1PIXA

Crystal structure of the carboxyltransferase subunit of the bacterial ion pump glutaconyl-coenzyme a decarboxylase
Total Genus 219
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
219
sequence length
586
structure length
586
Chain Sequence
GFYSMPRYFQNMPQVGKPLKKADAANEEQLKKIEEEIHQLIKEAQEAGKADADVNKRGELTALQRIEKLVEPGSWRPLNTLFNPQGNKNGSVAIVKGLGRVNGKWCVVVASDNKKLAGAWVPGQAECLLRASDTAKTLHVPLVYVLNCSGVKFDEQEKVYPNRRGGGTPFFRNAELNQLGIPVIVGIYGTNPAGGGYHSISPTVIIAHEKANMAVGGAGIMGGMNPKGHVDLEYANEIADMVDRTGKTEPPGAVDIHYTETGFMREVYASEEGVLEGIKKYVGMLPKYDPEFFRVDDPKAPAFPADDLYSMVPLNDKRAYDIYNVIARLFDNSELHEYKKGYGPEMVTGLAKVNGLLVGVVANVQGLLMNYPEYKAAGSVGIGGKLYRQGLVKMNEFVTLCARDRLPIVWIQDTTGIDVGNDAEKAELLGLGQSLIYSIQTSHIPQFEITLRKGTAAAHYVLGGPQGNDTNAFSIGTAATEIAVMNGETAATAMYSRRLAKDRKAGKDLQPTIDKMNNLIQAFYTKSRPKVCAELGLVDEIVDMNKIRGYVEAFTEAAYQNPESICPFHQMILPRAIREFETFVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutaconyl-CoA decarboxylase A subunit
publication title Crystal structure of the carboxyltransferase subunit of the bacterial sodium ion pump glutaconyl-coenzyme A decarboxylase
pubmed doi rcsb
source organism Acidaminococcus fermentans
molecule tags Lyase
total genus 219
structure length 586
sequence length 586
chains with identical sequence B
ec nomenclature ec 4.1.1.70: Transferred entry: 7.2.4.5.
pdb deposition date 2003-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01039 Carboxyl_trans Carboxyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.680 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Helix bin 1pixA01
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1pixA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1pixA03
3KTGA 5DU6A 3P85A 3QMJA 1Q51A 3WG5A 4I52A 3TVUA 3U9TB 1J7XA 3KTHA 2DUBA 4ZDCA 2J5GA 3Q0GA 4JJTA 5E0NX 5E0SH 5DKPA 3R0OA 1UYTA 4L8KA 1N6EA 4FNDA 5INGA 3H81A 2J5II 3RSIA 2J5IA 3NJDA 4OLQA 2Q35A 4MOUA 1UYRA 4FN7A 3ZWCA 2J5SA 3KTIA 4U0GH 3G64A 5FIFA 1PJHA 2GTRA 3QXZA 4U19A 1WDMA 2BZRA 4K3WA 3P5MA 3SWXA 5DZKA 3OMEA 5KDRB 1HZDA 3PZKA 3MFMA 3TVWA 5G1SA 2VSUC 5KDRA 4KPKA 3I47A 4F47A 1HNUA 2VSSA 4QIIA 3LKEA 3MT6A 1K32A 3M6MA 4RYFH 1Y7OA 1RJNA 5FUSA 4NNQA 5DTPA 5CTCA 5CTBA 3K8XA 3BF0A 3QXIA 5JBWA 3KTKA 1FC9A 2Q2XA 3OT6A 3T3WA 2A7KA 4FNBA 4JWVA 3H0QA 1RJMA 4QFEA 4I42A 1O8UA 3T8AA 2FZSA 4ZDFA 4FZWA 3R9SA 1X0UA 3RRVA 4JVTA 2ZL0A 2WTBA 4ZDDA 4U1AA 5DUFA 4JCRA 4FB8A 3HP0A 4K2NA 3FF6A 2VX2A 4IZCA 4WZ8B 1HNOA 2F9IA 3KTJA 3GMAA 1XX4A 1ON3A 3QKAA 2VREA 4JFCA 1XNYA 3MOYA 3LAOA 4MI2A 4I4ZA 2F9YB 2PPYA 2UZFA 4Q0GA 4GM2A 4ZU2A 1DCIA 3QYRA 3ZW9A 3PE8A 4WYOB 2VSUF 2VSSF 3ZWBA 2ZL4A 3TV5A 5MGBA 1SG4A 1WZ8A 2D3TA 3ZWAA 4L6WA 4FJWD 4GHNA 5G1QA 2PBPA 5DL1A 3OC7A 2X58A 4B3JA 3T8BA 3VIVA 4FN8A 5INIA 4EMPA 2C8TA 3GKBA 3QREA 1N6DA 1FC6A 2W3PA 3IBBA 3K50A 4KNPA 2QQ3A 4JCSA 5DZKH 1NZYB 4RCNA 2IEXA 1YG6A 3Q7HA 2A81A 4JCTA 3NJBA 1EF9A 4ZDBA 1UIYA 3R9TA 2ZL3A 2F6IA 4JCQA 2CBYA 1XNVA 3HRXA 1YG8A 5C90A 3TZ3A 1Q52A 3HE2A 3TT7A 4FZWC 3GF7A 2NP9A 2ZQRA 4G2RA 4U0HA 2FW2A 4HC8A 3N6RB 5KJPA 1DUBA 4MXIA 3Q1TA 3M6NA 3SLLA 1OD4A 1K39A 5C9GA 3R9QA 4JYLA 3ST9A 3TRRA 2ZL2A 4EMMA 1PIXA 5IKLB 5DU4A 3TLFA 1EF8A 3BPPA 3U9RB 1WDLA 5JBXA 1ON9A 3GF3A 1FC7A 1OD2A 5E0SA 1TG6A 2F9YA 4QIJA 4IZBA 3ISAA 2F6QA 4U18A 4ELSA 3R6HA 1TYFA 3H0UA 4IZDA 3DJAA 3V5IA 1XO6A 4Z0MA 2ZQQA 2PG8A 1XNWA 3TDCA 3BEZA 2DEOA 5DUCA 4K29A 3IAVA 2J5GD 2J5IB 3TT6A 2CE3A 3T89A 3MYBA 4U0GA 3IB9A 3H0JA 3DORA 4ASIA 3KQFA 1UYVA 1WDKA 5G1RA 5INFA 5DTWA 2VSUE 3HINA 4LK5A 2VSSE 3H0SA 4YLHA 4B3HA 4JOTA 5DU8A 4B3IA 1UYSA 1SZOA 3RSTA 1VRGA 4NEKA 4KWBA 2EJ5A 4RYFA 3QWDA 3STAA 1NZYA 1W2XA 3U9SB 3HLN1 3T88A 4Q1IA 4ZDEA 1N6FA 2VSUA 2A7SA 3JU1A 4HNKA 3Q0JA 4KD6A 2X24A 4JSBA 4OG1A 3V5EA 3PEAA 1FCFA 3ZW8A 3L3SA 1EY3A 3QK8A 4DI1A 4OMRA 1JXZA 3FDUA 2HW5A 3P2LA 3GLMA 4ELWA 4WCZA 4JYJA 1MJ3A 4EMLA 4ELXA 3H02A 2FBMA 2Q34A 3PGQA 2F9IB
chains in the Genus database with same CATH superfamily
