1PIXA

Crystal structure of the carboxyltransferase subunit of the bacterial ion pump glutaconyl-coenzyme a decarboxylase
Total Genus 219
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
219
sequence length
586
structure length
586
Chain Sequence
GFYSMPRYFQNMPQVGKPLKKADAANEEQLKKIEEEIHQLIKEAQEAGKADADVNKRGELTALQRIEKLVEPGSWRPLNTLFNPQGNKNGSVAIVKGLGRVNGKWCVVVASDNKKLAGAWVPGQAECLLRASDTAKTLHVPLVYVLNCSGVKFDEQEKVYPNRRGGGTPFFRNAELNQLGIPVIVGIYGTNPAGGGYHSISPTVIIAHEKANMAVGGAGIMGGMNPKGHVDLEYANEIADMVDRTGKTEPPGAVDIHYTETGFMREVYASEEGVLEGIKKYVGMLPKYDPEFFRVDDPKAPAFPADDLYSMVPLNDKRAYDIYNVIARLFDNSELHEYKKGYGPEMVTGLAKVNGLLVGVVANVQGLLMNYPEYKAAGSVGIGGKLYRQGLVKMNEFVTLCARDRLPIVWIQDTTGIDVGNDAEKAELLGLGQSLIYSIQTSHIPQFEITLRKGTAAAHYVLGGPQGNDTNAFSIGTAATEIAVMNGETAATAMYSRRLAKDRKAGKDLQPTIDKMNNLIQAFYTKSRPKVCAELGLVDEIVDMNKIRGYVEAFTEAAYQNPESICPFHQMILPRAIREFETFVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase
molecule keywords Glutaconyl-CoA decarboxylase A subunit
publication title Crystal structure of the carboxyltransferase subunit of the bacterial sodium ion pump glutaconyl-coenzyme A decarboxylase
pubmed doi rcsb
source organism Acidaminococcus fermentans
total genus 219
structure length 586
sequence length 586
chains with identical sequence B
ec nomenclature ec 4.1.1.70: Transferred entry: 7.2.4.5.
pdb deposition date 2003-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01039 Carboxyl_trans Carboxyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.680 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Helix bin 1pixA01
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1pixA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1pixA03
5G1RA 4U0GH 3MYBA 5KJPA 2VREA 3IBBA 2A7KA 1RJNA 4U1AA 4ZDDA 2W3PA 3PZKA 3BEZA 4B3IA 3MFMA 4ZU2A 3QKAA 3NJBA 2PBPA 2J5SA 3V5EA 1N6FA 4RCNA 1Q51A 4K29A 1TYFA 5DZKH 5DUCA 1HNUA 4KD6A 4JSBA 4FJWD 3LAOA 2F6IA 3HRXA 4KPKA 2CE3A 3BPPA 4JYLA 1NZYB 4HNKA 4EMPA 5G1SA 4L8KA 3K8XA 4JVTA 5E0NX 3OC7A 2FZSA 1UYTA 3OT6A 4OLQA 1XNYA 5DKPA 3H0QA 3L3SA 2GTRA 3HP0A 1VRGA 2VX2A 1XNWA 2VSUC 1EF9A 3Q0JA 3M6NA 4FN8A 1UYSA 3U9TB 3R0OA 3TT6A 4L6WA 4KNPA 3P85A 4JWVA 4FZWC 5INIA 4I52A 4OG1A 3DJAA 4JCQA 3R6HA 2FW2A 5INFA 2ZL3A 4K2NA 3V5IA 1WDKA 3M6MA 3MT6A 4G2RA 2A7SA 2X24A 4ELSA 2WTBA 1PJHA 3R9QA 4NNQA 1WDMA 4GM2A 5JBWA 1Y7OA 4GHNA 2C8TA 3GKBA 3H81A 4RYFA 4QIIA 4IZCA 5DTWA 3TZ3A 4FNDA 3NJDA 1ON3A 4YLHA 4FN7A 2J5IB 3DORA 2F9YB 3QREA 3FDUA 1WDLA 3PGQA 5JBXA 5E0SH 1MJ3A 2FBMA 2HW5A 5DL1A 5FIFA 2DEOA 2NP9A 3H02A 2Q34A 1OD4A 5DU6A 3RSIA 4FB8A 2ZQQA 3STAA 5DU8A 4Z0MA 1DUBA 1XNVA 1XO6A 3ZWBA 1O8UA 1UIYA 3U9SB 1K39A 3SLLA 3IB9A 2VSSA 2PPYA 4U0GA 3KTIA 3TLFA 4JYJA 3GF3A 3QYRA 1NZYA 3TV5A 2VSUF 3H0UA 3Q1TA 3T89A 2EJ5A 3IAVA 4MOUA 4U19A 3K50A 3ISAA 5E0SA 3JU1A 1PIXA 4I42A 2J5II 5DZKA 4ZDEA 5IKLB 3P2LA 2CBYA 3T8AA 4MI2A 4FNBA 2VSUE 2J5GD 3QMJA 2F9IB 2IEXA 3TRRA 4F47A 4ELWA 3U9RB 3QWDA 1N6DA 4HC8A 3VIVA 3RRVA 4B3HA 1HZDA 5C9GA 3P5MA 3RSTA 1EF8A 1UYRA 1DCIA 4QFEA 5DU4A 2QQ3A 4NEKA 4WCZA 1HNOA 4B3JA 3GMAA 3ZW9A 4QIJA 3GF7A 1YG6A 4ELXA 3I47A 1FC6A 3H0SA 2F6QA 3TT7A 3QK8A 3ZWAA 3TDCA 4IZDA 3KTKA 2VSSF 3Q7HA 2J5IA 3KTJA 3ST9A 4EMLA 3T8BA 3G64A 2F9YA 1K32A 3OMEA 1ON9A 1Q52A 4JCRA 1W2XA 3PE8A 1SG4A 2Q35A 4JOTA 2J5GA 4LK5A 2VSSE 1TG6A 1J7XA 2A81A 1FCFA 3LKEA 5FUSA 3GLMA 4ZDFA 3HLN1 4EMMA 5G1QA 5CTBA 1XX4A 1EY3A 1FC9A 3TVUA 1RJMA 1OD2A 3ZWCA 3N6RB 1UYVA 2D3TA 2PG8A 1SZOA 3SWXA 1WZ8A 2ZL2A 1YG8A 5DUFA 1X0UA 2DUBA 3KQFA 4I4ZA 3TVWA 2ZL4A 4U0HA 2ZQRA 2ZL0A 3QXIA 4RYFH 4WZ8B 3QXZA 4WYOB 4ZDBA 4JCTA 5KDRB 5MGBA 4ZDCA 2X58A 3Q0GA 5INGA 4U18A 3H0JA 4DI1A 4JJTA 3KTGA 2F9IA 4MXIA 4Q1IA 3T88A 3KTHA 3WG5A 5KDRA 2Q2XA 2VSUA 3BF0A 1N6EA 4K3WA 3FF6A 3PEAA 1FC7A 5DTPA 3ZW8A 4IZBA 4Q0GA 4JCSA 4ASIA 3R9TA 4OMRA 4FZWA 3HE2A 3T3WA 3R9SA 2BZRA 3MOYA 1JXZA 3HINA 4JFCA 2UZFA 5C90A 4KWBA 5CTCA
chains in the Genus database with same CATH superfamily
2NPSB 3KZIH 4HKZH 3RK3B 3V4QA 1IK9A 3M0DC 1SQBJ 3PP5A 2KNCA 1L0NJ 3GHGA 3KQGA 2W3PA 2PAJA 2Q3IA 1NYHA 3MFMA 1U57A 1URQD 3QKAA 1PZQA 1FU1A 1EZVI 3NJBA 2J5SA 1N73C 1VQPP 2C9NY 3RL0C 2P2UA 1LTSC 1NTZE 1PPJE 3L75D 1TYFA 5DZKH 2Y9YA 1MFZA 5DUCA 1LWUA 3H1LE 1U7JA 1IC2A 3O6QA 3C1LA 1SQBE 2RMZA 1N7LA 1L0NE 4H0LD 3H1HJ 1YTZT 2QM8A 3HRXA 3JCUE 2LKMA 2YNYA 1LT9A 3IR9A 2XV5A 2O01N 5BU5A 1VDFA 1YYCA 2N1TA 3L72J 1SFCD 3L73G 2Y0EA 2O01J 3ABVC 1VQMP 4PD4E 1LTAC 2HG5D 1VRGA 1LJ2A 1FOSE 1JY3N 1JO5A 1S5LX 3Q0JA 3H1HE 2AEJA 2E75C 4FN8A 1UYSA 4UB8E 3R0OA 3HE4B 2C0XA 2Y0DA 1URQB 2R5DA 2CPBA 2WSCH 2KB7P 1NU1J 3H32B 1SS1A 1VQKP 4H13D 3FWNA 4OWFA 1OXZA 4KNPA 1VQNP 3L72E 1Q81Q 3AE7C 2P7JA 2JWAA 2QEXP 4JCQA 3R6HA 2V4HA 2ZL3A 4PJ0H 1KQLA 2QJYB 3V5IA 2FY8A 1WDKA 3NXSA 4H0LB 1RF1C 3MT6A 3IN6A 2WTBA 1RE4A 1PJHA 4GOEA 4GM2A 1H89A 1KILC 1NU1E 1GL2D 1ZRTE 4DJGA 2P67A 4EIJA 1FZGA 3WUUA 1FDMA 1SFCB 2KI7B 1ON3A 3L35A 2P1JA 3H1KJ 2QIWA 4XA4A 4W7ZA 3MD0A 2QJPC 5KLVD 2ZT9D 2CPSA 3H25A 3S4RA 2W83C 1FE6A 2FBMA 5DL1A 1AFOA 1AV1A 2H8PD 3OW2O 3BCCD 4H13B 3TSIA 3HD7D 1OD4A 2ZQQA 2IPPA 3HUSC 1YHQP 2WPSA 4Z0MA 3H1KE 1DUBA 1XO6A 3CC7P 1SQXG 1BE3G 3CWBJ 1O8UA 2FYUG 3CL3D 1DEBA 2PPYA 4WY4D 3TLFA 4JYJA 1W2BO 4KJMA 1SQVD 1GL2B 5B66H 2WTYA 2JR8A 4MOUA 