1PIXA

Crystal structure of the carboxyltransferase subunit of the bacterial ion pump glutaconyl-coenzyme a decarboxylase
Total Genus 219
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
219
sequence length
586
structure length
586
Chain Sequence
GFYSMPRYFQNMPQVGKPLKKADAANEEQLKKIEEEIHQLIKEAQEAGKADADVNKRGELTALQRIEKLVEPGSWRPLNTLFNPQGNKNGSVAIVKGLGRVNGKWCVVVASDNKKLAGAWVPGQAECLLRASDTAKTLHVPLVYVLNCSGVKFDEQEKVYPNRRGGGTPFFRNAELNQLGIPVIVGIYGTNPAGGGYHSISPTVIIAHEKANMAVGGAGIMGGMNPKGHVDLEYANEIADMVDRTGKTEPPGAVDIHYTETGFMREVYASEEGVLEGIKKYVGMLPKYDPEFFRVDDPKAPAFPADDLYSMVPLNDKRAYDIYNVIARLFDNSELHEYKKGYGPEMVTGLAKVNGLLVGVVANVQGLLMNYPEYKAAGSVGIGGKLYRQGLVKMNEFVTLCARDRLPIVWIQDTTGIDVGNDAEKAELLGLGQSLIYSIQTSHIPQFEITLRKGTAAAHYVLGGPQGNDTNAFSIGTAATEIAVMNGETAATAMYSRRLAKDRKAGKDLQPTIDKMNNLIQAFYTKSRPKVCAELGLVDEIVDMNKIRGYVEAFTEAAYQNPESICPFHQMILPRAIREFETFVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the carboxyltransferase subunit of the bacterial sodium ion pump glutaconyl-coenzyme A decarboxylase
pubmed doi rcsb
source organism Acidaminococcus fermentans
molecule tags Lyase
molecule keywords Glutaconyl-CoA decarboxylase A subunit
total genus 219
structure length 586
sequence length 586
chains with identical sequence B
ec nomenclature ec 4.1.1.70: Transferred entry: 7.2.4.5.
pdb deposition date 2003-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01039 Carboxyl_trans Carboxyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.680 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Helix bin 1pixA01
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1pixA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1pixA03
4U0GH 2FBMA 3OT6A 3SLLA 4OG1A 3ZW8A 1UYRA 3TVWA 4K29A 2VSSA 3G64A 5MGBA 4GHNA 4B3JA 4G2RA 3WG5A 2ZL2A 3QXIA 2ZQRA 4U19A 4B3IA 5DUFA 4EMLA 3T3WA 3V5IA 2F6QA 1RJMA 2VSUC 3V5EA 5DU8A 1PIXA 4KPKA 4FJWD 2J5GD 1K32A 2PG8A 2VX2A 5JBWA 3TRRA 1HNUA 1W2XA 3HE2A 1FC6A 1K39A 5DTWA 3STAA 4MOUA 1XNYA 4ELXA 2VSUE 5DZKH 4FB8A 3R9TA 1MJ3A 2J5SA 1EF8A 4ZDFA 3U9RB 1XX4A 3R9QA 4U0HA 1WDKA 4ASIA 2A7SA 4OLQA 1FCFA 3OMEA 2CE3A 5DZKA 1WDMA 2F9IA 1WZ8A 4IZCA 1O8UA 2J5IB 5DU6A 3U9TB 4JCTA 3GLMA 4I42A 1WDLA 3BF0A 3KTIA 3SWXA 3HINA 3K50A 3P2LA 5JBXA 4RCNA 2D3TA 1EY3A 4EMPA 2HW5A 4ELSA 3H0QA 4KWBA 1UYSA 5G1SA 2IEXA 2CBYA 2PPYA 3H81A 5E0SA 4JOTA 4HC8A 4RYFH 2ZL3A 3R0OA 2GTRA 5IKLB 3QREA 1ON9A 3QXZA 1TG6A 5G1RA 4U0GA 1YG8A 3H0JA 3ZWCA 4NNQA 4KNPA 4U1AA 4FNBA 4L6WA 4JJTA 3Q0JA 4NEKA 1UYTA 3LKEA 3QYRA 1XO6A 1OD4A 1N6DA 4WYOB 2FW2A 5DUCA 3TZ3A 3I47A 1Y7OA 1JXZA 3H0UA 1DUBA 2X58A 2Q35A 5KDRB 3KTKA 2FZSA 5E0SH 3IB9A 4KD6A 3QWDA 3PZKA 1NZYB 3IAVA 1Q51A 2X24A 3M6NA 4JVTA 2VSSE 4ZU2A 3T89A 4ZDDA 3KTGA 2ZQQA 3QMJA 2ZL0A 4K3WA 3T8AA 4WZ8B 1DCIA 4Q1IA 3IBBA 3TVUA 3R9SA 3NJDA 3PE8A 4ELWA 3PGQA 3ISAA 2A7KA 1OD2A 4RYFA 3DORA 3TDCA 2DUBA 1HZDA 1TYFA 4QIIA 3Q7HA 2ZL4A 2BZRA 4HNKA 5DKPA 4JSBA 1EF9A 5DU4A 3MFMA 3T8BA 3P5MA 3VIVA 3TT6A 5INFA 3DJAA 3H0SA 4I4ZA 3T88A 5FUSA 4FNDA 3JU1A 4FN7A 4JCRA 3TV5A 2F9YA 5DTPA 1RJNA 5INGA 3ZWBA 3N6RB 1SZOA 1NZYA 4F47A 1PJHA 5FIFA 4QIJA 2VREA 3NJBA 3TT7A 1FC7A 4MI2A 1Q52A 4I52A 3FDUA 4Q0GA 2A81A 5C90A 3GMAA 1J7XA 2VSUA 4DI1A 3HLN1 5KJPA 2F9IB 3QKAA 2NP9A 1SG4A 2DEOA 3RSIA 4FZWC 4L8KA 2J5IA 3HP0A 3P85A 3Q1TA 1VRGA 3U9SB 2F6IA 3OC7A 3GF3A 4B3HA 4GM2A 2UZFA 2QQ3A 2PBPA 4Z0MA 1UYVA 1XNVA 5INIA 4OMRA 4JFCA 4WCZA 1HNOA 5E0NX 3KQFA 4JCQA 1XNWA 2WTBA 5CTBA 4IZBA 3MT6A 3GF7A 3BPPA 4QFEA 2J5GA 1UIYA 4JYLA 2J5II 4ZDBA 3M6MA 4FN8A 3MOYA 3ZWAA 2EJ5A 3K8XA 2Q34A 2W3PA 3HRXA 3LAOA 3R6HA 1N6EA 3QK8A 3FF6A 2VSUF 2VSSF 3ST9A 4MXIA 4U18A 1YG6A 3MYBA 5CTCA 4FZWA 2F9YB 4EMMA 5C9GA 1N6FA 4ZDEA 4K2NA 3RRVA 3RSTA 3TLFA 4ZDCA 5KDRA 4LK5A 1ON3A 1X0UA 3Q0GA 2C8TA 4JYJA 3H02A 2Q2XA 4IZDA 3KTJA 5G1QA 3L3SA 3KTHA 5DL1A 3BEZA 4JWVA 3PEAA 4YLHA 3GKBA 1FC9A 4JCSA 3ZW9A
chains in the Genus database with same CATH superfamily
2FBMA 4RKUJ 1S9KE 3SLLA 4OG1A 1BCCG 3ZDMA 2ZXXA 3N4XA 3BPTA 2ZYDA 5MGBA 4B3JA 4G2RA 4H0LC 2M8RA 4LGDE 3L37A 3WG5A 1Z56A 2ZL2A 2E75B 2M3EA 4EMLA 2M5AA 3MZWB 5CCGA 3V2QA 1NU1G 1AV1A 2W6JH 4KPKA 2J5GD 1QL1A 3CWBG 3AE1C 1NWQA 1SQXJ 2PG8A 2WZ7A 1HNUA 4IOIH 1FC6A 4JYBA 1PFIA 4ELXA 1QEXA 1KILA 4FB8A 3BASA 1CZQA 5CCHD 3R9TA 3B5NB 2YXRB 1EF8A 2OTJP 3G9RA 2XDJA 2QE7H 1EZVD 2NRGA 1HBWA 2A45G 1ZRTE 3L75D 3OMEA 2IFMA 5EFWB 4L76A 3AEEC 5DZKA 1J1DC 3EQ2A 2YKOA 1YJ9P 3R4YA 2W27A 5CJ0A 1FZCA 5DU6A 4JCTA 1L2PA 2PP6A 3GLMA 1FU1A 1VDFA 1LTBC 1L0LE 3HTKA 1LTJC 3HINA 4BRYA 1NTZK 1BE3D 2D3TA 2IYPA 3N7NA 4ELSA 2RKLA 3H0QA 3A0BE 1UYSA 5G1SA 3PHLA 4PJ0H 2CBYA 2L5GB 5AVXB 5AVQB 5E0SA 3MD0A 3MP7B 3V2NA 1LTIC 4RYFH 5GTHH 3R0OA 4I2LC 2OYHA 1KN7A 3SSUA 5IKLB 3IAOA 5G1RA 3Q1MA 1YHQP 1S72P 1S2EA 1YG8A 1FAVA 4KNPA 4L6WA 3VP8A 2MKVA 3LKEA 3G6EP 1IFNA 2C9LY 1R5SA 1KB9H 1NTMD 3A7OA 4NPFX 2FW2A 2G8YA 4I7ZB 2WQYC 3O8ZA 3M06A 3H0UA 1KB9E 2XKMA 1SQVK 2E5YA 4EDFA 3CC7P 2QM7A 2Q35A 3II6A 5E0SH 4KD6A 3IN6A 2FYUG 3EFGA 2X24A 1Q2NA 2FYUK 3GHGC 2BCCD 4GIFA 2E75D 1DD3A 1RY3A 1T2KD 2ZL0A 1HWTC 1SQBG 3L70G 2L91A 4WZ8B 3E7KA 1Q81Q 1DCIA 2W6AA 1M1JA 3PGQA 1IO4A 2A7KA 1DD4A 2KSJA 1JMBA 3MUDA 1ZXGA 3DORA 3TDCA 2E42A 2CK3H 2O1JA 3U1AA 1HZDA 3Q7HA 5DKPA 3V4WA 4JSBA 4EI2A 