1PIXA

Crystal structure of the carboxyltransferase subunit of the bacterial ion pump glutaconyl-coenzyme a decarboxylase
Total Genus 219
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
219
sequence length
586
structure length
586
Chain Sequence
b'GFYSMPRYFQNMPQVGKPLKKADAANEEQLKKIEEEIHQLIKEAQEAGKADADVNKRGELTALQRIEKLVEPGSWRPLNTLFNPQGNKNGSVAIVKGLGRVNGKWCVVVASDNKKLAGAWVPGQAECLLRASDTAKTLHVPLVYVLNCSGVKFDEQEKVYPNRRGGGTPFFRNAELNQLGIPVIVGIYGTNPAGGGYHSISPTVIIAHEKANMAVGGAGIMGGMNPKGHVDLEYANEIADMVDRTGKTEPPGAVDIHYTETGFMREVYASEEGVLEGIKKYVGMLPKYDPEFFRVDDPKAPAFPADDLYSMVPLNDKRAYDIYNVIARLFDNSELHEYKKGYGPEMVTGLAKVNGLLVGVVANVQGLLMNYPEYKAAGSVGIGGKLYRQGLVKMNEFVTLCARDRLPIVWIQDTTGIDVGNDAEKAELLGLGQSLIYSIQTSHIPQFEITLRKGTAAAHYVLGGPQGNDTNAFSIGTAATEIAVMNGETAATAMYSRRLAKDRKAGKDLQPTIDKMNNLIQAFYTKSRPKVCAELGLVDEIVDMNKIRGYVEAFTEAAYQNPESICPFHQMILPRAIREFETFVKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutaconyl-CoA decarboxylase A subunit
molecule tags Lyase
source organism Acidaminococcus fermentans
publication title Crystal structure of the carboxyltransferase subunit of the bacterial sodium ion pump glutaconyl-coenzyme A decarboxylase
pubmed doi rcsb
total genus 219
structure length 586
sequence length 586
chains with identical sequence B
ec nomenclature ec 4.1.1.70: Transferred entry: 7.2.4.5.
pdb deposition date 2003-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01039 Carboxyl_trans Carboxyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.680 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Helix bin 1pixA01
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1pixA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1pixA03
5KDRA 5DL1A 5JBWA 5DZKH 4JJTA 5DU6A 5DKPA 3R9QA 4ZU2A 3M6MA 4ZDBA 4IZDA 3QREA 2VSUC 3HINA 1EF9A 3ZWBA 2WTBA 3PEAA 3K8XA 4FZWA 4FB8A 3Q1TA 3I47A 4RYFA 4EMMA 3HE2A 4FZWC 3GLMA 3TVUA 5INGA 5INIA 5E0NX 5CTBA 1HNUA 5CTCA 5DUFA 3GKBA 4ZDEA 4U0GH 3T8AA 1K32A 3SWXA 4JCRA 3R9TA 3QXIA 3LAOA 3ISAA 3BEZA 4K3WA 4MXIA 1UYRA 4JOTA 1SG4A 3QKAA 5KDRB 3ZWCA 4YLHA 3RSTA 1FC9A 5DTWA 2W3PA 1X0UA 5INFA 4EMLA 1XO6A 2VSSE 1N6EA 4MOUA 3MOYA 2FZSA 3QWDA 2ZQRA 3P5MA 1FC6A 3BPPA 4G2RA 4NNQA 5MGBA 2VSUE 5KJPA 5G1SA 2VX2A 3JU1A 1HNOA 3TVWA 2PG8A 1Y7OA 1N6FA 4DI1A 1RJNA 1J7XA 2F9IA 3P2LA 4ZDDA 4U0GA 3WG5A 1UYSA 3TT6A 2J5II 1VRGA 5FIFA 3M6NA 3FF6A 4JCSA 3QYRA 3H0QA 2J5IB 4GM2A 4WCZA 5JBXA 1ON3A 1UYTA 3TT7A 3Q0JA 2BZRA 2DUBA 2F9YA 1N6DA 4L8KA 3R9SA 3BF0A 3U9SB 4QIJA 3T89A 4JVTA 4Q0GA 2J5SA 3KTHA 3KTIA 3H0JA 2CE3A 2FW2A 3P85A 4LK5A 4OLQA 4U1AA 3OMEA 3GF3A 2J5GD 1OD4A 5DZKA 2VSUA 3TLFA 4FNDA 4IZCA 2A81A 3K50A 1Q51A 2F6IA 1W2XA 2D3TA 4B3JA 3G64A 3QMJA 3H81A 4K29A 3L3SA 5E0SH 4ASIA 5C90A 1FC7A 2ZL0A 2Q34A 4JCTA 4RYFH 3GF7A 4JCQA 1NZYB 5IKLB 4IZBA 4FJWD 3H0UA 4HC8A 1XNWA 1MJ3A 3HLN1 4JYLA 2VSUF 3VIVA 2QQ3A 4RCNA 3H02A 3MT6A 1YG8A 5DUCA 2PPYA 1WDKA 4OMRA 1XNVA 4FN8A 5C9GA 3LKEA 3T3WA 3IB9A 4FN7A 2GTRA 1XX4A 1WZ8A 2ZQQA 4KNPA 3ZW8A 1UYVA 1TYFA 4ELXA 4JFCA 4Q1IA 1Q52A 3R6HA 2ZL4A 2HW5A 2ZL2A 3FDUA 2FBMA 3PGQA 1RJMA 4WZ8B 1DCIA 5DTPA 3DORA 1XNYA 1JXZA 3N6RB 3OC7A 3HP0A 2CBYA 1DUBA 2J5IA 5DU4A 5DU8A 1EF8A 2PBPA 3MYBA 3PZKA 3KQFA 3U9TB 5E0SA 2F9YB 3QXZA 3DJAA 3T8BA 4QFEA 3KTGA 1NZYA 5G1QA 4ZDFA 3OT6A 3QK8A 2IEXA 2UZFA 3ZWAA 3R0OA 2A7SA 2J5GA 4ELSA 3U9RB 4I52A 4NEKA 1PIXA 4U18A 3ST9A 1EY3A 4I4ZA 3PE8A 4U19A 3HRXA 2VREA 3TDCA 3TRRA 2NP9A 2F9IB 2Q35A 1PJHA 3RSIA 4WYOB 2ZL3A 3KTKA 3ZW9A 4FNBA 3GMAA 2F6QA 1K39A 4L6WA 2C8TA 3MFMA 1SZOA 4JWVA 1OD2A 3Q7HA 4MI2A 3V5EA 4HNKA 3STAA 4KWBA 1ON9A 2VSSF 4QIIA 4ZDCA 3H0SA 3TZ3A 2DEOA 3IAVA 4KD6A 4K2NA 3T88A 1YG6A 3V5IA 1WDLA 4B3HA 1TG6A 2VSSA 4F47A 4U0HA 3NJBA 3SLLA 3Q0GA 4JYJA 4JSBA 1O8UA 4Z0MA 2X58A 3NJDA 1UIYA 5FUSA 4B3IA 1FCFA 3IBBA 2EJ5A 2A7KA 4OG1A 5G1RA 1WDMA 2X24A 4ELWA 4I42A 4GHNA 3KTJA 2Q2XA 3RRVA 1HZDA 3TV5A 4EMPA 4KPKA
chains in the Genus database with same CATH superfamily
1J1DC 3SFDC 2OQQA 1KN7A 1KZUB 5DZKH 2XU6A 4JJTA 4K35A 3FGAD 3A3YB 2BCCE 4JYBA 1URQC 1JY3O 1ZMEC 2QIWA 3HINA 3AEEC 1GZLA 1SQXG 1KILD 1CZQA 1M57D 4Y99C 1VQNP 3Q1TA 1Q2NA 3I47A 2HPCA 2FYUK 2M8RA 1KQLA 4Y28J 3GLMA 4W7YA 2VRSA 2N9BA 2WPRA 2IZ1A 1NU1E 1NTZJ 2HODA 4ZDEA 3F89A 3CCLP 1K32A 1GU5A 2ZJSE 3H1KJ 1A02J 2AEJA 3L73G 3MUDA 3L74G 1LTAC 1NTME 2WSCH 2P2UA 5APYA 4RESB 4BRYB 3H1LG 1IFJA 1GK6A 1S2EA 1LGHB 2H89C 1VQPP 5H2FH 3RBZA 3A0HE 3USSA 1XO6A 3WUVA 3M0AA 3PLNA 3MOYA 3RK2D 3QWDA 2ZQRA 3P5MA 1FC6A 1NOHA 1LTIC 3BPPA 2KSEA 2H43A 2KS1A 4O9BA 2AXCA 1RQVA 4PD4H 2R44A 1HNOA 3TVWA 1ZRTD 1Y7OA 2W6AA 4DI1A 3P2LA 2DW3A 2NPSB 1L0LG 2FYUE 1YBKA 5AVVB 5TISE 4ZDDA 2J59M 4U0GA 2C9NY 1NGMB 1VRGA 2OYIA 3M0DC 1JEKA 1FZAA 2A06D 2J5IB 4GM2A 4WCZA 1Z56A 3MIWA 1YI2P 1QVGO 3NFQA 2AEMA 1N73A 4PD4E 3G4SP 3JCUE 2DUBA 1NYHA 4L8KA 4R4MA 2A45I 1AQ5A 3CCRP 4QIJA 3WU2E 3T89A 4U7JA 3H0JA 1NKZB 3RK3D 2J5GD 1OD4A 4C7RA 1L4AB 1KILC 1X9VA 1OX3A 2XNXA 1Q51A 4NPDA 1WMKA 3KZIE 1EQ7A 2BEZF 1H0TA 3SWYA 1Y47A 3G64A 2OYHC 2BCCG 1SQQJ 4U3FG 5C90A 1YJ9P 2KZJA 2Q34A 2I1KA 1Q86Q 3PJSK 3CXHH 5KJ7D 1IK7A 1L0NG 1DIPA 3AEDC 4JCQA 5AW9B 2Z4EA 1HJBA 3CLQA 3CWBG 1OXZA 1N7SA 4H0LC 3AE4C 1XNWA 2IX7C 1MJ3A 4JYLA 3O8ZA 1MUUA 1L0LE 2WSFJ 1IO4A 1XTCC 3CX5E 2FYZA 