1S5LE 3WUTA 2CK3H 2J58A 1RH5B 3SSUA 1NWQA 1BDCA 3P7KA 1RY3A 3B5NA 1BGYJ 4I42A 1X22A 4TLFA 3CWBE 4ZDEA 2IYOA 1SQQD 3EFGA 3T8AA 2ZT9B 3A5TA 1QX8A 3L71G 1EZVE 1M56D 2J5GD 3Q1MA 2M0BA 1SLQA 3L74D 3D6YA 3FWLA 4U3FG 3HD7B 3H1JD 4N78D 4L75A 3CD6P 3KXDA 3QWDA 3TDKA 1BGYE 3U1CA 1N7SC 4KT0J 3AE9C 1EF8A 3BPTA 2PGDA 1IFIA 4EDFA 4QFEA 3RBXA 5GTHE 4HH2A 2N1TD 4ZKPA 3WU2H 1K73Q 3RBZA 1GW3A 3EQ2A 1HNOA 1LNQA 2WT7A 1DEEG 1SQXK 1FZBA 2O1JA 4ELXA 4H44D 3BRVB 3RK3E 2KNCB 2F6QA 2MKVA 3SFDC 4IZDA 2HLOA 2IBZD 3E7KA 3W68A 1ZV8A 3G64A 1NTZG 1PPJG 3BATA 2E74C 3G3ZA 3W67A 3U1AA 3H1LG 1VQ4P 2KP8A 4PD4H 1J1DC 2IDBA 3O6QB 1SQBG 3WMM0 5H2FE 1L0NG 3TGUD 3H1IJ 2QG4A 5E79H 3MGNA 5KKZC 1QVGO 3CC4P 1TG6A 1RQVA 3TYYA 1G1JA 2E42A 4U7JA 5FUSA 3GLMA 5BVZA 3M9QA 1IFPA 5G1QA 1HJ0A 2N1TB 1EY3A 2H88C 3TVUA 3AEDC 2W6BA 2A06D 1UIIA 2KSJA 2M5AA 3C9IA 3L75J 3N6RB 2OTKE 3H1IE 3V2NA 3H1HG 2PG8A 1SZOA 1SQVK 1YI2P 3CCQP 2ZL2A 1X0UA 2DUBA 4GOFA 3M06A 1YIJP 3QXIA 1JTHB 4WZ8B 5DJTB 1T3UA 4ZDBA 1LTBC 2JO1A 2Q9IA 1GU5A 3L72G 4ZDCA 2OGUA 3FXEA 5INGA 1W2EA 1SP4A 1SQQK 2WSCJ 1ZMEC 4RO0A 3L75E 1EDIA 3G6EP 4MXIA 2YO3A 3T88A 5KDRA 5AW5B 4I6MC 3BF0A 1RQUA 1LP1A 3VP8A 4DZOA 3ZW8A 1NU1G 2KYVA 1NHLA 1J1EB 1FZCC 2Z5IA 4JCSA 1SQBK 2POHA 1VF5D 1EDKA 3A0BH 4LC1A 3ITKA 2OYOA 2FYNB 5GTIH 3B5ND 4JFCA 2UZFA 2H89C 1L4AA 5C90A 4PD4I 3QH9A 5CTCA 3A2AA 3FXDA 4UB6H 3IBBA 5HUQA 3BVHA 3AE5C 2IBZI 1NAYA 4BXLA 2Y9ZA 3M91A 1JEKA 4IOIH 3V5EA 1N6FA 1BCCD 2NRGA 4RCNA 3H1KG 2ZJSE 5AW3B 3RK2C 4EYYQ 3SWFA 3M9BA 4KD6A 1VQLP 2WWWA 5L8RJ 1VQ7P 1AA0A 1KTMA 2ZAEB 2QE7H 1IFMA 1T8ZA 2V7QH 3KPEA 4FJWD 3M0AA 1KORA 2N9YB 1QVFO 5KLVJ 4HNKA 1VF5B 3AE1C 3K8XA 1FJPA 5E0NX 4ZMDA 4NPDA 1UYTA 3OT6A 5KTBA 3L70D 3BCCJ 5C39A 3CWBG 1KFNA 3HP0A 3I5CA 4J2UA 1EZVG 2QJKC 1DH3A 4W80A 3D6ZA 5KLVE 1YITP 2Z5HA 1T2KC 1OX3A 4NPFX 1P84D 2KSEA 5KAIH 3PLNA 3V6IA 4L6WA 1JY2O 4PV1C 2ZYDA 3BCCE 1OZHA 1SQVJ 1BGYG 5B66E 4I52A 1OVVA 2E43A 1ZP0C 5INFA 2YXRB 5EFWB 1H8AA 3QWOC 1NJIQ 1R5LA 4OH8B 3Q2YA 2M3EA 3JC22 4L74A 4OGQD 3EFFK 1SQQJ 2A7SA 3AEGC 1DD3A 2DW3A 3R9QA 2WT7B 4AQRD 2FFDA 1N86A 1FJKA 1LTJA 4GHNA 2C8TA 1SQVE 2NPSC 4M3LA 4RYFA 3RK3C 2Q6QA 1DD4A 3L4FA 4IZCA 5DTWA 3O8ZA 3H1JJ 3TZ3A 1N7SA 3NJDA 5CCHC 2H7HA 1KMIZ 1NTMD 3V2QA 4FN7A 2WSFH 5KJ7C 1YQ3C 1SQQE 3QREA 4BWNA 2N9BA 3FDUA 1AJYA 5E0SH 5DJUB 3G9RA 1S2EA 3MUDA 1X79B 3LIEA 1YQ4C 2DEOA 1D7MA 3WU2E 3H1JE 4N78E 3R4YA 5DU8A 1S4XA 5KLIB 2QSIA 1QL2A 3VMXA 3VTPC 5APUA 1FOSF 2E76B 1XNVA 3A7OA 4OVNF 3CMAP 1YJWP 2AXTE 3Q5RA 1UIYA 2M8RA 2HR3A 4OGQB 2I8DA 1K39A 2VSSA 3GF3A 5AVUB 4YTPC 3H1IG 1NZYA 3TV5A 2VSUF 1L4AD 1PGQA 4I1LA 3IAVA 4ASWA 4DT0A 1CSBA 1USEA 4U19A 3TGUJ 1PIXA 1URQC 5E79E 3LW5H 3MZWB 4EI2A 2BASA 5AVVB 2JWDA 3HTKA 2IBZE 2KLUA 2D2CD 2CBYA 3T97A 1JUNA 4RKUJ 5KAFH 2FKWB 3L75G 2VSUE 3SFEC 2IEXA 2QJYC 5AVWB 1MV8A 4ELWA 5CCGA 4H0LC 1GW4A 3AEAC 3HE5B 3TGUE 4KHXA 1HUCA 4WBAA 1N6DA 3IAOA 4K35A 2YXQB 1HZDA 1S72P 1NVOA 5C9GA 3AE6C 3P5MA 3SWKA 5K5GB 1CI6B 2OYIA 2ZVOB 2JJLA 2ZFCA 4C7NB 2W8ZA 1FDIA 1SFCC 1L0LD 1KB9D 3VMYA 1Q82Q 3IF4A 4B3JA 1LTTC 2A06E 3GMAA 3CPWO 2JKVA 1ZN5A 4QIJA 3GF7A 4NPEA 2WQYC 2ZYAA 2B87A 2YMYA 1FZCA 3PRJA 3QK8A 3TDCA 3PTZA 5APWA 2B89A 4H13C 2D2CB 1GDTA 3Q7HA 2J5IA 2WMMA 2F9YA 1KB9H 1NTMK 3OMEA 1Q52A 4JCRA 3A0BE 1KYOD 4B86A 3PE8A 4N6JA 1SG4A 4JBZA 2FXMA 1GK6A 4LLHA 1IFJA 5GTIE 4R4MA 3CCRP 3SWYA 2WSEH 2NZ2A 2OYHB 1UIXA 1NTKD 1Q2NA 2FBWC 1M1JB 3BASA 3CMEP 3L37A 4UB6E 5AW1B 1FCFA 1GL2C 1ZR2A 2V7QJ 1KYOH 3HLN1 4EMMA 1RE3A 2I1KA 1FC9A 1HBWA 3CCMP 5AVQB 1OWAA 1BCCJ 3CX5D 2B9BA 1H0TA 1UYVA 2ZXXA 1LT1A 3WUVA 2ZT9C 3S1KA 5KLVG 3SWXA 1WZ8A 5DUFA 3F89A 5CMZA 3TVWA 3E1RA 2ZL0A 4RYFH 3GW6A 1KQFB 4WYOB 4D6TD 3BCCG 3HD7C 5AW7B 1GK4A 3CXHD 2YMKA 1BCCE 3CX5H 4DI1A 4JJTA 3KTGA 2KZIA 3L70J 2L5GB 1QEXA 2AEMA 4Q1IA 2HFED 3WG5A 2Q2XA 2WZ7A 2HPCA 4K3WA 4WY4C 1KFMA 5DTPA 2FFDB 4L73A 4WY4B 1FZAA 1LTJB 3VMAA 1SQVG 1VQ6P 3KHUA 1X0TA 1PV3A 4OMRA 2R44A 1OW7A 4HB1A 3HE2A 5KAIE 1KB9I 3L70E 2G8YA 5M1BA 3HINA 3GHGB 4HDTA 2AXTH 2MJZA 5B5EH 1L0LK 3VOPA 1SQQG 3N4XA 3CCVP 3OA7A 5KJPA 2K9JA 5CBOA 2A7KA 2XNXA 2OTJP 3R2PA 1RJNA 1EQ7A 4ZDDA 2WSFJ 3A3YB 3D70A 3BEZA 1MUUA 2GA1A 3P32A 1LWUB 3H6PA 1P84E 2VRSA 1JOCA 3H1JG 5KLVK 3CCEP 2PBPA 5CCGD 1HTLC 1AVYA 1X8YA 3B8EB 2KLVA 3M0DA 1HJBA 1Q51A 2J5UA 3KYQA 1HNUA 1QLED 1LT9C 5KJ7A 2KUBA 1VQOP 5TISH 1LT9B 1M57D 1NTMJ 5AVTB 1ZW0A 3AE2C 2N1TC 3LAOA 1N73A 1YJNP 4I2LC 2F6IA 2Z4EA 2CE3A 3BPPA 4KPKA 1NZYB 1FZFA 4EMPA 4A7PA 5G1SA 3CCSP 1NTKK 3OC7A 4DCKA 4BRYA 1XNYA 5DKPA 1HF9A 1S9KD 3H0QA 4H44B 1USDA 1MKMA 3P8MC 1KQGB 3L3SA 3CX5I 1M90Q 2IBZG 2RKLA 2ZYGA 1NTME 2R3CA 3OAKA 1J2JB 2VX2A 1XNWA 3T97B 1TU3F 2VSUC 2O1KA 3LW5J 3M6NA 3U9TB 4Y28J 3TT6A 1PP9D 4YXDC 1T6AA 2LXBA 3AEFC 3TGUG 2SPZA 2YO2A 4RESB 4JWVA 3HE4A 5INIA 5CBNA 5CHXA 1PGPA 1RE4C 4OG1A 3DJAA 1J1EC 2FW2A 2FXOA 1M7LA 2OYIB 3H32A 2ZXEB 3AEEC 2I1JA 1G2CA 1JMBA 3TNUA 1K9MQ 2HODA 4ELSA 2FYNC 2YJGA 4NNQA 2A06G 3NMDA 1VPCA 5JBWA 5KAFE 3E1IA 2BCCD 4NARA 3H81A 4Y99C 2P10A 3B4SA 1JY3P 2B87B 1RF1A 4Y99B 1VQ5P 3PH0A 4YLHA 2W27A 1KILA 3MTUE 2J5IB 2F9YB 3Q5SA 5APSA 2ITAA 1LTIC 1JCCA 2HW5A 1L0LJ 3P8CD 5APTA 1EXJA 2NP9A 2A45H 1HH0A 1BDDA 2Q34A 1RHZB 4FB8A 3I56P 3PHLA 3STAA 1T2KD 4ASVA 5BU8B 1VF5C 2QRXA 1PL5A 3CI9A 4PV1D 