2R3SA 5KKZB 3I56P 1FBMA 1HGVA 3V2PA 4DOJA 3H0SA 4BWNA 2P67A 4N78E 2QJPC 3OAKA 1EDIA 3JU1A 3V6IA 1RQUA 4PV1B 3U59A 3H1KJ 2H43A 2YMKA 4JCRA 3FXEA 3TV5A 1VQKP 1RF0A 2I8DA 2B87B 3OW2O 3ZWBA 5AW2B 1NZYA 5CBOA 4D6TJ 5KLVJ 4K3AA 4DT0A 4WY4D 3L75E 1PJHA 5K5GB 4H44D 3TT7A 3NJBA 2FFDC 1FC7A 3B5NA 1FJKA 3BCCE 5DJUB 4KHXA 1YITP 1PP9J 3KXDA 4U7JA 1SQPE 1ZN5A 1J7XA 1NU1D 1L0NK 4DI1A 3HUSA 1VQLP 4I7ZC 2AEFA 2K3RA 2QJYC 2W6BA 2DEOA 4H0LD 1L0LG 1JY2N 2R3CA 1JUNA 1M56D 1L0LJ 1KQSO 3H1HG 1EXJA 2FYZA 3L73J 1YQ3C 2QQ3A 1E79H 4WBAA 1VQ9P 1QL2A 1SQXD 1LTAC 2K9YA 3VYIA 1LWUC 5TISH 3CCRP 1PGOA 1NHLA 3CCQP 3L75G 4H13C 1HNOA 2BEQD 1S1CX 1WT6A 5CHXA 5CTBA 3KZIE 4IZBA 3ABVC 3GF7A 3BPPA 4EYYQ 2C0XA 1CI6A 1FZBA 5GTIE 2AXTH 2FFDA 4XA4A 1BGYD 1P84E 2QJPB 5APTA 2E5TA 2EJ5A 4YXWH 3KDPB 3HE4B 5APXA 2W3PA 1W5CE 3HRXA 3KPEA 5AVTB 3LAOA 1N73A 3QK8A 3BRVB 3CWBD 3FF6A 2O1KA 3EFFK 2N1TB 3MIWA 1N7SA 3H32B 3ST9A 2GM4A 1FOSF 2Q7CA 4EMMA 3CWBJ 2BEZF 1XTGB 3TDKA 2IYOA 2R5BA 3HD7D 1MFTA 3HD7B 1JNMA 3WUTA 2IBZD 1RHZB 4ZDCA 4GOFA 4XE5B 3GHGB 2YO3A 3HTKB 1JCDA 3F5HA 3RK3C 1FDIA 1L0ND 2WWWA 3PH0A 4XFJA 4JYJA 3D70A 3H6PA 5KAIE 5G1QA 2XU6A 3PLNA 1VQ7P 1T8ZA 3L72E 3MGNA 1USDA 1GL2A 4JCSA 4HB1A 3ZW9A 4IL6H 3SWYA 5KLVD 1NTKK 2Q5UA 1LJ2A 1N73C 4LC1A 1OWAA 3RK3E 1NU1J 3JCUE 3JSVC 3ZW8A 1SQVD 4NPDA 2POHA 1NKZB 3TGUJ 2W8ZA 2QVAA 2ZT9D 1JCCA 1VQ6P 4GHNA 5AVZB 4OGQC 1YJNP 4C7NB 2UWJE 4OH8B 3QXIA 5AW1B 3D6YA 3AE8C 3V2RA 2WPQA 3V5IA 2F6QA 1RJMA 2VSUC 2WSFJ 4UB8E 3E1IA 1IFIA 3AEGC 1S3JA 1K32A 2OQQA 3PTZA 3LW5J 3TRRA 1D7MA 1W2XA 3M0AA 3HE2A 1KILB 1XNYA 2H7HA 2A45H 2N1TD 2VSUE 5DZKH 4Y99C 1U7JA 3B8EB 3CCVP 4ZDFA 3G4SP 1JY3P 4TLFA 1DX7A 4U0HA 3SFDC 2N1TA 4OLQA 2A06G 1P84I 1BSHA 3L72G 1DH3A 2HYNA 2RMZA 4U3FG 2Q9IA 2P2UA 2Q1KA 3U9TB 5KLIB 2D2CD 2KP8A 3A5TA 2CPSA 2NPSD 1LP1B 3H1HD 3P2LA 1OMIA 4PD4E 1VQOP 3QH9A 1OVUA 4AUWA 3W67A 3Q2YA 5APQA 1EY3A 4EMPA 1SQVG 2HW5A 5B66E 3H1KD 2G3AA 4Y99B 3B4SA 4KWBA 1IJDB 2IEXA 4L73A 1DIPA 5AW5B 1K04A 1S5LH 4HC8A 2Z5HA 5B5EE 2AXCA 2Q3IA 1HF9A 4NPEA 1N7SC 1TG6A 3TK1A 4H44C 4ASWA 3G3ZA 3H0JA 4NNQA 3EWKA 3H1JG 1PZQA 3CMAP 5CCGD 5BVZA 1RE4A 1NTMK 3Q5PA 1UYTA 3QYRA 1YIJP 4L75A 1H0TB 2LKMA 1GMJA 1IC2A 5DUCA 2WMMA 2P7JA 1KB9I 3I47A 1JXZA 1RE4C 5C39A 3A2AA 1NTMG 3CX5I 1N7LA 2AEMA 1NAFA 1YJWP 3CXHD 1A02F 2JP3A 3KTKA 2FZSA 3IB9A 1NZYB 3VMYA 3IAVA 1SQBJ 4WY4A 2ZT9B 3JCUH 3L72D 2V7QH 1HVVA 1M1KQ 3T89A 4ZDDA 3RBXA 4AQRD 3CPWO 2KLUA 2CPBA 2OYIC 2Y9ZA 2QSIA 1OVRA 3G71P 3T8AA 4UB6H 3AE2C 2SPZA 4Q1IA 3IBBA 1FE6A 2O01J 2V7QJ 4RYFA 1MZ9A 2YJGA 1X22A 1PL5A 1EXIA 1LTTC 5APYA 2DUBA 5AW4B 2BZRA 1LT9A 1X0TA 2E76D 4C7RA 3D71A 2HPCA 3RL0C 2NZ2A 2JDIH 3VMXA 5CCHC 1SQBE 3AE9C 4JF7A 2KIKA 1KV4A 4I4ZA 5FUSA 1BGYE 1FC2C 1BSNA 3HRNA 4FNDA 2M5AB 3H1LD 4FN7A 1GTWA 1LWUB 3L36A 3VN0A 3E1RA 4W80A 3S1KA 2WSSH 4TT3H 5KJ7C 1ZMEC 2K9JB 2H89C 1T3UA 2XNDH 3KYQA 3FWLA 3VMZA 1IZNB 3N6RB 3U1CA 5AW3B 1SFCA 5BU5A 3VP9A 3AECC 3IFMA 2ZXEB 1P84D 3L71G 3CC4P 4QIJA 2VREA 1OFCX 5AVSB 5GTHE 1EZVI 1S9KD 2WTYA 3T97A 1SP4A 1W2BO 1AQ5A 1FJPA 2KUBA 3VOPA 3ITKA 1VQMP 3BRTB 1BGYJ 3JC22 2K37A 3HD7A 1NTKE 4ASVA 1Q82Q 5KJPA 2YIUC 2NP9A 1FOSE 2PGDA 1VQ8P 1JY2O 1SQQJ 2YXQB 2OYIB 1N86A 2FYUE 1VQNP 4ZKUA 1K9MQ 1UIIA 2F6IA 3OC7A 1QX8A 1YTZI 1U57A 4U3FE 4GM2A 1VQ4P 4JBZA 2PBPA 1GL2D 3H1LE 5APSA 1NU1E 2N9BA 1H88A 1HGZA 4OMRA 5CCGC 1QLED 1ZP0C 2FXMA 3KQFA 2FYUJ 4JCQA 1SFCC 2ZYGA 1JTHA 2GUSA 5AW7B 1KC8Q 3MT6A 2OYHB 2J5II 2M3BA 2OTLP 3M6MA 1IFPA 3HE4A 4FN8A 1PV3A 1WMKA 2IPPA 1BDCA 2QJKC 1BCCE 3USSA 4JYCA 3P32A 1KILC 2E74B 2LXCB 1SQVE 3R6HA 5CJ4A 1N6EA 2QRXA 3R2PA 1L0LD 2VSUF 2WPVB 3AE7C 4MXIA 4U18A 3Q5RA 3MYBA 5CTCA 3K5BA 3OJAB 1JMMA 3CCEP 4N3YB 2WPRA 4OGQD 1N6FA 5AW0B 3L74J 4K2NA 1KILE 3S9OA 4LK5A 5APUA 2HR3A 2ZFCA 2PRRA 4RESB 2IZ1A 1GW4A 4AYCA 4IZDA 3KTJA 4D6TD 2I1KA 4YXDC 3KTHA 2QIWA 4U0GH 3CI9A 1E5WA 1N7SD 1ZLLA 5KJ7D 1UYRA 3TVWA 5KLIC 3F89A 2HFED 3FWNA 1M1JC 2VSSA 1JY2P 3M0DA 1HH0A 3G64A 4WWIA 3RK3B 1HTLC 1ZW0A 4U19A 1NTME 1LT9B 2P10A 2WSEJ 3HE5A 5DUFA 3MTUE 2BCCJ 2OYOA 4H13B 3GW6A 3H1LG 3CC2P 2OYHC 4FJWD 1SQPJ 1L0LK 3V4QA 3CCSP 1GZLA 1KB9D 1GW3A 2VX2A 5JBWA 3H1HJ 1GL2C 3L71J 1KILD 5CCHA 1K39A 2K9JA 2O01H 3STAA 3CL3D 2WSEH 3CLQA 4I1LA 5DJTB 2J5SA 2KB7P 2FKWB 3SFEC 1KFMA 3H1IG 1WDKA 3RGUA 2A7SA 3L70D 2R5DA 4HKZH 2KSEA 2CE3A 1BE3G 2YKQA 3L70J 1O8UA 2QJYB 2FYUD 1VL2A 1EQ7A 3BF0A 4Z1MH 1N8RQ 4LLHA 1KQLA 2IZ0A 3TGUE 1DEEG 4GOEA 2O3JA 4C46A 5KAFE 4RCNA 2HPCB 3UIAA 3LIDA 2HODB 5E79H 3P8CD 4JPZB 1K73Q 2KNCB 2NPSC 2PPYA 3H81A 1J1DB 1G2CA 1G1JA 1Q86Q 1LTSC 4JOTA 1LWUA 2WITA 1FZGA 4GT1A 3L74D 4N78D 1EDJA 3QXZA 1LT9C 3KHUA 3ZWCA 5TISE 3W68A 4U1AA 4FNBA 1LTJB 1CI6B 2H8PD 4JJTA 4ZMDA 2QEXP 1OD4A 4Y28J 2JWDA 4WB4A 2ZJSE 5GTIH 1JOCA 5AVVB 1Y7OA 3D6ZA 4B86A 2YNYA 2H88C 3RL0g 1JEKA 2X58A 1L0NE 2NPSB 3QWDA 1SQXE 1YBKA 1J2JB 1Q51A 5H2FH 2R44A 4UB8H 4O9BA 2VSSE 1SQPG 4ZU2A 4M3LA 4ZNCA 4KT0J 1L4AB 2OTKE 1N2DC 3QMJA 2XNXA 4DZOA 1ZR4A 2WSCJ 3C1LA 1KTMA 5APVA 3R9SA 3NJDA 3FGAD 2Q6QA 2XV5A 3AE5C 4IFDK 1OW8A 1PPJG 1LGHB 1OZHA 1NTZD 1KYOH 1PP9G 3C9IA 2ITAA 1EF9A 2Y9YA 5DU4A 1NO4A 3FXDA 3T8BA 3P5MA 2ZVNB 3DJAA 1TU3F 1NKNA 1Q90D 3L72J 3T88A 3CD6P 5AVYB 3I55P 1G1IA 1AVYA 4MN4C 1OIPA 2IBZG 3NFQA 1PPJE 1MKMA 2F9YA 1SFCB 2B89A 1RJNA 1DEBA 5INGA 2K1AA 2JJLA 4BXLA 3CXHI 1SZOA 4F47A 2RN0A 3B5ND 3TNUA 4L74A 2J5UA 2WSFH 5FIFA 3TGUD 2IBZE 1MV8A 2GA1A 1PGJA 4MI2A 1KYOI 1SQVJ 3NXSA 1PP9D 3CCUP 1AVOA 1T2KC 2ZAEB 1GU5A 1Q52A 1YQ4C 1X9VA 4PD4H 4OWFA 4K35A 4Q0GA 2J58A 1BCCJ 4IFMA 4W7ZA 2C9NY 1RF0C 3GMAA 2W83C 3L71E 3H1HE 4EOTA 3QKAA 1K05A 1X8YA 4FZWC 1L0NG 4L8KA 4U3FJ 3P85A 3Q1TA 1VRGA 3U9SB 1AA0A 1SQXK 1PGPA 3MHVA 3M0DC 1U7MA 4H44B 2DW3A 2GUVA 3GF3A 1IFMA 4R4LA 2QG4A 3RK2B 3CCLP 2AXTE 3H1IJ 2RH0A 3CX5E 4Z0MA 1KYOE 1NTKD 1ZOYC 1CSBA 4EIJA 1XNVA 1NOHA 1K8AQ 5INIA 1IK9A 2KS1B 1CW5A 4JFCA 4GODA 4WCZA 2KNCA 2KI7B 1XNWA 3WU2H 3CCJP 1KORA 2J5GA 1AJYA 1UIYA 4ZDBA 3RL0B 4C7NA 3ZWAA 3K8XA 2Z5IA 2Q34A 4OVNF 3L73G 2ZT9C 1JY3O 1LTJA 1VF5D 1SLQA 5BU8B 2WVRA 3H1JD 2IFNA 5AW9B 3H32A 3LW5H 3HD7C 2VRSA 3WUUA 1N73B 1NTZJ 2VSSF 1IFJA 3CX5D 1FDMA 5AVRB 4FZWA 2F9YB 3BCCD 3TGUG 1RE3A 3RBZA 5C9GA 1PP9E 1M57D 4ZDEA 3A0HH 3RRVA 3HUSB 3BCCJ 1X0UA 5AVWB 3AEFC 2QJKB 1HUCA 3VMAA 2C8TA 1SQPD 3CXHH 2HG5D 3H02A 5KLVE 1ZR2A 1SQBD 1YTZT 2E75C 3AEBC 1OW6A 4WY4C 1Y9BA 3AE6C 3HUSC 4QMAA 2JWAA 3PEAA 3FX0A 1GU4A 3WU2E 3GKBA 2PAJA 1GDTA 1LTGC 2P1JA 3B71A 2YIUB 5CBNA 3M91A 3OT6A 2AEJA 5AW6B 3M9HA 4IL6E 1HJBA 1AFOA 3Q5SA 4K29A 1M7LA 1LP1A 1PPJD 2E76C 1VPCA 5KAIH 3RK3D 1OXZA 4PJ0E 2Q3EA 1HJ0A 2ZQRA 4B3IA 1FZAA 5KKZC 2KOGA 3T3WA 5AW8B 1SVFA 2BASA 3V5EA 5DU8A 1SQQK 1PIXA 3P8CE 1VQ5P 1RF1A 1ZRTD 3BVHA 1FZCC 1URQA 2R32A 4PV1C 2IBZI 3V5BA 2I1JA 5KJ7A 5DTWA 4MOUA 4U3FD 1L4AC 1URQD 2FY8A 4HH2A 1FZEA 1MJ3A 3NMDA 2WT7B 2JKVA 3U9RB 2FYNB 3I5CA 4IFFA 1XX4A 3C8VA 3CWBE 3R9QA 4HDTA 2O01N 1KYOD 4ASIA 1OW7A 1FCFA 3RL0D 1WDMA 2F9IA 3AEAC 4I6MC 3OA7A 4YTPC 1NVOA 5CMZA 1WZ8A 4IZCA 3CCMP 2NPSA 2K88A 1JB0J 2J5IB 1FDOA 5KLVG 2LXBA 3O6QB 4I42A 1WDLA 1FZCB 3KTIA 3SWXA 3AE4C 1R5LA 3K50A 2FXOA 5JBXA 3AE3C 2HODA 2OYIA 5B5EH 4GKGA 1EDLA 1S5LE 3BATA 1NTKJ 1L4AA 2KYVA 2YKPA 1GK4A 3A0HE 3NTNA 3KZIH 2Y0EA 5KLVK 2KZIA 1T3JA 5B66H 2E76B 1XTCC 2BCCG 1GK6A 2ZL3A 1QVFO 1NJIQ 2GTRA 1Y8AA 3L73E 1RF1C 3QREA 1ON9A 1P84H 2LR2A 3L74E 1JTHB 4U0GA 3H1KG 2ZYAA 3B5NC 4KJMA 1FS0E 1L0NJ 1QVGO 3Q0JA 4NEKA 2YMYA 3MUDC 3TNUB 1XO6A 1N6DA 1KQGB 4WYOB 2B9BA 1KFNA 3TZ3A 1J1EC 2ZVOB 4H0LB 1IFDA 3P7KA 2HLOA 1DUBA 3CMEP 1JO5A 3A3YB 1GD2E 4J2UA 3KQGA 5KDRB 3PRJA 3CX5H 3PZKA 3GHGA 1VF5B 1RH5B 3L75J 3CXHE 1J1EB 3RK2C 1NTKG 5AVUB 2KK7A 2WT7A 3M6NA 2A45I 3L35A 4JVTA 4WY4B 4A7PA 5KTBA 4BRYB 3KTGA 4ZKPA 2ZQQA 4UB6E 3T97B 1GL2B 1T6AA 1EZVE 1S5LX 4K3WA 1A02J 2B88A 2JO1A 1NYHA 3PP5A 4DCKA 4GDOA 2P58A 2KS1A 2Z4EA 3TVUA 3O6QA 3PE8A 4ELWA 3L73D 2JR8A 3ISAA 3SWFA 1USEA 2J59M 3RK2D 1OD2A 3TYYA 1TYFA 4QIIA 1KD1Q 5APWA 2ZL4A 4IL6X 1R8EA 4HNKA 2C0WA 2FBWC 3MFMA 3L70E 2JEEA 1SQQE 3VIVA 2WPSA 3TT6A 5INFA 1NTZG 3P8MC 2WSCH 1NTZE 4PD4D 1SQQG 2W90A 2N1TC 1KZUB 2PFXA 1SFCD 1FZFA 3IF4A 2V4HA 4HYTB 5DTPA 1OX3A 3TF5A 3H1KE 1JM0A 1L4AD 1URQC 3IR9A 3S4RA 3L74G 2Y0DA 1NH4A 2FYNC 3SWKA 4JQ0D 1NU1K 1OVVA 1H8AA 1EDKA 4DJGA 1RQVA 2N9YB 1IK7A 3PJSK 1X79B 1EZVG 3H1JJ 4HJGH 5H2FE 2OARA 1Y47A 4WVZA 4I52A 1S4XA 3FDUA 2Y0CA 1RE3C 1BGYG 2A81A 1VF5C 3BCCG 1M90Q 5C90A 1M8OB 1SQBK 3H1IE 2VSUA 1SQQD 3TSIA 4D6TE 3HLN1 2KLVA 1NGMB 3LIEA 3AEDC 2F9IB 2OGUA 3A0BH 1SG4A 3L71D 4RO0A 2M0BA 3RSIA 5KAFH 2J5IA 3HP0A 5M1BA 3WUVA 1ZV8A 4D6TG 1BDDA 2E43A 1SQXG 1WRGA 2IX7C 1LNQA 4B3HA 4OGQB 2UZFA 2A06E 1QGKB 3M9QA 2KZJA 1UYVA 4W7YA 1RF1B 5HUQA 1PGQA 5E0NX 2QM8A 2WTBA 1G2CB 1LT1A 1VQPP 1SS1A 4YPCA 3M9BA 4QFEA 3Q3DA 3GG2A 1SQPK 4JYLA 2B87A 2XZRA 2E74C 1H0TA 3MOYA 2FXPA 3VTPC 4PV1D 2FFDB 3HE5B 1JY3N 1BE3E 3WMM0 1UIXA 1MFZA 4R4MA 2D2CB 2QA4P 2A06D 1YI2P 1KMIZ 1BE3J 2KXPB 1BCCD 1URQB 1Q7YQ 5TJHA 4PD4I 1YG6A 4N6JA 1N7SB 1NAYA 2YO2A 5L8RJ 5E79E 3RSTA 4RJTA 1MUUA 3TLFA 5KDRA 2D2CC 3H1JE 1ON3A 4H13D 2IDBA 3QWOC 3Q0GA 3H1ID 1W2EA 1KQFB 3L4FA 2Q2XA 4CPGA 1AQTA 2E74D 2BCCE 3L3SA 3H25A 5DL1A 1EC5A 3BEZA 4JWVA 1YYCA 4YLHA 2MJZA 1FC9A 4NARA 3H1LJ 1H89A 1NTMJ 1M1JB
chains in the Genus database with same CATH topology
4U0GH 2FBMA 4RKUJ 3OT6A 3SLLA 3RK3E 4OG1A 3ZW8A 3Q5SA 1UYRA 3TVWA 5KLIC 4K29A 2VSSA 2E76C 3BPTA 2ZT9D 3G64A 5MGBA 4GHNA 4B3JA 4G2RA 4OGQC 4H0LC 3WG5A 1HJ0A 2ZL2A 3QXIA 2ZQRA 4U19A 4B3IA 2E75B 3AE8C 3D6YA 5KKZC 2P10A 2WSEJ 5DUFA 4EMLA 3T3WA 3V5IA 2F6QA 1RJMA 2VSUC 3V5EA 2WSFJ 5DU8A 4H13B 1PIXA 4KPKA 4FJWD 2J5GD 3AEGC 3AE1C 1K32A 4PV1C 2OQQA 2PG8A 2VX2A 3LW5J 5JBWA 3TRRA 1HNUA 1W2XA 3HE2A 1FC6A 1K39A 5DTWA 3STAA 4MOUA 1XNYA 4ELXA 2VSUE 5DZKH 4FB8A 3R9TA 1MJ3A 2J5SA 1EF8A 3SFEC 3G9RA 4ZDFA 3U9RB 1XX4A 3C8VA 3R9QA 4HDTA 4U0HA 1WDKA 3SFDC 4ASIA 1ZRTE 2A7SA 1OW7A 4OLQA 1FCFA 3OMEA 2CE3A 3AEEC 5DZKA 1WDMA 2F9IA 3AEAC 4YTPC 3R4YA 1WZ8A 4IZCA 1O8UA 2J5IB 1JB0J 1VL2A 5DU6A 4JCTA 1FDOA 3U9TB 2D2CD 3GLMA 4I42A 1WDLA 3BF0A 4Z1MH 3KTIA 3SWXA 3AE4C 3HINA 3K50A 3P2LA 5JBXA 1OMIA 3AE3C 4RCNA 2D3TA 3Q2YA 1EY3A 4EMPA 2HW5A 2G3AA 4ELSA 3H0QA 4KWBA 1UYSA 5G1SA 2IEXA 2CBYA 2PPYA 3H81A 2E76B 5E0SA 1DIPA 1K04A 4JOTA 4HC8A 4RYFH 2ZL3A 3R0OA 2GTRA 5IKLB 3QREA 1HF9A 1ON9A 3QXZA 3IAOA 1TG6A 5G1RA 3Q1MA 4U0GA 4H44C 1YG8A 3H0JA 3ZWCA 4NNQA 3EWKA 4KNPA 4U1AA 4FNBA 4L6WA 4JJTA 3Q5PA 3Q0JA 4NEKA 2MKVA 1UYTA 3LKEA 3QYRA 1XO6A 1OD4A 1N6DA 4Y28J 1KQGB 1GMJA 4WYOB 2FW2A 2G8YA 4I7ZB 2WQYC 5DUCA 3TZ3A 3I47A 1Y7OA 4H0LB 