1LTGC 1DX7A 3CCVP 3GHGC 1OZHA 3WG5A 5TISH 2ZYAA 4D6TE 1QX8A 2KS1B 1Y8AA 1NTKD 2O01N 3TVUA 3U9TB 2DUBA 4JBZA 1LTJB 4ZDCA 2H8PD 1GDTA 1SQBK 2PRRA 4C7RA 2A45H 2W6AA 1KILB 4PD4D 5E0SH 1LTJA 2WSCJ 2FYUG 5CJ0A 3R0OA 1P84E 4L8KA 4FNDA 3LIDA 4C7NB 2WTYA 1NOHA 3BCCD 1CW5A 2K1AA 2R3SA 3H81A 3VMYA 3RSIA 3IN6A 4C7NA 4MOUA 1L4AC 2ZJSE 1L2PA 4OWFA 3V2RA 1GK4A 4AYCA 3LW5J 4ZKPA 4U0GH 1HJ0A 2O01H 2GTRA 1RQUA 1SQPG 1UIXA 2RN0A 2C0WA 1NU1J 2O1JA 1GW3A 3P32A 1RF0A 2IZ1A 1BCCE 3TGUJ 3TVWA 2VSUC 1SQPJ 1FZFA 2YXRB 4F47A 5B66E 2R32A 1IFMA 1FZBA 3MT6A 1NAYA 1Y7OA 1EDLA 5FUSA 1IFPA 4NNQA 3H32A 3H1LE 1SQBE 5DJTB 3RK3C 3K8XA 2E75B 3H1IE 1YTZT 1FS0E 3KHUA 1HWTC 3H0QA 3HUSC 4I42A 1SLQA 3MUDA 1O8UA 3T8AA 4ZDFA 1X0UA 2QM7A 2ZL0A 1NGMB 2WZ7A 2WTBA 4HKZH 3VMXA 3P8CE 1X8YA 5KTBA 1HGZA 2IBZG 4K2NA 2VX2A 4IZCA 3WU2E 3B4SA 1YJ9P 1PPJD 5KLVG 3QKAA 3B5NB 3E1IA 1SQPD 2AXTH 1SQXE 1K73Q 1S72P 3RK2B 4GOFA 4I4ZA 1LTSC 1KMIZ 3HTKB 4GM2A 2OYIC 3BVHA 1DCIA 2QEXP 2B87A 1M1JB 4I7ZB 3L36A 1NTMJ 1M1JA 1SG4A 5AVRB 2Q6QA 1WZ8A 4UB6E 3SFDC 2D3TA 2ZYGA 2E76C 3ZWAA 3RK2D 4Z1MH 1U7MA 3PH0A 5BU8B 2OYOA 5CMZA 3MD0A 2IZ0A 3T8BA 4L74A 4BRYB 4TT3H 1VQMP 2FXMA 2K37A 5CCGC 1GMJA 3GKBA 4WY4C 1N6DA 2W3PA 1S2EA 3NFQA 4GDOA 5APQA 2XZRA 3AECC 5DZKH 2IBZD 1NZYB 1Y47A 5APUA 5AW7B 2P67A 1YG6A 1YYCA 4KT0J 3WUUA 2C9NY 4OH8B 1FJPA 1E79H 4JCTA 3AEFC 1EF9A 3R9TA 1RE4A 3S9OA 2M3EA 3H6PA 2MKVA 1NTMD 3KQGA 3L71E 4H44B 2NPSB 2JO1A 3L72J 3TZ3A 3HE2A 3GF7A 1W5CE 2W6JH 4QMAA 3IFMA 2W90A 3SWFA 3L74E 2NPSA 1NH4A 3QH9A 3V4QA 1VQ9P 3IAOA 1JTHB 5AVQB 1FDIA 1VQ6P 1KN7A 4D6TG 1KQLA 2K9YA 1VF5B 4ZKUA 3SLLA 4H44D 4IL6X 3NXSA 3V2QA 5C9GA 5AW1B 3A0BE 1OWAA 3PP5A 1RF1B 3H1HJ 2JJLA 1AJYA 1NU1K 4H0LB 1ZR2A 1EZVE 1ZW0A 1IK9A 1LTJC 4NPDA 3CWBE 3H25A 1EF8A 4PD4H 5JBXA 1USEA 3GF3A 1FC7A 2Y9ZA 1KILC 5E0SA 4A7PA 3CX5E 1T2KC 3GHGA 2F6QA 3KXDA 3L70E 4N78D 4NARA 4IZDA 2QE7H 3L72D 3RBXA 4R4MA 3AE1C 1T6AA 4H0LD 2YXQB 2YJGA 2ZXXA 3P8MC 1OFCX 3TDCA 1GZLA 5AVVB 1FDMA 5DUCA 1M1KQ 1HTLC 1OVVA 5CCHA 4K29A 1DD4A 3A0HH 4U3FE 4LLHA 1H0TB 2KNCB 3MYBA 3S1KA 4U0GA 3H0JA 3DORA 4ASIA 5GTIH 2BCCE 3KQFA 1BCCG 1H0TA 1JY2O 1EDJA 2KNCA 3PRJA 1G1IA 1FZEA 4W7ZA 1GK6A 4EOTA 4YLHA 3H1HD 2C0XA 1L4AA 1L0NJ 3BRVB 2KXPB 2QA4P 5DU8A 4B3IA 3M9BA 4C46A 3B8EB 4I6MC 1FE6A 1LWUB 2WSCH 1VRGA 4NEKA 3H1LG 1SQBG 1SQQJ 3I55P 2EJ5A 4OVNF 3T88A 3RGUA 4GOEA 1KFMA 4AQRD 2E75C 2VSUA 3JU1A 2HYNA 3H1IJ 3HRNA 2IYPA 3BPTA 1SFCB 2JWDA 4RO0A 4AUWA 5DJUB 4JF7A 1HVVA 1FCFA 2FYNB 3H1JE 3A2AA 4JQ0D 4DI1A 5CJ4A 3AE8C 3CL3D 3L73J 4OMRA 1JXZA 3P2LA 3GLMA 1K04A 1OX3A 2M5AA 4IFDK 1VQNP 1MJ3A 4JYJA 1SQXG 4CPGA 3HUSA 3H02A 3USSA 1FC2C 2ZT9B 2AEFA 1L0ND 1TU3F 3VP8A 3SWYA 3B5NC 2A06D 4XE5B 1BCCD 4YXWH 5DU6A 3RK2C 1ZMEC 1SQQD 2ZVNB 3S4RA 3A5TA 1FAVA 1HUCA 2P58A 2QSIA 3CD6P 4UB8E 2W27A 1M1JC 4I7ZC 2J5GA 1N86A 1S4XA 1HJBA 3H1LD 2ZT9D 4HH2A 1KB9D 1CSBA 3H1ID 5DKPA 3H1KE 1A02J 3VTPC 2Y0CA 1JO5A 2OYIA 5B5EH 5APXA 5INGA 1VPCA 3L73D 2PFXA 3RL0g 4J2UA 2O3JA 1LGHB 2D2CD 3AE7C 3CXHD 3SSUA 1JMBA 1JY2N 3QXZA 1CI6B 1JB0J 1OVRA 2RMZA 1BE3G 3SWXA 5DZKA 5KDRB 2ZVOB 3CMEP 1SQXD 4GODA 1GW4A 5KAIH 4ASWA 3TNUB 1J2JB 1FBMA 3L71G 3MFMA 1LTBC 2OARA 5KDRA 1VQ4P 4WY4A 4KPKA 3I47A 4PV1B 1SP4A 3OA7A 2KSEA 3V2NA 2VSSA 1ZP0C 4QIIA 3LKEA 3L74G 1N7SB 1SQVJ 4H44C 2NPSC 2XNXA 1RJNA 1KFNA 1T3UA 3KTKA 5JBWA 1GD2E 2E5TA 1FC9A 1XTGB 3OT6A 2IFMA 5TISE 3T3WA 4JWVA 2L91A 1S5LH 2OTJP 1R5LA 1VF5C 3EQ2A 2BASA 4BWNA 2WPRA 1EZVG 1N7SD 2DW3A 4L73A 3FXEA 1RF1C 2I1KA 1ZV8A 2Z5IA 4JCRA 4H0LC 1G2CB 3M06A 4PD4I 3FF6A 1PP9J 4WZ8B 1HNOA 2F9IA 3KTJA 3GMAA 3MTUE 4DJGA 3CWBJ 3L70G 5GTHH 3T97B 1G2CA 4JFCA 1BGYJ 3L75G 1M57D 1JCDA 4EI2A 1ZR4A 1L0LK 2KS1A 2WSFJ 2F9YB 1SQVD 3AEGC 2PPYA 2UZFA 4U3FG 3N7NA 5CCHC 1MFZA 3ZW9A 1XTCC 5H2FH 1KILA 2Q7CA 1EXJA 1LTIC 4WYOB 2BCCG 1HBWA 3ZWBA 3L74D 1KD1Q 1VQPP 1DIPA 1S3JA 2FYUJ 1QVGO 3Q5PA 4FJWD 3PTZA 3MGNA 1Q90D 1Q82Q 1GL2B 2KUBA 1VQ5P 3M9QA 3C8VA 1Q81Q 3AE5C 3VIVA 4BXLA 1KZUB 2CK3H 3MP7B 1JY2P 3BASA 1PP9D 1EZVD 3EFGA 1LWUC 3CWBD 1PFIA 3IBBA 1PGPA 2XDJA 1W2BO 4KNPA 1BGYD 4JCSA 3CC7P 3ITKA 2R3CA 3M91A 3OJAB 1IFDA 1GL2D 3CX5D 1YIJP 3G9RA 4YPCA 1KYOE 3GW6A 1OW6A 1NTZK 3RK3E 2A81A 3H1JG 2K9JB 3FXDA 3G4SP 3G3ZA 3NJBA 1L0LE 4ZDBA 1SFCC 1VQ7P 4JPZB 2ZL3A 4L75A 1FOSE 3WUVA 1XNVA 3D71A 2KB7P 1J1DB 5APVA 2FYNC 1AV1A 1NAFA 1CZQA 3CCLP 1JEKA 1OMIA 1X0TA 2FYUD 4FZWC 2ZQRA 4G2RA 3CLQA 2BCCD 2HR3A 1FZCB 1FDOA 3N6RB 2ZT9C 3HE4B 5KJ7D 2KYVA 3I5CA 3HE4A 3W68A 3AE9C 3R9QA 2Y0EA 2ZL2A 4KHXA 4DZOA 1PIXA 4I1LA 5IKLB 2B89A 3TLFA 1QL1A 2E42A 3TSIA 1KB9H 3H1KG 4RESB 2IX7C 3U9RB 3B5NA 3AE3C 1OD2A 1JOCA 2XU6A 5KLVJ 1NTKK 4HB1A 1EDIA 2VRSA 1QLED 1YI2P 2N1TD 3ISAA 4ELSA 3HTKA 5E79H 3A7OA 1NTZE 1TYFA 3H0UA 3MIWA 2PGDA 2WSEJ 3R4YA 2YNYA 2O1KA 1LT9B 2NZ2A 3L4FA 3H1JD 1KC8Q 3C1LA 2HFED 3CXHH 2PG8A 1XNWA 4ZMDA 1KQGB 2JP3A 1VQLP 1N2DC 2WVRA 1LT9A 3WU2H 3KZIE 2J5IB 3F89A 5APYA 1PGQA 1VL2A 2IBZI 5KKZB 2N9BA 2RKLA 5APWA 2VSSE 5AVUB 1JNMA 2FFDB 4BRYA 3JCUE 3PHLA 1AVOA 2H88C 