1EZVI 3MT6A 2K9JA 3BCCE 3V2PA 1YG8A 3A2AA 1E5WA 2FFDA 1FS0E 2IBZG 1VQ8P 1J1EB 1FBMA 2E74C 1KC8Q 5KLVG 1J2JB 1DD3A 4W80A 3TDKA 1JNMA 1BCCE 1L4AD 2GA1A 4WY4A 5C9GA 2K3RA 3LKEA 1SQBE 4OGQC 1Q82Q 1SFCC 3MZWB 3S1KA 1SQPG 3AECC 3ZW8A 1RE4A 1UYVA 3MTUE 3R6HA 1BGYG 1OFCX 2KUBA 2ZL4A 2PFXA 2HW5A 2ZL2A 2A45G 3AEBC 3BPTA 1YYCA 1LT9B 1DCIA 4BWNA 3H1KD 2FYNB 1ZV8A 1FJPA 3DORA 3HE5A 2CK3H 2M5AB 3CX5D 1KORA 3D6YA 3BRVB 2A45H 3PH0A 1OVUA 1LT9C 4EDFA 3G6EP 1S5LH 1SQVG 5DU8A 2PBPA 3KQFA 3RK3E 3U9TB 1W2BO 1KV4A 2H7HA 1OVVA 1NTKG 4UB6E 3T8BA 1ZOYC 3KTGA 1PP9G 3TGUE 2RMZA 3OT6A 2IEXA 3BCCJ 1PFIA 2SPZA 1VF5B 3A0BE 2J5GA 4ELSA 3H1JJ 2P10A 2HYNA 1PIXA 4GOFA 5CCGC 3IF4A 3PE8A 3VP8A 3H32A 3AE8C 2K9JB 4OWFA 3HRXA 2VREA 2LXBA 2E74B 3B5NB 3L4FA 3P8CD 1OW8A 4DJGA 1PPJG 5DJTB 3H1IE 1M1KQ 2KYVA 2OYHB 3A0BH 3SWKA 1EZVG 3RSIA 1SQVE 1HH0A 4ASWA 2W8ZA 4LC1A 1BCCJ 3H1JG 4WVZA 2QJKC 4W7ZA 2K9YA 4TT3H 3GMAA 3KYQA 3L72D 2C8TA 1L4AC 3MFMA 4JWVA 3AE1C 3Q7HA 1ZW0A 1BDCA 4A7PA 1S3JA 2IDBA 1K05A 3V5EA 3TGUD 3STAA 1FC2C 4KWBA 1ON9A 2VSSF 1OW6A 3M91A 4QIIA 4ZDCA 2N1TC 2WTYA 1Q81Q 1OWAA 3L70E 3I56P 1OZHA 2DEOA 1IFMA 3IAVA 5CCHA 1YJWP 4KD6A 1LTJC 5AVTB 4K2NA 3T88A 1HGZA 3L72J 3V5IA 4N78D 1TG6A 4U0HA 1VQ9P 2QJPB 3NJBA 5KJ7A 3P8CE 4H0LB 3GHGA 1QLED 1O8UA 4WY4D 3CL3D 2ZFCA 4I6MC 3B5ND 2E43A 3CPWO 4B3IA 3L36A 3TGUG 1X22A 1FZEA 1SQPD 3HD7A 2R3CA 3M0DA 3BVHA 2EJ5A 3L72G 1P84I 2H8PD 2WPSA 2O01N 2X24A 4GHNA 2R5DA 2Q2XA 3RRVA 2WVRA 1CI6A 1FZBA 3TV5A 1NHLA 5KDRA 2QA4P 4WWIA 1JMBA 2JDIH 1X79B 2B89A 2O01H 1L0LJ 4GOEA 5CBOA 1SQVK 3AE5C 3CD6P 1VQ5P 3V4QA 5BU5A 1X8YA 1K8AQ 2OYHA 2MKVA 1KQFB 2HG5D 5B5EE 1DX7A 3UIAA 3VMAA 2WTBA 4AQRD 4PV1C 1PGQA 1EDKA 3K8XA 1K73Q 4FZWA 4FB8A 4EMMA 3AEFC 3HE2A 1URQA 1L0NK 1KYOD 1VL2A 2IPPA 5INIA 1MFTA 2D2CC 1RF1C 1KB9E 1CSBA 1NU1G 3FWLA 5DUFA 1NU1J 5B5EH 3T8AA 1S5LX 5AVRB 2N9YB 4LLHA 1LTJB 2BCCD 3SWXA 4JYCA 2Y0EA 2OARA 1N86A 3L74J 1L0NJ 1SG4A 3H1KG 2E75C 4Z1MH 3ZWCA 2W83C 1IJDB 5L8RJ 1FC9A 5AW0B 2W3PA 1X0UA 1KQSO 2WPQA 3M06A 4EMLA 1BGYD 1G1IA 1HUCA 4D6TE 2JWDA 2AXTE 3HUSA 4RJTA 2WT7A 2FZSA 1BE3J 1QVFO 3L71D 4G2RA 2R3SA 4NNQA 5MGBA 4WY4C 3CXHI 2IBZI 2ZYAA 1S5LE 2QG4A 1N6FA 3JC22 1GL2A 2F9IA 1H88A 1FAVA 4LGDE 1R5SA 1RF0C 2W6BA 3TT6A 1NAFA 5AVXB 1YIJP 2OYIB 1GD2E 3AEGC 3QYRA 2FBWC 1JO5A 3ITKA 2B9BA 4IFFA 1UYTA 3Q0JA 3TT7A 1AV1A 4KT0J 1SQBG 4PJ0E 2KB7P 2BZRA 2ZXXA 3H1IJ 1N6DA 2GUSA 1FDMA 3CWBD 1S4XA 3R9SA 2E76B 3U9SB 4Q0GA 2J5SA 3V2NA 1YQ3C 1ZR4A 1MZ9A 2FW2A 3P85A 4OLQA 3OMEA 4IFDK 3GF3A 1SS1A 3V2QA 5AW6B 2VSUA 2XNDH 1G1JA 4FNDA 1LTJA 3VYIA 3H1LD 1H8AA 2A81A 4DOJA 1KILA 1N2DC 1Q90D 4IL6X 1W2XA 1YJNP 1T2KD 4EYYQ 3T97B 3L3SA 3M9HA 3WUTA 3U59A 5CCHD 4JPZB 4JCTA 1AA0A 1LTTC 3HD7C 3GF7A 2WT7B 1NZYB 1WT6A 3CXHD 5EFWB 2FXMA 3CC7P 4HKZH 4IZBA 1R5LA 4FJWD 5BU8B 2IYOA 2WSFH 3PP5A 3L37A 1VF5C 4GODA 2KXPB 2VSUF 1QL1A 3V4WA 5AW7B 5APUA 3VMYA 2QQ3A 1M1JA 3KQGA 2FFDB 2O3JA 3FWNA 1LWUC 4CPGA 5CMZA 5DUCA 5APWA 1WDKA 1RF1B 2D2CB 2N1TA 4RO0A 2OYOA 4OMRA 3LIDA 1KB9D 3WUUA 1RH5B 3L75E 2KLVA 3IB9A 3MHVA 4I1LA 4K3AA 2ZQQA 4PV1B 4KNPA 3MUDC 3AE9C 3AE7C 2QJYC 4Q1IA 1Q52A 2HR3A 1VQ6P 4H44C 5KKZC 2I8DA 5CCGA 5AVZB 3A0HH 3BCCD 5AW5B 3CCUP 2E74D 3PGQA 4MN4C 4UB8H 4BRYA 1NKNA 4H13B 1PGPA 2L5GB 3CMAP 3N6RB 1BE3D 3MGNA 3I55P 4M3LA 2CBYA 2J5IA 4BXLA 3PZKA 3IAOA 1N73B 2YXRB 1D7MA 1EDLA 4GKGA 4ZKUA 3QXZA 3VP9A 1NO4A 3DJAA 4QFEA 3L75D 1FOSE 1NZYA 1RE3A 3B4SA 2IYPA 3QK8A 1JY2O 3NXSA 1KYOE 1IFNA 5AW3B 2B87A 2KOGA 3HD7D 3SFEC 1FDIA 2YO2A 1GL2C 2XKMA 5CCHC 1NTZG 2HLOA 3G71P 1MKMA 1G2CB 3TNUA 3WU2H 3TDCA 2IZ0A 2Q5UA 3L74E 5KLVE 3HRNA 1J1EC 5AVQB 4GT1A 1SQBJ 1HJ0A 2V4HA 1VQLP 1DH3A 4WYOB 5APSA 2W6JH 3U1AA 4FNBA 1KD1Q 3CCSP 1OD2A 3H1HD 1T3JA 4C7NA 4HNKA 2G8YA 3GG2A 2H88C 3VMZA 3H0SA 1E79H 2E75B 4L76A 2W27A 5TISH 3HUSC 1BE3G 2Y0CA 1M90Q 4AUWA 1VPCA 4DT0A 4B3HA 3HE4A 5KLIC 4F47A 2K88A 1JTHA 4HDTA 1AFOA 2FXOA 4QMAA 2KSJA 3RK3C 1S1CX 4EIJA 4JYJA 4JSBA 4GDOA 3GW6A 2X58A 3CCMP 3CX5H 4Y99B 4D6TG 4L74A 1VDFA 2J58A 3RK2C 4KHXA 2ZYGA 1SQQD 4OG1A 1WDMA 3Q5PA 3GHGC 5GTHE 1HZDA 4H44B 1ZXGA 2LKMA 3H25A 2WITA 4N78E 1ON3A 1NTKD 5DL1A 2AEFA 3CMEP 5JBWA 2CPSA 2ITAA 3A7OA 1NTMJ 3ZDMA 1SQVD 3RL0g 4OGQB 4OH8B 2NPSA 4ZU2A 4KJMA 3M6MA 4ZDBA 3QREA 2VSUC 2QSIA 3NMDA 3PEAA 1NTMK 3TK1A 2D2CD 1LTGC 3B8EB 1R8EA 1URQB 3V6IA 3RL0D 4FZWC 1JOCA 3TVUA 4DCKA 2GM4A 1YHQP 5INGA 2YMYA 5KLVD 5E0NX 5CTBA 1LT9A 1HNUA 5CTCA 4PV1D 4TLFA 2IBZD 1KYOH 1FZFA 3GKBA 1DEEG 2JR8A 2WSSH 2M3BA 3R9TA 4YPCA 3LAOA 3ISAA 1UYRA 2C0WA 3H1IG 2N1TB 1RF1A 1AQTA 3H1HE 2MJZA 5DTWA 5CJ4A 5K5GB 1H0TB 3PHLA 4WBAA 1L0ND 3OAKA 4HJGH 1M1JC 1N6EA 2B88A 3P32A 4YXWH 1K04A 1DD4A 4U3FD 1RY3A 2K1AA 1KILE 1ZR2A 2VSUE 1YTZT 1TU3F 1OIPA 3L70G 2E5TA 5G1SA 1SQBD 1URQD 3LW5H 1NU1K 1YTZI 2IFMA 3B5NC 1PGOA 1NTZE 1PV3A 4XE5B 3TYYA 1VQ7P 2J5II 1VQOP 5FIFA 1VQKP 1P84D 4JCSA 1NTMD 3H0QA 1SQQE 1XTGB 3BASA 2Y9ZA 5JBXA 2E42A 2P67A 2QE7H 4UB6H 2E76C 2F9YA 1PP9E 2N1TD 1MFZA 2O01J 3C8VA 2IFNA 1NTKE 3KZIH 3BF0A 3M9BA 4JVTA 3CCQP 2HODB 2A06G 3KTHA 5KLVK 5AVUB 1IFDA 3PTZA 2PP6A 5DZKA 3KHUA 1IFPA 3TLFA 1JUNA 2LR2A 2QJPC 1LWUA 3K50A 1S72P 1PP9J 1SFCA 2F6IA 2YJGA 5APVA 5APQA 2D3TA 1NTMG 1PGJA 1PPJE 3L35A 2XZRA 3IN6A 2M0BA 4K29A 2V7QJ 5E0SH 1FC7A 3OW2O 2ZL0A 3CC2P 