1JXZA 3D6ZA 3H0UA 1DUBA 2H88C 3RL0g 2X58A 4J2UA 2Q35A 5KDRB 2JP3A 3KTKA 2FZSA 5E0SH 3IB9A 4KD6A 3QWDA 3PZKA 1NZYB 1VF5B 3IN6A 3IAVA 1Q51A 2X24A 2ZT9B 3M6NA 4JVTA 2VSSE 4ZU2A 3T89A 4ZDDA 2E75D 3KTGA 2ZQQA 3T97B 1DD3A 4KT0J 3QMJA 2QSIA 2ZL0A 1S5LX 4K3WA 2JO1A 1NYHA 3T8AA 2WSCJ 4GDOA 3AE2C 1KTMA 4WZ8B 1DCIA 4Q1IA 3IBBA 3TVUA 3O6QA 3R9SA 3NJDA 3PE8A 4ELWA 3PGQA 2O01J 3FGAD 3ISAA 2A7KA 1DD4A 1OD2A 3AE5C 2V7QJ 4RYFA 2YJGA 1OW8A 3DORA 1PL5A 3TDCA 1EXIA 2DUBA 1HZDA 1TYFA 4QIIA 3Q7HA 2ZL4A 2BZRA 4IL6X 1R8EA 4HNKA 5DKPA 2E76D 3D71A 4JSBA 1EF9A 5DU4A 2FBWC 3MFMA 2NZ2A 3T8BA 3AE9C 3P5MA 3VIVA 3TT6A 5INFA 3DJAA 3H0SA 1TU3F 1Q90D 4I4ZA 3T88A 5FUSA 2QJPC 4FNDA 3JU1A 4FN7A 1RQUA 4PV1B 2YMKA 4TT3H 1ZMEC 4JCRA 2H89C 3TV5A 1MKMA 2F9YA 5DTPA 1RJNA 5INGA 3ZWBA 3N6RB 1SZOA 1NZYA 4F47A 3AECC 2FYNC 2J5UA 1PJHA 5FIFA 4H44D 1RQVA 4QIJA 1IK7A 2VREA 3NJBA 3TT7A 1FC7A 4MI2A 1Q52A 1YQ4C 4I52A 3FDUA 4Q0GA 2A81A 1VF5C 5C90A 4U7JA 3GMAA 1J7XA 2VSUA 4DI1A 3HLN1 5KJPA 1NGMB 2F9IB 3AEDC 2YIUC 2NP9A 3QKAA 1SG4A 1K05A 4I7ZC 2DEOA 2QJYC 4H0LD 3RSIA 4FZWC 4L8KA 2J5IA 3HP0A 5M1BA 3P85A 3Q1TA 1VRGA 3U9SB 1EXJA 2F6IA 4H44B 3OC7A 3GF3A 4B3HA 1U57A 4OGQB 4R4LA 1YQ3C 4GM2A 2UZFA 2QQ3A 2PBPA 4Z0MA 1UYVA 1ZOYC 2K9YA 1XNVA 5INIA 4OMRA 4JFCA 5HUQA 4H13C 1HNOA 4WCZA 2BEQD 1ZP0C 5E0NX 1S1CX 3KQFA 4JCQA 1XNWA 2WTBA 5CTBA 4IZBA 3MT6A 3ABVC 3GF7A 3Q3DA 1KORA 3BPPA 4QFEA 2J5GA 1AJYA 1UIYA 4JYLA 2J5II 4ZDBA 3M6MA 2E74C 4FN8A 1PV3A 1WMKA 3MOYA 2FXPA 4PV1D 2QJKC 2EJ5A 3ZWAA 3K8XA 2Q34A 2ZT9C 2W3PA 3HRXA 1UIXA 1VF5D 2E74B 4R4MA 2D2CB 3LAOA 3R6HA 1N6EA 3QK8A 1KMIZ 2VSUF 3FF6A 2WPVB 2VSSF 3ST9A 3AE7C 4MXIA 4U18A 3Q5RA 1YG6A 3MYBA 5CTCA 4FZWA 2F9YB 4EMMA 5C9GA 2BEZF 4OGQD 1N6FA 5L8RJ 4ZDEA 4K2NA 3RRVA 3RSTA 3TLFA 4ZDCA 1KILE 2D2CC 3S9OA 5KDRA 4LK5A 1ON3A 4H13D 1X0UA 2IDBA 3AEFC 3Q0GA 1FDIA 2C8TA 4XFJA 1KQFB 4JYJA 3D70A 3H02A 2Q2XA 2E75C 3KTJA 4IZDA 3AEBC 2E74D 5G1QA 1OW6A 3L3SA 4YXDC 1Y9BA 3KTHA 3H25A 5DL1A 3AE6C 3BEZA 4JWVA 3PEAA 4YLHA 3GKBA 1FC9A 3B71A 4JCSA 3ZW9A 4NARA 2QIWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U0G H;  2FBM A;  3OT6 A;  3SLL A;  4OG1 A;  3ZW8 A;  1UYR A;  3TVW A;  4K29 A;  2VSS A;  3G64 A;  5MGB A;  4GHN A;  4B3J A;  4G2R A;  3WG5 A;  2ZL2 A;  3QXI A;  2ZQR A;  4U19 A;  4B3I A;  5DUF A;  4EML A;  3T3W A;  3V5I A;  2F6Q A;  1RJM A;  2VSU C;  3V5E A;  5DU8 A;  1PIX A;  4KPK A;  4FJW D;  2J5G D;  1K32 A;  2PG8 A;  2VX2 A;  5JBW A;  3TRR A;  1HNU A;  1W2X A;  3HE2 A;  1FC6 A;  1K39 A;  5DTW A;  3STA A;  4MOU A;  1XNY A;  4ELX A;  2VSU E;  5DZK H;  4FB8 A;  3R9T A;  1MJ3 A;  2J5S A;  1EF8 A;  4ZDF A;  3U9R B;  1XX4 A;  3R9Q A;  4U0H A;  1WDK A;  4ASI A;  2A7S A;  4OLQ A;  1FCF A;  3OME A;  2CE3 A;  5DZK A;  1WDM A;  2F9I A;  1WZ8 A;  4IZC A;  1O8U A;  2J5I B;  5DU6 A;  3U9T B;  4JCT A;  3GLM A;  4I42 A;  1WDL A;  3BF0 A;  3KTI A;  3SWX A;  3HIN A;  3K50 A;  3P2L A;  5JBX A;  4RCN A;  2D3T A;  1EY3 A;  4EMP A;  2HW5 A;  4ELS A;  3H0Q A;  4KWB A;  1UYS A;  5G1S A;  2IEX A;  2CBY A;  2PPY A;  3H81 A;  5E0S A;  4JOT A;  4HC8 A;  4RYF H;  2ZL3 A;  3R0O A;  2GTR A;  5IKL B;  3QRE A;  1ON9 A;  3QXZ A;  1TG6 A;  5G1R A;  4U0G A;  1YG8 A;  3H0J A;  3ZWC A;  4NNQ A;  4KNP A;  4U1A A;  4FNB A;  4L6W A;  4JJT A;  3Q0J A;  4NEK A;  1UYT A;  3LKE A;  3QYR A;  1XO6 A;  1OD4 A;  1N6D A;  4WYO B;  2FW2 A;  5DUC A;  3TZ3 A;  3I47 A;  1Y7O A;  1JXZ A;  3H0U A;  1DUB A;  2X58 A;  2Q35 A;  5KDR B;  3KTK A;  2FZS A;  5E0S H;  3IB9 A;  4KD6 A;  3QWD A;  3PZK A;  1NZY B;  3IAV A;  1Q51 A;  2X24 A;  3M6N A;  4JVT A;  2VSS E;  4ZU2 A;  3T89 A;  4ZDD A;  3KTG A;  2ZQQ A;  3QMJ A;  2ZL0 A;  4K3W A;  3T8A A;  4WZ8 B;  1DCI A;  4Q1I A;  3IBB A;  3TVU A;  3R9S A;  3NJD A;  3PE8 A;  4ELW A;  3PGQ A;  3ISA A;  2A7K A;  1OD2 A;  4RYF A;  3DOR A;  3TDC A;  2DUB A;  1HZD A;  1TYF A;  4QII A;  3Q7H A;  2ZL4 A;  2BZR A;  4HNK A;  5DKP A;  4JSB A;  1EF9 A;  5DU4 A;  3MFM A;  3T8B A;  3P5M A;  3VIV A;  3TT6 A;  5INF A;  3DJA A;  3H0S A;  4I4Z A;  3T88 A;  5FUS A;  4FND A;  3JU1 A;  4FN7 A;  4JCR A;  3TV5 A;  2F9Y A;  5DTP A;  1RJN A;  5ING A;  3ZWB A;  3N6R B;  1SZO A;  1NZY A;  4F47 A;  1PJH A;  5FIF A;  4QIJ A;  2VRE A;  3NJB A;  3TT7 A;  1FC7 A;  4MI2 A;  1Q52 A;  4I52 A;  3FDU A;  4Q0G A;  2A81 A;  5C90 A;  3GMA A;  1J7X A;  2VSU A;  4DI1 A;  3HLN 1;  5KJP A;  2F9I B;  3QKA A;  2NP9 A;  1SG4 A;  2DEO A;  3RSI A;  4FZW C;  4L8K A;  2J5I A;  3HP0 A;  3P85 A;  3Q1T A;  1VRG A;  3U9S B;  2F6I A;  3OC7 A;  3GF3 A;  4B3H A;  4GM2 A;  2UZF A;  2QQ3 A;  2PBP A;  4Z0M A;  1UYV A;  1XNV A;  5INI A;  4OMR A;  4JFC A;  4WCZ A;  1HNO A;  5E0N X;  3KQF A;  4JCQ A;  1XNW A;  2WTB A;  5CTB A;  4IZB A;  3MT6 A;  3GF7 A;  3BPP A;  4QFE A;  2J5G A;  1UIY A;  4JYL A;  2J5I I;  4ZDB A;  3M6M A;  4FN8 A;  3MOY A;  3ZWA A;  2EJ5 A;  3K8X A;  2Q34 A;  2W3P A;  3HRX A;  3LAO A;  3R6H A;  1N6E A;  3QK8 A;  3FF6 A;  2VSU F;  2VSS F;  3ST9 A;  4MXI A;  4U18 A;  1YG6 A;  3MYB A;  5CTC A;  4FZW A;  2F9Y B;  4EMM A;  5C9G A;  1N6F A;  4ZDE A;  4K2N A;  3RRV A;  3RST A;  3TLF A;  4ZDC A;  5KDR A;  4LK5 A;  1ON3 A;  1X0U A;  3Q0G A;  2C8T A;  4JYJ A;  3H02 A;  2Q2X A;  4IZD A;  3KTJ A;  5G1Q A;  3L3S A;  3KTH A;  5DL1 A;  3BEZ A;  4JWV A;  3PEA A;  4YLH A;  3GKB A;  1FC9 A;  4JCS A;  3ZW9 A; 
