B;  5APT A;  1EZV E;  3M0D C;  4B86 A;  1FOS F;  1BE3 E;  3GF3 A;  3NFQ A;  5DTW A;  2H8P D;  4WYO B;  3CME P;  2E42 A;  3MFM A;  3ST9 A;  2POH A;  1AQ5 A;  4GOD A;  5G1Q A;  1KIL B;  2Z5I A;  1L0L E;  2Y0D A;  3CCU P;  5ING A;  4NEK A;  5DKP A;  3Q7H A;  1KIL A;  2IZ0 A;  2WVR A;  1JEK A;  3KZI E;  4AYC A;  4TT3 H;  4PJ0 E;  1SQP K;  3L70 E;  1PGQ A;  2HOD B;  1SG4 A;  3KTH A;  1SQV K;  4ASW A;  4WB4 A;  3E1R A;  1OWA A;  3L74 E;  5AVY B;  1Y9B A;  1VQ6 P;  5AVX B;  1AA0 A;  1NTM J;  4FN7 A;  2NPS D;  3CL3 D;  1BCC D;  1GL2 B;  1JY3 N;  2W6A A;  3T8A A;  4MOU A;  1PV3 A;  2KZJ A;  5CCG C;  4FN8 A;  3L71 J;  2WTB A;  4XE5 B;  1HJ0 A;  4H13 C;  1PPJ G;  2L91 A;  3H1K D;  3H1L G;  4A7P A;  3KQF A;  2RMZ A;  2QIW A;  3AE6 C;  3MP7 B;  2N1T B;  4C7N B;  3IF4 A;  4IFM A;  1VQ4 P;  2E75 D;  3B5N B;  1ON3 A;  1UIX A;  2BAS A;  3G71 P;  1Q81 Q;  4HB1 A;  2FY8 A;  5EFW B;  1Q52 A;  1IO4 A;  2FYU G;  3HUS B;  1RHZ B;  2MJZ A;  3SWF A;  1H8A A;  3TNU A;  2J5I I;  2OYH A;  5AVZ B;  2WWW A;  3V5E A;  1OW8 A;  3LAO A;  5BVZ A;  2W8Z A;  3EQ2 A;  1NH4 A;  3LKE A;  1KD1 Q;  5AVS B;  4L76 A;  2Q1K A;  4NPF X;  2K1A A;  2Q35 A;  2F6Q A;  4IL6 H;  1RE3 A;  3CWB E;  1OW6 A;  1KIL D;  1LTJ B;  3JCU E;  3QXI A;  4WY4 C;  2HPC B;  1SQQ K;  1HUC A;  2XV5 A;  5GTH E;  1VDF A;  2J5G D;  3HE2 A;  2QRX A;  4K3A A;  4FZW A;  2R5D A;  4ZNC A;  1H88 A;  3TVU A;  5MGB A;  1NHL A;  3HTK A;  3H25 A;  4L8K A;  4DI1 A;  3L36 A;  4CPG A;  5AVU B;  1L2P A;  5CMZ A;  1K39 A;  3MT6 A;  5E0S H;  2KK7 A;  1JXZ A;  3CC4 P;  1UII A;  3KTK A;  3QWD A;  3L35 A;  2J59 M;  1LP1 B;  2YIU B;  3HRN A;  1PPJ D;  2CPS A;  1E79 H;  3PZK A;  4ASV A;  1GU5 A;  3ZW9 A;  3GF7 A;  2J5G A;  1LTI C;  1O8U A;  1USD A;  3RK2 B;  2O01 J;  1FDI A;  3P32 A;  2WMM A;  2A45 H;  4LC1 A;  1UYS A;  1G2C B;  2BCC G;  2LR2 A;  5FUS A;  3I55 P;  1HZD A;  1Q2N A;  5KLI B;  3H1I J;  3JU1 A;  4U18 A;  1USE A;  1N7S A;  1XTC C;  3H81 A;  2VX2 A;  3T97 A;  1NTZ E;  2D2C C;  1RQV A;  4NAR A;  1Y47 A;  1QEX A;  1CI6 A;  1YG8 A;  4JBZ A;  3BCC G;  1AVO A;  3NTN A;  3CX5 D;  2ZJS E;  3OJA B;  1X22 A;  4WY4 B;  3AE9 C;  4JYC A;  2K37 A;  2XND H;  1WDM A;  5BU8 B;  