1JY2P 1IFIA 3VOPA 5KAIH 4RYFH 1U7MA 3MP7B 5IKLB 5TJHA 2OYIC 1LTBC 2JJLA 1Y9BA 1NJIQ 4H13C 3H0UA 1IC2A 2KK7A 4HC8A 1SFCD 1JY3N 1MV8A 2E5YA 2QM8A 4R4LA 3L73D 2RH0A 3F5HA 4OGQD 1W2EA 3VIVA 1NTKK 4RCNA 1SQPJ 1QX8A 3H02A 2P58A 5E79E 2PPYA 4JBZA 2ZVOB 1LNQA 3H32B 1S9KE 1N7SD 4L73A 1EZVE 3L74D 2YIUC 2E76D 3BRTB 3RL0B 2V7QH 4IOIH 1M7LA 4JF7A 1HF9A 2KI7B 4FN7A 2GTRA 1XX4A 2FYNC 3L71G 4JQ0D 2PGDA 2KNCB 4HH2A 4ELXA 4JFCA 1NAYA 1FE6A 3L75J 2HPCB 3FDUA 1SQPK 1SQXD 2FBMA 1RJMA 3D6ZA 4WZ8B 3U1CA 1SFCB 5DTPA 1SQBK 1XNYA 2Z5IA 1JXZA 3E1RA 3CCEP 4PD4I 1QGKB 4I7ZC 1BCCG 3OC7A 3HP0A 1U57A 1LP1B 1JB0J 2NPSC 5DU4A 1SQQG 1EF8A 4WB4A 2Y9YA 4IFMA 3R2PA 4H0LD 1BSHA 3M9QA 4WY4B 3K5BA 3FXEA 4J2UA 1N7SB 1KB9I 2BASA 3Q3DA 4XA4A 3ZWAA 2WWWA 5B66E 1T6AA 2B87B 5HUQA 3SWFA 5KJ7C 3VMXA 3RK2B 3NTNA 5H2FE 2R32A 4I4ZA 5AVSB 4D6TD 1EDJA 4PD4D 1BE3E 2LXCB 4U19A 2OTLP 3TRRA 4XFJA 2Q9IA 1NTKJ 3H1KE 2Q35A 3H1LE 3PRJA 3H1HG 3II6A 1IZNB 3H1HJ 5KKZB 1HGVA 3G3ZA 2ZL3A 3KTKA 2OTKE 4ASVA 1WRGA 3A5TA 1L0NE 4L6WA 1K39A 3CXHE 1A02F 1K9MQ 1IK9A 2WPVB 1QL2A 3VTPC 2JKVA 2KS1B 1QEXA 1T8ZA 4GIFA 3FXDA 2KLUA 2QJKB 2WSEJ 3VN0A 5CJ0A 1SVFA 1NTZD 1BDDA 1UIIA 2WZ7A 2IBZE 3Q1MA 1YG6A 2G3AA 2QRXA 1RHZB 1WDLA 2HFED 3E7KA 2VSSA 1M56D 1FZCA 3OA7A 3QH9A 1LP1A 3SLLA 2ZXEB 3Q0GA 3RGUA 3B5NA 1HVVA 2J5UA 2O1KA 1JMMA 3L75G 1UIYA 3NJDA 4OVNF 1FCFA 1SQXE 2ZAEB 2BCCJ 2QEXP 1N8RQ 1ZP0C 3IFMA 3O6QB 3IBBA 2A7KA 4YXDC 4D6TJ 2FYUJ 3EQ2A 3BATA 2UWJE 1X0TA 1EZVD 4EMPA 1PZQA 3LW5J 4KPKA 1PPJD 4N3YB 1L4AA 5KAIE 4IL6E 1SQXJ 5KLIB 3BCCG 4C46A 5DU6A 5DKPA 3KDPB 2XV5A 3R9QA 1VQMP 1KB9H 1EDIA 3P8MC 4IZDA 2YMKA 4U3FJ 2PAJA 3I5CA 1PL5A 3TSIA 2QJYB 1DEBA 1EF9A 3ZWBA 3L71E 3CCJP 3OJAB 4RYFA 2OTJP 5E79H 1N7LA 2RKLA 2POHA 1KFMA 2O1JA 3TGUJ 3TF5A 1FZGA 1GMJA 4U0GH 2ZT9B 1BCCD 4JCRA 2AXTH 2QVAA 4IL6H 2P1JA 3QXIA 3BEZA 4K3WA 4MXIA 1HWTC 4JOTA 5AW4B 3QKAA 5KDRB 2OGUA 4YLHA 3HTKA 4DZOA 3RSTA 1NWQA 5INFA 2FXPA 2YXQB 4ZNCA 2VSSE 4MOUA 2QM7A 3B71A 5KLVJ 3C9IA 3SSUA 5CCGD 1J1DB 3L73J 1JCDA 2YNYA 5KAFE 5KJPA 2VX2A 2WMMA 3WMM0 3JU1A 4C7NB 2PG8A 3HE5B 4UB8E 1EXJA 1RJNA 2M3EA 1LTSC 1J7XA 4EOTA 1OW7A 1GU4A 3WG5A 2FYUG 1UYSA 2YIUB 3RL0C 3M6NA 3FF6A 1L0LD 2ZT9D 1SLQA 2ZYDA 2KP8A 2Z5HA 5B66H 5KAFH 2FKWB 4HB1A 1P84H 4U3FE 3L70D 3H1LJ 3CWBJ 2ZVNB 3P7KA 1FU1A 3LIEA 2YKPA 1BSNA 2I1JA 2JWAA 3KXDA 2JEEA 3EFGA 2Q3EA 3L71J 3KTIA 2CE3A 1GW4A 4LK5A 4U1AA 2YKQA 4ZKPA 2FYUD 3E1IA 1HTLC 1P84E 4I7ZB 1L2PA 1KMIZ 3H1ID 4IZCA 1JTHB 1USDA 3EFFK 1JM0A 3L73E 5DJUB 3S4RA 4B3JA 1GW3A 3QMJA 3H81A 1ZLLA 5GTHH 1W5CE 3HUSB 4ASIA 4NPEA 3EWKA 1H89A 4NARA 1M8OB 1BGYJ 2XDJA 1Q7YQ 1JY2N 3R4YA 3CWBE 1GL2B 5CHXA 3N4XA 1KFNA 2NPSD 2Q6QA 2YO3A 1EC5A 1HBWA 3AE2C 2YKOA 2L91A 3HLN1 2FY8A 1OMIA 4NPFX 1FDOA 1SP4A 2FFDC 4I2LC 4B86A 1Y8AA 5C39A 2RN0A 1NU1D 1JY3P 3GHGB 1L0LK 3CI9A 1FZCB 1GDTA 2PRRA 1JCCA 1KILB 1XNVA 4FN8A 1LT1A 3AE6C 3T3WA 1T3UA 2P7JA 1WZ8A 1AVYA 1RE4C 3RK3B 2WSCJ 3O6QA 3HD7B 2KNCA 1SQPE 3D71A 1TYFA 3Q2YA 3CX5I 1G2CA 2W90A 1FJKA 1N7SC 1USEA 3QWOC 4N6JA 1SQQK 1S9KD 1GL2D 3W67A 1GK4A 1NTZK 2C0XA 3H6PA 3JSVC 3T97A 3D70A 2M5AA 1ZN5A 3MD0A 5CBNA 4HYTB 5AVWB 2BEQD 1YQ4C 1DUBA 3MYBA 2C9LY 3HE4B 3H1JE 5E0SA 2NRGA 5APTA 2F9YB 3L70J 1KYOI 5G1QA 4ZDFA 2UZFA 3R0OA 2A7SA 5KTBA 1FOSF 2E75D 3L72E 1AJYA 1AVOA 1M1JB 1RQUA 3U9RB 4EI2A 4RKUJ 4I52A 4NEKA 2KIKA 4U18A 3ST9A 1NH4A 1EY3A 1SQVJ 1YITP 5AW1B 3ABVC 4H44D 4AYCA 3AE3C 3Q5SA 3CC4P 2NP9A 2F9IB 2CPBA 3C1LA 3HTKB 1UIXA 1NVOA 1LWUB 1PJHA 1KQGB 4H13D 3W68A 2Q1KA 2Y0DA 3ZW9A 4ZMDA 1N73C 3Q5RA 3H1JD 1RF0A 2F6QA 1SZOA 3S9OA 5AW8B 4MI2A 3IR9A 5GTIH 3V2RA 5M1BA 3FX0A 2WSEH 3TZ3A 2NZ2A 2WQYC 2KZIA 1SQXK 1VF5D 2GUVA 4PJ0H 5APXA 1RE3C 1CW5A 3AEAC 2ZT9C 2Q7CA 2JP3A 3V5BA 1OVRA 3TNUB 1ZRTE 3RBXA 3CCVP 5AVYB 4Z0MA 2K37A 3JCUH 2JO1A 5FUSA 1KTMA 1VQ4P 3KPEA 1T2KC 3G9RA 5GTIE 4L75A 1U7JA 2A06E 2Q3IA 1FZCC 1EXIA 5BVZA 1BGYE 5G1RA 1GTWA 4ELWA 1LJ2A 5AW2B 4I42A 3KTJA 4YTPC 1CI6B 3N7NA 1PP9D 2R5BA
chains in the Genus database with same CATH topology
5KDRA 3SFDC 5DL1A 2OQQA 5JBWA 5DZKH 4JJTA 3RL0g 5DU6A 3FGAD 5DKPA 3AE5C 4OGQB 3R9QA 4ZU2A 3M6MA 4ZDBA 1ZMEC 4IZDA 2YMKA 2MKVA 3QREA 1KQFB 2QIWA 2VSUC 1PL5A 3HINA 3AEEC 1EF9A 2QSIA 3ZWBA 2WTBA 3PEAA 4PV1C 2D2CD 3K8XA 4FZWA 4FB8A 3Q1TA 3I47A 4RYFA 4EMMA 1R8EA 4Y28J 3AEFC 3HE2A 4FZWC 3GLMA 3TVUA 1VL2A 5INGA 5INIA 5E0NX 2D2CC 5CTBA 1HNUA 5CTCA 4PV1D 5DUFA 1GMJA 3GKBA 4ZDEA 4U0GH 3T8AA 1S5LX 2ZT9B 1K32A 3SWXA 4JCRA 3R9TA 3QXIA 3LAOA 3ISAA 3BEZA 4K3WA 4MXIA 1UYRA 4JOTA 1SG4A 3QKAA 5KDRB 2E75C 4Z1MH 3ZWCA 4YLHA 5L8RJ 3RSTA 1FC9A 2H89C 2W3PA 5DTWA 1X0UA 5INFA 2FXPA 4EMLA 1XO6A 2VSSE 1N6EA 4MOUA 3B71A 1K04A 1DD4A 3MOYA 2FZSA 4KPKA 3QWDA 2ZQRA 3P5MA 1FC6A 1KILE 3BPPA 4G2RA 4NNQA 5MGBA 2VSUE 1TU3F 5KJPA 5G1SA 2VX2A 1RQVA 3JU1A 1HNOA 3TVWA 2PG8A 1Y7OA 1N6FA 1EXJA 1RJNA 4DI1A 1J7XA 2F9IA 3P2LA 1PV3A 4ZDDA 1OW7A 4U0GA 3WG5A 1UYSA 3TT6A 2J5II 1NGMB 1VRGA 5FIFA 3M6NA 3FF6A 2ZT9D 4JCSA 3AEGC 3QYRA 3H0QA 2FBWC 2J5IB 4GM2A 4WCZA 5JBXA 1UYTA 3TT7A 3Q0JA 4KT0J 2BZRA 2E76C 2DUBA 1NYHA 2F9YA 1N6DA 4L8KA 2O01J 3C8VA 4R4MA 3R9SA 3BF0A 2E76B 3U9SB 4QIJA 3T89A 4JVTA 4Q0GA 2J5SA 1YQ3C 4U7JA 3KTIA 3KTHA 3H0JA 2CE3A 2FW2A 3P85A 4LK5A 4OLQA 4U1AA 3OMEA 3GF3A 2J5GD 1OD4A 5DZKA 2VSUA 4I7ZB 3TLFA 