2WSEJ 4WVZA 5AW2B 5AW0B 2M3BA 1QL1A 3IB9A 4U0GA 5AW4B 1L0LE 3HUSA 1M8OB 1KB9E 2QM7A 3B5NB 1H0TB 3Q1TA 2XU6A 3A0HE 1VL2A 1GMJA 3PJSK 1SQPD 1Y9BA 2HYNA 2GM4A 3ISAA 2BEQD 3JU1A 1LTGC 3OJAB 1NTKJ 2J5II 1IO4A 5IKLB 5APVA 3P2LA 5AVXB 2P58A 5AW6B 1BCCG 2E5YA 3QMJA 3VYIA 1KYOE 1NOHA 4F47A 4I7ZB 2WPQA 3U9RB 1IZNB 1JM0A 3RL0D 1NTKE 3AE3C 1P84H 4XE5B 1UYRA 1PGJA 2K9YA 4D6TJ 3L70G 3L74J 1HGZA 1G1IA 3CLQA 4HYTB 3CCJP 2QA4P 3CX5E 2WPRA 1YG6A 1JB0J 2A45I 2K9JB 3I47A 1N8RQ 2OQQA 1A02J 1FC6A 1M1KQ 3VN0A 3TT7A 1X9VA 3L73D 3ZWAA 2VSSF 4D6TE 2R5BA 1XTGB 1N2DC 2BEZF 3ST9A 1SVFA 4EMLA 1FZEA 3U59A 3L74E 4DOJA 1H88A 1K32A 3CXHE 1ON9A 5KLIC 3V2PA 2C9LY 2YKPA 2E75D 1JNMA 2E76C 2H43A 3UIAA 1KZUB 5AW9B 3RGUA 1FC2C 4C46A 2Q35A 2ZVNB 4OGQC 1MFTA 4JOTA 4IL6H 2J5GA 1N73B 5B5EE 3RL0B 1JMMA 2VSSE 3Q5PA 2FYZA 2KOGA 1J7XA 1OW6A 1R5SA 3LKEA 3HRNA 4ZDFA 2M5AB 4JYBA 4BRYB 2QVAA 1NO4A 1XX4A 1S3JA 1EDJA 3C8VA 4MN4C 1RJMA 4L76A 1LGHB 3TK1A 1NTMG 1NKNA 2R3SA 1KILD 4ZKUA 2D3TA 2WVRA 4IFFA 1YG8A 5TISE 1Q7YQ 3KQFA 4I4ZA 2B88A 1SQPK 1P84I 1GU4A 1BSHA 4JCTA 1K8AQ 5KDRB 1K05A 2K1AA 3AE8C 5CJ4A 2X58A 3Q0GA 1LP1B 1T3JA 2E75B 4EOTA 1JTHA 4U18A 3H0JA 1ZXGA 1ZLLA 2F9IA 1Q90D 3KTHA 1W5CE 1GTWA 2VSUA 2L91A 1G2CB 3TNUB 3FF6A 2HODB 2IFNA 1FC7A 1DIPA 4GODA 3CCUP 4IZBA 1L4AC 4Q0GA 3D71A 3R9TA 1L4AB 1PP9J 1SQXD 1BE3D 1K04A 3AEBC 2FYUD 1RF1B 3T3WA 1HGVA 3R9SA 1Q86Q 2BZRA 3GG2A 2RH0A 4JF7A 1YJ9P 1S9KE 4QMAA 1IK7A 1KILB 1E79H 4KWBA 2D2CC 3VMZA 2W6AA 5G1RA 4U0GH 2XKMA 1R8EA 3MYBA 2VREA 1NH4A 4U1AA 3USSA 3PZKA 4B3IA 3A0HH 4ZU2A 1PP9E 2GUVA 3AECC 3F5HA 1RF0C 1KC8Q 2BCCJ 2OYHC 2QJPB 2KS1A 3L71D 4K29A 1M1JC 4GDOA 4JSBA 3CCLP 1JY2N 2KIKA 4U3FD 1FBMA 4N3YB 2IFMA 1L0LG 3HUSB 2W6JH 4JYLA 1N7SD 4L8KA 2PFXA 5AW8B 2BCCE 4JVTA 3NFQA 2YKOA 2FZSA 4OLQA 1OVUA 2J59M 2Y0CA 2K37A 2GTRA 1OMIA 4AUWA 1EF9A 3L36A 2Q1KA 1KV4A 4GT1A 1DX7A 2Q5UA 2UWJE 3BRTB 4IL6X 4AYCA 4CPGA 3P8CE 3NTNA 3P85A 1IFDA 4FZWC 1NTZD 1PPJD 5AVZB 1NTKG 2JP3A 3LIDA 2E74D 3H1LD 1SQPJ 1KD1Q 2FFDC 1LTJC 4RJTA 4JPZB 2W90A 4K2NA 1WT6A 1SQBD 3CXHH 1L0ND 3VP9A 3M6MA 1OW8A 4G2RA 2X24A 3Q3DA 1FDOA 1N7SB 3GHGC 1WDMA 3V4WA 1Y7OA 2KXPB 3GKBA 5TJHA 4QIIA 1SQPE 3B71A 1XTCC 4FNDA 3MUDC 2FYUK 4GKGA 4D6TG 1LWUC 3MP7B 4PD4D 3FX0A 3L74G 1EXIA 3DORA 2NPSA 3H1HD 1WMKA 3TF5A 3JCUH 1IFNA 1WDLA 2WPVB 3PGQA 5JBXA 1KYOI 2IX7C 1MJ3A 5CCHA 5FIFA 1Y8AA 2FXPA 3S9OA 3H02A 3L72D 5DU6A 3RSIA 4IFMA 1FS0E 1MZ9A 2PRRA 2E74B 2JEEA 1Y47A 2O3JA 1GD2E 2JDIH 3G71P 3N7NA 3IFMA 1J1DB 2LR2A 4UB8H 4YPCA 3ZWBA 3L73J 4LGDE 2G3AA 4YXWH 4K3AA 3U9SB 4W7YA 3KZIE 3SLLA 5KKZB 4H44C 3KTIA 3QYRA 1NU1D 2IZ0A 4ZNCA 3H0UA 1ZRTD 1NKZB 3T89A 2EJ5A 5AVSB 2E5TA 1VQ9P 1IJDB 3HTKB 2O01H 1VQ8P 1CW5A 3V2RA 3K50A 3KDPB 5E0SA 1Z56A 2LXCB 1AQTA 4IL6E 5DZKA 3L73E 5CCGC 1QGKB 1AQ5A 3CXHI 4MI2A 4FNBA 1PGOA 2F9IB 2OYIC 4TT3H 1CZQA 1URQA 4WWIA 3TRRA 4IFDK 4Z1MH 4O9BA 5APQA 1OFCX 1KQSO 4HC8A 3VIVA 1GZLA 3H1KD 3RRVA 4B3HA 5AVYB 2K3RA 3RK2D 1HWTC 3RSTA 4WB4A 1NTZK 3JSVC 1ZR4A 2YKQA 1DCIA 3HE5A 5DU4A 2QQ3A 2Q7CA 4GIFA 2KZJA 4NEKA 1JY3O 2AXCA 4WCZA 2XNDH 1CI6A 1L0NK 2WITA 5APYA 1FZCB 3CC2P 2C0WA 2IZ1A 3ZW9A 4C7NA 1KILE 1HVVA 2OARA 3H0SA 1SFCA 1PP9G 1OVRA 3CWBD 3KTKA 3FGAD 4PJ0E 3KTJA 1YTZI 3T8BA 2IYPA 1EZVD 2KS1B 1SQXJ 1BE3J 2K88A 2FYUJ 1W2XA 3RL0g 1S5LH 1WRGA 1YBKA 4C7RA 4R4LA 1S1CX 1RE3C 1KN7A 1BGYD 1FAVA 1BSNA 4LK5A 3II6A 3RK2B 3V5BA 3B5NC 2A81A 2BCCG 1RF0A 3ZDMA 1NAFA 2OYHA 1SQXE 2XDJA 1BE3E 2PP6A 5CJ0A 1EDLA 2A45G 3I55P 5CTBA 1E5WA 3AE4C 1M1JA 2FYUE 5APXA 1OD2A 3ZWCA 3L71J 1L2PA 3M9HA 4HJGH 1GL2A 3EWKA 1NGMB 2NPSD 1NU1K 3RK3D 1AVOA 4U3FJ 3G4SP 1U7MA 1OIPA 2ZL4A 5AVRB 4U0HA 2ZQRA 5GTHH 5CCHD 3QXZA 2GUSA 5MGBA 4I7ZC 5KJ7D 1EC5A 2QJKB 2HPCB 2YIUC 2XZRA 3K5BA 2KK7A 2AEFA 3L71E 1ZOYC 2YIUB 3MHVA 2OTLP 1JY2P 4JQ0D 2RN0A 4PV1B 3HD7A 1N6EA 4U3FE 3PEAA 4XFJA 2R32A 2E76D 1JCDA 4ASIA 1SQPG 4FZWA 4JYCA 4WY4A 3MOYA 1PFIA 5H2FH 3MIWA 1JXZA 1NTZJ 2Q3EA 2WSSH 1A02F 3H1ID 3H1LJ
chains in the Genus database with same CATH topology
5G1RA 4U0GH 1R8EA 3MYBA 5KJPA 2VREA 3IBBA 2A7KA 1RJNA 5HUQA 4U1AA 4ZDDA 2WSFJ 2W3PA 3PZKA 3AE5C 3D70A 1NYHA 3BEZA 3MFMA 4B3IA 4ZU2A 1U57A 3QKAA 3AECC 3NJBA 2PBPA 2J5SA 3V5EA 1N6FA 4RCNA 1Q51A 4K29A 2J5UA 1TYFA 5DZKH 5DUCA 1HNUA 4GDOA 4KD6A 4JSBA 5L8RJ 1KTMA 3O6QA 3AE2C 4H0LD 4FJWD 3LAOA 1KORA 2F6IA 3HRXA 4KPKA 2CE3A 3BPPA 4JYLA 1NZYB 4HNKA 4EMPA 1VF5B 3AE1C 5G1SA 4L8KA 3K8XA 4JVTA 5E0NX 3OC7A 2FZSA 1UYTA 3OT6A 4OLQA 1XNYA 5DKPA 1HF9A 3H0QA 4H44B 1MKMA 1KQGB 3L3SA 2GTRA 3HP0A 2O01J 3ABVC 1OMIA 1VRGA 2VX2A 1XNWA 3T97B 4J2UA 1TU3F 2VSUC 1S5LX 1EF9A 3Q0JA 2QJKC 3LW5J 2E75C 3M6NA 4FN8A 1UYSA 3U9TB 3D6ZA 3R0OA 4Y28J 3TT6A 4YXDC 4IL6X 3AEFC 4L6WA 4PV1C 4H13D 4KNPA 3P85A 4JWVA 4FZWC 3AE7C 4I52A 2JP3A 5INIA 2E74D 4OG1A 3DJAA 4JCQA 1ZP0C 3R6HA 2FW2A 5INFA 2ZL3A 3AEEC 4K2NA 3V5IA 1WDKA 3Q2YA 4H0LB 3M6MA 3MT6A 1OW8A 4OGQD 4G2RA 3IN6A 2A7SA 2X24A 3AEGC 3Q3DA 4ELSA 2FYNC 1DD3A 2WTBA 1PJHA 3R9QA 2YJGA 4NNQA 1FDOA 1WDMA 4GM2A 5JBWA 1Y7OA 4GHNA 2C8TA 3GKBA 4NARA 1ZRTE 3H81A 4RYFA 2P10A 4QIIA 1DD4A 4IZCA 5DTWA 3TZ3A 3B71A 4FNDA 3NJDA 1ON3A 1KMIZ 4YLHA 4FN7A 2J5IB 2QIWA 1EXIA 3DORA 2F9YB 3Q5SA 1YQ3C 1WMKA 3QREA 2QJPC 3FDUA 2ZT9D 2WPVB 1WDLA 1AJYA 3PGQA 5JBXA 5E0SH 3H25A 3G9RA 1MJ3A 