4UB6 H;  1RH5 B;  1NU1 G;  1R5L A;  1LWU A;  4KNP A;  2N9B A;  1FZF A;  1JTH B;  1VQN P;  3V2P A;  4OGQ B;  1N7L A;  2J5S A;  3VP8 A;  1KYO H;  3P8C D;  4N3Y B;  2X58 A;  1AVY A;  3R6H A;  1KIL E;  5JBW A;  3L73 D;  3FWN A;  1L0L G;  1N7S B;  2WSE J;  3QRE A;  3PH0 A;  1JMB A;  5AW6 B;  3D6Z A;  1WMK A;  3SSU A;  4KT0 J;  3L4F A;  3R2P A;  3BCC J;  5APV A;  2QJY B;  1Z56 A;  2Y0E A;  3QXZ A;  3GKB A;  1ZR2 A;  5KTB A;  2PFX A;  2WSE H;  4EMP A;  4U3F D;  2M0B A;  3KDP B;  3RL0 B;  4EYY Q;  1ZV8 A;  1FZG A;  1RE4 C;  3AEC C;  2YIU C;  1LTJ C;  1X0T A;  3H02 A;  3H1J E;  2WTY A;  1URQ A;  3GMA A;  1L4A C;  1X9V A;  3CCV P;  3W67 A;  1N7S C;  1UYV A;  2WPQ A;  2H88 C;  1M1J B;  4U3F J;  3IR9 A;  1XTG B;  3IBB A;  3M0D A;  1SQP E;  3I47 A;  1SQV G;  5KJ7 A;  3Q2Y A;  3RBX A;  2PP6 A;  2QJP C;  1LTS C;  3GW6 A;  2UZF A;  2D2C D;  2SPZ A;  3H1K J;  1LGH B;  5TIS E;  3Q5P A;  2WPV B;  1CSB A;  2IFM A;  2O01 N;  3RRV A;  4ZKP A;  2KB7 P;  1FS0 E;  3D6Y A;  1SQV D;  2K9J A;  1NU1 D;  1EZV G;  5AVR B;  1MFT A;  2XU6 A;  3H6P A;  1KMI Z;  1J1E B;  4RO0 A;  1NU1 J;  3TZ3 A;  1X8Y A;  3BF0 A;  4OMR A;  5DJU B;  4MXI A;  1HBW A;  3ISA A;  1NTK G;  1OIP A;  2IBZ I;  1VQP P;  2A06 G;  2KS1 B;  3MGN A;  3IAV A;  5AW7 B;  2WIT A;  1FAV A;  5KDR A;  1QX8 A;  2FYU E;  3TSI A;  2V7Q J;  5TJH A;  3WMM 0;  1BGY G;  1P84 H;  4QFE A;  3AE4 C;  4ZKU A;  2J5I A;  4GIF A;  4ELW A;  1NTM E;  3GHG B;  5E79 E;  2BCC J;  1R5S A;  5KAI E;  3H32 A;  2KP8 A;  4I7Z B;  1OMI A;  3V2N A;  3CX5 H;  2ZQR A;  1QLE D;  1WRG A;  3AEA C;  2HYN A; 
#chains in the Genus database with same CATH homology
 4IZD A;  5DZK A;  4R4M A;  3AE3 C;  2Q34 A;  3GF3 A;  4FJW D;  5DTW A;  4WYO B;  5L8R J;  2ZL4 A;  2OQQ A;  3MFM A;  2G8Y A;  3ST9 A;  4Q1I A;  5G1Q A;  3HIN A;  2F9Y A;  4ELX A;  4KD6 A;  2A7S A;  1KQG B;  4YTP C;  1UIY A;  5ING A;  4NEK A;  3VIV A;  5DKP A;  3Q7H A;  4OGQ C;  2FBM A;  2F9Y B;  1ON9 A;  2FZS A;  5DU4 A;  4PV1 C;  1TG6 A;  4I42 A;  5G1S A;  2E74 D;  4TT3 H;  4U0G H;  4RYF A;  3AEE C;  4FNB A;  4K29 A;  1K05 A;  1SG4 A;  3KTH A;  3PEA A;  5DUF A;  4JVT A;  1MKM A;  3PGQ A;  1Y9B A;  4ZDE A;  4G2R A;  3RSI A;  4U1A