4FNDA 1KMIZ 4IZCA 2QJPC 2A81A 3K50A 1Q51A 2F6IA 2YJGA 1Q90D 1WMKA 2BEZF 4IL6X 1W2XA 2D3TA 4B3JA 3G64A 3QMJA 3H81A 3T97B 3IN6A 4K29A 2V7QJ 3L3SA 5E0SH 4ASIA 5C90A 1FC7A 2ZL0A 3EWKA 2Q34A 4JCTA 4NARA 4RYFH 1IK7A 3GF7A 1DIPA 3AEDC 4JCQA 1NZYB 3R4YA 5IKLB 4IZBA 1Y9BA 4FJWD 4H13C 3H0UA 4HC8A 4H0LC 3AE4C 1XNWA 1VF5C 3AE2C 4R4LA 1MJ3A 4OGQD 3HLN1 4JYLA 2VSUF 3VIVA 1OMIA 1FDOA 2WSFJ 2QQ3A 4RCNA 3H02A 3MT6A 1YG8A 5DUCA 2PPYA 2E74C 1WDKA 1DD3A 2D2CB 4OMRA 1XNVA 4FN8A 5C9GA 2YIUC 2E76D 3AE6C 3LKEA 3T3WA 1HF9A 3IB9A 4OGQC 4FN7A 2GTRA 1XX4A 1WZ8A 2ZQQA 4PV1B 2FYNC 4KNPA 2WSCJ 3O6QA 3AE9C 3AE7C 3AECC 3ZW8A 2QJYC 1UYVA 3D71A 1TYFA 4JFCA 4ELXA 3Q2YA 1Q52A 4Q1IA 3R6HA 4H44C 2ZL4A 5KKZC 2HW5A 2ZL2A 3FDUA 3AEBC 2FBMA 2E74D 3BPTA 1RJMA 3PGQA 3D6ZA 4WZ8B 1DCIA 4H13B 5DTPA 3DORA 3D70A 1XNYA 1JXZA 3N6RB 1KORA 3D6YA 4I7ZC 3OC7A 3HP0A 2BEQD 1U57A 1YQ4C 2CBYA 1DUBA 1JB0J 2J5IA 5DU4A 5DU8A 1EF8A 3MYBA 2PBPA 3IAOA 3PZKA 3KQFA 3RK3E 3U9TB 5E0SA 2F9YB 3QXZA 4H0LD 3DJAA 3T8BA 4QFEA 1ZOYC 3KTGA 4J2UA 1NZYA 3Q3DA 5G1QA 4ZDFA 3OT6A 3QK8A 2IEXA 2UZFA 3ZWAA 3R0OA 2A7SA 2E75D 1AJYA 1VF5B 3SFEC 5HUQA 2J5GA 4ELSA 1FDIA 1RQUA 3U9RB 2P10A 4RKUJ 4I52A 4NEKA 1PIXA 4U18A 3ST9A 1EY3A 4I4ZA 1MKMA 3ABVC 3PE8A 3AE8C 4U19A 3HRXA 4H44D 2VREA 3TDCA 3AE3C 3Q5SA 3TRRA 2E74B 4XFJA 2NP9A 2F9IB 1UIXA 1OW8A 2Q35A 1HJ0A 1PJHA 1KQGB 4H13D 3RSIA 4WYOB 2ZL3A 3KTKA 3ZW9A 2QJKC 2K9YA 4TT3H 4FNBA 3Q5RA 3GMAA 2F6QA 1K39A 4L6WA 2C8TA 3MFMA 1SZOA 4JWVA 1OD2A 3AE1C 3S9OA 3Q7HA 4MI2A 2IDBA 1K05A 3V5EA 4HNKA 2G8YA 3STAA 4KWBA 2WPVB 1ON9A 2VSSF 1OW6A 5M1BA 2H88C 4QIIA 4ZDCA 3H0SA 3TZ3A 2NZ2A 2WQYC 2E75B 1VF5D 2WSEJ 2DEOA 3IAVA 4KD6A 4K2NA 3AEAC 2ZT9C 3Q1MA 3T88A 1YG6A 2G3AA 3V5IA 1WDLA 4B3HA 2JP3A 1TG6A 2VSSA 5KLIC 4F47A 4HDTA 4U0HA 3NJBA 3SLLA 1ZRTE 3Q0GA 1S1CX 4H0LB 4JYJA 4JSBA 4GDOA 1O8UA 4Z0MA 2JO1A 2X58A 2J5UA 3NJDA 1UIYA 5FUSA 4B3IA 1FCFA 1KTMA 1ZP0C 3G9RA 3IBBA 2EJ5A 2A7KA 4YXDC 1EXIA 4OG1A 5G1RA 1WDMA 3Q5PA 2X24A 4ELWA 4I42A 4GHNA 3KTJA 2Q2XA 3RRVA 4YTPC 1HZDA 4H44B 3TV5A 4EMPA 3H25A 3LW5J 1ON3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KDR A;  5DL1 A;  5JBW A;  5DZK H;  4JJT A;  5DU6 A;  5DKP A;  3R9Q A;  4ZU2 A;  3M6M A;  4ZDB A;  4IZD A;  3QRE A;  2VSU C;  3HIN A;  1EF9 A;  3ZWB A;  2WTB A;  3PEA A;  3K8X A;  4FZW A;  4FB8 A;  3Q1T A;  3I47 A;  4RYF A;  4EMM A;  3HE2 A;  4FZW C;  3GLM A;  3TVU A;  5ING A;  5INI A;  5E0N X;  5CTB A;  1HNU A;  5CTC A;  5DUF A;  3GKB A;  4ZDE A;  4U0G H;  3T8A A;  1K32 A;  3SWX A;  4JCR A;  3R9T A;  3QXI A;  3LAO A;  3ISA A;  3BEZ A;  4K3W A;  4MXI A;  1UYR A;  4JOT A;  1SG4 A;  3QKA A;  5KDR B;  3ZWC A;  4YLH A;  3RST A;  1FC9 A;  5DTW A;  2W3P A;  1X0U A;  5INF A;  4EML A;  1XO6 A;  2VSS E;  1N6E A;  4MOU A;  3MOY A;  2FZS A;  3QWD A;  2ZQR A;  3P5M A;  1FC6 A;  3BPP A;  4G2R A;  4NNQ A;  5MGB A;  2VSU E;  5KJP A;  5G1S A;  2VX2 A;  3JU1 A;  1HNO A;  3TVW A;  2PG8 A;  1Y7O A;  1N6F A;  4DI1 A;  1RJN A;  1J7X A;  2F9I A;  3P2L A;  4ZDD A;  4U0G A;  3WG5 A;  1UYS A;  3TT6 A;  2J5I I;  1VRG A;  5FIF A;  3M6N A;  3FF6 A;  4JCS A;  3QYR A;  3H0Q A;  2J5I B;  4GM2 A;  4WCZ A;  5JBX A;  1ON3 A;  1UYT A;  3TT7 A;  3Q0J A;  2BZR A;  2DUB A;  2F9Y A;  1N6D A;  4L8K A;  3R9S A;  3BF0 A;  3U9S B;  4QIJ A;  3T89 A;  4JVT A;  4Q0G A;  2J5S A;  3KTH A;  3KTI A;  3H0J A;  2CE3 A;  2FW2 A;  3P85 A;  4LK5 A;  4OLQ A;  4U1A A;  3OME A;  3GF3 A;  2J5G D;  1OD4 A;  5DZK A;  2VSU A;  3TLF A;  4FND A;  4IZC A;  2A81 A;  3K50 A;  1Q51 A;  2F6I A;  1W2X A;  2D3T A;  4B3J A;  3G64 A;  3QMJ A;  3H81 A;  4K29 A;  3L3S A;  5E0S H;  4ASI A;  5C90 A;  1FC7 A;  2ZL0 A;  2Q34 A;  4JCT A;  4RYF H;  3GF7 A;  4JCQ A;  1NZY B;  5IKL B;  4IZB A;  4FJW D;  3H0U A;  4HC8 A;  1XNW A;  1MJ3 A;  3HLN 1;  4JYL A;  2VSU F;  3VIV A;  2QQ3 A;  4RCN A;  3H02 A;  3MT6 A;  1YG8 A;  5DUC A;  2PPY A;  1WDK A;  4OMR A;  1XNV A;  4FN8 A;  5C9G A;  3LKE A;  3T3W A;  3IB9 A;  4FN7 A;  2GTR A;  1XX4 A;  1WZ8 A;  2ZQQ A;  4KNP A;  3ZW8 A;  1UYV A;  1TYF A;  4ELX A;  4JFC A;  4Q1I A;  1Q52 A;  3R6H A;  2ZL4 A;  2HW5 A;  2ZL2 A;  3FDU A;  2FBM A;  3PGQ A;  1RJM A;  4WZ8 B;  1DCI A;  5DTP A;  3DOR A;  1XNY A;  1JXZ A;  3N6R B;  3OC7 A;  3HP0 A;  2CBY A;  1DUB A;  2J5I A;  5DU4 A;  5DU8 A;  1EF8 A;  2PBP A;  3MYB A;  3PZK A;  3KQF A;  3U9T B;  5E0S A;  2F9Y B;  3QXZ A;  3DJA A;  3T8B A;  4QFE A;  3KTG A;  1NZY A;  5G1Q A;  4ZDF A;  3OT6 A;  3QK8 A;  2IEX A;  2UZF A;  3ZWA A;  3R0O A;  2A7S A;  2J5G A;  4ELS A;  3U9R B;  4I52 A;  4NEK A;  1PIX A;  4U18 A;  3ST9 A;  1EY3 A;  4I4Z A;  3PE8 A;  4U19 A;  3HRX A;  2VRE A;  3TDC A;  3TRR A;  2NP9 A;  2F9I B;  2Q35 A;  1PJH A;  3RSI A;  4WYO B;  2ZL3 A;  3KTK A;  3ZW9 A;  4FNB A;  3GMA A;  2F6Q A;  1K39 A;  4L6W A;  2C8T A;  3MFM A;  1SZO A;  4JWV A;  1OD2 A;  3Q7H A;  4MI2 A;  3V5E A;  4HNK A;  3STA A;  4KWB A;  1ON9 A;  2VSS F;  4QII A;  4ZDC A;  3H0S A;  3TZ3 A;  2DEO A;  3IAV A;  4KD6 A;  4K2N A;  3T88 A;  1YG6 A;  3V5I A;  1WDL A;  4B3H A;  1TG6 A;  2VSS A;  4F47 A;  4U0H A;  3NJB A;  3SLL A;  3Q0G A;  4JYJ A;  4JSB A;  1O8U A;  4Z0M A;  2X58 A;  3NJD A;  1UIY A;  5FUS A;  4B3I A;  1FCF A;  3IBB A;  2EJ5 A;  2A7K A;  4OG1 A;  5G1R A;  1WDM A;  2X24 A;  4ELW A;  4I42 A;  4GHN A;  3KTJ A;  2Q2X A;  3RRV A;  1HZD A;  3TV5 A;  4EMP A;  4KPK A; 