2FBMA 2HW5A 5DL1A 5FIFA 1YQ4C 2FXPA 3S9OA 1EXJA 4H13B 2DEOA 2NP9A 3H02A 2Q34A 1OD4A 5DU6A 3RSIA 4FB8A 2E74B 2ZQQA 3R4YA 3STAA 5DU8A 2QSIA 4Z0MA 2E76B 1DUBA 1VF5C 1XNVA 1XO6A 1PL5A 4PV1D 2WSEJ 3ZWBA 3Q5RA 1O8UA 1UIYA 2G3AA 4OGQB 3U9SB 1K39A 3SLLA 3IB9A 2VSSA 2PPYA 4U0GA 4H44C 3KTIA 3TLFA 4JYJA 3GF3A 3QYRA 4YTPC 1NZYA 3TV5A 2VSUF 3H0UA 3Q1TA 3T89A 2EJ5A 1VL2A 3IAVA 1GMJA 4MOUA 4U19A 1Y9BA 3K50A 3ISAA 2BEQD 5E0SA 3JU1A 1PIXA 4I42A 2J5II 5DZKA 4ZDEA 5IKLB 2D2CD 3P2LA 2CBYA 3T8AA 2ZT9B 4RKUJ 4MI2A 4FNBA 2VSUE 2J5GD 3QMJA 3Q1MA 2F9IB 3SFEC 4TT3H 2IEXA 3TRRA 3D6YA 4Z1MH 2QJYC 4F47A 4ELWA 4H0LC 4I7ZB 3U9RB 3AEAC 3QWDA 1N6DA 4HC8A 3IAOA 3VIVA 3RRVA 4B3HA 1HZDA 3AE3C 5C9GA 3AE6C 4KT0J 3P5MA 3RSTA 3AE9C 1EF8A 3BPTA 1UYRA 1DCIA 4QFEA 5DU4A 2K9YA 2QQ3A 1FDIA 4NEKA 4WCZA 1HNOA 4B3JA 3GMAA 3ZW9A 4QIJA 1KILE 3GF7A 1YG6A 1JB0J 2WQYC 4ELXA 3I47A 4H44D 2OQQA 3RK3E 1FC6A 3H0SA 2F6QA 2MKVA 3TT7A 3SFDC 3QK8A 3TDCA 4IZDA 3ZWAA 3KTKA 2VSSF 4H13C 2D2CB 3FGAD 3Q7HA 2J5IA 3KTJA 2BEZF 3ST9A 4EMLA 3T8BA 3G64A 2F9YA 1K32A 2E74C 3OMEA 1ON9A 1Q52A 4JCRA 5KLIC 2E75D 2E76C 1W2XA 3RL0g 3PE8A 1SG4A 2IDBA 4R4LA 2Q35A 4R4MA 1S1CX 4OGQC 4JOTA 2NZ2A 5KKZC 2J5GA 1UIXA 4LK5A 2FBWC 2VSSE 3Q5PA 1TG6A 1RQVA 4U7JA 1OW6A 1J7XA 1FCFA 2A81A 3LKEA 5FUSA 3GLMA 4ZDFA 2V7QJ 3HLN1 4EMMA 5G1QA 1HJ0A 5CTBA 3AE4C 1XX4A 1EY3A 2H88C 1FC9A 3TVUA 3C8VA 1RJMA 3AEDC 1OD2A 3ZWCA 3N6RB 3EWKA 1NGMB 1UYVA 2D3TA 2PG8A 2ZT9C 1SZOA 3SWXA 1WZ8A 2ZL2A 1YG8A 5DUFA 1X0UA 2DUBA 3KQFA 4I4ZA 3TVWA 2ZL4A 4U0HA 2ZQRA 2ZL0A 3QXIA 4RYFH 4WZ8B 1KQFB 3QXZA 4WYOB 4ZDBA 2JO1A 4JCTA 5KDRB 5MGBA 4I7ZC 1K05A 3AE8C 2YMKA 4ZDCA 2X58A 2YIUC 3Q0GA 5INGA 2E75B 1ZOYC 4U18A 3H0JA 2WSCJ 1ZMEC 3KTGA 4JJTA 4DI1A 2F9IA 4MXIA 4Q1IA 3T88A 1Q90D 3KTHA 3WG5A 5KDRA 2Q2XA 4PV1B 2VSUA 3BF0A 1N6EA 1RQUA 4K3WA 3FF6A 3PEAA 4XFJA 1FC7A 5DTPA 3ZW8A 1DIPA 2E76D 4IZBA 4Q0GA 4JCSA 4ASIA 3D71A 1VF5D 3R9TA 1PV3A 1K04A 4OMRA 3AEBC 4FZWA 1OW7A 3HE2A 3T3WA 3R9SA 2BZRA 2G8YA 3MOYA 5M1BA 1JXZA 3HINA 4JFCA 1IK7A 4HDTA 2UZFA 2H89C 5C90A 4KWBA 2D2CC 5CTCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G1R A;  4U0G H;  3MYB A;  5KJP A;  2VRE A;  3IBB A;  2A7K A;  1RJN A;  4U1A A;  4ZDD A;  2W3P A;  3PZK A;  3BEZ A;  4B3I A;  3MFM A;  4ZU2 A;  3QKA A;  3NJB A;  2PBP A;  2J5S A;  3V5E A;  1N6F A;  4RCN A;  1Q51 A;  4K29 A;  1TYF A;  5DZK H;  5DUC A;  1HNU A;  4KD6 A;  4JSB A;  4FJW D;  3LAO A;  2F6I A;  3HRX A;  4KPK A;  2CE3 A;  3BPP A;  4JYL A;  1NZY B;  4HNK A;  4EMP A;  5G1S A;  4L8K A;  3K8X A;  4JVT A;  5E0N X;  3OC7 A;  2FZS A;  1UYT A;  3OT6 A;  4OLQ A;  1XNY A;  5DKP A;  3H0Q A;  3L3S A;  2GTR A;  3HP0 A;  1VRG A;  2VX2 A;  1XNW A;  2VSU C;  1EF9 A;  3Q0J A;  3M6N A;  4FN8 A;  1UYS A;  3U9T B;  3R0O A;  3TT6 A;  4L6W A;  4KNP A;  3P85 A;  4JWV A;  4FZW C;  5INI A;  4I52 A;  4OG1 A;  3DJA A;  4JCQ A;  3R6H A;  2FW2 A;  5INF A;  2ZL3 A;  4K2N A;  3V5I A;  1WDK A;  3M6M A;  3MT6 A;  4G2R A;  2A7S A;  2X24 A;  4ELS A;  2WTB A;  1PJH A;  3R9Q A;  4NNQ A;  1WDM A;  4GM2 A;  5JBW A;  1Y7O A;  4GHN A;  2C8T A;  3GKB A;  3H81 A;  4RYF A;  4QII A;  4IZC A;  5DTW A;  3TZ3 A;  4FND A;  3NJD A;  1ON3 A;  4YLH A;  4FN7 A;  2J5I B;  3DOR A;  2F9Y B;  3QRE A;  3FDU A;  1WDL A;  3PGQ A;  5JBX A;  5E0S H;  1MJ3 A;  2FBM A;  2HW5 A;  5DL1 A;  5FIF A;  2DEO A;  2NP9 A;  3H02 A;  2Q34 A;  1OD4 A;  5DU6 A;  3RSI A;  4FB8 A;  2ZQQ A;  3STA A;  5DU8 A;  4Z0M A;  1DUB A;  1XNV A;  1XO6 A;  3ZWB A;  1O8U A;  1UIY A;  3U9S B;  1K39 A;  3SLL A;  3IB9 A;  2VSS A;  2PPY A;  4U0G A;  3KTI A;  3TLF A;  4JYJ A;  3GF3 A;  3QYR A;  1NZY A;  3TV5 A;  2VSU F;  3H0U A;  3Q1T A;  3T89 A;  2EJ5 A;  3IAV A;  4MOU A;  4U19 A;  3K50 A;  3ISA A;  5E0S A;  3JU1 A;  1PIX A;  4I42 A;  2J5I I;  5DZK A;  4ZDE A;  5IKL B;  3P2L A;  2CBY A;  3T8A A;  4MI2 A;  4FNB A;  2VSU E;  2J5G D;  3QMJ A;  2F9I B;  2IEX A;  3TRR A;  4F47 A;  4ELW A;  3U9R B;  3QWD A;  1N6D A;  4HC8 A;  3VIV A;  3RRV A;  4B3H A;  1HZD A;  5C9G A;  3P5M A;  3RST A;  1EF8 A;  1UYR A;  1DCI A;  4QFE A;  5DU4 A;  2QQ3 A;  4NEK A;  4WCZ A;  1HNO A;  4B3J A;  3GMA A;  3ZW9 A;  4QIJ A;  3GF7 A;  1YG6 A;  4ELX A;  3I47 A;  1FC6 A;  3H0S A;  2F6Q A;  3TT7 A;  3QK8 A;  3ZWA A;  3TDC A;  4IZD A;  3KTK A;  2VSS F;  3Q7H A;  2J5I A;  3KTJ A;  3ST9 A;  4EML A;  3T8B A;  3G64 A;  2F9Y A;  1K32 A;  3OME A;  1ON9 A;  1Q52 A;  4JCR A;  1W2X A;  3PE8 A;  1SG4 A;  2Q35 A;  4JOT A;  2J5G A;  4LK5 A;  2VSS E;  1TG6 A;  1J7X A;  2A81 A;  1FCF A;  3LKE A;  5FUS A;  3GLM A;  4ZDF A;  3HLN 1;  4EMM A;  5G1Q A;  5CTB A;  1XX4 A;  1EY3 A;  1FC9 A;  3TVU A;  1RJM A;  1OD2 A;  3ZWC A;  3N6R B;  1UYV A;  2D3T A;  2PG8 A;  1SZO A;  3SWX A;  1WZ8 A;  2ZL2 A;  1YG8 A;  5DUF A;  1X0U A;  2DUB A;  3KQF A;  4I4Z A;  3TVW A;  2ZL4 A;  4U0H A;  2ZQR A;  2ZL0 A;  3QXI A;  4RYF H;  4WZ8 B;  3QXZ A;  4WYO B;  4ZDB A;  4JCT A;  5KDR B;  5MGB A;  4ZDC A;  2X58 A;  3Q0G A;  5ING A;  4U18 A;  3H0J A;  4DI1 A;  4JJT A;  3KTG A;  2F9I A;  4MXI A;  4Q1I A;  3T88 A;  3KTH A;  3WG5 A;  5KDR A;  2Q2X A;  2VSU A;  3BF0 A;  1N6E A;  4K3W A;  3FF6 A;  3PEA A;  1FC7 A;  5DTP A;  3ZW8 A;  4IZB A;  4Q0G A;  4JCS A;  4ASI A;  3R9T A;  4OMR A;  4FZW A;  3HE2 A;  3T3W A;  3R9S A;  2BZR A;  3MOY A;  1JXZ A;  3HIN A;  4JFC A;  2UZF A;  5C90 A;  4KWB A;  5CTC A; 