1X79B 1OVUA 2POHA 4PV1C 1SZOA 3Q3DA 1N7SC 5KLVD 3VMAA 5AW5B 1BE3E 4OGQD 1NZYA 1W2XA 3HLN1 3Q1MA 2WSSH 2A7SA 1MZ9A 1S1CX 4KD6A 1NTKE 2FXOA 3U59A 1N73B 2M8RA 2AEMA 2KK7A 1YBKA 3V5EA 3PEAA 1IK7A 2XV5A 3ZW8A 1RH5B 2ZYDA 2HW5A 1SS1A 2QJKB 2KIKA 4WB4A 1JTHA 2IYOA 3BCCE 3C9IA 4M3LA 3G71P 4D6TJ 1VQOP 1AQTA 3HD7B 3HE5B 1GU4A 1K9MQ 1KILE 2HLOA 1RF1A 3P85A 2A45I 3QMJA 4LGDE 3A0HE 3FX0A 5AVWB 3CI9A 3W67A 2BEZF 1SQPK 1J7XA 4IL6H 5GTIE 2K88A 1SVFA 1ZLLA 3Q0GA 3L75E 4EDFA 4JJTA 5E0NX 1VQKP 1UYTA 4KJMA 3HD7D 1PGJA 1Y9BA 5TJHA 5KAFE 4EYYQ 1GL2C 2GUSA 3CCQP 4LC1A 3A0BH 1URQB 3V6IA 1RHZB 1M56D 3NJDA 1NWQA 1OW8A 2XKMA 3Q5RA 5K5GB 1R5SA 3R2PA 2J5SA 1IO4A 2K3RA 2Q1KA 1RY3A 4JYCA 4B86A 2CPBA 2OYHB 4D6TD 1PJHA 3CX5H 1WDMA 4K3WA 2WSFH 1YQ4C 3P5MA 2PP6A 1BCCJ 5AW0B 1FOSF 3OMEA 1L0LG 1URQD 2I1JA 1FZAA 3PZKA 1NU1E 3SFEC 1MUUA 1LWUA 1IFJA 5AW8B 5KJ7C 1P84D 5AW3B 3UIAA 1NKNA 1PPJE 2JR8A 1J1DC 3H1LJ 4N3YB 1SQBJ 3TGUE 1K32A 3M6MA 4RYFH 2XNDH 1X9VA 3O6QB 1NHLA 1QEXA 1YJWP 1S9KE 1NTMK 3BF0A 2Q2XA 2RH0A 5AVSB 1FZCC 1SFCA 4FNBA 3VOPA 2QRXA 1RJMA 1IFNA 3BRTB 2N1TC 1QVFO 4WVZA 4FZWA 3R9SA 2KLUA 2PAJA 1GTWA 2WMMA 3WUTA 3AE2C 4TLFA 4ZDDA 3TYYA 3V4WA 5DUFA 5APTA 1KB9I 1SQXJ 2JWAA 4DOJA 2ITAA 1DD3A 5AW4B 3LIEA 1NTZG 1KYOD 1ON3A 4HYTB 3MOYA 3RK3D 2H7HA 3LAOA 2Q5UA 4MI2A 1KORA 2P7JA 2D2CB 3ZDMA 1SQBD 1KQSO 4Q0GA 1PZQA 1VQ8P 1LT9C 3CXHI 2LXBA 1MV8A 2UWJE 2VSSF 3TV5A 5KAIE 1D7MA 5KKZC 1NTME 4L6WA 4W7YA 4DCKA 4I2LC 3P8CD 5G1QA 5AVZB 1AA0A 3CCJP 1NKZB 1GU5A 4B3JA 2FFDC 2QJPB 4EMPA 2KI7B 1KV4A 2C8TA 3OAKA 2SPZA 1CI6A 3CCEP 2JDIH 3CPWO 2M3BA 2WPVB 1NTKG 1S5LE 3TNUA 2HPCB 1BE3J 2WSEH 2C9LY 4RCNA 2GA1A 3G6EP 1JM0A 3D6ZA 2IFNA 3L71J 1OIPA 4RJTA 1N73C 1N7SA 2W6BA 4JCQA 2CBYA 4Y99C 3L74J 4W80A 1S5LX 2FYZA 1ZRTE 3HRXA 3MZWB 3A3YB 3BCCG 3M9HA 1Q52A 2NP9A 3VN0A 2QJKC 1Q86Q 5CCGD 4U0HA 2V7QJ 2FW2A 4H13B 4WY4D 3JC22 2Q3EA 3AE6C 3Q1TA 3WMM0 4PJ0H 2QM8A 3HD7C 1H89A 4HDTA 5H2FE 3EWKA 3PJSK 1K39A 1U7JA 4JYLA 1LJ2A 3TRRA 4EMMA 2KOGA 1L0NK 2G8YA 1R8EA 2WT7B 1BE3D 1YQ3C 4H13D 2IDBA 3BPPA 1QL2A 1WDLA 3T97A 1SQQK 3H1HE 2YMYA 1ZXGA 2KZJA 3L70J 2WT7A 3L71D 1JY3O 1TG6A 2YKOA 3L75J 2F9YA 2Y0DA 5C39A 2B9BA 2E5YA 4U18A 2KSJA 3R6HA 1PGOA 1BDCA 3M0AA 3DJAA 1M7LA 1URQC 1EQ7A 3V5IA 1XO6A 2WQYC 4U3FJ 2M0BA 4NPFX 4Z0MA 1EZVI 2ZQQA 5AVYB 1NO4A 1LP1B 2KZIA 2YIUB 5M1BA 2DEOA 4IOIH 2BCCJ 1X22A 3NMDA 4MN4C 3KPEA 5AVXB 2CE3A 3T89A 3FWLA 3CX5I 1LP1A 2OYHC 1GL2A 1NU1G 3L37A 2W83C 3D70A 1UYVA 4WBAA 2VSUE 3HINA 1KILD 3H0SA 4B3HA 1PPJG 3TK1A 4GT1A 1P84H 3TGUG 1T2KD 2QJYB 3VMZA 1SQXK 3D6YA 1L0NE 4KWBA 1FU1A 3L70D 2E74B 4RYFA 3QWDA 2A06E 2LKMA 3L75D 3U9SB 5CBNA 1YJNP 2CPSA 1SQQE 1EC5A 4ZDEA 4O9BA 1Q2NA 3TF5A 3Q5SA 2K9JA 3H32B 2IPPA 1AVYA 4RKUJ 5KJ7A 4U3FD 3TDKA 2LXCB 3H1JJ 2X24A 2JKVA 2AXTE 3GG2A 4OG1A 1LNQA 1KB9E 2OGUA 2E74D 3CCRP 3L3SA 1DEEG 1EY3A 1T3JA 1QGKB 3VP9A 3FDUA 5B66H 1FZCA 2N1TB 4WCZA 1H8AA 2YO3A 5E79E 1KYOH 4EMLA 2G3AA 4ELXA 3IR9A 3L73E 1KTMA 2Q34A 2QVAA 5HUQA 3PGQA 2N1TA 1G1JA 4YTPC 1NU1D 1AFOA 3CXHE 3KTGA 2E75D 2P10A 2D2CC 1Q51A 4I52A 2FXPA 4K3AA 3TGUD 1VDFA 2Y9YA 3KTHA 1YTZI 3FWNA 3M0DC 1JY3N 1YITP 3H1KJ 1PV3A 1BSNA 1NTMG 1BSHA 2B87B 1SQVK 1S9KD 5CBOA 2JEEA 4Y28J 1N6EA 1M8OB 4DT0A 2V4HA 1W2EA 1OW7A 1IC2A 4OGQB 3Q2YA 3B5ND 5KLIB 3KYQA 2J5II 3RL0B 2QJPC 2J5IA 2R5BA 4OLQA 2Q35A 1UYRA 1J1EB 2NRGA 4FN7A 1LT1A 3ZWCA 3KTIA 3G64A 5FIFA 4U19A 2BZRA 1WMKA 2FFDA 3N4XA 1HZDA 2L5GB 2J59M 4UB6H 3U1CA 3CCMP 4XA4A 1LTTC 3RL0D 5G1SA 3KDPB 1EXIA 1ZOYC 2YMKA 1UIIA 2Q3IA 1HNUA 3H1KD 3KZIH 3CCUP 1N8RQ 1RE3C 3L72G 4YXDC 2QG4A 2A45G 5DTPA 5CTCA 4Y99B 1YHQP 5CTBA 1SQVE 3QXIA 4PD4E 2MJZA 4H13C 1N73A 2GM4A 2HG5D 2A7KA 2FYUK 3JCUH 5L8RJ 2OTKE 3B71A 2W8ZA 4IL6E 4QFEA 2FZSA 3RRVA 4JVTA 2Q9IA 3H1HG 4HJGH 4U1AA 3P7KA 4FB8A 3HP0A 2E43A 2Z4EA 2NPSD 3HD7A 3HE5A 2I8DA 1KQFB 1XX4A 2YKPA 2VREA 2WWWA 3O8ZA 3OW2O 3NTNA 1XNYA 1PP9E 3CMAP 2O01J 4K35A 1K8AQ 1IFIA 1USDA 3GHGB 3II6A 3CCSP 1JY3P 1BGYE 4ZU2A 1ZRTD 2V7QH 3QYRA 1VF5D 1FZGA 3PE8A 2YIUC 5EFWB 2VSUF 1NVOA 2LR2A 2ZL4A 5MGBA 2QIWA 4U7JA 1Q7YQ 5CHXA 3CC2P 2BEQD 4GHNA 4WWIA 2AXCA 1URQA 1E5WA 2PBPA 5DL1A 2ZFCA 2FYUE 2OQQA 3OC7A 2X58A 1BDDA 1P84I 1JMMA 1IZNB 1L0NG 2AEJA 4FN8A 5INIA 1RF0C 2A06G 1L4AB 1WRGA 2QJYC 2OYHA 3QREA 1SQQG 1FC6A 1JCCA 5CCHD 2E74C 3K50A 1U57A 1HF9A 2HODB 3AEDC 2QQ3A 5AVTB 2R44A 5KAFH 3BATA 1L0LJ 1JUNA 2IEXA 2HODA 2WITA 1SQPE 5KLVK 3Q7HA 3H1IG 1ZN5A 2J5UA 3JSVC 1OXZA 1L4AD 1UIYA 2F6IA 3F5HA 1PL5A 5AW2B 1YG8A 3O6QA 