#chains in the Genus database with same CATH topology
 1J1D C;  3SFD C;  2OQQ A;  1KN7 A;  1KZU B;  5DZK H;  2XU6 A;  4JJT A;  4K35 A;  3FGA D;  3A3Y B;  2BCC E;  4JYB A;  1URQ C;  1JY3 O;  1ZME C;  2QIW A;  3HIN A;  3AEE C;  1GZL A;  1SQX G;  1KIL D;  1CZQ A;  1M57 D;  4Y99 C;  1VQN P;  3Q1T A;  1Q2N A;  3I47 A;  2HPC A;  2FYU K;  2M8R A;  1KQL A;  4Y28 J;  3GLM A;  4W7Y A;  2VRS A;  2N9B A;  2WPR A;  2IZ1 A;  1NU1 E;  1NTZ J;  2HOD A;  4ZDE A;  3F89 A;  3CCL P;  1K32 A;  1GU5 A;  2ZJS E;  3H1K J;  1A02 J;  2AEJ A;  3L73 G;  3MUD A;  3L74 G;  1LTA C;  1NTM E;  2WSC H;  2P2U A;  5APY A;  4RES B;  4BRY B;  3H1L G;  1IFJ A;  1GK6 A;  1S2E A;  1LGH B;  2H89 C;  1VQP P;  5H2F H;  3RBZ A;  3A0H E;  3USS A;  1XO6 A;  3WUV A;  3M0A A;  3PLN A;  3MOY A;  3RK2 D;  3QWD A;  2ZQR A;  3P5M A;  1FC6 A;  1NOH A;  1LTI C;  3BPP A;  2KSE A;  2H43 A;  2KS1 A;  4O9B A;  2AXC A;  1RQV A;  4PD4 H;  2R44 A;  1HNO A;  3TVW A;  1ZRT D;  1Y7O A;  2W6A A;  4DI1 A;  3P2L A;  2DW3 A;  2NPS B;  1L0L G;  2FYU E;  1YBK A;  5AVV B;  5TIS E;  4ZDD A;  2J59 M;  4U0G A;  2C9N Y;  1NGM B;  1VRG A;  2OYI A;  3M0D C;  1JEK A;  1FZA A;  2A06 D;  2J5I B;  4GM2 A;  4WCZ A;  1Z56 A;  3MIW A;  1YI2 P;  1QVG O;  3NFQ A;  2AEM A;  1N73 A;  4PD4 E;  3G4S P;  3JCU E;  2DUB A;  1NYH A;  4L8K A;  4R4M A;  2A45 I;  1AQ5 A;  3CCR P;  4QIJ A;  3WU2 E;  3T89 A;  4U7J A;  3H0J A;  1NKZ B;  3RK3 D;  2J5G D;  1OD4 A;  4C7R A;  1L4A B;  1KIL C;  1X9V A;  1OX3 A;  2XNX A;  1Q51 A;  4NPD A;  1WMK A;  3KZI E;  1EQ7 A;  2BEZ F;  1H0T A;  3SWY A;  1Y47 A;  3G64 A;  2OYH C;  2BCC G;  1SQQ J;  4U3F G;  5C90 A;  1YJ9 P;  2KZJ A;  2Q34 A;  2I1K A;  1Q86 Q;  3PJS K;  3CXH H;  5KJ7 D;  1IK7 A;  1L0N G;  1DIP A;  3AED C;  4JCQ A;  5AW9 B;  2Z4E A;  1HJB A;  3CLQ A;  3CWB G;  1OXZ A;  1N7S A;  4H0L C;  3AE4 C;  1XNW A;  2IX7 C;  1MJ3 A;  4JYL A;  3O8Z A;  1MUU A;  1L0L E;  2WSF J;  1IO4 A;  1XTC C;  3CX5 E;  2FYZ A;  1EZV I;  3MT6 A;  2K9J A;  3BCC E;  3V2P A;  1YG8 A;  3A2A A;  1E5W A;  2FFD A;  1FS0 E;  2IBZ G;  1VQ8 P;  1J1E B;  1FBM A;  2E74 C;  1KC8 Q;  5KLV G;  1J2J B;  1DD3 A;  4W80 A;  3TDK A;  1JNM A;  1BCC E;  1L4A D;  2GA1 A;  4WY4 A;  5C9G A;  2K3R A;  3LKE A;  1SQB E;  4OGQ C;  1Q82 Q;  1SFC C;  3MZW B;  3S1K A;  1SQP G;  3AEC C;  3ZW8 A;  1RE4 A;  1UYV A;  3MTU E;  3R6H A;  1BGY G;  1OFC X;  2KUB A;  2ZL4 A;  2PFX A;  2HW5 A;  2ZL2 A;  2A45 G;  3AEB C;  3BPT A;  1YYC A;  1LT9 B;  1DCI A;  4BWN A;  3H1K D;  2FYN B;  1ZV8 A;  1FJP A;  3DOR A;  3HE5 A;  2CK3 H;  2M5A B;  3CX5 D;  1KOR A;  3D6Y A;  3BRV B;  2A45 H;  3PH0 A;  1OVU A;  1LT9 C;  4EDF A;  3G6E P;  1S5L H;  1SQV G;  5DU8 A;  2PBP A;  3KQF A;  3RK3 E;  3U9T B;  1W2B O;  1KV4 A;  2H7H A;  1OVV A;  1NTK G;  4UB6 E;  3T8B A;  1ZOY C;  3KTG A;  1PP9 G;  3TGU E;  2RMZ A;  3OT6 A;  2IEX A;  3BCC J;  1PFI A;  2SPZ A;  1VF5 B;  3A0B E;  2J5G A;  4ELS A;  3H1J J;  2P10 A;  2HYN A;  1PIX A;  4GOF A;  5CCG C;  3IF4 A;  3PE8 A;  3VP8 A;  3H32 A;  3AE8 C;  2K9J B;  4OWF A;  3HRX A;  2VRE A;  2LXB A;  2E74 B;  3B5N B;  3L4F A;  3P8C D;  1OW8 A;  4DJG A;  1PPJ G;  5DJT B;  3H1I E;  1M1K Q;  2KYV A;  2OYH B;  3A0B H;  3SWK A;  1EZV G;  3RSI A;  1SQV E;  1HH0 A;  4ASW A;  2W8Z A;  4LC1 A;  1BCC J;  3H1J G;  4WVZ A;  2QJK C;  4W7Z A;  2K9Y A;  4TT3 H;  3GMA A;  3KYQ A;  3L72 D;  2C8T A;  1L4A C;  3MFM A;  4JWV A;  3AE1 C;  3Q7H A;  1ZW0 A;  1BDC A;  4A7P A;  1S3J A;  2IDB A;  1K05 A;  3V5E A;  3TGU D;  3STA A;  1FC2 C;  4KWB A;  1ON9 A;  2VSS F;  1OW6 A;  3M91 A;  4QII A;  4ZDC A;  2N1T C;  2WTY A;  1Q81 Q;  1OWA A;  3L70 E;  3I56 P;  1OZH A;  2DEO A;  1IFM A;  3IAV A;  5CCH A;  1YJW P;  4KD6 A;  1LTJ C;  5AVT B;  4K2N A;  3T88 A;  1HGZ A;  3L72 J;  3V5I A;  4N78 D;  1TG6 A;  4U0H A;  1VQ9 P;  2QJP B;  3NJB A;  5KJ7 A;  3P8C E;  4H0L B;  3GHG A;  1QLE D;  1O8U A;  4WY4 D;  3CL3 D;  2ZFC A;  4I6M C;  3B5N D;  2E43 A;  3CPW O;  4B3I A;  3L36 A;  3TGU G;  1X22 A;  1FZE A;  1SQP D;  3HD7 A;  2R3C A;  3M0D A;  3BVH A;  2EJ5 A;  3L72 G;  1P84 I;  2H8P D;  2WPS A;  2O01 N;  2X24 A;  4GHN A;  2R5D A;  2Q2X A;  3RRV A;  2WVR A;  1CI6 A;  1FZB A;  3TV5 A;  1NHL A;  5KDR A;  2QA4 P;  4WWI A;  1JMB A;  2JDI H;  1X79 B;  2B89 A;  2O01 H;  1L0L J;  4GOE A;  5CBO A;  1SQV K;  3AE5 C;  3CD6 P;  1VQ5 P;  3V4Q A;  5BU5 A;  1X8Y A;  1K8A Q;  2OYH A;  2MKV A;  1KQF B;  2HG5 D;  5B5E E;  1DX7 A;  3UIA A;  3VMA A;  2WTB A;  4AQR D;  4PV1 C;  1PGQ A;  1EDK A;  3K8X A;  1K73 Q;  4FZW A;  4FB8 A;  4EMM A;  3AEF C;  3HE2 A;  1URQ A;  1L0N K;  1KYO D;  1VL2 A;  2IPP A;  5INI A;  1MFT A;  2D2C C;  1RF1 C;  1KB9 E;  1CSB A;  1NU1 G;  3FWL A;  5DUF A;  1NU1 J;  5B5E H;  3T8A A;  1S5L X;  5AVR B;  2N9Y B;  4LLH A;  1LTJ B;  2BCC D;  3SWX A;  4JYC A;  2Y0E A;  2OAR A;  1N86 A;  3L74 J;  1L0N J;  1SG4 A;  3H1K G;  2E75 C;  4Z1M H;  3ZWC A;  2W83 C;  1IJD B;  5L8R J;  1FC9 A;  5AW0 B;  2W3P A;  1X0U A;  1KQS O;  2WPQ A;  3M06 A;  4EML A;  1BGY D;  1G1I A;  1HUC A;  4D6T E;  2JWD A;  2AXT E;  3HUS A;  4RJT A;  2WT7 