#chains in the Genus database with same CATH topology
 2NPS B;  3KZI H;  4HKZ H;  3RK3 B;  3V4Q A;  1IK9 A;  3M0D C;  1SQB J;  3PP5 A;  2KNC A;  1L0N J;  3GHG A;  3KQG A;  2W3P A;  2PAJ A;  2Q3I A;  1NYH A;  3MFM A;  1U57 A;  1URQ D;  3QKA A;  1PZQ A;  1FU1 A;  1EZV I;  3NJB A;  2J5S A;  1N73 C;  1VQP P;  2C9N Y;  3RL0 C;  2P2U A;  1LTS C;  1NTZ E;  1PPJ E;  3L75 D;  1TYF A;  5DZK H;  2Y9Y A;  1MFZ A;  5DUC A;  1LWU A;  3H1L E;  1U7J A;  1IC2 A;  3O6Q A;  3C1L A;  1SQB E;  2RMZ A;  1N7L A;  1L0N E;  4H0L D;  3H1H J;  1YTZ T;  2QM8 A;  3HRX A;  3JCU E;  2LKM A;  2YNY A;  1LT9 A;  3IR9 A;  2XV5 A;  2O01 N;  5BU5 A;  1VDF A;  1YYC A;  2N1T A;  3L72 J;  1SFC D;  3L73 G;  2Y0E A;  2O01 J;  3ABV C;  1VQM P;  4PD4 E;  1LTA C;  2HG5 D;  1VRG A;  1LJ2 A;  1FOS E;  1JY3 N;  1JO5 A;  1S5L X;  3Q0J A;  3H1H E;  2AEJ A;  2E75 C;  4FN8 A;  1UYS A;  4UB8 E;  3R0O A;  3HE4 B;  2C0X A;  2Y0D A;  1URQ B;  2R5D A;  2CPB A;  2WSC H;  2KB7 P;  1NU1 J;  3H32 B;  1SS1 A;  1VQK P;  4H13 D;  3FWN A;  4OWF A;  1OXZ A;  4KNP A;  1VQN P;  3L72 E;  1Q81 Q;  3AE7 C;  2P7J A;  2JWA A;  2QEX P;  4JCQ A;  3R6H A;  2V4H A;  2ZL3 A;  4PJ0 H;  1KQL A;  2QJY B;  3V5I A;  2FY8 A;  1WDK A;  3NXS A;  4H0L B;  1RF1 C;  3MT6 A;  3IN6 A;  2WTB A;  1RE4 A;  1PJH A;  4GOE A;  4GM2 A;  1H89 A;  1KIL C;  1NU1 E;  1GL2 D;  1ZRT E;  4DJG A;  2P67 A;  4EIJ A;  1FZG A;  3WUU A;  1FDM A;  1SFC B;  2KI7 B;  1ON3 A;  3L35 A;  2P1J A;  3H1K J;  2QIW A;  4XA4 A;  4W7Z A;  3MD0 A;  2QJP C;  5KLV D;  2ZT9 D;  2CPS A;  3H25 A;  3S4R A;  2W83 C;  1FE6 A;  2FBM A;  5DL1 A;  1AFO A;  1AV1 A;  2H8P D;  3OW2 O;  3BCC D;  4H13 B;  3TSI A;  3HD7 D;  1OD4 A;  2ZQQ A;  2IPP A;  3HUS C;  1YHQ P;  2WPS A;  4Z0M A;  3H1K E;  1DUB A;  1XO6 A;  3CC7 P;  1SQX G;  1BE3 G;  3CWB J;  1O8U A;  2FYU G;  3CL3 D;  1DEB A;  2PPY A;  4WY4 D;  3TLF A;  4JYJ A;  1W2B O;  4KJM A;  1SQV D;  1GL2 B;  5B66 H;  2WTY A;  2JR8 A;  4MOU A;  1S5L E;  3WUT A;  2CK3 H;  2J58 A;  1RH5 B;  3SSU A;  1NWQ A;  1BDC A;  3P7K A;  1RY3 A;  3B5N A;  1BGY J;  4I42 A;  1X22 A;  4TLF A;  3CWB E;  4ZDE A;  2IYO A;  1SQQ D;  3EFG A;  3T8A A;  2ZT9 B;  3A5T A;  1QX8 A;  3L71 G;  1EZV E;  1M56 D;  2J5G D;  3Q1M A;  2M0B A;  1SLQ A;  3L74 D;  3D6Y A;  3FWL A;  4U3F G;  3HD7 B;  3H1J D;  4N78 D;  4L75 A;  3CD6 P;  3KXD A;  3QWD A;  3TDK A;  1BGY E;  3U1C A;  1N7S C;  4KT0 J;  3AE9 C;  1EF8 A;  3BPT A;  2PGD A;  1IFI A;  4EDF A;  4QFE A;  3RBX A;  5GTH E;  4HH2 A;  2N1T D;  4ZKP A;  3WU2 H;  1K73 Q;  3RBZ A;  1GW3 A;  3EQ2 A;  1HNO A;  1LNQ A;  2WT7 A;  1DEE G;  1SQX K;  1FZB A;  2O1J A;  4ELX A;  4H44 D;  3BRV B;  3RK3 E;  2KNC B;  2F6Q A;  2MKV A;  3SFD C;  4IZD A;  2HLO A;  2IBZ D;  3E7K A;  3W68 A;  1ZV8 A;  3G64 A;  1NTZ G;  1PPJ G;  3BAT A;  2E74 C;  3G3Z A;  3W67 A;  3U1A A;  3H1L G;  1VQ4 P;  2KP8 A;  4PD4 H;  1J1D C;  2IDB A;  3O6Q B;  1SQB G;  3WMM 0;  5H2F E;  1L0N G;  3TGU D;  3H1I J;  2QG4 A;  5E79 H;  3MGN A;  5KKZ C;  1QVG O;  3CC4 P;  1TG6 A;  1RQV A;  3TYY A;  1G1J A;  2E42 A;  4U7J A;  5FUS A;  3GLM A;  5BVZ A;  3M9Q A;  1IFP A;  5G1Q A;  1HJ0 A;  2N1T B;  1EY3 A;  2H88 C;  3TVU A;  3AED C;  2W6B A;  2A06 D;  1UII A;  2KSJ A;  2M5A A;  3C9I A;  3L75 J;  3N6R B;  2OTK E;  3H1I E;  3V2N A;  3H1H G;  2PG8 A;  1SZO A;  1SQV K;  1YI2 P;  3CCQ P;  2ZL2 A;  1X0U A;  2DUB A;  4GOF A;  3M06 A;  1YIJ P;  3QXI A;  1JTH B;  4WZ8 B;  5DJT B;  1T3U A;  4ZDB A;  1LTB C;  2JO1 A;  2Q9I A;  1GU5 A;  3L72 G;  4ZDC A;  2OGU A;  3FXE A;  5ING A;  1W2E A;  1SP4 A;  1SQQ K;  2WSC J;  1ZME C;  4RO0 A;  3L75 E;  1EDI A;  3G6E P;  4MXI A;  2YO3 A;  3T88 A;  5KDR A;  5AW5 B;  4I6M C;  3BF0 A;  1RQU A;  1LP1 A;  3VP8 A;  4DZO A;  3ZW8 A;  1NU1 G;  2KYV A;  1NHL A;  1J1E B;  1FZC C;  2Z5I A;  4JCS A;  1SQB K;  2POH A;  1VF5 D;  1EDK A;  3A0B H;  4LC1 A;  3ITK A;  2OYO A;  2FYN B;  5GTI H;  3B5N D;  4JFC A;  2UZF A;  2H89 C;  1L4A A;  5C90 A;  4PD4 I;  3QH9 A;  5CTC A;  3A2A A;  3FXD A;  4UB6 H;  3IBB A;  5HUQ A;  3BVH A;  3AE5 C;  2IBZ I;  1NAY A;  4BXL A;  2Y9Z A;  3M91 A;  1JEK A;  4IOI H;  3V5E A;  1N6F A;  1BCC D;  2NRG A;  4RCN A;  3H1K G;  2ZJS E;  5AW3 B;  3RK2 C;  4EYY Q;  3SWF A;  3M9B A;  4KD6 A;  1VQL P;  2WWW A;  5L8R J;  1VQ7 P;  1AA0 A;  1KTM A;  2ZAE B;  2QE7 H;  1IFM A;  1T8Z A;  2V7Q H;  3KPE A;  4FJW D;  3M0A A;  1KOR A;  2N9Y B;  1QVF O;  5KLV J;  4HNK A;  1VF5 B;  3AE1 C;  3K8X A;  1FJP A;  5E0N X;  4ZMD A;  4NPD A;  1UYT A;  3OT6 A;  5KTB A;  3L70 D;  3BCC J;  5C39 A;  3CWB G;  1KFN A;  3HP0 A;  3I5C A;  4J2U A;  1EZV G;  2QJK C;  1DH3 A;  4W80 A;  3D6Z A;  5KLV E;  1YIT P;  2Z5H A;  1T2K C;  1OX3 A;  4NPF X;  1P84 D;  2KSE A;  5KAI H;  3PLN A;  3V6I A;  4L6W A;  1JY2 O;  4PV1 C;  2ZYD A;  3BCC E;  1OZH A;  1SQV J;  1BGY G;  5B66 E;  4I52 A;  1OVV A;  2E43 A;  1ZP0 C;  5INF A;  2YXR B;  5EFW B;  1H8A A;  3QWO C;  1NJI Q;  1R5L A;  4OH8 B;  3Q2Y A;  2M3E A;  3JC2 2;  4L74 A;  4OGQ D;  3EFF K;  1SQQ J;  2A7S A;  3AEG C;  1DD3 A;  2DW3 A;  3R9Q A;  2WT7 B;  4AQR D;  2FFD