5C90A 1K05A 3MUDC 3TT7A 4IFMA 3L73G 1NJIQ 1HH0A 3RK3B 3LW5H 4XFJA 1KYOI 1H88A 3V2PA 4HC8A 1T8ZA 2M5AB 5KJPA 3SWKA 1MKMA 3HUSB 1DUBA 4MXIA 5BVZA 3AE4C 1AQ5A 3M6NA 1OD4A 5AW6B 3ST9A 3L35A 5B5EE 1SFCD 5DU4A 2ZAEB 3VYIA 1L0LD 2GUVA 1M90Q 1MFTA 4ASVA 2H43A 1ON9A 1NTZJ 1A02F 2IBZE 4QIJA 2P2UA 2N9YB 4IZBA 1DEBA 5KLVE 3M0DA 3E7KA 3QWOC 2KLVA 2OYIB 4OGQC 5KLIC 4R4LA 3RL0C 3E1RA 1WT6A 2FBWC 3CC4P 1RQVA 3BEZA 1J1EC 1EDKA 5APSA 3IAVA 2J5GD 3U1AA 3TT6A 1LTAC 4GKGA 3IB9A 2E76B 4UB8H 4JYBA 1DH3A 3V5BA 4NPEA 2B88A 1WDKA 5G1RA 4L76A 2WPQA 5INFA 5DTWA 4LK5A 2OTLP 4JOTA 3AEAC 2P1JA 3PLNA 3I56P 1UYSA 3RSTA 4GIFA 4WY4B 2YKQA 1SQVG 3AEEC 1RE4C 2HPCA 1NTZD 2E76D 3STAA 2H89C 1NTKJ 2Z5HA 3RBZA 5CCGA 1NYHA 4Q1IA 2R5DA 4PJ0E 1N7LA 1N6FA 4HNKA 3Q0JA 3FGAD 5GTHE 2ZXEB 2FY8A 3IF4A 4JSBA 1RE3A 1Z56A 4N78E 3L72E 3AEBC 3ABVC 1IJDB 2WPSA 5BU5A 3K5BA 3BCCJ 3EFFK 3QK8A 2YO2A 2FKWB 3MHVA 5AW9B 4PV1D 4IFFA 4ELWA 1FJKA 2KP8A 1PP9G 4ZNCA 4N6JA 2FBMA 2J58A 3CWBG 4EIJA 1HGVA 2F9IB 1BGYG
chains in the Genus database with same CATH topology
3KTGA 1KILE 2E75D 5DU6A 3P85A 1ZMEC 2P10A 3QMJA 2D2CC 1Q51A 3WG5A 4I52A 2FXPA 3TVUA 2BEZF 3U9TB 2QSIA 1J7XA 3KTHA 2DUBA 4I7ZC 4ZDCA 2J5GA 1PV3A 3Q0GA 2ZT9D 4JJTA 5E0NX 5E0SH 5DKPA 2WSCJ 3R0OA 1UYTA 4L8KA 4Y28J 1Y9BA 1N6EA 4FNDA 1OW7A 5INGA 4OGQB 3Q2YA 3H81A 2J5II 3RL0g 2QJPC 2J5IA 3NJDA 4OLQA 3IN6A 3RSIA 2Q35A 4MOUA 4J2UA 1OW8A 1UYRA 3Q5RA 2D2CD 3AE7C 4FN7A 3LW5J 3ZWCA 2J5SA 3KTIA 4U0GH 1HJ0A 3G64A 5FIFA 1PJHA 2GTRA 1RQUA 3QXZA 1UIXA 1WDMA 2BZRA 4K3WA 4U19A 1YQ4C 3P5MA 1JB0J 1WMKA 3SWXA 5DZKA 3OMEA 5KDRB 1HZDA 3PZKA 3MFMA 3TVWA 3SFEC 5G1SA 2VSUC 5KDRA 1EXIA 4KPKA 1ZOYC 2YMKA 3I47A 4PV1B 4F47A 1HNUA 2VSSA 1ZP0C 4QIIA 3LKEA 3MT6A 4H44C 1K32A 3M6MA 4RYFH 1Y7OA 4YXDC 1RJNA 5FUSA 4NNQA 5DTPA 5CTCA 5CTBA 3K8XA 2E75B 3BF0A 3KTKA 3QXIA 5JBWA 1FC9A 4H13C 2Q2XA 3OT6A 3T3WA 2A7KA 4FNBA 5L8RJ 4JWVA 3H0QA 3B71A 1RJMA 4QFEA 4I42A 1VF5C 1O8UA 3T8AA 2FZSA 4ZDFA 4FZWA 3R9SA 1X0UA 3RRVA 4JVTA 2ZL0A 1NGMB 2WTBA 3AE2C 4ZDDA 4U1AA 5DUFA 4JCRA 4H0LC 4FB8A 3HP0A 4K2NA 3FF6A 2VX2A 4IZCA 4WZ8B 1HNOA 2F9IA 3KTJA 1DD3A 3GMAA 1KQFB 1XX4A 1ON3A 3T97B 3QKAA 2VREA 4JFCA 1XNYA 3MOYA 3LAOA 2O01J 4MI2A 1KORA 4I4ZA 2D2CB 2WSFJ 2F9YB 3AEGC 1KMIZ 2PPYA 2UZFA 4Q0GA 4GM2A 4ZU2A 1DCIA 3QYRA 4I7ZB 1VF5D 3ZW9A 1EXJA 3PE8A 2YIUC 4WYOB 2VSUF 2VSSF 3ZWBA 2ZL4A 3TV5A 5MGBA 1SG4A 1DIPA 2QIWA 4U7JA 1WZ8A 3SFDC 2D3TA 5KKZC 2E76C 3Q5PA 3ZWAA 4L6WA 2BEQD 4FJWD 4GHNA 4Z1MH 1Q90D 5G1QA 2PBPA 5DL1A 2OQQA 3OC7A 2X58A 4B3JA 3C8VA 3AE5C 3T8BA 3VIVA 4FN8A 5INIA 4EMPA 2QJYC 4TT3H 1GMJA 2C8TA 3GKBA 3QREA 1N6DA 1FC6A 2W3PA 3IBBA 2E74C 3K50A 1U57A 1HF9A 4KNPA 3AEDC 2WPVB 2QQ3A 4JCSA 4GDOA 3AECC 5DZKH 1NZYB 3G9RA 4RCNA 2IEXA 1YG6A 1OW6A 3Q7HA 3D6ZA 4KT0J 3RK3E 2J5UA 2A81A 4JCTA 3NJBA 3AEFC 1EF9A 4ZDBA 1UIYA 3R9TA 3S9OA 2ZL3A 2F6IA 4JCQA 2CBYA 2MKVA 1PL5A 1XNVA 3D71A 1S5LX 4H44B 1ZRTE 3HRXA 1YG8A 3O6QA 2FYNC 2JO1A 5C90A 1K05A 3TZ3A 1Q52A 1OMIA 3HE2A 3TT7A 4FZWC 3GF7A 2NP9A 2ZQRA 4G2RA 2QJKC 4XFJA 4U0HA 2V7QJ 2FW2A 4H13B 1FDOA 4HC8A 3IAOA 3N6RB 2ZT9C 1FDIA 5KJPA 3AE6C 1MKMA 1DUBA 4MXIA 2K9YA 1VF5B 3AE4C 3Q1TA 3M6NA 4HDTA 3SLLA 1OD4A 3EWKA 4H44D 4IL6X 1K39A 5C9GA 3AE9C 3R9QA 4JYLA 3ST9A 3TRRA 2ZL2A 4EMMA 2G8YA 1R8EA 1AJYA 1PIXA 4H0LB 5DU4A 3TLFA 5IKLB 1EF8A 3H25A 1YQ3C 4H13D 2IDBA 3BPPA 3U9RB 1WDLA 3AE3C 5JBXA 1ON9A 3GF3A 1FC7A 1OD2A 5E0SA 1TG6A 2F9YA 4QIJA 4IZBA 3ISAA 2F6QA 4U18A 4ELSA 3R6HA 1TYFA 3H0UA 4NARA 4IZDA 2WSEJ 3DJAA 3R4YA 3V5IA 1XO6A 4R4MA 2WQYC 3AE1C 2NZ2A 4OGQC 4Z0MA 4H0LD 5KLIC 2YJGA 2ZQQA 4R4LA 2PG8A 1XNWA 3TDCA 2FBWC 1KQGB 5M1BA 1RQVA 3BEZA 2DEOA 2JP3A 5DUCA 4K29A 1DD4A 3IAVA 2J5GD 2J5IB 3TT6A 2CE3A 3T89A 3MYBA 4U0GA 1VL2A 3IB9A 2E76B 3H0JA 3DORA 4ASIA 3D70A 3KQFA 1UYVA 1WDKA 5G1RA 5INFA 5DTWA 2VSUE 3HINA 4LK5A 2VSSE 3H0SA 4YLHA 4B3HA 4JOTA 3AEAC 2H88C 5DU8A 4B3IA 1UYSA 4PV1C 1SZOA 3RSTA 1VRGA 4NEKA 3D6YA 3Q3DA 4KWBA 3AEEC 2EJ5A 2E74B 4RYFA 2E76D 3QWDA 4OGQD 3STAA 2H89C 1NZYA 1W2XA 3U9SB 3HLN1 3T88A 1NYHA 4Q1IA 4ZDEA 2E75C 3Q1MA 1N6FA 3Q5SA 2VSUA 2A7SA 1S1CX 3JU1A 4HNKA 3Q0JA 3FGAD 4KD6A 4RKUJ 2X24A 3BPTA 4JSBA 4OG1A 3AEBC 3ABVC 3V5EA 3PEAA 1FCFA 1IK7A 2E74D 3L3SA 3ZW8A 1EY3A 3QK8A 4DI1A 3AE8C 4OMRA 1JXZA 3FDUA 2HW5A 3P2LA 3GLMA 4PV1D 1K04A 4ELWA 4WCZA 4JYJA 1MJ3A 4EMLA 2G3AA 4ELXA 3H02A 1KTMA 2FBMA 2Q34A 5HUQA 2ZT9B 3PGQA 1TU3F 4YTPC 2F9IB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KTG A;  5DU6 A;  3P85 A;  3QMJ A;  1Q51 A;  3WG5 A;  4I52 A;  3TVU A;  3U9T B;  1J7X A;  3KTH A;  2DUB A;  4ZDC A;  2J5G A;  3Q0G A;  4JJT A;  5E0N X;  5E0S H;  5DKP A;  3R0O A;  1UYT A;  4L8K A;  1N6E A;  4FND A;  5ING A;  3H81 A;  2J5I I;  3RSI A;  2J5I A;  3NJD A;  4OLQ A;  2Q35 A;  4MOU A;  1UYR A;  4FN7 A;  3ZWC A;  2J5S A;  3KTI A;  4U0G H;  3G64 A;  5FIF A;  1PJH A;  2GTR A;  3QXZ A;  4U19 A;  1WDM A;  2BZR A;  4K3W A;  3P5M A;  3SWX A;  5DZK A;  3OME A;  5KDR B;  1HZD A;  3PZK A;  3MFM A;  3TVW A;  5G1S A;  2VSU C;  5KDR A;  4KPK A;  3I47 A;  4F47 A;  1HNU A;  2VSS A;  4QII A;  3LKE A;  3MT6 A;  1K32 A;  3M6M A;  4RYF H;  1Y7O A;  1RJN A;  5FUS A;  4NNQ A;  5DTP A;  5CTC A;  5CTB A;  3K8X A;  3BF0 A;  3QXI A;  5JBW A;  3KTK A;  1FC9 A;  2Q2X A;  3OT6 A;  3T3W A;  2A7K A;  4FNB A;  4JWV A;  3H0Q A;  1RJM A;  4QFE A;  4I42 A;  1O8U A;  3T8A A;  2FZS A;  4ZDF A;  4FZW A;  3R9S A;  1X0U A;  3RRV A;  4JVT A;  2ZL0 A;  2WTB A;  4ZDD A;  4U1A A;  5DUF A;  4JCR A;  4FB8 A;  3HP0 A;  4K2N A;  3FF6 A;  2VX2 A;  4IZC A;  4WZ8 B;  1HNO A;  2F9I A;  3KTJ A;  3GMA A;  1XX4 A;  1ON3 A;  3QKA A;  2VRE A;  4JFC A;  1XNY A;  3MOY A;  3LAO A;  4MI2 A;  4I4Z A;  2F9Y B;  2PPY A;  2UZF A;  4Q0G A;  4GM2 A;  4ZU2 A;  1DCI A;  3QYR A;  3ZW9 A;  3PE8 A;  4WYO B;  2VSU F;  2VSS F;  3ZWB A;  2ZL4 A;  3TV5 A;  5MGB A;  1SG4 A;  1WZ8 A;  2D3T A;  3ZWA A;  4L6W A;  4FJW D;  4GHN A;  5G1Q A;  2PBP A;  5DL1 A;  3OC7 A;  2X58 A;  4B3J A;  3T8B A;  3VIV A;  4FN8 A;  5INI A;  4EMP A;  2C8T A;  3GKB A;  3QRE A;  1N6D A;  1FC6 A;  2W3P A;  3IBB A;  3K50 A;  4KNP A;  2QQ3 A;  4JCS A;  5DZK H;  1NZY B;  4RCN A;  2IEX A;  1YG6 A;  3Q7H A;  2A81 A;  4JCT A;  3NJB A;  1EF9 A;  4ZDB A;  1UIY A;  3R9T A;  2ZL3 A;  2F6I A;  4JCQ A;  2CBY A;  1XNV A;  3HRX A;  1YG8 A;  5C90 A;  3TZ3 A;  1Q52 A;  3HE2 A;  3TT7 A;  4FZW C;  3GF7 A;  2NP9 A;  2ZQR A;  4G2R A;  4U0H A;  2FW2 A;  4HC8 A;  3N6R B;  5KJP A;  1DUB A;  4MXI A;  3Q1T A;  3M6N A;  3SLL A;  1OD4 A;  1K39 A;  5C9G A;  3R9Q A;  4JYL A;  3ST9 A;  3TRR A;  2ZL2 A;  4EMM A;  1PIX A;  5IKL B;  5DU4 A;  3TLF A;  1EF8 A;  3BPP A;  3U9R B;  1WDL A;  5JBX A;  1ON9 A;  3GF3 A;  1FC7 A;  1OD2 A;  5E0S A;  1TG6 A;  2F9Y A;  4QIJ A;  4IZB A;  3ISA A;  2F6Q A;  4U18 A;  4ELS A;  3R6H A;  1TYF A;  3H0U A;  4IZD A;  3DJA A;  3V5I A;  1XO6 A;  4Z0M A;  2ZQQ A;  2PG8 A;  1XNW A;  3TDC A;  3BEZ A;  2DEO A;  5DUC A;  4K29 A;  3IAV A;  2J5G D;  2J5I B;  3TT6 A;  2CE3 A;  3T89 A;  3MYB A;  4U0G A;  3IB9 A;  3H0J A;  3DOR A;  4ASI A;  3KQF A;  1UYV A;  1WDK A;  5G1R A;  5INF A;  5DTW A;  2VSU E;  3HIN A;  4LK5 A;  2VSS E;  3H0S A;  4YLH A;  4B3H A;  4JOT A;  5DU8 A;  4B3I A;  1UYS A;  1SZO A;  3RST A;  1VRG A;  4NEK A;  4KWB A;  2EJ5 A;  4RYF A;  3QWD A;  3STA A;  1NZY A;  1W2X A;  3U9S B;  3HLN 1;  3T88 A;  4Q1I A;  4ZDE A;  1N6F A;  2VSU A;  2A7S A;  3JU1 A;  4HNK A;  3Q0J A;  4KD6 A;  2X24 A;  4JSB A;  4OG1 A;  3V5E A;  3PEA A;  1FCF A;  3ZW8 A;  3L3S A;  1EY3 A;  3QK8 A;  4DI1 A;  4OMR A;  1JXZ A;  3FDU A;  2HW5 A;  3P2L A;  3GLM A;  4ELW A;  4WCZ A;  4JYJ A;  1MJ3 A;  4EML A;  4ELX A;  3H02 A;  2FBM A;  2Q34 A;  3PGQ A;  2F9I B; 
#chains in the Genus database with same CATH topology
 1LTG C;  1DX7 A;  3CCV P;  3GHG C;  1OZH A;  3WG5 A;  5TIS H;  2ZYA A;  4D6T E;  1QX8 A;  2KS1 B;  1Y8A A;  1NTK D;  2O01 N;  3TVU A;  3U9T B;  2DUB A;  4JBZ A;  1LTJ B;  4ZDC A;  2H8P D;  1GDT A;  1SQB K;  2PRR A;  4C7R A;  2A45 H;  2W6A A;  1KIL B;  4PD4 D;  5E0S H;  1LTJ A;  2WSC J;  2FYU G;  5CJ0 A;  3R0O A;  1P84 E;  4L8K A;  4FND A;  3LID A;  4C7N B;  2WTY A;  1NOH A;  3BCC D;  1CW5 A;  2K1A A;  2R3S A;  3H81 A;  3VMY A;  3RSI A;  3IN6 A;  4C7N A;  4MOU A;  1L4A C;  2ZJS E;  1L2P A;  4OWF A;  3V2R A;  1GK4 A;  4AYC A;  3LW5 J;  4ZKP A;  4U0G H;  1HJ0 A;  2O01 H;  2GTR A;  1RQU A;  1SQP G;  1UIX A;  2RN0 A;  2C0W A;  1NU1 J;  2O1J A;  1GW3 A;  3P32 A;  1RF0 A;  2IZ1 A;  1BCC E;  3TGU J;  3TVW A;  2VSU C;  1SQP J;  1FZF A;  2YXR B;  4F47 A;  5B66 E;  2R32 A;  1IFM A;  1FZB A;  3MT6 A;  1NAY A;  1Y7O A;  1EDL A;  5FUS A;  1IFP A;  4NNQ A;  3H32 A;  3H1L E;  1SQB E;  5DJT B;  3RK3 C;  3K8X A;  2E75 B;  3H1I E;  1YTZ T;  1FS0 E;  3KHU A;  1HWT C;  3H0Q A;  3HUS C;  4I42 A;  1SLQ A;  3MUD A;  1O8U A;  3T8A A;  4ZDF A;  1X0U A;  2QM7 A;  2ZL0 A;  1NGM B;  2WZ7 A;  2WTB A;  4HKZ H;  3VMX A;  3P8C E;  1X8Y A;  5KTB A;  1HGZ A;  2IBZ G;  4K2N A;  2VX2 A;  4IZC A;  3WU2 E;  3B4S A;  1YJ9 P;  1PPJ D;  5KLV G;  3QKA A;  3B5N B;  3E1I A;  1SQP D;  2AXT H;  1SQX E;  1K73 Q;  1S72 P;  3RK2 B;  4GOF A;  4I4Z A;  1LTS C;  1KMI Z;  3HTK B;  4GM2 A;  2OYI C;  3BVH A;  1DCI A;  2QEX P;  2B87 A;  1M1J B;  4I7Z B;  3L36 A;  1NTM J;  1M1J A;  1SG4 A;  5AVR B;  2Q6Q A;  1WZ8 A;  4UB6 E;  3SFD C;  2D3T A;  2ZYG A;  2E76 C;  3ZWA A;  3RK2 D;  4Z1M H;  1U7M A;  3PH0 A;  5BU8 B;  2OYO A;  5CMZ A;  3MD0 A;  2IZ0 A;  3T8B A;  4L74 A;  4BRY B;  4TT3 H;  1VQM P;  2FXM A;  2K37 A;  5CCG C;  1GMJ A;  3GKB A;  4WY4 C;  1N6D A;  2W3P A;  1S2E A;  3NFQ A;  4GDO A;  5APQ A;  2XZR A;  3AEC C;  5DZK H;  2IBZ D;  1NZY B;  1Y47 A;  5APU A;  5AW7 B;  2P67 A;  1YG6 A;  1YYC A;  4KT0 J;  3WUU A;  2C9N Y;  4OH8 B;  1FJP A;  1E79 H;  4JCT A;  3AEF C;  1EF9 A;  3R9T A;  1RE4 A;  3S9O A;  2M3E A;  3H6P A;  2MKV A;  1NTM D;  3KQG A;  3L71 E;  4H44 B;  2NPS B;  2JO1 A;  3L72 J;  3TZ3 A;  3HE2 A;  3GF7 A;  1W5C E;  2W6J H;  4QMA A;  3IFM A;  2W90 A;  3SWF A;  3L74 E;  2NPS A;  1NH4 A;  3QH9 A;  3V4Q A;  1VQ9 P;  3IAO A;  1JTH B;  5AVQ B;  1FDI A;  1VQ6 P;  1KN7 A;  4D6T G;  1KQL A;  2K9Y A;  1VF5 B;  4ZKU A;  3SLL A;  4H44 D;  4IL6 X;  3NXS A;  3V2Q A;  5C9G A;  5AW1 B;  3A0B E;  1OWA A;  3PP5 A;  1RF1 B;  3H1H J;  2JJL A;  1AJY A;  1NU1 K;  4H0L B;  1ZR2 A;  1EZV E;  1ZW0 A;  1IK9 A;  1LTJ C;  4NPD A;  3CWB E;  3H25 A;  1EF8 A;  4PD4 H;  5JBX A;  1USE A;  3GF3 A;  1FC7 A;  2Y9Z A;  1KIL C;  5E0S A;  4A7P A;  3CX5 E;  1T2K C;  3GHG A;  2F6Q A;  3KXD A;  3L70 E;  4N78 D;  4NAR A;  4IZD A;  2QE7 H;  3L72 D;  3RBX A;  4R4M A;  3AE1 C;  1T6A A;  4H0L D;  2YXQ B;  2YJG A;  2ZXX A;  3P8M C;  1OFC X;  3TDC A;  1GZL A;  5AVV B;  1FDM A;  5DUC A;  1M1K Q;  1HTL C;  1OVV A;  5CCH A;  4K29 A;  1DD4 A;  3A0H H;  4U3F E;  4LLH A;  1H0T B;  2KNC B;  3MYB A;  3S1K A;  4U0G A;  3H0J A;  3DOR A;  4ASI A;  5GTI H;  2BCC E;  3KQF A;  1BCC G;  1H0T A;  1JY2 O;  1EDJ A;  2KNC A;  3PRJ A;  1G1I A;  1FZE A;  4W7Z A;  1GK6 A;  4EOT A;  4YLH A;  3H1H D;  2C0X A;  1L4A A;  1L0N J;  3BRV B;  2KXP B;  2QA4 P;  5DU8 A;  4B3I A;  3M9B A;  4C46 A;  3B8E B;  4I6M C;  1FE6 A;  1LWU B;  2WSC H;  1VRG A;  4NEK A;  3H1L G;  1SQB G;  1SQQ J;  3I55 P;  2EJ5 A;  4OVN F;  3T88 A;  3RGU A;  4GOE A;  1KFM A;  4AQR D;  2E75 C;  2VSU A;  3JU1 A;  2HYN A;  3H1I J;  3HRN A;  2IYP A;  3BPT A;  1SFC B;  2JWD A;  4RO0 A;  4AUW A;  5DJU B;  4JF7 A;  1HVV A;  1FCF A;  2FYN B;  3H1J E;  3A2A A;  4JQ0 D;  4DI1 A;  5CJ4 A;  3AE8 C;  3CL3 D;  3L73 J;  4OMR A;  1JXZ A;  3P2L A;  3GLM A;  1K04 A;  1OX3 A;  2M5A A;  4IFD K;  1VQN P;  1MJ3 A;  4JYJ A;  1SQX G;  4CPG A;  3HUS A;  3H02 A;  3USS A;  1FC2 C;  2ZT9 B;  2AEF A;  1L0N D;  1TU3 F;  3VP8 A;  3SWY A;  3B5N C;  2A06 D;  4XE5 B;  1BCC D;  4YXW H;  5DU6 A;  3RK2 C;  1ZME C;  1SQQ D;  2ZVN B;  3S4R A;  3A5T A;  1FAV A;  1HUC A;  2P58 A;  2QSI A;  3CD6 P;  4UB8 E;  2W27 A;  1M1J C;  4I7Z C;  2J5G A;  1N86 A;  1S4X A;  1HJB A;  3H1L D;  2ZT9 D;  4HH2 A;  1KB9 D;  1CSB A;  3H1I D;  5DKP A;  3H1K E;  1A02 J;  3VTP C;  2Y0C A;  1JO5 A;  2OYI A;  5B5E H;  5APX A;  5ING A;  1VPC A;  3L73 D;  2PFX A;  3RL0 g;  4J2U A;  2O3J A;  1LGH B;  2D2C D;  3AE7 C;  3CXH D;  3SSU A;  1JMB A;  1JY2 N;  3QXZ A;  1CI6 B;  1JB0 J;  1OVR A;  2RMZ A;  1BE3 G;  3SWX A;  5DZK A;  5KDR B;  2ZVO B;  3CME P;  1SQX D;  4GOD A;  1GW4 A;  5KAI H;  4ASW A;  3TNU B;  1J2J B;  1FBM A;  3L71 G;  3MFM A;  1LTB C;  2OAR A;  5KDR A;  1VQ4 P;  4WY4 A;  4KPK A;  3I47 A;  4PV1 B;  1SP4 A;  3OA7 A;  2KSE A;  3V2N A;  2VSS A;  1ZP0 C;  4QII A;  3LKE A;  3L74 G;  1N7S B;  1SQV J;  4H44 C;  2NPS C;  2XNX A;  1RJN A;  1KFN A;  1T3U A;  3KTK A;  5JBW A;  1GD2 E;  2E5T A;  1FC9 A;  1XTG B;  3OT6 A;  2IFM A;  5TIS E;  3T3W A;  4JWV A;  2L91 A;  1S5L H;  2OTJ P;  1R5L A;  1VF5 C;  3EQ2 A;  2BAS A;  4BWN A;  2WPR A;  1EZV G;  1N7S D;  2DW3 A;  4L73 A;  3FXE A;  1RF1 C;  2I1K A;  1ZV8 A;  2Z5I A;  4JCR A;  4H0L C;  1G2C B;  3M06 A;  4PD4 I;  3FF6 A;  1PP9 J;  4WZ8 B;  1HNO A;  2F9I A;  3KTJ A;  3GMA A;  3MTU E;  4DJG A;  3CWB J;  3L70 G;  5GTH H;  3T97 B;  1G2C A;  4JFC A;  1BGY J;  3L75 G;  1M57 D;  1JCD A;  4EI2 A;  1ZR4 A;  1L0L K;  2KS1 A;  2WSF J;  2F9Y B;  1SQV D;  3AEG C;  2PPY A;  2UZF A;  4U3F G;  3N7N A;  5CCH C;  1MFZ A;  3ZW9 A;  1XTC C;  5H2F H;  1KIL A;  2Q7C A;  1EXJ A;  1LTI