#chains in the Genus database with same CATH topology
 2FBM A;  4RKU J;  1S9K E;  3SLL A;  4OG1 A;  1BCC G;  3ZDM A;  2ZXX A;  3N4X A;  3BPT A;  2ZYD A;  5MGB A;  4B3J A;  4G2R A;  4H0L C;  2M8R A;  4LGD E;  3L37 A;  3WG5 A;  1Z56 A;  2ZL2 A;  2E75 B;  2M3E A;  4EML A;  2M5A A;  3MZW B;  5CCG A;  3V2Q A;  1NU1 G;  1AV1 A;  2W6J H;  4KPK A;  2J5G D;  1QL1 A;  3CWB G;  3AE1 C;  1NWQ A;  1SQX J;  2PG8 A;  2WZ7 A;  1HNU A;  4IOI H;  1FC6 A;  4JYB A;  1PFI A;  4ELX A;  1QEX A;  1KIL A;  4FB8 A;  3BAS A;  1CZQ A;  5CCH D;  3R9T A;  3B5N B;  2YXR B;  1EF8 A;  2OTJ P;  3G9R A;  2XDJ A;  2QE7 H;  1EZV D;  2NRG A;  1HBW A;  2A45 G;  1ZRT E;  3L75 D;  3OME A;  2IFM A;  5EFW B;  4L76 A;  3AEE C;  5DZK A;  1J1D C;  3EQ2 A;  2YKO A;  1YJ9 P;  3R4Y A;  2W27 A;  5CJ0 A;  1FZC A;  5DU6 A;  4JCT A;  1L2P A;  2PP6 A;  3GLM A;  1FU1 A;  1VDF A;  1LTB C;  1L0L E;  3HTK A;  1LTJ C;  3HIN A;  4BRY A;  1NTZ K;  1BE3 D;  2D3T A;  2IYP A;  3N7N A;  4ELS A;  2RKL A;  3H0Q A;  3A0B E;  1UYS A;  5G1S A;  3PHL A;  4PJ0 H;  2CBY A;  2L5G B;  5AVX B;  5AVQ B;  5E0S A;  3MD0 A;  3MP7 B;  3V2N A;  1LTI C;  4RYF H;  5GTH H;  3R0O A;  4I2L C;  2OYH A;  1KN7 A;  3SSU A;  5IKL B;  3IAO A;  5G1R A;  3Q1M A;  1YHQ P;  1S72 P;  1S2E A;  1YG8 A;  1FAV A;  4KNP A;  4L6W A;  3VP8 A;  2MKV A;  3LKE A;  3G6E P;  1IFN A;  2C9L Y;  1R5S A;  1KB9 H;  1NTM D;  3A7O A;  4NPF X;  2FW2 A;  2G8Y A;  4I7Z B;  2WQY C;  3O8Z A;  3M06 A;  3H0U A;  1KB9 E;  2XKM A;  1SQV K;  2E5Y A;  4EDF A;  3CC7 P;  2QM7 A;  2Q35 A;  3II6 A;  5E0S H;  4KD6 A;  3IN6 A;  2FYU G;  3EFG A;  2X24 A;  1Q2N A;  2FYU K;  3GHG C;  2BCC D;  4GIF A;  2E75 D;  1DD3 A;  1RY3 A;  1T2K D;  2ZL0 A;  1HWT C;  1SQB G;  3L70 G;  2L91 A;  4WZ8 B;  3E7K A;  1Q81 Q;  1DCI A;  2W6A A;  1M1J A;  3PGQ A;  1IO4 A;  2A7K A;  1DD4 A;  2KSJ A;  1JMB A;  3MUD A;  1ZXG A;  3DOR A;  3TDC A;  2E42 A;  2CK3 H;  2O1J A;  3U1A A;  1HZD A;  3Q7H A;  5DKP A;  3V4W A;  4JSB A;  4EI2 A;  2R3S A;  5KKZ B;  3I56 P;  1FBM A;  1HGV A;  3V2P A;  4DOJ A;  3H0S A;  4BWN A;  2P67 A;  4N78 E;  2QJP C;  3OAK A;  1EDI A;  3JU1 A;  3V6I A;  1RQU A;  4PV1 B;  3U59 A;  3H1K J;  2H43 A;  2YMK A;  4JCR A;  3FXE A;  3TV5 A;  1VQK P;  1RF0 A;  2I8D A;  2B87 B;  3OW2 O;  3ZWB A;  5AW2 B;  1NZY A;  5CBO A;  4D6T J;  5KLV J;  4K3A A;  4DT0 A;  4WY4 D;  3L75 E;  1PJH A;  5K5G B;  4H44 D;  3TT7 A;  3NJB A;  2FFD C;  1FC7 A;  3B5N A;  1FJK A;  3BCC E;  5DJU B;  4KHX A;  1YIT P;  1PP9 J;  3KXD A;  4U7J A;  1SQP E;  1ZN5 A;  1J7X A;  1NU1 D;  1L0N K;  4DI1 A;  3HUS A;  1VQL P;  4I7Z C;  2AEF A;  2K3R A;  2QJY C;  2W6B A;  2DEO A;  4H0L D;  1L0L G;  1JY2 N;  2R3C A;  1JUN A;  1M56 D;  1L0L J;  1KQS O;  3H1H G;  1EXJ A;  2FYZ A;  3L73 J;  1YQ3 C;  2QQ3 A;  1E79 H;  4WBA A;  1VQ9 P;  1QL2 A;  1SQX D;  1LTA C;  2K9Y A;  3VYI A;  1LWU C;  5TIS H;  3CCR P;  1PGO A;  1NHL A;  3CCQ P;  3L75 G;  4H13 C;  1HNO A;  2BEQ D;  1S1C X;  1WT6 A;  5CHX A;  5CTB A;  3KZI E;  4IZB A;  3ABV C;  3GF7 A;  3BPP A;  4EYY Q;  2C0X A;  1CI6 A;  1FZB A;  5GTI E;  2AXT H;  2FFD A;  4XA4 A;  1BGY D;  1P84 E;  2QJP B;  5APT A;  2E5T A;  2EJ5 A;  4YXW H;  3KDP B;  3HE4 B;  5APX A;  2W3P A;  1W5C E;  3HRX A;  3KPE A;  5AVT B;  3LAO A;  1N73 A;  3QK8 A;  3BRV B;  3CWB D;  3FF6 A;  2O1K A;  3EFF K;  2N1T B;  3MIW A;  1N7S A;  3H32 B;  3ST9 A;  2GM4 A;  1FOS F;  2Q7C A;  4EMM A;  3CWB J;  2BEZ F;  1XTG B;  3TDK A;  2IYO A;  2R5B A;  3HD7 D;  1MFT A;  3HD7 B;  1JNM A;  3WUT A;  2IBZ D;  1RHZ B;  4ZDC A;  4GOF A;  4XE5 B;  3GHG B;  2YO3 A;  3HTK B;  1JCD A;  3F5H A;  3RK3 C;  1FDI A;  1L0N D;  2WWW A;  3PH0 A;  4XFJ A;  4JYJ A;  3D70 A;  3H6P A;  5KAI E;  5G1Q A;  2XU6 A;  3PLN A;  1VQ7 P;  1T8Z A;  3L72 E;  3MGN A;  1USD A;  1GL2 A;  4JCS A;  4HB1 A;  3ZW9 A;  4IL6 H;  3SWY A;  5KLV D;  1NTK K;  2Q5U A;  1LJ2 A;  1N73 C;  4LC1 A;  1OWA A;  3RK3 E;  1NU1 J;  3JCU E;  3JSV C;  3ZW8 A;  1SQV D;  4NPD A;  2POH A;  1NKZ B;  3TGU J;  2W8Z A;  2QVA A;  2ZT9 D;  1JCC A;  1VQ6 P;  4GHN A;  5AVZ B;  4OGQ C;  1YJN P;  4C7N B;  2UWJ E;  4OH8 B;  3QXI A;  5AW1 B;  3D6Y A;  3AE8 C;  3V2R A;  2WPQ A;  3V5I A;  2F6Q A;  1RJM A;  2VSU C;  2WSF J;  4UB8 E;  3E1I A;  1IFI A;  3AEG C;  1S3J A;  1K32 A;  2OQQ A;  3PTZ A;  3LW5 J;  3TRR A;  1D7M A;  1W2X A;  3M0A A;  3HE2 A;  1KIL B;  1XNY A;  2H7H A;  2A45 H;  2N1T D;  2VSU E;  5DZK H;  4Y99 C;  1U7J A;  3B8E B;  3CCV P;  4ZDF A;  3G4S P;  1JY3 P;  4TLF A;  1DX7 A;  4U0H A;  3SFD C;  2N1T A;  4OLQ A;  2A06 G;  1P84 I;  1BSH A;  3L72 G;  1DH3 A;  2HYN A;  2RMZ A;  4U3F G;  2Q9I A;  2P2U A;  2Q1K A;  3U9T B;  5KLI B;  2D2C D;  2KP8 A;  3A5T A;  2CPS A;  2NPS D;  1LP1 B;  3H1H D;  3P2L A;  1OMI A;  4PD4 E;  1VQO P;  3QH9 A;  1OVU A;  4AUW A;  3W67 A;  3Q2Y A;  5APQ A;  1EY3 A;  4EMP A;  1SQV G;  2HW5 A;  5B66 E;  3H1K D;  2G3A A;  4Y99 B;  3B4S A;  4KWB A;  1IJD B;  2IEX A;  4L73 A;  1DIP A;  5AW5 B;  1K04 A;  1S5L H;  4HC8 A;  2Z5H A;  5B5E E;  2AXC A;  2Q3I A;  1HF9 A;  4NPE A;  1N7S C;  1TG6 A;  3TK1 A;  4H44 C;  4ASW