A;  1N86 A;  1FJK A;  1LTJ A;  4GHN A;  2C8T A;  1SQV E;  2NPS C;  4M3L A;  4RYF A;  3RK3 C;  2Q6Q A;  1DD4 A;  3L4F A;  4IZC A;  5DTW A;  3O8Z A;  3H1J J;  3TZ3 A;  1N7S A;  3NJD A;  5CCH C;  2H7H A;  1KMI Z;  1NTM D;  3V2Q A;  4FN7 A;  2WSF H;  5KJ7 C;  1YQ3 C;  1SQQ E;  3QRE A;  4BWN A;  2N9B A;  3FDU A;  1AJY A;  5E0S H;  5DJU B;  3G9R A;  1S2E A;  3MUD A;  1X79 B;  3LIE A;  1YQ4 C;  2DEO A;  1D7M A;  3WU2 E;  3H1J E;  4N78 E;  3R4Y A;  5DU8 A;  1S4X A;  5KLI B;  2QSI A;  1QL2 A;  3VMX A;  3VTP C;  5APU A;  1FOS F;  2E76 B;  1XNV A;  3A7O A;  4OVN F;  3CMA P;  1YJW P;  2AXT E;  3Q5R A;  1UIY A;  2M8R A;  2HR3 A;  4OGQ B;  2I8D A;  1K39 A;  2VSS A;  3GF3 A;  5AVU B;  4YTP C;  3H1I G;  1NZY A;  3TV5 A;  2VSU F;  1L4A D;  1PGQ A;  4I1L A;  3IAV A;  4ASW A;  4DT0 A;  1CSB A;  1USE A;  4U19 A;  3TGU J;  1PIX A;  1URQ C;  5E79 E;  3LW5 H;  3MZW B;  4EI2 A;  2BAS A;  5AVV B;  2JWD A;  3HTK A;  2IBZ E;  2KLU A;  2D2C D;  2CBY A;  3T97 A;  1JUN A;  4RKU J;  5KAF H;  2FKW B;  3L75 G;  2VSU E;  3SFE C;  2IEX A;  2QJY C;  5AVW B;  1MV8 A;  4ELW A;  5CCG A;  4H0L C;  1GW4 A;  3AEA C;  3HE5 B;  3TGU E;  4KHX A;  1HUC A;  4WBA A;  1N6D A;  3IAO A;  4K35 A;  2YXQ B;  1HZD A;  1S72 P;  1NVO A;  5C9G A;  3AE6 C;  3P5M A;  3SWK A;  5K5G B;  1CI6 B;  2OYI A;  2ZVO B;  2JJL A;  2ZFC A;  4C7N B;  2W8Z A;  1FDI A;  1SFC C;  1L0L D;  1KB9 D;  3VMY A;  1Q82 Q;  3IF4 A;  4B3J A;  1LTT C;  2A06 E;  3GMA A;  3CPW O;  2JKV A;  1ZN5 A;  4QIJ A;  3GF7 A;  4NPE A;  2WQY C;  2ZYA A;  2B87 A;  2YMY A;  1FZC A;  3PRJ A;  3QK8 A;  3TDC A;  3PTZ A;  5APW A;  2B89 A;  4H13 C;  2D2C B;  1GDT A;  3Q7H A;  2J5I A;  2WMM A;  2F9Y A;  1KB9 H;  1NTM K;  3OME A;  1Q52 A;  4JCR A;  3A0B E;  1KYO D;  4B86 A;  3PE8 A;  4N6J A;  1SG4 A;  4JBZ A;  2FXM A;  1GK6 A;  4LLH A;  1IFJ A;  5GTI E;  4R4M A;  3CCR P;  3SWY A;  2WSE H;  2NZ2 A;  2OYH B;  1UIX A;  1NTK D;  1Q2N A;  2FBW C;  1M1J B;  3BAS A;  3CME P;  3L37 A;  4UB6 E;  5AW1 B;  1FCF A;  1GL2 C;  1ZR2 A;  2V7Q J;  1KYO H;  3HLN 1;  4EMM A;  1RE3 A;  2I1K A;  1FC9 A;  1HBW A;  3CCM P;  5AVQ B;  1OWA A;  1BCC J;  3CX5 D;  2B9B A;  1H0T A;  1UYV A;  2ZXX A;  1LT1 A;  3WUV A;  2ZT9 C;  3S1K A;  5KLV G;  3SWX A;  1WZ8 A;  5DUF A;  3F89 A;  5CMZ A;  3TVW A;  3E1R A;  2ZL0 A;  4RYF H;  3GW6 A;  1KQF B;  4WYO B;  4D6T D;  3BCC G;  3HD7 C;  5AW7 B;  1GK4 A;  3CXH D;  2YMK A;  1BCC E;  3CX5 H;  4DI1 A;  4JJT A;  3KTG A;  2KZI A;  3L70 J;  2L5G B;  1QEX A;  2AEM A;  4Q1I A;  2HFE D;  3WG5 A;  2Q2X A;  2WZ7 A;  2HPC A;  4K3W A;  4WY4 C;  1KFM A;  5DTP A;  2FFD B;  4L73 A;  4WY4 B;  1FZA A;  1LTJ B;  3VMA A;  1SQV G;  1VQ6 P;  3KHU A;  1X0T A;  1PV3 A;  4OMR A;  2R44 A;  1OW7 A;  4HB1 A;  3HE2 A;  5KAI E;  1KB9 I;  3L70 E;  2G8Y A;  5M1B A;  3HIN A;  3GHG B;  4HDT A;  2AXT H;  2MJZ A;  5B5E H;  1L0L K;  3VOP A;  1SQQ G;  3N4X A;  3CCV P;  3OA7 A;  5KJP A;  2K9J A;  5CBO A;  2A7K A;  2XNX A;  2OTJ P;  3R2P A;  1RJN A;  1EQ7 A;  4ZDD A;  2WSF J;  3A3Y B;  3D70 A;  3BEZ A;  1MUU A;  2GA1 A;  3P32 A;  1LWU B;  3H6P A;  1P84 E;  2VRS A;  1JOC A;  3H1J G;  5KLV K;  3CCE P;  2PBP A;  5CCG D;  1HTL C;  1AVY A;  1X8Y A;  3B8E B;  2KLV A;  3M0D A;  1HJB A;  1Q51 A;  2J5U A;  3KYQ A;  1HNU A;  1QLE D;  1LT9 C;  5KJ7 A;  2KUB A;  1VQO P;  5TIS H;  1LT9 B;  1M57 D;  1NTM J;  5AVT B;  1ZW0 A;  3AE2 C;  2N1T C;  3LAO A;  1N73 A;  1YJN P;  4I2L C;  2F6I A;  2Z4E A;  2CE3 A;  3BPP A;  4KPK A;  1NZY B;  1FZF A;  4EMP A;  4A7P A;  5G1S A;  3CCS P;  1NTK K;  3OC7 A;  4DCK A;  4BRY A;  1XNY A;  5DKP A;  1HF9 A;  1S9K D;  3H0Q A;  4H44 B;  1USD A;  1MKM A;  3P8M C;  1KQG B;  3L3S A;  3CX5 I;  1M90 Q;  2IBZ G;  2RKL A;  2ZYG A;  1NTM E;  2R3C A;  3OAK A;  1J2J B;  2VX2 A;  1XNW A;  3T97 B;  1TU3 F;  2VSU C;  2O1K A;  3LW5 J;  3M6N A;  3U9T B;  4Y28 J;  3TT6 A;  1PP9 D;  4YXD C;  1T6A A;  2LXB A;  3AEF C;  3TGU G;  2SPZ A;  2YO2 A;  4RES B;  4JWV A;  3HE4 A;  5INI A;  5CBN A;  5CHX A;  1PGP A;  1RE4 C;  4OG1 A;  3DJA A;  1J1E C;  2FW2 A;  2FXO A;  1M7L A;  2OYI B;  3H32 A;  2ZXE B;  3AEE C;  2I1J A;  1G2C A;  1JMB A;  3TNU A;  1K9M Q;  2HOD A;  4ELS A;  2FYN C;  2YJG A;  4NNQ A;  2A06 G;  3NMD A;  1VPC A;  5JBW A;  5KAF E;  3E1I A;  2BCC D;  4NAR A;  3H81 A;  4Y99 C;  2P10 A;  3B4S A;  1JY3 P;  2B87 B;  1RF1 A;  4Y99 B;  1VQ5 P;  3PH0 A;  4YLH A;  2W27 A;  1KIL A;  3MTU E;  2J5I B;  2F9Y B;  3Q5S A;  5APS A;  2ITA A;  1LTI C;  1JCC A;  2HW5 A;  1L0L J;  3P8C D;  5APT A;  1EXJ A;  2NP9 A;  2A45 H;  1HH0 A;  1BDD A;  2Q34 A;  1RHZ B;  4FB8 A;  3I56 P;  3PHL A;  3STA A;  1T2K D;  4ASV A;  5BU8 B;  1VF5 C;  2QRX A;  1PL5 A;  3CI9 A;  4PV1 D;  2WSE J;  4WVZ A;  5AW2 B;  5AW0 B;  2M3B A;  1QL1 A;  3IB9 A;  4U0G A;  5AW4 B;  1L0L E;  3HUS A;  1M8O B;  1KB9 E;  2QM7 A;  3B5N B;  1H0T B;  3Q1T A;  2XU6 A;  3A0H E;  1VL2 A;  1GMJ A;  3PJS K;  1SQP D;  1Y9B A;  2HYN A;  2GM4 A;  3ISA A;  2BEQ D;  3JU1 A;  1LTG C;  3OJA B;  1NTK J;  2J5I I;  1IO4 A;  5IKL B;  5APV A;  3P2L A;  5AVX B;  2P58 A;  5AW6 B;  1BCC G;  2E5Y A;  3QMJ A;  3VYI A;  1KYO E;  1NOH A;  4F47 A;  4I7Z B;  2WPQ A;  3U9R B;  1IZN B;  1JM0 A;  3RL0 D;  1NTK E;  3AE3 C;  1P84 H;  4XE5 B;  1UYR A;  1PGJ A;  2K9Y A;  4D6T J;  3L70 G;  3L74 J;  1HGZ A;  1G1I A;  3CLQ A;  4HYT B;  3CCJ P;  2QA4 P;  3CX5 E;  2WPR A;  1YG6 A;  1JB0 J;  2A45 I;  2K9J B;  3I47 A;  1N8R Q;  2OQQ A;  1A02 J;  1FC6 A;  1M1K Q;  3VN0 A;  3TT7 A;  1X9V A;  3L73 D;  3ZWA A;  2VSS F;  4D6T E;  2R5B A;  1XTG B;  1N2D C;  2BEZ F;  3ST9 A;  1SVF A;  4EML A;  1FZE A;  3U59 A;  3L74 E;  4DOJ A;  1H88 A;  1K32 A;  3CXH E;  1ON9 A;  5KLI C;  3V2P A;  2C9L Y;  2YKP A;  2E75 D;  1JNM A;  2E76 C;  2H43 A;  3UIA A;  1KZU B;  5AW9 B;  3RGU A;  1FC2 C;  4C46 A;  2Q35 A;  2ZVN B;  4OGQ C;  1MFT A;  4JOT A;  4IL6 H;  2J5G A;  1N73 B;  5B5E E;  3RL0 B;  1JMM A;  2VSS E;  3Q5P A;  2FYZ A;  2KOG A;  1J7X A;  1OW6 A;  1R5S A;  3LKE A;  3HRN A;  4ZDF A;  2M5A B;  4JYB A;  4BRY B;  2QVA A;  1NO4 A;  1XX4 A;  1S3J A;  1EDJ A;  3C8V A;  4MN4 C;  1RJM A;  4L76 A;  1LGH B;  3TK1 A;  1NTM G;  1NKN A;  2R3S A;  1KIL D;  4ZKU A;  2D3T A;  2WVR A;  4IFF A;  1YG8 A;  5TIS E;  1Q7Y Q;  3KQF A;  4I4Z A;  2B88 A;  1SQP K;  1P84 I;  1GU4 A;  1BSH A;  4JCT A;  1K8A Q;  5KDR B;  1K05 A;  2K1A A;  3AE8 C;  5CJ4 A;  2X58 A;  3Q0G A;  1LP1 B;  1T3J A;  2E75 B;  4EOT A;  1JTH A;  4U18 A;  3H0J A;  1ZXG A;  1ZLL A;  2F9I A;  1Q90 D;  3KTH A;  1W5C E;  1GTW A;  2VSU A;  2L91 A;  1G2C B;  3TNU B;  3FF6 A;  2HOD B;  2IFN A;  1FC7 A;  1DIP A;  4GOD A;  3CCU P;  4IZB A;  1L4A C;  4Q0G A;  3D71 A;  3R9T A;  1L4A B;  1PP9 J;  1SQX D;  1BE3 D;  1K04 A;  3AEB C;  2FYU D;  1RF1 B;  3T3W A;  1HGV A;  3R9S A;  1Q86 Q;  2BZR A;  3GG2 A;  2RH0 A;  4JF7 A;  1YJ9 P;  1S9K E;  4QMA A;  1IK7 A;  1KIL B;  1E79 H;  4KWB A;  2D2C C;  3VMZ A;  2W6A A;  5G1R A;  4U0G H;  2XKM A;  1R8E A;  3MYB A;  2VRE A;  1NH4 A;  4U1A A;  3USS A;  3PZK A;  4B3I A;  3A0H H;  4ZU2 A;  1PP9 E;  2GUV A;  3AEC C;  3F5H A;  1RF0 C;  1KC8 Q;  2BCC J;  2OYH C;  2QJP B;  2KS1 A;  3L71 D;  4K29 A;  1M1J C;  4GDO A;  4JSB A;  3CCL P;  1JY2 N;  2KIK A;  4U3F D;  1FBM A;  4N3Y B;  2IFM A;  1L0L G;  3HUS B;  2W6J H;  4JYL A;  1N7S D;  4L8K A;  2PFX A;  5AW8 B;  2BCC E;  4JVT A;  3NFQ A;  2YKO A;  2FZS A;  4OLQ A;  1OVU A;  2J59 M;  2Y0C A;  2K37 A;  2GTR A;  1OMI A;  4AUW A;  1EF9 A;  3L36 A;  2Q1K A;  1KV4 A;  4GT1 A;  1DX7 A;  2Q5U A;  2UWJ E;  3BRT B;  4IL6 X;  4AYC A;  4CPG A;  3P8C E;  3NTN A;  3P85 A;  1IFD A;  4FZW C;  1NTZ D;  1PPJ D;  5AVZ B;  1NTK G;  2JP3 A;  3LID A;  2E74 D;  3H1L D;  1SQP J;  1KD1 Q;  2FFD C;  1LTJ C;  4RJT A;  4JPZ B;  2W90 A;  4K2N A;  1WT6 A;  1SQB D;  3CXH H;  1L0N D;  3VP9 A;  3M6M A;  1OW8 A;  4G2R A;  2X24 A;  3Q3D A;  1FDO A;  1N7S B;  3GHG C;  1WDM A;  3V4W A;  1Y7O A;  2KXP B;  3GKB A;  5TJH A;  4QII A;  1SQP E;  3B71 A;  1XTC C;  4FND A;  3MUD C;  2FYU K;  4GKG A;  4D6T G;  1LWU C;  3MP7 B;  4PD4 D;  3FX0 A;  3L74 G;  1EXI A;  3DOR A;  2NPS A;  3H1H D;  1WMK A;  3TF5 A;  3JCU H;  1IFN A;  1WDL A;  2WPV B;  3PGQ A;  5JBX A;  1KYO I;  2IX7 C;  1MJ3 A;  5CCH A;  5FIF A;  1Y8A A;  2FXP A;  3S9O A;  3H02 A;  3L72 D;  5DU6 A;  3RSI A;  4IFM A;  1FS0 E;  1MZ9 A;  2PRR A;  2E74 B;  2JEE A;  1Y47 A;  2O3J A;  1GD2 E;  2JDI H;  3G71 P;  3N7N A;  3IFM A;  1J1D B;  2LR2 A;  4UB8 H;  4YPC A;  3ZWB A;  3L73 J;  4LGD E;  2G3A A;  4YXW H;  4K3A A;  3U9S B;  4W7Y A;  3KZI E;  3SLL A;  5KKZ B;  4H44 C;  3KTI A;  3QYR A;  1NU1 D;  2IZ0 A;  4ZNC A;  3H0U A;  1ZRT D;  1NKZ B;  3T89 A;  2EJ5 A;  5AVS B;  2E5T A;  1VQ9 P;  1IJD B;  3HTK B;  2O01 H;  1VQ8 P;  1CW5 A;  3V2R A;  3K50 A;  3KDP B;  5E0S A;  1Z56 A;  2LXC B;  1AQT A;  4IL6 E;  5DZK A;  3L73 E;  5CCG C;  1QGK B;  1AQ5 A;  3CXH I;  4MI2 A;  4FNB A;  1PGO A;  2F9I B;  2OYI C;  4TT3 H;  1CZQ A;  1URQ A;  4WWI A;  3TRR A;  4IFD K;  4Z1M H;  4O9B A;  5APQ A;  1OFC X;  1KQS O;  4HC8 A;  3VIV A;  1GZL A;  3H1K D;  3RRV A;  4B3H A;  5AVY B;  2K3R A;  3RK2 D;  1HWT C;  3RST A;  4WB4 A;  1NTZ K;  3JSV C;  1ZR4 A;  2YKQ A;  1DCI A;  3HE5 A;  5DU4 A;  2QQ3 A;  2Q7C A;  4GIF A;  2KZJ A;  4NEK A;  1JY3 O;  2AXC A;  4WCZ A;  2XND H;  1CI6 A;  1L0N K;  2WIT A;  5APY A;  1FZC B;  3CC2 P;  2C0W A;  2IZ1 A;  3ZW9 A;  4C7N A;  1KIL E;  1HVV A;  2OAR A;  3H0S A;  1SFC A;  1PP9 G;  1OVR A;  3CWB D;  3KTK A;  3FGA D;  4PJ0 E;  3KTJ A;  1YTZ I;  3T8B A;  2IYP A;  1EZV D;  2KS1 B;  1SQX J;  1BE3 J;  2K88 A;  2FYU J;  1W2X A;  3RL0 g;  1S5L H;  1WRG A;  1YBK A;  4C7R A;  4R4L A;  1S1C X;  1RE3 C;  1KN7 A;  1BGY D;  1FAV A;  1BSN A;  4LK5 A;  3II6 A;  3RK2 B;  3V5B A;  3B5N C;  2A81 A;  2BCC G;  1RF0 A;  3ZDM A;  1NAF A;  2OYH A;  1SQX E;  2XDJ A;  1BE3 E;  2PP6 A;  5CJ0 A;  1EDL A;  2A45 G;  3I55 P;  5CTB A;  1E5W A;  3AE4 C;  1M1J A;  2FYU E;  5APX A;  1OD2 A;  3ZWC A;  3L71 J;  1L2P A;  3M9H A;  4HJG H;  1GL2 A;  3EWK A;  1NGM B;  2NPS D;  1NU1 K;  3RK3 D;  1AVO A;  4U3F J;  3G4S P;  1U7M A;  1OIP A;  2ZL4 A;  5AVR B;  4U0H A;  2ZQR A;  5GTH H;  5CCH D;  3QXZ A;  2GUS A;  5MGB A;  4I7Z C;  5KJ7 D;  1EC5 A;  2QJK B;  2HPC B;  2YIU C;  2XZR A;  3K5B A;  2KK7 A;  2AEF A;  3L71 E;  1ZOY C;  2YIU B;  3MHV A;  2OTL P;  1JY2 P;  4JQ0 D;  2RN0 A;  4PV1 B;  3HD7 A;  1N6E A;  4U3F E;  3PEA A;  4XFJ A;  2R32 A;  2E76 D;  1JCD A;  4ASI A;  1SQP G;  4FZW A;  4JYC A;  4WY4 A;  3MOY A;  1PFI A;  5H2F H;  3MIW A;  1JXZ A;  1NTZ J;  2Q3E A;  2WSS H;  1A02 F;  3H1I D;  3H1L J; 