C;  4WYO B;  2BCC G;  1HBW A;  3ZWB A;  3L74 D;  1KD1 Q;  1VQP P;  1DIP A;  1S3J A;  2FYU J;  1QVG O;  3Q5P A;  4FJW D;  3PTZ A;  3MGN A;  1Q90 D;  1Q82 Q;  1GL2 B;  2KUB A;  1VQ5 P;  3M9Q A;  3C8V A;  1Q81 Q;  3AE5 C;  3VIV A;  4BXL A;  1KZU B;  2CK3 H;  3MP7 B;  1JY2 P;  3BAS A;  1PP9 D;  1EZV D;  3EFG A;  1LWU C;  3CWB D;  1PFI A;  3IBB A;  1PGP A;  2XDJ A;  1W2B O;  4KNP A;  1BGY D;  4JCS A;  3CC7 P;  3ITK A;  2R3C A;  3M91 A;  3OJA B;  1IFD A;  1GL2 D;  3CX5 D;  1YIJ P;  3G9R A;  4YPC A;  1KYO E;  3GW6 A;  1OW6 A;  1NTZ K;  3RK3 E;  2A81 A;  3H1J G;  2K9J B;  3FXD A;  3G4S P;  3G3Z A;  3NJB A;  1L0L E;  4ZDB A;  1SFC C;  1VQ7 P;  4JPZ B;  2ZL3 A;  4L75 A;  1FOS E;  3WUV A;  1XNV A;  3D71 A;  2KB7 P;  1J1D B;  5APV A;  2FYN C;  1AV1 A;  1NAF A;  1CZQ A;  3CCL P;  1JEK A;  1OMI A;  1X0T A;  2FYU D;  4FZW C;  2ZQR A;  4G2R A;  3CLQ A;  2BCC D;  2HR3 A;  1FZC B;  1FDO A;  3N6R B;  2ZT9 C;  3HE4 B;  5KJ7 D;  2KYV A;  3I5C A;  3HE4 A;  3W68 A;  3AE9 C;  3R9Q A;  2Y0E A;  2ZL2 A;  4KHX A;  4DZO A;  1PIX A;  4I1L A;  5IKL B;  2B89 A;  3TLF A;  1QL1 A;  2E42 A;  3TSI A;  1KB9 H;  3H1K G;  4RES B;  2IX7 C;  3U9R B;  3B5N A;  3AE3 C;  1OD2 A;  1JOC A;  2XU6 A;  5KLV J;  1NTK K;  4HB1 A;  1EDI A;  2VRS A;  1QLE D;  1YI2 P;  2N1T D;  3ISA A;  4ELS A;  3HTK A;  5E79 H;  3A7O A;  1NTZ E;  1TYF A;  3H0U A;  3MIW A;  2PGD A;  2WSE J;  3R4Y A;  2YNY A;  2O1K A;  1LT9 B;  2NZ2 A;  3L4F A;  3H1J D;  1KC8 Q;  3C1L A;  2HFE D;  3CXH H;  2PG8 A;  1XNW A;  4ZMD A;  1KQG B;  2JP3 A;  1VQL P;  1N2D C;  2WVR A;  1LT9 A;  3WU2 H;  3KZI E;  2J5I B;  3F89 A;  5APY A;  1PGQ A;  1VL2 A;  2IBZ I;  5KKZ B;  2N9B A;  2RKL A;  5APW A;  2VSS E;  5AVU B;  1JNM A;  2FFD B;  4BRY A;  3JCU E;  3PHL A;  1AVO A;  2H88 C;  1X79 B;  1OVU A;  2POH A;  4PV1 C;  1SZO A;  3Q3D A;  1N7S C;  5KLV D;  3VMA A;  5AW5 B;  1BE3 E;  4OGQ D;  1NZY A;  1W2X A;  3HLN 1;  3Q1M A;  2WSS H;  2A7S A;  1MZ9 A;  1S1C X;  4KD6 A;  1NTK E;  2FXO A;  3U59 A;  1N73 B;  2M8R A;  2AEM A;  2KK7 A;  1YBK A;  3V5E A;  3PEA A;  1IK7 A;  2XV5 A;  3ZW8 A;  1RH5 B;  2ZYD A;  2HW5 A;  1SS1 A;  2QJK B;  2KIK A;  4WB4 A;  1JTH A;  2IYO A;  3BCC E;  3C9I A;  4M3L A;  3G71 P;  4D6T J;  1VQO P;  1AQT A;  3HD7 B;  3HE5 B;  1GU4 A;  1K9M Q;  1KIL E;  2HLO A;  1RF1 A;  3P85 A;  2A45 I;  3QMJ A;  4LGD E;  3A0H E;  3FX0 A;  5AVW B;  3CI9 A;  3W67 A;  2BEZ F;  1SQP K;  1J7X A;  4IL6 H;  5GTI E;  2K88 A;  1SVF A;  1ZLL A;  3Q0G A;  3L75 E;  4EDF A;  4JJT A;  5E0N X;  1VQK P;  1UYT A;  4KJM A;  3HD7 D;  1PGJ A;  1Y9B A;  5TJH A;  5KAF E;  4EYY Q;  1GL2 C;  2GUS A;  3CCQ P;  4LC1 A;  3A0B H;  1URQ B;  3V6I A;  1RHZ B;  1M56 D;  3NJD A;  1NWQ A;  1OW8 A;  2XKM A;  3Q5R A;  5K5G B;  1R5S A;  3R2P A;  2J5S A;  1IO4 A;  2K3R A;  2Q1K A;  1RY3 A;  4JYC A;  4B86 A;  2CPB A;  2OYH B;  4D6T D;  1PJH A;  3CX5 H;  1WDM A;  4K3W A;  2WSF H;  1YQ4 C;  3P5M A;  2PP6 A;  1BCC J;  5AW0 B;  1FOS F;  3OME A;  1L0L G;  1URQ D;  2I1J A;  1FZA A;  3PZK A;  1NU1 E;  3SFE C;  1MUU A;  1LWU A;  1IFJ A;  5AW8 B;  5KJ7 C;  1P84 D;  5AW3 B;  3UIA A;  1NKN A;  1PPJ E;  2JR8 A;  1J1D C;  3H1L J;  4N3Y B;  1SQB J;  3TGU E;  1K32 A;  3M6M A;  4RYF H;  2XND H;  1X9V A;  3O6Q B;  1NHL A;  1QEX A;  1YJW P;  1S9K E;  1NTM K;  3BF0 A;  2Q2X A;  2RH0 A;  5AVS B;  1FZC C;  1SFC A;  4FNB A;  3VOP A;  2QRX A;  1RJM A;  1IFN A;  3BRT B;  2N1T C;  1QVF O;  4WVZ A;  4FZW A;  3R9S A;  2KLU A;  2PAJ A;  1GTW A;  2WMM A;  3WUT A;  3AE2 C;  4TLF A;  4ZDD A;  3TYY A;  3V4W A;  5DUF A;  5APT A;  1KB9 I;  1SQX J;  2JWA A;  4DOJ A;  2ITA A;  1DD3 A;  5AW4 B;  3LIE A;  1NTZ G;  1KYO D;  1ON3 A;  4HYT B;  3MOY A;  3RK3 D;  2H7H A;  3LAO A;  2Q5U A;  4MI2 A;  1KOR A;  2P7J A;  2D2C B;  3ZDM A;  1SQB D;  1KQS O;  4Q0G A;  1PZQ A;  1VQ8 P;  1LT9 C;  3CXH I;  2LXB A;  1MV8 A;  2UWJ E;  2VSS F;  3TV5 A;  5KAI E;  1D7M A;  5KKZ C;  1NTM E;  4L6W A;  4W7Y A;  4DCK A;  4I2L C;  3P8C D;  5G1Q A;  5AVZ B;  1AA0 A;  3CCJ P;  1NKZ B;  1GU5 A;  4B3J A;  2FFD C;  2QJP B;  4EMP A;  2KI7 B;  1KV4 A;  2C8T A;  3OAK A;  2SPZ A;  1CI6 A;  3CCE P;  2JDI H;  3CPW O;  2M3B A;  2WPV B;  1NTK G;  1S5L E;  3TNU A;  2HPC B;  1BE3 J;  2WSE H;  2C9L Y;  4RCN A;  2GA1 A;  3G6E P;  1JM0 A;  3D6Z A;  2IFN A;  3L71 J;  1OIP A;  4RJT A;  1N73 C;  1N7S A;  2W6B A;  4JCQ A;  2CBY A;  4Y99 C;  3L74 J;  4W80 A;  1S5L X;  2FYZ A;  1ZRT E;  3HRX