A;  4NNQ A;  4LK5 A;  3R0O A;  4FN7 A;  3T97 B;  1W2X A;  4ZDB A;  1WDL A;  5FIF A;  3T8A A;  3OC7 A;  4MOU A;  1PV3 A;  2QSI A;  2NP9 A;  3LW5 J;  3FGA D;  4GHN A;  4FN8 A;  2GTR A;  2WTB A;  1HJ0 A;  1RQU A;  3ZW8 A;  1VF5 B;  3FDU A;  4H13 C;  3AEF C;  2MKV A;  4GM2 A;  4Q0G A;  3D70 A;  3T89 A;  4H0L B;  4L6W A;  5KDR B;  2ZT9 C;  3KQF A;  4H44 B;  5G1R A;  1AJY A;  4RYF H;  2QIW A;  3AE6 C;  3MYB A;  3AE8 C;  4WCZ A;  5IKL B;  2IDB A;  1XNW A;  3S9O A;  1FC9 A;  2VSS F;  3DOR A;  2E75 D;  3AE2 C;  1JB0 J;  1UYR A;  1ON3 A;  2VSU E;  1UIX A;  1N6E A;  3G9R A;  1Q52 A;  3ZWB A;  2ZT9 B;  4OG1 A;  2J5I B;  1EY3 A;  1MJ3 A;  3T88 A;  1IK7 A;  3TRR A;  1ZME C;  4IZC A;  4ZDD A;  2ZL2 A;  4HC8 A;  3B71 A;  1RJM A;  2J5I I;  2VSU F;  2W3P A;  3Q0J A;  3QMJ A;  3STA A;  1KTM A;  4WZ8 B;  3SLL A;  4YXD C;  3V5E A;  1OW8 A;  3LAO A;  1KQF B;  3Q3D A;  3K50 A;  2QJY C;  3LKE A;  5JBX A;  1HNO A;  2YMK A;  5C9G A;  2Q2X A;  2E76 B;  2BZR A;  4JOT A;  3R9S A;  1UYT A;  1PIX A;  3Q1M A;  1FC7 A;  3R9Q A;  3AEG C;  5DZK H;  1VL2 A;  5KLI C;  3D71 A;  2G3A A;  2Q35 A;  2F6Q A;  1NZY B;  3QK8 A;  4HNK A;  1NZY A;  1YQ4 C;  2WQY C;  1OW6 A;  1PL5 A;  1K32 A;  3QXI A;  4F47 A;  3H0Q A;  2J5G D;  3HE2 A;  2WSF J;  3SWX A;  4QIJ A;  4ZDF A;  4FZW A;  4JCT A;  4JCR A;  3TVU A;  5MGB A;  3KTG A;  3H25 A;  4L8K A;  2QQ3 A;  5E0N X;  4DI1 A;  5DTP A;  3M6N A;  2WSC J;  1K39 A;  3V5I A;  3MT6 A;  5E0S H;  1JXZ A;  3FF6 A;  2BEZ F;  2DEO A;  1R8E A;  1XO6 A;  3AE1 C;  3NJD A;  3QYR A;  4FB8 A;  2BEQ D;  3IB9 A;  5DU6 A;  5INI A;  2D2C B;  4Z0M A;  3H0J A;  3KTK A;  3QWD A;  2F9I A;  1ZP0 C;  2VSS A;  4JSB A;  2CE3 A;  4ZDC A;  1ZOY C;  1EF8 A;  2K9Y A;  4FND A;  3PZK A;  3ZW9 A;  3GF7 A;  2J5G A;  3AEB C;  1K04 A;  1O8U A;  3HLN 1;  2O01 J;  1FDI A;  2PG8 A;  2FXP A;  3OT6 A;  5CTB A;  1UYS A;  4OLQ A;  2CBY A;  4B3I A;  5FUS A;  3ZWC A;  3GLM A;  3MOY A;  1HZD A;  5KJP A;  1XX4 A;  3JU1 A;  4U18 A;  4H0L D;  4J2U A;  2E75 C;  3H0U A;  3H81 A;  2VX2 A;  3HP0 A;  3T3W A;  4H44 D;  2D2C C;  1RQV A;  3WG5 A;  4NAR A;  4RCN A;  3TVW A;  3RK3 E;  1DUB A;  1YG8 A;  2VRE A;  4MI2 A;  2IEX A;  3TDC A;  4U0H A;  