#chains in the Genus database with same CATH homology
 5G1R A;  4U0G H;  1R8E A;  3MYB A;  5KJP A;  2VRE A;  3IBB A;  2A7K A;  1RJN A;  5HUQ A;  4U1A A;  4ZDD A;  2WSF J;  2W3P A;  3PZK A;  3AE5 C;  3D70 A;  1NYH A;  3BEZ A;  3MFM A;  4B3I A;  4ZU2 A;  1U57 A;  3QKA A;  3AEC C;  3NJB A;  2PBP A;  2J5S A;  3V5E A;  1N6F A;  4RCN A;  1Q51 A;  4K29 A;  2J5U A;  1TYF A;  5DZK H;  5DUC A;  1HNU A;  4GDO A;  4KD6 A;  4JSB A;  5L8R J;  1KTM A;  3O6Q A;  3AE2 C;  4H0L D;  4FJW D;  3LAO A;  1KOR A;  2F6I A;  3HRX A;  4KPK A;  2CE3 A;  3BPP A;  4JYL A;  1NZY B;  4HNK A;  4EMP A;  1VF5 B;  3AE1 C;  5G1S A;  4L8K A;  3K8X A;  4JVT A;  5E0N X;  3OC7 A;  2FZS A;  1UYT A;  3OT6 A;  4OLQ A;  1XNY A;  5DKP A;  1HF9 A;  3H0Q A;  4H44 B;  1MKM A;  1KQG B;  3L3S A;  2GTR A;  3HP0 A;  2O01 J;  3ABV C;  1OMI A;  1VRG A;  2VX2 A;  1XNW A;  3T97 B;  4J2U A;  1TU3 F;  2VSU C;  1S5L X;  1EF9 A;  3Q0J A;  2QJK C;  3LW5 J;  2E75 C;  3M6N A;  4FN8 A;  1UYS A;  3U9T B;  3D6Z A;  3R0O A;  4Y28 J;  3TT6 A;  4YXD C;  4IL6 X;  3AEF C;  4L6W A;  4PV1 C;  4H13 D;  4KNP A;  3P85 A;  4JWV A;  4FZW C;  3AE7 C;  4I52 A;  2JP3 A;  5INI A;  2E74 D;  4OG1 A;  3DJA A;  4JCQ A;  1ZP0 C;  3R6H A;  2FW2 A;  5INF A;  2ZL3 A;  3AEE C;  4K2N A;  3V5I A;  1WDK A;  3Q2Y A;  4H0L B;  3M6M A;  3MT6 A;  1OW8 A;  4OGQ D;  4G2R A;  3IN6 A;  2A7S A;  2X24 A;  3AEG C;  3Q3D A;  4ELS A;  2FYN C;  1DD3 A;  2WTB A;  1PJH A;  3R9Q A;  2YJG A;  4NNQ A;  1FDO A;  1WDM A;  4GM2 A;  5JBW A;  1Y7O A;  4GHN A;  2C8T A;  3GKB A;  4NAR A;  1ZRT E;  3H81 A;  4RYF A;  2P10 A;  4QII A;  1DD4 A;  4IZC A;  5DTW A;  3TZ3 A;  3B71 A;  4FND A;  3NJD A;  1ON3 A;  1KMI Z;  4YLH A;  4FN7 A;  2J5I B;  2QIW A;  1EXI A;  3DOR A;  2F9Y B;  3Q5S A;  1YQ3 C;  1WMK A;  3QRE A;  2QJP C;  3FDU A;  2ZT9 D;  2WPV B;  1WDL A;  1AJY A;  3PGQ A;  5JBX A;  5E0S H;  3H25 A;  3G9R A;  1MJ3 A;  2FBM A;  2HW5 A;  5DL1 A;  5FIF A;  1YQ4 C;  2FXP A;  3S9O A;  1EXJ A;  4H13 B;  2DEO A;  2NP9 A;  3H02 A;  2Q34 A;  1OD4 A;  5DU6 A;  3RSI A;  4FB8 A;  2E74 B;  2ZQQ A;  3R4Y A;  3STA A;  5DU8 A;  2QSI A;  4Z0M A;  2E76 B;  1DUB A;  1VF5 C;  1XNV A;  1XO6 A;  1PL5 A;  4PV1 D;  2WSE J;  3ZWB A;  3Q5R A;  1O8U A;  1UIY A;  2G3A A;  4OGQ B;  3U9S B;  1K39 A;  3SLL A;  3IB9 A;  2VSS A;  2PPY A;  4U0G A;  4H44 C;  3KTI A;  3TLF A;  4JYJ A;  3GF3 A;  3QYR A;  4YTP C;  1NZY A;  3TV5 A;  2VSU F;  3H0U A;  3Q1T A;  3T89 A;  2EJ5 A;  1VL2 A;  3IAV A;  1GMJ A;  4MOU A;  4U19 A;  1Y9B A;  3K50 A;  3ISA A;  2BEQ D;  5E0S A;  3JU1 A;  1PIX A;  4I42 A;  2J5I I;  5DZK A;  4ZDE A;  5IKL B;  2D2C D;  3P2L A;  2CBY A;  3T8A A;  2ZT9 B;  4RKU J;  4MI2 A;  4FNB A;  2VSU E;  2J5G D;  3QMJ A;  3Q1M A;  2F9I B;  3SFE C;  4TT3 H;  2IEX A;  3TRR A;  3D6Y A;  4Z1M H;  2QJY C;  4F47 A;  4ELW A;  4H0L C;  4I7Z B;  3U9R B;  3AEA C;  3QWD A;  1N6D A;  4HC8 A;  3IAO A;  3VIV A;  3RRV A;  4B3H A;  1HZD A;  3AE3 C;  5C9G A;  3AE6 C;  4KT0 J;  3P5M A;  3RST A;  3AE9 C;  1EF8 A;  3BPT A;  1UYR A;  1DCI A;  4QFE A;  5DU4 A;  2K9Y A;  2QQ3 A;  1FDI A;  4NEK A;  4WCZ A;  1HNO A;  4B3J A;  3GMA A;  3ZW9 A;  4QIJ A;  1KIL E;  3GF7 A;  1YG6 A;  1JB0 J;  2WQY C;  4ELX A;  3I47 A;  4H44 D;  2OQQ A;  3RK3 E;  1FC6 A;  3H0S A;  2F6Q A;  2MKV A;  3TT7 A;  3SFD C;  3QK8 A;  3TDC A;  4IZD A;  3ZWA A;  3KTK A;  2VSS F;  4H13 C;  2D2C B;  3FGA D;  3Q7H A;  2J5I A;  3KTJ A;  2BEZ F;  3ST9 A;  4EML A;  3T8B A;  3G64 A;  2F9Y A;  1K32 A;  2E74 C;  3OME A;  1ON9 A;  1Q52 A;  4JCR A;  5KLI C;  2E75 D;  2E76 C;  1W2X A;  3RL0 g;  3PE8 A;  1SG4 A;  2IDB A;  4R4L A;  2Q35 A;  4R4M A;  1S1C X;  4OGQ C;  4JOT A;  2NZ2 A;  5KKZ C;  2J5G A;  1UIX A;  4LK5 A;  2FBW C;  2VSS E;  3Q5P A;  1TG6 A;  1RQV A;  4U7J A;  1OW6 A;  1J7X A;  1FCF A;  2A81 A;  3LKE A;  5FUS A;  3GLM A;  4ZDF A;  2V7Q J;  3HLN 1;  4EMM A;  5G1Q A;  1HJ0 A;  5CTB A;  3AE4 C;  1XX4 A;  1EY3 A;  2H88 C;  1FC9 A;  3TVU A;  3C8V A;  1RJM A;  3AED C;  1OD2 A;  3ZWC A;  3N6R B;  3EWK A;  1NGM B;  1UYV A;  2D3T A;  2PG8 A;  2ZT9 C;  1SZO A;  3SWX A;  1WZ8 A;  2ZL2 A;  1YG8 A;  5DUF A;  1X0U A;  2DUB A;  3KQF A;  4I4Z A;  3TVW A;  2ZL4 A;  4U0H A;  2ZQR A;  2ZL0 A;  3QXI A;  4RYF H;  4WZ8 B;  1KQF B;  3QXZ A;  4WYO B;  4ZDB A;  2JO1 A;  4JCT A;  5KDR B;  5MGB A;  4I7Z C;  1K05 A;  3AE8 C;  2YMK A;  4ZDC A;  2X58 A;  2YIU C;  3Q0G A;  5ING A;  2E75 B;  1ZOY C;  4U18 A;  3H0J A;  2WSC J;  1ZME C;  3KTG A;  4JJT A;  4DI1 A;  2F9I A;  4MXI A;  4Q1I A;  3T88 A;  1Q90 D;  3KTH A;  3WG5 A;  5KDR A;  2Q2X A;  4PV1 B;  2VSU A;  3BF0 A;  1N6E A;  1RQU A;  4K3W A;  3FF6 A;  3PEA A;  4XFJ A;  1FC7 A;  5DTP A;  3ZW8 A;  1DIP A;  2E76 D;  4IZB A;  4Q0G A;  4JCS A;  4ASI A;  3D71 A;  1VF5 D;  3R9T A;  1PV3 A;  1K04 A;  4OMR A;  3AEB C;  4FZW A;  1OW7 A;  3HE2 A;  3T3W A;  3R9S A;  2BZR A;  2G8Y A;  3MOY A;  5M1B A;  1JXZ A;  3HIN A;  4JFC A;  1IK7 A;  4HDT A;  2UZF A;  2H89 C;  5C90 A;  4KWB A;  2D2C C;  5CTC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...