A;  3G3Z A;  3H0J A;  4NNQ A;  3EWK A;  3H1J G;  1PZQ A;  3CMA P;  5CCG D;  5BVZ A;  1RE4 A;  1NTM K;  3Q5P A;  1UYT A;  3QYR A;  1YIJ P;  4L75 A;  1H0T B;  2LKM A;  1GMJ A;  1IC2 A;  5DUC A;  2WMM A;  2P7J A;  1KB9 I;  3I47 A;  1JXZ A;  1RE4 C;  5C39 A;  3A2A A;  1NTM G;  3CX5 I;  1N7L A;  2AEM A;  1NAF A;  1YJW P;  3CXH D;  1A02 F;  2JP3 A;  3KTK A;  2FZS A;  3IB9 A;  1NZY B;  3VMY A;  3IAV A;  1SQB J;  4WY4 A;  2ZT9 B;  3JCU H;  3L72 D;  2V7Q H;  1HVV A;  1M1K Q;  3T89 A;  4ZDD A;  3RBX A;  4AQR D;  3CPW O;  2KLU A;  2CPB A;  2OYI C;  2Y9Z A;  2QSI A;  1OVR A;  3G71 P;  3T8A A;  4UB6 H;  3AE2 C;  2SPZ A;  4Q1I A;  3IBB A;  1FE6 A;  2O01 J;  2V7Q J;  4RYF A;  1MZ9 A;  2YJG A;  1X22 A;  1PL5 A;  1EXI A;  1LTT C;  5APY A;  2DUB A;  5AW4 B;  2BZR A;  1LT9 A;  1X0T A;  2E76 D;  4C7R A;  3D71 A;  2HPC A;  3RL0 C;  2NZ2 A;  2JDI H;  3VMX A;  5CCH C;  1SQB E;  3AE9 C;  4JF7 A;  2KIK A;  1KV4 A;  4I4Z A;  5FUS A;  1BGY E;  1FC2 C;  1BSN A;  3HRN A;  4FND A;  2M5A B;  3H1L D;  4FN7 A;  1GTW A;  1LWU B;  3L36 A;  3VN0 A;  3E1R A;  4W80 A;  3S1K A;  2WSS H;  4TT3 H;  5KJ7 C;  1ZME C;  2K9J B;  2H89 C;  1T3U A;  2XND H;  3KYQ A;  3FWL A;  3VMZ A;  1IZN B;  3N6R B;  3U1C A;  5AW3 B;  1SFC A;  5BU5 A;  3VP9 A;  3AEC C;  3IFM A;  2ZXE B;  1P84 D;  3L71 G;  3CC4 P;  4QIJ A;  2VRE A;  1OFC X;  5AVS B;  5GTH E;  1EZV I;  1S9K D;  2WTY A;  3T97 A;  1SP4 A;  1W2B O;  1AQ5 A;  1FJP A;  2KUB A;  3VOP A;  3ITK A;  1VQM P;  3BRT B;  1BGY J;  3JC2 2;  2K37 A;  3HD7 A;  1NTK E;  4ASV A;  1Q82 Q;  5KJP A;  2YIU C;  2NP9 A;  1FOS E;  2PGD A;  1VQ8 P;  1JY2 O;  1SQQ J;  2YXQ B;  2OYI B;  1N86 A;  2FYU E;  1VQN P;  4ZKU A;  1K9M Q;  1UII A;  2F6I A;  3OC7 A;  1QX8 A;  1YTZ I;  1U57 A;  4U3F E;  4GM2 A;  1VQ4 P;  4JBZ A;  2PBP A;  1GL2 D;  3H1L E;  5APS A;  1NU1 E;  2N9B A;  1H88 A;  1HGZ A;  4OMR A;  5CCG C;  1QLE D;  1ZP0 C;  2FXM A;  3KQF A;  2FYU J;  4JCQ A;  1SFC C;  2ZYG A;  1JTH A;  2GUS A;  5AW7 B;  1KC8 Q;  3MT6 A;  2OYH B;  2J5I I;  2M3B A;  2OTL P;  3M6M A;  1IFP A;  3HE4 A;  4FN8 A;  1PV3 A;  1WMK A;  2IPP A;  1BDC A;  2QJK C;  1BCC E;  3USS A;  4JYC A;  3P32 A;  1KIL C;  2E74 B;  2LXC B;  1SQV E;  3R6H A;  5CJ4 A;  1N6E A;  2QRX A;  3R2P A;  1L0L D;  2VSU F;  2WPV B;  3AE7 C;  4MXI A;  4U18 A;  3Q5R A;  3MYB A;  5CTC A;  3K5B A;  3OJA B;  1JMM A;  3CCE P;  4N3Y B;  2WPR A;  4OGQ D;  1N6F A;  5AW0 B;  3L74 J;  4K2N A;  1KIL E;  3S9O A;  4LK5 A;  5APU A;  2HR3 A;  2ZFC A;  2PRR A;  4RES B;  2IZ1 A;  1GW4 A;  4AYC A;  4IZD A;  3KTJ A;  4D6T D;  2I1K A;  4YXD C;  3KTH A;  2QIW A;  4U0G H;  3CI9 A;  1E5W A;  1N7S D;  1ZLL A;  5KJ7 D;  1UYR A;  3TVW A;  5KLI C;  3F89 A;  2HFE D;  3FWN A;  1M1J C;  2VSS A;  1JY2 P;  3M0D A;  1HH0 A;  3G64 A;  4WWI A;  3RK3 B;  1HTL C;  1ZW0 A;  4U19 A;  1NTM E;  1LT9 B;  2P10 A;  2WSE J;  3HE5 A;  5DUF A;  3MTU E;  2BCC J;  2OYO A;  4H13 B;  3GW6 A;  3H1L G;  3CC2 P;  2OYH C;  4FJW D;  1SQP J;  1L0L K;  3V4Q A;  3CCS P;  1GZL A;  1KB9 D;  1GW3 A;  2VX2 A;  5JBW A;  3H1H J;  1GL2 C;  3L71 J;  1KIL D;  5CCH A;  1K39 A;  2K9J A;  2O01 H;  3STA A;  3CL3 D;  2WSE H;  3CLQ A;  4I1L A;  5DJT B;  2J5S A;  2KB7 P;  2FKW B;  3SFE C;  1KFM A;  3H1I G;  1WDK A;  3RGU A;  2A7S A;  3L70 D;  2R5D A;  4HKZ H;  2KSE A;  2CE3 A;  1BE3 G;  2YKQ A;  3L70 J;  1O8U A;  2QJY B;  2FYU D;  1VL2 A;  1EQ7 A;  3BF0 A;  4Z1M H;  1N8R Q;  4LLH A;  1KQL A;  2IZ0 A;  3TGU E;  1DEE G;  4GOE A;  2O3J A;  4C46 A;  5KAF E;  4RCN A;  2HPC B;  3UIA A;  3LID A;  2HOD B;  5E79 H;  3P8C D;  4JPZ B;  1K73 Q;  2KNC B;  2NPS C;  2PPY A;  3H81 A;  1J1D B;  1G2C A;  1G1J A;  1Q86 Q;  1LTS C;  4JOT A;  1LWU A;  2WIT A;  1FZG A;  4GT1 A;  3L74 D;  4N78 D;  1EDJ A;  3QXZ A;  1LT9 C;  3KHU A;  3ZWC A;  5TIS E;  3W68 A;  4U1A A;  4FNB A;  1LTJ B;  1CI6 B;  2H8P D;  4JJT A;  4ZMD A;  2QEX P;  1OD4 A;  4Y28 J;  2JWD A;  4WB4 A;  2ZJS E;  5GTI H;  1JOC A;  5AVV B;  1Y7O A;  3D6Z A;  4B86 A;  2YNY A;  2H88 C;  3RL0 g;  1JEK A;  2X58 A;  1L0N E;  2NPS B;  3QWD A;  1SQX E;  1YBK A;  1J2J B;  1Q51 A;  5H2F H;  2R44 A;  4UB8 H;  4O9B A;  2VSS E;  1SQP G;  4ZU2 A;  4M3L A;  4ZNC A;  4KT0 J;  1L4A B;  2OTK E;  1N2D C;  3QMJ A;  2XNX A;  4DZO A;  1ZR4 A;  2WSC J;  3C1L A;  1KTM A;  5APV A;  3R9S A;  3NJD A;  3FGA D;  2Q6Q A;  2XV5 A;  3AE5 C;  4IFD K;  1OW8 A;  1PPJ G;  1LGH B;  1OZH A;  1NTZ D;  1KYO H;  1PP9 G;  3C9I A;  2ITA A;  1EF9 A;  2Y9Y A;  5DU4 A;  1NO4 A;  3FXD A;  3T8B A;  3P5M A;  2ZVN B;  3DJA A;  1TU3 F;  1NKN A;  1Q90 D;  3L72 J;  3T88 A;  3CD6 P;  5AVY B;  3I55 P;  1G1I A;  1AVY A;  4MN4 C;  1OIP A;  2IBZ G;  3NFQ A;  1PPJ E;  1MKM A;  2F9Y A;  1SFC B;  2B89 A;  1RJN A;  1DEB A;  5ING A;  2K1A A;  2JJL A;  4BXL A;  3CXH I;  1SZO A;  4F47 A;  2RN0 A;  3B5N D;  3TNU A;  4L74 A;  2J5U A;  2WSF H;  5FIF A;  3TGU D;  2IBZ E;  1MV8 A;  2GA1 A;  1PGJ A;  4MI2 A;  1KYO I;  1SQV J;  3NXS A;  1PP9 D;  3CCU P;  1AVO A;  1T2K C;  2ZAE B;  1GU5 A;  1Q52 A;  1YQ4 C;  1X9V A;  4PD4 H;  4OWF A;  4K35 A;  4Q0G A;  2J58 A;  1BCC J;  4IFM A;  4W7Z A;  2C9N Y;  1RF0 C;  3GMA A;  2W83 C;  3L71 E;  3H1H E;  4EOT A;  3QKA A;  1K05 A;  1X8Y