3AE9 C;  4U0G A;  1ZRT E;  1WDM A;  3BPP A;  3ABV C;  2YJG A;  1KOR A;  4IZB A;  4KNP A;  1DCI A;  1NGM B;  4B3J A;  4Y28 J;  4OGQ B;  4JJT A;  1WZ8 A;  2J5S A;  1GMJ A;  4H13 B;  2ZT9 D;  2P10 A;  2VSU A;  2X58 A;  2E74 C;  3R6H A;  5C90 A;  4PV1 D;  1KIL E;  5JBW A;  3P2L A;  2HW5 A;  4QII A;  4GDO A;  4FZW C;  4I7Z C;  1HNU A;  2WSE J;  3QRE A;  2PBP A;  3D6Z A;  3M6M A;  1TU3 F;  1WMK A;  4ZU2 A;  2EJ5 A;  3BEZ A;  3AED C;  3O6Q A;  2ZL0 A;  1EF9 A;  2F9I B;  4KT0 J;  4JYL A;  1U57 A;  4ELS A;  3PE8 A;  3TT6 A;  3C8V A;  3QXZ A;  3SFE C;  1HF9 A;  3GKB A;  2FYN C;  5CTC A;  3N6R B;  2ZQQ A;  1EXI A;  2H89 C;  3DJA A;  4EMP A;  3TV5 A;  3TLF A;  2D3T A;  4JCQ A;  3RST A;  3TT7 A;  3NJB A;  2E74 B;  3AEC C;  2YIU C;  1WDK A;  3H02 A;  1FC6 A;  3GMA A;  1EXJ A;  3SFD C;  4JFC A;  4R4L A;  3EWK A;  1UYV A;  3Q5R A;  2H88 C;  1S1C X;  3U9R B;  4U7J A;  4H44 C;  3T8B A;  4B3H A;  3H0S A;  3IBB A;  4YLH A;  1J7X A;  4JWV A;  3Q0G A;  1N6D A;  3IN6 A;  3I47 A;  2FW2 A;  5E0S A;  2VSU C;  3Q2Y A;  2E76 C;  2QJP C;  4RKU J;  3OME A;  3L3S A;  2A81 A;  4ASI A;  2UZF A;  2D2C D;  1Y7O A;  2VSS E;  4U19 A;  3BPT A;  1DD3 A;  4Z1M H;  1VF5 D;  4EML A;  1N6F A;  3R9T A;  3U9S B;  3Q5P A;  3P85 A;  2WPV B;  1YG6 A;  1Q90 D;  3RRV A;  3RL0 g;  3Q5S A;  3D6Y A;  2ZL3 A;  4I4Z A;  4JCS A;  3R4Y A;  4K3W A;  5KKZ C;  1FDO A;  2F6I A;  3G64 A;  1Q51 A;  2PPY A;  2JO1 A;  2DUB A;  3HRX A;  5DUC A;  1OD4 A;  1YQ3 C;  3K8X A;  2QJK C;  1TYF A;  4KPK A;  1KMI Z;  5INF A;  5HUQ A;  3KTJ A;  5DL1 A;  5DU8 A;  2E75 B;  4I52 A;  3AE7 C;  3IAO A;  3TZ3 A;  3BF0 A;  1DIP A;  1OD2 A;  4OMR A;  4MXI A;  4K2N A;  4HDT A;  2C8T A;  1XNY A;  3ISA A;  3Q1T A;  3QKA A;  1X0U A;  4H0L C;  1PJH A;  3IAV A;  4EMM A;  3U9T B;  5KDR A;  1RJN A;  1SZO A;  1DD4 A;  4JYJ A;  2A7K A;  3ZWA A;  2V7Q J;  4OGQ D;  2J5U A;  1FCF A;  4IL6 X;  4H13 D;  1NYH A;  2JP3 A;  4KWB A;  4QFE A;  3AE4 C;  1VRG A;  2J5I A;  4ELW A;  2X24 A;  3KTI A;  4XFJ A;  4PV1 B;  1OW7 A;  3AE5 C;  4I7Z B;  3P5M A;  1OMI A;  2NZ2 A;  2ZQR A;  2FBW C;  1XNV A;  2E76 D;  1S5L X;  5M1B A;  1VF5 C;  3AEA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...