A;  2FZS A;  1BE3 J;  1QVF O;  3L71 D;  4G2R A;  2R3S A;  4NNQ A;  5MGB A;  4WY4 C;  3CXH I;  2IBZ I;  2ZYA A;  1S5L E;  2QG4 A;  1N6F A;  3JC2 2;  1GL2 A;  2F9I A;  1H88 A;  1FAV A;  4LGD E;  1R5S A;  1RF0 C;  2W6B A;  3TT6 A;  1NAF A;  5AVX B;  1YIJ P;  2OYI B;  1GD2 E;  3AEG C;  3QYR A;  2FBW C;  1JO5 A;  3ITK A;  2B9B A;  4IFF A;  1UYT A;  3Q0J A;  3TT7 A;  1AV1 A;  4KT0 J;  1SQB G;  4PJ0 E;  2KB7 P;  2BZR A;  2ZXX A;  3H1I J;  1N6D A;  2GUS A;  1FDM A;  3CWB D;  1S4X A;  3R9S A;  2E76 B;  3U9S B;  4Q0G A;  2J5S A;  3V2N A;  1YQ3 C;  1ZR4 A;  1MZ9 A;  2FW2 A;  3P85 A;  4OLQ A;  3OME A;  4IFD K;  3GF3 A;  1SS1 A;  3V2Q A;  5AW6 B;  2VSU A;  2XND H;  1G1J A;  4FND A;  1LTJ A;  3VYI A;  3H1L D;  1H8A A;  2A81 A;  4DOJ A;  1KIL A;  1N2D C;  1Q90 D;  4IL6 X;  1W2X A;  1YJN P;  1T2K D;  4EYY Q;  3T97 B;  3L3S A;  3M9H A;  3WUT A;  3U59 A;  5CCH D;  4JPZ B;  4JCT A;  1AA0 A;  1LTT C;  3HD7 C;  3GF7 A;  2WT7 B;  1NZY B;  1WT6 A;  3CXH D;  5EFW B;  2FXM A;  3CC7 P;  4HKZ H;  4IZB A;  1R5L A;  4FJW D;  5BU8 B;  2IYO A;  2WSF H;  3PP5 A;  3L37 A;  1VF5 C;  4GOD A;  2KXP B;  2VSU F;  1QL1 A;  3V4W A;  5AW7 B;  5APU A;  3VMY A;  2QQ3 A;  1M1J A;  3KQG A;  2FFD B;  2O3J A;  3FWN A;  1LWU C;  4CPG A;  5CMZ A;  5DUC A;  5APW A;  1WDK A;  1RF1 B;  2D2C B;  2N1T A;  4RO0 A;  2OYO A;  4OMR A;  3LID A;  1KB9 D;  3WUU A;  1RH5 B;  3L75 E;  2KLV A;  3IB9 A;  3MHV A;  4I1L A;  4K3A A;  2ZQQ A;  4PV1 B;  4KNP A;  3MUD C;  3AE9 C;  3AE7 C;  2QJY C;  4Q1I A;  1Q52 A;  2HR3 A;  1VQ6 P;  4H44 C;  5KKZ C;  2I8D A;  5CCG A;  5AVZ B;  3A0H H;  3BCC D;  5AW5 B;  3CCU P;  2E74 D;  3PGQ A;  4MN4 C;  4UB8 H;  4BRY A;  1NKN A;  4H13 B;  1PGP A;  2L5G B;  3CMA P;  3N6R B;  1BE3 D;  3MGN A;  3I55 P;  4M3L A;  2CBY A;  2J5I A;  4BXL A;  3PZK A;  3IAO A;  1N73 B;  2YXR B;  1D7M A;  1EDL A;  4GKG A;  4ZKU A;  3QXZ A;  3VP9 A;  1NO4 A;  3DJA A;  4QFE A;  3L75 D;  1FOS E;  1NZY A;  1RE3 A;  3B4S A;  2IYP A;  3QK8 A;  1JY2 O;  3NXS A;  1KYO E;  1IFN A;  5AW3 B;  2B87 A;  2KOG A;  3HD7 D;  3SFE C;  1FDI A;  2YO2 A;  1GL2 C;  2XKM A;  5CCH C;  1NTZ G;  2HLO A;  3G71 P;  1MKM A;  1G2C B;  3TNU A;  3WU2 H;  3TDC A;  2IZ0 A;  2Q5U A;  3L74 E;  5KLV E;  3HRN A;  1J1E C;  5AVQ B;  4GT1 A;  1SQB J;  1HJ0 A;  2V4H A;  1VQL P;  1DH3 A;  4WYO B;  5APS A;  2W6J H;  3U1A A;  4FNB A;  1KD1 Q;  3CCS P;  1OD2 A;  3H1H D;  1T3J A;  4C7N A;  4HNK A;  2G8Y A;  3GG2 A;  2H88 C;  3VMZ A;  3H0S A;  1E79 H;  2E75 B;  4L76 A;  2W27 A;  5TIS H;  3HUS C;  1BE3 G;  2Y0C A;  1M90 Q;  4AUW A;  1VPC A;  4DT0 A;  4B3H A;  3HE4 A;  5KLI C;  4F47 A;  2K88 A;  1JTH A;  4HDT A;  1AFO A;  2FXO A;  4QMA A;  2KSJ A;  3RK3 C;  1S1C X;  4EIJ A;  4JYJ A;  4JSB A;  4GDO A;  3GW6 A;  2X58 A;  3CCM P;  3CX5 H;  4Y99 B;  4D6T G;  4L74 A;  1VDF A;  2J58 A;  3RK2 C;  4KHX A;  2ZYG A;  1SQQ D;  4OG1 A;  1WDM A;  3Q5P A;  3GHG C;  5GTH E;  1HZD A;  4H44 B;  1ZXG A;  2LKM A;  3H25 A;  2WIT A;  4N78 E;  1ON3 A;  1NTK D;  5DL1 A;  2AEF A;  3CME P;  5JBW A;  2CPS A;  2ITA A;  3A7O A;  1NTM J;  3ZDM A;  1SQV D;  3RL0 g;  4OGQ B;  4OH8 B;  2NPS A;  4ZU2 A;  4KJM A;  3M6M A;  4ZDB A;  3QRE A;  2VSU C;  2QSI A;  3NMD A;  3PEA A;  1NTM K;  3TK1 A;  2D2C D;  1LTG C;  3B8E B;  1R8E A;  1URQ B;  3V6I A;  3RL0 D;  4FZW C;  1JOC A;  3TVU A;  4DCK A;  2GM4 A;  1YHQ P;  5ING A;  2YMY A;  5KLV D;  5E0N X;  5CTB A;  1LT9 A;  1HNU A;  5CTC A;  4PV1 D;  4TLF A;  2IBZ D;  1KYO H;  1FZF A;  3GKB A;  1DEE G;  2JR8 A;  2WSS H;  2M3B A;  3R9T A;  4YPC A;  3LAO A;  3ISA A;  1UYR A;  2C0W A;  3H1I G;  2N1T B;  1RF1 A;  1AQT A;  3H1H E;  2MJZ A;  5DTW A;  5CJ4 A;  5K5G B;  1H0T B;  3PHL A;  4WBA A;  1L0N D;  3OAK A;  4HJG H;  1M1J C;  1N6E A;  2B88 A;  3P32 A;  4YXW H;  1K04 A;  1DD4 A;  4U3F D;  1RY3 A;  2K1A A;  1KIL E;  1ZR2 A;  2VSU E;  1YTZ T;  1TU3 F;  1OIP A;  3L70 G;  2E5T A;  5G1S A;  1SQB D;  1URQ D;  3LW5 H;  1NU1 K;  1YTZ I;  2IFM A;  3B5N C;  1PGO A;  1NTZ E;  1PV3 A;  4XE5 B;  3TYY A;  1VQ7 P;  2J5I I;  1VQO P;  5FIF A;  1VQK P;  1P84 D;  4JCS A;  1NTM D;  3H0Q A;  1SQQ E;  1XTG B;  3BAS A;  2Y9Z A;  5JBX A;  2E42 A;  2P67 A;  2QE7 H;  4UB6 H;  2E76 C;  2F9Y A;  1PP9 E;  2N1T D;  1MFZ A;  2O01 J;  3C8V A;  2IFN A;  1NTK E;  3KZI H;  3BF0 A;  3M9B A;  4JVT A;  3CCQ P;  2HOD B;  2A06 G;  3KTH A;  5KLV K;  5AVU B;  1IFD A;  3PTZ A;  2PP6 A;  5DZK A;  3KHU A;  1IFP A;  3TLF A;  1JUN A;  2LR2 A;  2QJP C;  1LWU A;  3K50 A;  1S72 P;  1PP9 J;  1SFC A;  2F6I A;  2YJG A;  5APV A;  5APQ A;  2D3T A;  1NTM G;  1PGJ A;  1PPJ E;  3L35 A;  2XZR A;  3IN6 A;  2M0B A;  4K29 A;  2V7Q J;  5E0S H;  1FC7 A;  3OW2 O;  2ZL0 A;  3CC2 P;  1JY2 P;  1IFI A;  3VOP A;  5KAI H;  4RYF H;  1U7M A;  3MP7 B;  5IKL B;  5TJH A;  2OYI C;  1LTB C;  2JJL A;  1Y9B A;  1NJI Q;  4H13 C;  3H0U A;  1IC2 A;  2KK7 A;  4HC8 A;  1SFC D;  1JY3 N;  1MV8 A;  2E5Y A;  2QM8 A;  4R4L A;  3L73 D;  2RH0 A;  3F5H A;  4OGQ D;  1W2E A;  3VIV A;  1NTK K;  4RCN A;  1SQP J;  1QX8 A;  3H02 A;  2P58 A;  5E79 E;  2PPY A;  4JBZ A;  2ZVO B;  1LNQ A;  3H32 B;  1S9K E;  1N7S D;  4L73 A;  1EZV E;  3L74 D;  2YIU C;  2E76 D;  3BRT B;  3RL0 B;  2V7Q H;  4IOI H;  