A;  4FZW C;  1L0N G;  4L8K A;  4U3F J;  3P85 A;  3Q1T A;  1VRG A;  3U9S B;  1AA0 A;  1SQX K;  1PGP A;  3MHV A;  3M0D C;  1U7M A;  4H44 B;  2DW3 A;  2GUV A;  3GF3 A;  1IFM A;  4R4L A;  2QG4 A;  3RK2 B;  3CCL P;  2AXT E;  3H1I J;  2RH0 A;  3CX5 E;  4Z0M A;  1KYO E;  1NTK D;  1ZOY C;  1CSB A;  4EIJ A;  1XNV A;  1NOH A;  1K8A Q;  5INI A;  1IK9 A;  2KS1 B;  1CW5 A;  4JFC A;  4GOD A;  4WCZ A;  2KNC A;  2KI7 B;  1XNW A;  3WU2 H;  3CCJ P;  1KOR A;  2J5G A;  1AJY A;  1UIY A;  4ZDB A;  3RL0 B;  4C7N A;  3ZWA A;  3K8X A;  2Z5I A;  2Q34 A;  4OVN F;  3L73 G;  2ZT9 C;  1JY3 O;  1LTJ A;  1VF5 D;  1SLQ A;  5BU8 B;  2WVR A;  3H1J D;  2IFN A;  5AW9 B;  3H32 A;  3LW5 H;  3HD7 C;  2VRS A;  3WUU A;  1N73 B;  1NTZ J;  2VSS F;  1IFJ A;  3CX5 D;  1FDM A;  5AVR B;  4FZW A;  2F9Y B;  3BCC D;  3TGU G;  1RE3 A;  3RBZ A;  5C9G A;  1PP9 E;  1M57 D;  4ZDE A;  3A0H H;  3RRV A;  3HUS B;  3BCC J;  1X0U A;  5AVW B;  3AEF C;  2QJK B;  1HUC A;  3VMA A;  2C8T A;  1SQP D;  3CXH H;  2HG5 D;  3H02 A;  5KLV E;  1ZR2 A;  1SQB D;  1YTZ T;  2E75 C;  3AEB C;  1OW6 A;  4WY4 C;  1Y9B A;  3AE6 C;  3HUS C;  4QMA A;  2JWA A;  3PEA A;  3FX0 A;  1GU4 A;  3WU2 E;  3GKB A;  2PAJ A;  1GDT A;  1LTG C;  2P1J A;  3B71 A;  2YIU B;  5CBN A;  3M91 A;  3OT6 A;  2AEJ A;  5AW6 B;  3M9H A;  4IL6 E;  1HJB A;  1AFO A;  3Q5S A;  4K29 A;  1M7L A;  1LP1 A;  1PPJ D;  2E76 C;  1VPC A;  5KAI H;  3RK3 D;  1OXZ A;  4PJ0 E;  2Q3E A;  1HJ0 A;  2ZQR A;  4B3I A;  1FZA A;  5KKZ C;  2KOG A;  3T3W A;  5AW8 B;  1SVF A;  2BAS A;  3V5E A;  5DU8 A;  1SQQ K;  1PIX A;  3P8C E;  1VQ5 P;  1RF1 A;  1ZRT D;  3BVH A;  1FZC C;  1URQ A;  2R32 A;  4PV1 C;  2IBZ I;  3V5B A;  2I1J A;  5KJ7 A;  5DTW A;  4MOU A;  4U3F D;  1L4A C;  1URQ D;  2FY8 A;  4HH2 A;  1FZE A;  1MJ3 A;  3NMD A;  2WT7 B;  2JKV A;  3U9R B;  2FYN B;  3I5C A;  4IFF A;  1XX4 A;  3C8V A;  3CWB E;  3R9Q A;  4HDT A;  2O01 N;  1KYO D;  4ASI A;  1OW7 A;  1FCF A;  3RL0 D;  1WDM A;  2F9I A;  3AEA C;  4I6M C;  3OA7 A;  4YTP C;  1NVO A;  5CMZ A;  1WZ8 A;  4IZC A;  3CCM P;  2NPS A;  2K88 A;  1JB0 J;  2J5I B;  1FDO A;  5KLV G;  2LXB A;  3O6Q B;  4I42 A;  1WDL A;  1FZC B;  3KTI A;  3SWX A;  3AE4 C;  1R5L A;  3K50 A;  2FXO A;  5JBX A;  3AE3 C;  2HOD A;  2OYI A;  5B5E H;  4GKG A;  1EDL A;  1S5L E;  3BAT A;  1NTK J;  1L4A A;  2KYV A;  2YKP A;  1GK4 A;  3A0H E;  3NTN A;  3KZI H;  2Y0E A;  5KLV K;  2KZI A;  1T3J A;  5B66 H;  2E76 B;  1XTC C;  2BCC G;  1GK6 A;  2ZL3 A;  1QVF O;  1NJI Q;  2GTR A;  1Y8A A;  3L73 E;  1RF1 C;  3QRE A;  1ON9 A;  1P84 H;  2LR2 A;  3L74 E;  1JTH B;  4U0G A;  3H1K G;  2ZYA A;  3B5N C;  4KJM A;  1FS0 E;  1L0N J;  1QVG O;  3Q0J A;  4NEK A;  2YMY A;  3MUD C;  3TNU B;  1XO6 A;  1N6D A;  1KQG B;  4WYO B;  2B9B A;  1KFN A;  3TZ3 A;  1J1E C;  2ZVO B;  4H0L B;  1IFD A;  3P7K A;  2HLO A;  1DUB A;  3CME P;  1JO5 A;  3A3Y B;  1GD2 E;  4J2U A;  3KQG A;  5KDR B;  3PRJ A;  3CX5 H;  3PZK A;  3GHG A;  1VF5 B;  1RH5 B;  3L75 J;  3CXH E;  1J1E B;  3RK2 C;  1NTK G;  5AVU B;  2KK7 A;  2WT7 A;  3M6N A;  2A45 I;  3L35 A;  4JVT A;  4WY4 B;  4A7P A;  5KTB A;  4BRY B;  3KTG A;  4ZKP A;  2ZQQ A;  4UB6 E;  3T97 B;  1GL2 B;  1T6A A;  1EZV E;  1S5L X;  4K3W A;  1A02 J;  2B88 A;  2JO1 A;  1NYH A;  3PP5 A;  4DCK A;  4GDO A;  2P58 A;  2KS1 A;  2Z4E A;  3TVU A;  3O6Q A;  3PE8 A;  4ELW A;  3L73 D;  2JR8 A;  3ISA A;  3SWF A;  1USE A;  2J59 M;  3RK2 D;  1OD2 A;  3TYY A;  1TYF A;  4QII A;  1KD1 Q;  5APW A;  2ZL4 A;  4IL6 X;  1R8E A;  4HNK A;  2C0W A;  2FBW C;  3MFM A;  3L70 E;  2JEE A;  1SQQ E;  3VIV A;  2WPS A;  3TT6 A;  5INF A;  1NTZ G;  3P8M C;  2WSC H;  1NTZ E;  4PD4 D;  1SQQ G;  2W90 A;  2N1T C;  1KZU B;  2PFX A;  1SFC D;  1FZF A;  3IF4 A;  2V4H A;  4HYT B;  5DTP A;  1OX3 A;  3TF5 A;  3H1K E;  1JM0 A;  1L4A D;  1URQ C;  3IR9 A;  3S4R A;  3L74 G;  2Y0D A;  1NH4 A;  2FYN C;  3SWK A;  4JQ0 D;  1NU1 K;  1OVV A;  1H8A A;  1EDK A;  4DJG A;  1RQV A;  2N9Y B;  1IK7 A;  3PJS K;  1X79 B;  1EZV G;  3H1J J;  4HJG H;  5H2F E;  2OAR A;  1Y47 A;  4WVZ A;  4I52 A;  1S4X A;  3FDU A;  2Y0C A;  1RE3 C;  1BGY G;  2A81 A;  1VF5 C;  3BCC G;  1M90 Q;  5C90 A;  1M8O B;  1SQB K;  3H1I E;  2VSU A;  1SQQ D;  3TSI A;  4D6T E;  3HLN 1;  2KLV A;  1NGM B;  3LIE A;  3AED C;  2F9I B;  2OGU A;  3A0B H;  1SG4 A;  3L71 D;  4RO0 A;  2M0B A;  3RSI A;  5KAF H;  2J5I A;  3HP0 A;  5M1B A;  3WUV A;  1ZV8 A;  4D6T G;  1BDD A;  2E43 A;  1SQX G;  1WRG A;  2IX7 C;  1LNQ A;  4B3H A;  4OGQ B;  2UZF A;  2A06 E;  1QGK B;  3M9Q A;  2KZJ A;  1UYV A;  4W7Y A;  1RF1 B;  5HUQ A;  1PGQ A;  5E0N X;  2QM8 A;  2WTB A;  1G2C B;  1LT1 A;  1VQP P;  1SS1 A;  4YPC A;  3M9B A;  4QFE A;  3Q3D A;  3GG2 A;  1SQP K;  4JYL A;  2B87 A;  2XZR A;  2E74 C;  1H0T A;  3MOY A;  2FXP A;  3VTP C;  4PV1 D;  2FFD B;  3HE5 B;  1JY3 N;  1BE3 E;  3WMM 0;  1UIX A;  1MFZ A;  4R4M A;  2D2C B;  2QA4 P;  2A06 D;  1YI2 P;  1KMI Z;  1BE3 J;  2KXP B;  1BCC D;  1URQ B;  1Q7Y Q;  5TJH A;  4PD4 I;  1YG6 A;  4N6J A;  1N7S B;  1NAY A;  2YO2 A;  5L8R J;  5E79 E;  3RST A;  4RJT A;  1MUU A;  3TLF A;  5KDR A;  2D2C C;  3H1J E;  1ON3 A;  4H13 D;  2IDB A;  3QWO C;  3Q0G A;  3H1I D;  1W2E A;  1KQF B;  3L4F A;  2Q2X A;  4CPG A;  1AQT A;  2E74 D;  2BCC E;  3L3S A;  3H25 A;  5DL1 A;  1EC5 A;  3BEZ A;  4JWV A;  1YYC A;  4YLH A;  2MJZ A;  1FC9 A;  4NAR A;  3H1L J;  1H89 A;  1NTM J;  1M1J B; 