1M7L A;  4JF7 A;  1HF9 A;  2KI7 B;  4FN7 A;  2GTR A;  1XX4 A;  2FYN C;  3L71 G;  4JQ0 D;  2PGD A;  2KNC B;  4HH2 A;  4ELX A;  4JFC A;  1NAY A;  1FE6 A;  3L75 J;  2HPC B;  3FDU A;  1SQP K;  1SQX D;  2FBM A;  1RJM A;  3D6Z A;  4WZ8 B;  3U1C A;  1SFC B;  5DTP A;  1SQB K;  1XNY A;  2Z5I A;  1JXZ A;  3E1R A;  3CCE P;  4PD4 I;  1QGK B;  4I7Z C;  1BCC G;  3OC7 A;  3HP0 A;  1U57 A;  1LP1 B;  1JB0 J;  2NPS C;  5DU4 A;  1SQQ G;  1EF8 A;  4WB4 A;  2Y9Y A;  4IFM A;  3R2P A;  4H0L D;  1BSH A;  3M9Q A;  4WY4 B;  3K5B A;  3FXE A;  4J2U A;  1N7S B;  1KB9 I;  2BAS A;  3Q3D A;  4XA4 A;  3ZWA A;  2WWW A;  5B66 E;  1T6A A;  2B87 B;  5HUQ A;  3SWF A;  5KJ7 C;  3VMX A;  3RK2 B;  3NTN A;  5H2F E;  2R32 A;  4I4Z A;  5AVS B;  4D6T D;  1EDJ A;  4PD4 D;  1BE3 E;  2LXC B;  4U19 A;  2OTL P;  3TRR A;  4XFJ A;  2Q9I A;  1NTK J;  3H1K E;  2Q35 A;  3H1L E;  3PRJ A;  3H1H G;  3II6 A;  1IZN B;  3H1H J;  5KKZ B;  1HGV A;  3G3Z A;  2ZL3 A;  3KTK A;  2OTK E;  4ASV A;  1WRG A;  3A5T A;  1L0N E;  4L6W A;  1K39 A;  3CXH E;  1A02 F;  1K9M Q;  1IK9 A;  2WPV B;  1QL2 A;  3VTP C;  2JKV A;  2KS1 B;  1QEX A;  1T8Z A;  4GIF A;  3FXD A;  2KLU A;  2QJK B;  2WSE J;  3VN0 A;  5CJ0 A;  1SVF A;  1NTZ D;  1BDD A;  1UII A;  2WZ7 A;  2IBZ E;  3Q1M A;  1YG6 A;  2G3A A;  2QRX A;  1RHZ B;  1WDL A;  2HFE D;  3E7K A;  2VSS A;  1M56 D;  1FZC A;  3OA7 A;  3QH9 A;  1LP1 A;  3SLL A;  2ZXE B;  3Q0G A;  3RGU A;  3B5N A;  1HVV A;  2J5U A;  2O1K A;  1JMM A;  3L75 G;  1UIY A;  3NJD A;  4OVN F;  1FCF A;  1SQX E;  2ZAE B;  2BCC J;  2QEX P;  1N8R Q;  1ZP0 C;  3IFM A;  3O6Q B;  3IBB A;  2A7K A;  4YXD C;  4D6T J;  2FYU J;  3EQ2 A;  3BAT A;  2UWJ E;  1X0T A;  1EZV D;  4EMP A;  1PZQ A;  3LW5 J;  4KPK A;  1PPJ D;  4N3Y B;  1L4A A;  5KAI E;  4IL6 E;  1SQX J;  5KLI B;  3BCC G;  4C46 A;  5DU6 A;  5DKP A;  3KDP B;  2XV5 A;  3R9Q A;  1VQM P;  1KB9 H;  1EDI A;  3P8M C;  4IZD A;  2YMK A;  4U3F J;  2PAJ A;  3I5C A;  1PL5 A;  3TSI A;  2QJY B;  1DEB A;  1EF9 A;  3ZWB A;  3L71 E;  3CCJ P;  3OJA B;  4RYF A;  2OTJ P;  5E79 H;  1N7L A;  2RKL A;  2POH A;  1KFM A;  2O1J A;  3TGU J;  3TF5 A;  1FZG A;  1GMJ A;  4U0G H;  2ZT9 B;  1BCC D;  4JCR A;  2AXT H;  2QVA A;  4IL6 H;  2P1J A;  3QXI A;  3BEZ A;  4K3W A;  4MXI A;  1HWT C;  4JOT A;  5AW4 B;  3QKA A;  5KDR B;  2OGU A;  4YLH A;  3HTK A;  4DZO A;  3RST A;  1NWQ A;  5INF A;  2FXP A;  2YXQ B;  4ZNC A;  2VSS E;  4MOU A;  2QM7 A;  3B71 A;  5KLV J;  3C9I A;  3SSU A;  5CCG D;  1J1D B;  3L73 J;  1JCD A;  2YNY A;  5KAF E;  5KJP A;  2VX2 A;  2WMM A;  3WMM 0;  3JU1 A;  4C7N B;  2PG8 A;  3HE5 B;  4UB8 E;  1EXJ A;  1RJN A;  2M3E A;  1LTS C;  1J7X A;  4EOT A;  1OW7 A;  1GU4 A;  3WG5 A;  2FYU G;  1UYS A;  2YIU B;  3RL0 C;  3M6N A;  3FF6 A;  1L0L D;  2ZT9 D;  1SLQ A;  2ZYD A;  2KP8 A;  2Z5H A;  5B66 H;  5KAF H;  2FKW B;  4HB1 A;  1P84 H;  4U3F E;  3L70 D;  3H1L J;  3CWB J;  2ZVN B;  3P7K A;  1FU1 A;  3LIE A;  2YKP A;  1BSN A;  2I1J A;  2JWA A;  3KXD A;  2JEE A;  3EFG A;  2Q3E A;  3L71 J;  3KTI A;  2CE3 A;  1GW4 A;  4LK5 A;  4U1A A;  2YKQ A;  4ZKP A;  2FYU D;  3E1I A;  1HTL C;  1P84 E;  4I7Z B;  1L2P A;  1KMI Z;  3H1I D;  4IZC A;  1JTH B;  1USD A;  3EFF K;  1JM0 A;  3L73 E;  5DJU B;  3S4R A;  4B3J A;  1GW3 A;  3QMJ A;  3H81 A;  1ZLL A;  5GTH H;  1W5C E;  3HUS B;  4ASI A;  4NPE A;  3EWK A;  1H89 A;  4NAR A;  1M8O B;  1BGY J;  2XDJ A;  1Q7Y Q;  1JY2 N;  3R4Y A;  3CWB E;  1GL2 B;  5CHX A;  3N4X A;  1KFN A;  2NPS D;  2Q6Q A;  2YO3 A;  1EC5 A;  1HBW A;  3AE2 C;  2YKO A;  2L91 A;  3HLN 1;  2FY8 A;  1OMI A;  4NPF X;  1FDO A;  1SP4 A;  2FFD C;  4I2L C;  4B86 A;  1Y8A A;  5C39 A;  2RN0 A;  1NU1 D;  1JY3 P;  3GHG B;  1L0L K;  3CI9 A;  1FZC B;  1GDT A;  2PRR A;  1JCC A;  1KIL B;  1XNV A;  4FN8 A;  1LT1 A;  3AE6 C;  3T3W A;  1T3U A;  2P7J A;  1WZ8 A;  1AVY A;  1RE4 C;  3RK3 B;  2WSC J;  3O6Q A;  3HD7 B;  2KNC A;  1SQP E;  3D71 A;  1TYF A;  3Q2Y A;  3CX5 I;  1G2C A;  2W90 A;  1FJK A;  1N7S C;  1USE A;  3QWO C;  4N6J A;  1SQQ K;  1S9K D;  1GL2 D;  3W67 A;  1GK4 A;  1NTZ K;  2C0X A;  3H6P A;  3JSV C;  3T97 A;  3D70 A;  2M5A A;  1ZN5 A;  3MD0 A;  5CBN A;  4HYT B;  5AVW B;  2BEQ D;  1YQ4 C;  1DUB A;  3MYB A;  2C9L Y;  3HE4 B;  3H1J E;  5E0S A;  2NRG A;  5APT A;  2F9Y B;  3L70 J;  1KYO I;  5G1Q A;  4ZDF A;  2UZF A;  3R0O A;  2A7S A;  5KTB A;  1FOS F;  2E75 D;  3L72 E;  1AJY A;  1AVO A;  1M1J B;  1RQU A;  3U9R B;  4EI2 A;  4RKU J;  4I52 A;  4NEK A;  2KIK A;  4U18 A;  3ST9 A;  1NH4 A;  1EY3 A;  1SQV J;  1YIT P;  5AW1 B;  3ABV C;  4H44 D;  4AYC A;  3AE3 C;  3Q5S A;  3CC4 P;  2NP9 A;  2F9I B;  2CPB A;  3C1L A;  3HTK B;  1UIX A;  1NVO A;  1LWU B;  1PJH A;  1KQG B;  4H13 D;  3W68 A;  2Q1K A;  2Y0D A;  3ZW9 A;  4ZMD A;  1N73 C;  3Q5R A;  3H1J D;  1RF0 A;  2F6Q A;  1SZO A;  3S9O A;  5AW8 B;  4MI2 A;  3IR9 A;  5GTI H;  3V2R A;  5M1B A;  3FX0 A;  2WSE H;  3TZ3 A;  2NZ2 A;  2WQY C;  2KZI A;  1SQX K;  1VF5 D;  2GUV A;  4PJ0 H;  5APX A;  1RE3 C;  1CW5 A;  3AEA C;  2ZT9 C;  2Q7C A;  2JP3 A;  3V5B A;  1OVR A;  3TNU B;  1ZRT E;  3RBX A;  3CCV P;  5AVY B;  4Z0M A;  2K37 A;  3JCU H;  2JO1 A;  5FUS A;  1KTM A;  1VQ4 P;  3KPE A;  1T2K C;  3G9R A;  5GTI E;  4L75 A;  1U7J A;  2A06 E;  2Q3I A;  1FZC C;  1EXI A;  5BVZ A;  1BGY E;  5G1R A;  1GTW A;  4ELW A;  1LJ2 A;  5AW2 B;  4I42 A;  3KTJ A;  4YTP C;  1CI6 B;  3N7N A;  1PP9 D;  2R5B A; 
#chains in the Genus database with same CATH homology
 5KDR A;  3SFD C;  5DL1 A;  2OQQ A;  5JBW A;  5DZK H;  4JJT A;  3RL0 g;  5DU6 A;  3FGA D;  5DKP A;  3AE5 C;  4OGQ B;  3R9Q A;  4ZU2 A;  3M6M A;  4ZDB A;  1ZME C;  4IZD A;  2YMK A;  2MKV A;  3QRE A;  1KQF B;  2QIW A;  2VSU C;  1PL5 A;  3HIN A;  3AEE C;  1EF9 A;  2QSI A;  3ZWB A;  2WTB A;  3PEA A;  4PV1 C;  2D2C D;  3K8X A;  4FZW A;  4FB8 A;  3Q1T A;  3I47 A;  4RYF A;  4EMM A;  1R8E A;  4Y28 J;  3AEF C;  3HE2 A;  4FZW C;  3GLM A;  3TVU A;  1VL2 A;  5ING A;  5INI A;  5E0N X;  2D2C C;  5CTB A;  1HNU A;  5CTC A;  4PV1 D;  5DUF A;  1GMJ A;  3GKB A;  4ZDE A;  4U0G H;  3T8A A;  1S5L X;  2ZT9 B;  1K32 A;  3SWX A;  4JCR A;  3R9T A;  3QXI A;  3LAO A;  3ISA A;  3BEZ A;  4K3W A;  4MXI A;  1UYR A;  4JOT A;  1SG4 A;  3QKA A;  5KDR B;  2E75 C;  4Z1M H;  3ZWC A;  4YLH A;  5L8R J;  3RST A;  1FC9 A;  2H89 C;  2W3P A;  5DTW A;  1X0U A;  5INF A;  2FXP A;  4EML A;  1XO6 A;  2VSS E;  1N6E A;  4MOU A;  3B71 A;  1K04 A;  1DD4 A;  3MOY A;  2FZS A;  4KPK A;  3QWD A;  2ZQR A;  3P5M A;  1FC6 A;  1KIL E;  3BPP A;  4G2R A;  4NNQ A;  5MGB A;  2VSU E;  1TU3 F;  5KJP A;  5G1S A;  2VX2 A;  1RQV A;  3JU1 A;  1HNO A;  3TVW A;  2PG8 A;  1Y7O A;  1N6F A;  1EXJ A;  1RJN A;  4DI1 A;  1J7X A;  2F9I A;  3P2L A;  1PV3 A;  4ZDD A;  1OW7 A;  4U0G A;  3WG5 A;  1UYS A;  3TT6 A;  2J5I I;  1NGM B;  1VRG A;  5FIF A;  3M6N A;  3FF6 A;  2ZT9 D;  4JCS A;  3AEG C;  3QYR A;  3H0Q A;  2FBW C;  2J5I B;  4GM2 A;  4WCZ A;  5JBX A;  1UYT A;  3TT7 A;  3Q0J A;  4KT0 J;  2BZR A;  2E76 C;  2DUB A;  1NYH A;  2F9Y A;  1N6D A;  4L8K A;  2O01 J;  3C8V A;  4R4M A;  3R9S A;  3BF0 A;  2E76 B;  3U9S B;  4QIJ A;  3T89 A;  4JVT A;  4Q0G A;  2J5S A;  1YQ3 C;  4U7J A;  3KTI A;  3KTH A;  3H0J A;  2CE3 A;  2FW2 A;  3P85 A;  4LK5 A;  4OLQ A;  4U1A A;  3OME A;  3GF3 A;  2J5G D;  1OD4 A;  5DZK A;  2VSU A;  4I7Z B;  3TLF A;  4FND A;  1KMI Z;  4IZC A;  2QJP C;  2A81 A;  3K50 A;  1Q51 A;  2F6I A;  2YJG A;  1Q90 D;  1WMK A;  2BEZ F;  4IL6 X;  1W2X A;  2D3T A;  4B3J A;  3G64 A;  3QMJ A;  3H81 A;  3T97 B;  3IN6 A;  4K29 A;  2V7Q J;  3L3S A;  5E0S H;  4ASI A;  5C90 A;  1FC7 A;  2ZL0 A;  3EWK A;  2Q34 A;  4JCT A;  4NAR A;  4RYF H;  1IK7 A;  3GF7 A;  1DIP A;  3AED C;  4JCQ A;  1NZY B;  3R4Y A;  5IKL B;  4IZB A;  1Y9B A;  4FJW D;  4H13 C;  3H0U A;  4HC8 A;  4H0L C;  3AE4 C;  1XNW A;  1VF5 C;  3AE2 C;  4R4L A;  1MJ3 A;  4OGQ D;  3HLN 1;  4JYL A;  2VSU F;  3VIV A;  1OMI A;  1FDO A;  2WSF J;  2QQ3 A;  4RCN A;  3H02 A;  3MT6 A;  1YG8 A;  5DUC A;  2PPY A;  2E74 C;  1WDK A;  1DD3 A;  2D2C B;  4OMR A;  1XNV A;  4FN8 A;  5C9G A;  2YIU C;  2E76 D;  3AE6 C;  3LKE A;  3T3W A;  1HF9 A;  3IB9 A;  4OGQ C;  4FN7 A;  2GTR A;  1XX4 A;  1WZ8 A;  2ZQQ A;  4PV1 B;  2FYN C;  4KNP A;  2WSC J;  3O6Q A;  3AE9 C;  3AE7 C;  3AEC C;  3ZW8 A;  2QJY C;  1UYV A;  3D71 A;  1TYF A;  4JFC A;  4ELX A;  3Q2Y A;  1Q52 A;  4Q1I A;  3R6H A;  4H44 C;  2ZL4 A;  5KKZ C;  2HW5 A;  2ZL2 A;  3FDU A;  3AEB C;  2FBM A;  2E74 D;  3BPT A;  1RJM A;  3PGQ A;  3D6Z A;  4WZ8 B;  1DCI A;  4H13 B;  5DTP A;  3DOR A;  3D70 A;  1XNY A;  1JXZ A;  3N6R B;  1KOR A;  3D6Y A;  4I7Z C;  3OC7 A;  3HP0 A;  2BEQ D;  1U57 A;  1YQ4 C;  2CBY A;  1DUB A;  1JB0 J;  2J5I A;  5DU4 A;  5DU8 A;  1EF8 A;  3MYB A;  2PBP A;  3IAO A;  3PZK A;  3KQF A;  3RK3 E;  3U9T B;  5E0S A;  2F9Y B;  3QXZ A;  4H0L D;  3DJA A;  3T8B A;  4QFE A;  1ZOY C;  3KTG A;  4J2U A;  1NZY A;  3Q3D A;  5G1Q A;  4ZDF A;  3OT6 A;  3QK8 A;  2IEX A;  2UZF A;  3ZWA A;  3R0O A;  2A7S A;  2E75 D;  1AJY A;  1VF5 B;  3SFE C;  5HUQ A;  2J5G A;  4ELS A;  1FDI A;  1RQU A;  3U9R B;  2P10 A;  4RKU J;  4I52 A;  4NEK A;  1PIX A;  4U18 A;  3ST9 A;  1EY3 A;  4I4Z A;  1MKM A;  3ABV C;  3PE8 A;  3AE8 C;  4U19 A;  3HRX A;  4H44 D;  2VRE A;  3TDC A;  3AE3 C;  3Q5S A;  3TRR A;  2E74 B;  4XFJ A;  2NP9 A;  2F9I B;  1UIX A;  1OW8 A;  2Q35 A;  1HJ0 A;  1PJH A;  1KQG B;  4H13 D;  3RSI A;  4WYO B;  2ZL3 A;  3KTK A;  3ZW9 A;  2QJK C;  2K9Y A;  4TT3 H;  4FNB A;  3Q5R A;  3GMA A;  2F6Q A;  1K39 A;  4L6W A;  2C8T A;  3MFM A;  1SZO A;  4JWV A;  1OD2 A;  3AE1 C;  3S9O A;  3Q7H A;  4MI2 A;  2IDB A;  1K05 A;  3V5E A;  4HNK A;  2G8Y A;  3STA A;  4KWB A;  2WPV B;  1ON9 A;  2VSS F;  1OW6 A;  5M1B A;  2H88 C;  4QII A;  4ZDC A;  3H0S A;  3TZ3 A;  2NZ2 A;  2WQY C;  2E75 B;  1VF5 D;  2WSE J;  2DEO A;  3IAV A;  4KD6 A;  4K2N A;  3AEA C;  2ZT9 C;  3Q1M A;  3T88 A;  1YG6 A;  2G3A A;  3V5I A;  1WDL A;  4B3H A;  2JP3 A;  1TG6 A;  2VSS A;  5KLI C;  4F47 A;  4HDT A;  4U0H A;  3NJB A;  3SLL A;  1ZRT E;  3Q0G A;  1S1C X;  4H0L B;  4JYJ A;  4JSB A;  4GDO A;  1O8U A;  4Z0M A;  2JO1 A;  2X58 A;  2J5U A;  3NJD A;  1UIY A;  5FUS A;  4B3I A;  1FCF A;  1KTM A;  1ZP0 C;  3G9R A;  3IBB A;  2EJ5 A;  2A7K A;  4YXD C;  1EXI A;  4OG1 A;  5G1R A;  1WDM A;  3Q5P A;  2X24 A;  4ELW A;  4I42 A;  4GHN A;  3KTJ A;  2Q2X A;  3RRV A;  4YTP C;  1HZD A;  4H44 B;  3TV5 A;  4EMP A;  3H25 A;  3LW5 J;  1ON3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...