#chains in the Genus database with same CATH homology
 4U0G H;  2FBM A;  4RKU J;  3OT6 A;  3SLL A;  3RK3 E;  4OG1 A;  3ZW8 A;  3Q5S A;  1UYR A;  3TVW A;  5KLI C;  4K29 A;  2VSS A;  2E76 C;  3BPT A;  2ZT9 D;  3G64 A;  5MGB A;  4GHN A;  4B3J A;  4G2R A;  4OGQ C;  4H0L C;  3WG5 A;  1HJ0 A;  2ZL2 A;  3QXI A;  2ZQR A;  4U19 A;  4B3I A;  2E75 B;  3AE8 C;  3D6Y A;  5KKZ C;  2P10 A;  2WSE J;  5DUF A;  4EML A;  3T3W A;  3V5I A;  2F6Q A;  1RJM A;  2VSU C;  3V5E A;  2WSF J;  5DU8 A;  4H13 B;  1PIX A;  4KPK A;  4FJW D;  2J5G D;  3AEG C;  3AE1 C;  1K32 A;  4PV1 C;  2OQQ A;  2PG8 A;  2VX2 A;  3LW5 J;  5JBW A;  3TRR A;  1HNU A;  1W2X A;  3HE2 A;  1FC6 A;  1K39 A;  5DTW A;  3STA A;  4MOU A;  1XNY A;  4ELX A;  2VSU E;  5DZK H;  4FB8 A;  3R9T A;  1MJ3 A;  2J5S A;  1EF8 A;  3SFE C;  3G9R A;  4ZDF A;  3U9R B;  1XX4 A;  3C8V A;  3R9Q A;  4HDT A;  4U0H A;  1WDK A;  3SFD C;  4ASI A;  1ZRT E;  2A7S A;  1OW7 A;  4OLQ A;  1FCF A;  3OME A;  2CE3 A;  3AEE C;  5DZK A;  1WDM A;  2F9I A;  3AEA C;  4YTP C;  3R4Y A;  1WZ8 A;  4IZC A;  1O8U A;  2J5I B;  1JB0 J;  1VL2 A;  5DU6 A;  4JCT A;  1FDO A;  3U9T B;  2D2C D;  3GLM A;  4I42 A;  1WDL A;  3BF0 A;  4Z1M H;  3KTI A;  3SWX A;  3AE4 C;  3HIN A;  3K50 A;  3P2L A;  5JBX A;  1OMI A;  3AE3 C;  4RCN A;  2D3T A;  3Q2Y A;  1EY3 A;  4EMP A;  2HW5 A;  2G3A A;  4ELS A;  3H0Q A;  4KWB A;  1UYS A;  5G1S A;  2IEX A;  2CBY A;  2PPY A;  3H81 A;  2E76 B;  5E0S A;  1DIP A;  1K04 A;  4JOT A;  4HC8 A;  4RYF H;  2ZL3 A;  3R0O A;  2GTR A;  5IKL B;  3QRE A;  1HF9 A;  1ON9 A;  3QXZ A;  3IAO A;  1TG6 A;  5G1R A;  3Q1M A;  4U0G A;  4H44 C;  1YG8 A;  3H0J A;  3ZWC A;  4NNQ A;  3EWK A;  4KNP A;  4U1A A;  4FNB A;  4L6W A;  4JJT A;  3Q5P A;  3Q0J A;  4NEK A;  2MKV A;  1UYT A;  3LKE A;  3QYR A;  1XO6 A;  1OD4 A;  1N6D A;  4Y28 J;  1KQG B;  1GMJ A;  4WYO B;  2FW2 A;  2G8Y A;  4I7Z B;  2WQY C;  5DUC A;  3TZ3 A;  3I47 A;  1Y7O A;  4H0L B;  1JXZ A;  3D6Z A;  3H0U A;  1DUB A;  2H88 C;  3RL0 g;  2X58 A;  4J2U A;  2Q35 A;  5KDR B;  2JP3 A;  3KTK A;  2FZS A;  5E0S H;  3IB9 A;  4KD6 A;  3QWD A;  3PZK A;  1NZY B;  1VF5 B;  3IN6 A;  3IAV A;  1Q51 A;  2X24 A;  2ZT9 B;  3M6N A;  4JVT A;  2VSS E;  4ZU2 A;  3T89 A;  4ZDD A;  2E75 D;  3KTG A;  2ZQQ A;  3T97 B;  1DD3 A;  4KT0 J;  3QMJ A;  2QSI A;  2ZL0 A;  1S5L X;  4K3W A;  2JO1 A;  1NYH A;  3T8A A;  2WSC J;  4GDO A;  3AE2 C;  1KTM A;  4WZ8 B;  1DCI A;  4Q1I A;  3IBB A;  3TVU A;  3O6Q A;  3R9S A;  3NJD A;  3PE8 A;  4ELW A;  3PGQ A;  2O01 J;  3FGA D;  3ISA A;  2A7K A;  1DD4 A;  1OD2 A;  3AE5 C;  2V7Q J;  4RYF A;  2YJG A;  1OW8 A;  3DOR A;  1PL5 A;  3TDC A;  1EXI A;  2DUB A;  1HZD A;  1TYF A;  4QII A;  3Q7H A;  2ZL4 A;  2BZR A;  4IL6 X;  1R8E A;  4HNK A;  5DKP A;  2E76 D;  3D71 A;  4JSB A;  1EF9 A;  5DU4 A;  2FBW C;  3MFM A;  2NZ2 A;  3T8B A;  3AE9 C;  3P5M A;  3VIV A;  3TT6 A;  5INF A;  3DJA A;  3H0S A;  1TU3 F;  1Q90 D;  4I4Z A;  3T88 A;  5FUS A;  2QJP C;  4FND A;  3JU1 A;  4FN7 A;  1RQU A;  4PV1 B;  2YMK A;  4TT3 H;  1ZME C;  4JCR A;  2H89 C;  3TV5 A;  1MKM A;  2F9Y A;  5DTP A;  1RJN A;  5ING A;  3ZWB A;  3N6R B;  1SZO A;  1NZY A;  4F47 A;  3AEC C;  2FYN C;  2J5U A;  1PJH A;  5FIF A;  4H44 D;  1RQV A;  4QIJ A;  1IK7 A;  2VRE A;  3NJB A;  3TT7 A;  1FC7 A;  4MI2 A;  1Q52 A;  1YQ4 C;  4I52 A;  3FDU A;  4Q0G A;  2A81 A;  1VF5 C;  5C90 A;  4U7J A;  3GMA A;  1J7X A;  2VSU A;  4DI1 A;  3HLN 1;  5KJP A;  1NGM B;  2F9I B;  3AED C;  2YIU C;  2NP9 A;  3QKA A;  1SG4 A;  1K05 A;  4I7Z C;  2DEO A;  2QJY C;  4H0L D;  3RSI A;  4FZW C;  4L8K A;  2J5I A;  3HP0 A;  5M1B A;  3P85 A;  3Q1T A;  1VRG A;  3U9S B;  1EXJ A;  2F6I A;  4H44 B;  3OC7 A;  3GF3 A;  4B3H A;  1U57 A;  4OGQ B;  4R4L A;  1YQ3 C;  4GM2 A;  2UZF A;  2QQ3 A;  2PBP A;  4Z0M A;  1UYV A;  1ZOY C;  2K9Y A;  1XNV A;  5INI A;  4OMR A;  4JFC A;  5HUQ A;  4H13 C;  1HNO A;  4WCZ A;  2BEQ D;  1ZP0 C;  5E0N X;  1S1C X;  3KQF A;  4JCQ A;  1XNW A;  2WTB A;  5CTB A;  4IZB A;  3MT6 A;  3ABV C;  3GF7 A;  3Q3D A;  1KOR A;  3BPP A;  4QFE A;  2J5G A;  1AJY A;  1UIY A;  4JYL A;  2J5I I;  4ZDB A;  3M6M A;  2E74 C;  4FN8 A;  1PV3 A;  1WMK A;  3MOY A;  2FXP A;  4PV1 D;  2QJK C;  2EJ5 A;  3ZWA A;  3K8X A;  2Q34 A;  2ZT9 C;  2W3P A;  3HRX A;  1UIX A;  1VF5 D;  2E74 B;  4R4M A;  2D2C B;  3LAO A;  3R6H A;  1N6E A;  3QK8 A;  1KMI Z;  2VSU F;  3FF6 A;  2WPV B;  2VSS F;  3ST9 A;  3AE7 C;  4MXI A;  4U18 A;  3Q5R A;  1YG6 A;  3MYB A;  5CTC A;  4FZW A;  2F9Y B;  4EMM A;  5C9G A;  2BEZ F;  4OGQ D;  1N6F A;  5L8R J;  4ZDE A;  4K2N A;  3RRV A;  3RST A;  3TLF A;  4ZDC A;  1KIL E;  2D2C C;  3S9O A;  5KDR A;  4LK5 A;  1ON3 A;  4H13 D;  1X0U A;  2IDB A;  3AEF C;  3Q0G A;  1FDI A;  2C8T A;  4XFJ A;  1KQF B;  4JYJ A;  3D70 A;  3H02 A;  2Q2X A;  2E75 C;  3KTJ A;  4IZD A;  3AEB C;  2E74 D;  5G1Q A;  1OW6 A;  3L3S A;  4YXD C;  1Y9B A;  3KTH A;  3H25 A;  5DL1 A;  3AE6 C;  3BEZ A;  4JWV A;  3PEA A;  4YLH A;  3GKB A;  1FC9 A;  3B71 A;  4JCS A;  3ZW9 A;  4NAR A;  2QIW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...