A;  3MZW B;  3A3Y B;  3BCC G;  3M9H A;  1Q52 A;  2NP9 A;  3VN0 A;  2QJK C;  1Q86 Q;  5CCG D;  4U0H A;  2V7Q J;  2FW2 A;  4H13 B;  4WY4 D;  3JC2 2;  2Q3E A;  3AE6 C;  3Q1T A;  3WMM 0;  4PJ0 H;  2QM8 A;  3HD7 C;  1H89 A;  4HDT A;  5H2F E;  3EWK A;  3PJS K;  1K39 A;  1U7J A;  4JYL A;  1LJ2 A;  3TRR A;  4EMM A;  2KOG A;  1L0N K;  2G8Y A;  1R8E A;  2WT7 B;  1BE3 D;  1YQ3 C;  4H13 D;  2IDB A;  3BPP A;  1QL2 A;  1WDL A;  3T97 A;  1SQQ K;  3H1H E;  2YMY A;  1ZXG A;  2KZJ A;  3L70 J;  2WT7 A;  3L71 D;  1JY3 O;  1TG6 A;  2YKO A;  3L75 J;  2F9Y A;  2Y0D A;  5C39 A;  2B9B A;  2E5Y A;  4U18 A;  2KSJ A;  3R6H A;  1PGO A;  1BDC A;  3M0A A;  3DJA A;  1M7L A;  1URQ C;  1EQ7 A;  3V5I A;  1XO6 A;  2WQY C;  4U3F J;  2M0B A;  4NPF X;  4Z0M A;  1EZV I;  2ZQQ A;  5AVY B;  1NO4 A;  1LP1 B;  2KZI A;  2YIU B;  5M1B A;  2DEO A;  4IOI H;  2BCC J;  1X22 A;  3NMD A;  4MN4 C;  3KPE A;  5AVX B;  2CE3 A;  3T89 A;  3FWL A;  3CX5 I;  1LP1 A;  2OYH C;  1GL2 A;  1NU1 G;  3L37 A;  2W83 C;  3D70 A;  1UYV A;  4WBA A;  2VSU E;  3HIN A;  1KIL D;  3H0S A;  4B3H A;  1PPJ G;  3TK1 A;  4GT1 A;  1P84 H;  3TGU G;  1T2K D;  2QJY B;  3VMZ A;  1SQX K;  3D6Y A;  1L0N E;  4KWB A;  1FU1 A;  3L70 D;  2E74 B;  4RYF A;  3QWD A;  2A06 E;  2LKM A;  3L75 D;  3U9S B;  5CBN A;  1YJN P;  2CPS A;  1SQQ E;  1EC5 A;  4ZDE A;  4O9B A;  1Q2N A;  3TF5 A;  3Q5S A;  2K9J A;  3H32 B;  2IPP A;  1AVY A;  4RKU J;  5KJ7 A;  4U3F D;  3TDK A;  2LXC B;  3H1J J;  2X24 A;  2JKV A;  2AXT E;  3GG2 A;  4OG1 A;  1LNQ A;  1KB9 E;  2OGU A;  2E74 D;  3CCR P;  3L3S A;  1DEE G;  1EY3 A;  1T3J A;  1QGK B;  3VP9 A;  3FDU A;  5B66 H;  1FZC A;  2N1T B;  4WCZ A;  1H8A A;  2YO3 A;  5E79 E;  1KYO H;  4EML A;  2G3A A;  4ELX A;  3IR9 A;  3L73 E;  1KTM A;  2Q34 A;  2QVA A;  5HUQ A;  3PGQ A;  2N1T A;  1G1J A;  4YTP C;  1NU1 D;  1AFO A;  3CXH E;  3KTG A;  2E75 D;  2P10 A;  2D2C C;  1Q51 A;  4I52 A;  2FXP A;  4K3A A;  3TGU D;  1VDF A;  2Y9Y A;  3KTH A;  1YTZ I;  3FWN A;  3M0D C;  1JY3 N;  1YIT P;  3H1K J;  1PV3 A;  1BSN A;  1NTM G;  1BSH A;  2B87 B;  1SQV K;  1S9K D;  5CBO A;  2JEE A;  4Y28 J;  1N6E A;  1M8O B;  4DT0 A;  2V4H A;  1W2E A;  1OW7 A;  1IC2 A;  4OGQ B;  3Q2Y A;  3B5N D;  5KLI B;  3KYQ A;  2J5I I;  3RL0 B;  2QJP C;  2J5I A;  2R5B A;  4OLQ A;  2Q35 A;  1UYR A;  1J1E B;  2NRG A;  4FN7 A;  1LT1 A;  3ZWC A;  3KTI A;  3G64 A;  5FIF A;  4U19 A;  2BZR A;  1WMK A;  2FFD A;  3N4X A;  1HZD A;  2L5G B;  2J59 M;  4UB6 H;  3U1C A;  3CCM P;  4XA4 A;  1LTT C;  3RL0 D;  5G1S A;  3KDP B;  1EXI A;  1ZOY C;  2YMK A;  1UII A;  2Q3I A;  1HNU A;  3H1K D;  3KZI H;  3CCU P;  1N8R Q;  1RE3 C;  3L72 G;  4YXD C;  2QG4 A;  2A45 G;  5DTP A;  5CTC A;  4Y99 B;  1YHQ P;  5CTB A;  1SQV E;  3QXI A;  4PD4 E;  2MJZ A;  4H13 C;  1N73 A;  2GM4 A;  2HG5 D;  2A7K A;  2FYU K;  3JCU H;  5L8R J;  2OTK E;  3B71 A;  2W8Z A;  4IL6 E;  4QFE A;  2FZS A;  3RRV A;  4JVT A;  2Q9I A;  3H1H G;  4HJG H;  4U1A A;  3P7K A;  4FB8 A;  3HP0 A;  2E43 A;  2Z4E A;  2NPS D;  3HD7 A;  3HE5 A;  2I8D A;  1KQF B;  1XX4 A;  2YKP A;  2VRE A;  2WWW A;  3O8Z A;  3OW2 O;  3NTN A;  1XNY A;  1PP9 E;  3CMA P;  2O01 J;  4K35 A;  1K8A Q;  1IFI A;  1USD A;  3GHG B;  3II6 A;  3CCS P;  1JY3 P;  1BGY E;  4ZU2 A;  1ZRT D;  2V7Q H;  3QYR A;  1VF5 D;  1FZG A;  3PE8 A;  2YIU C;  5EFW B;  2VSU F;  1NVO A;  2LR2 A;  2ZL4 A;  5MGB A;  2QIW A;  4U7J A;  1Q7Y Q;  5CHX A;  3CC2 P;  2BEQ D;  4GHN A;  4WWI A;  2AXC A;  1URQ A;  1E5W A;  2PBP A;  5DL1 A;  2ZFC A;  2FYU E;  2OQQ A;  3OC7 A;  2X58 A;  1BDD A;  1P84 I;  1JMM A;  1IZN B;  1L0N G;  2AEJ A;  4FN8 A;  5INI A;  1RF0 C;  2A06 G;  1L4A B;  1WRG A;  2QJY C;  2OYH A;  3QRE A;  1SQQ G;  1FC6 A;  1JCC A;  5CCH D;  2E74 C;  3K50 A;  1U57 A;  1HF9 A;  2HOD B;  3AED C;  2QQ3 A;  5AVT B;  2R44 A;  5KAF H;  3BAT A;  1L0L J;  1JUN A;  2IEX A;  2HOD A;  2WIT A;  1SQP E;  5KLV K;  3Q7H A;  3H1I G;  1ZN5 A;  2J5U A;  3JSV C;  1OXZ A;  1L4A D;  1UIY A;  2F6I A;  3F5H A;  1PL5 A;  5AW2 B;  1YG8 A;  3O6Q A;  5C90 A;  1K05 A;  3MUD C;  3TT7 A;  4IFM A;  3L73 G;  1NJI Q;  1HH0 A;  3RK3 B;  3LW5 H;  4XFJ A;  1KYO I;  1H88 A;  3V2P A;  4HC8 A;  1T8Z A;  2M5A B;  5KJP A;  3SWK A;  1MKM A;  3HUS B;  1DUB A;  4MXI A;  5BVZ A;  3AE4 C;  1AQ5 A;  3M6N A;  1OD4 A;  5AW6 B;  3ST9 A;  3L35 A;  5B5E E;  1SFC D;  5DU4 A;  2ZAE B;  3VYI A;  1L0L D;  2GUV A;  1M90 Q;  1MFT A;  4ASV A;  2H43 A;  1ON9 A;  1NTZ J;  1A02 F;  2IBZ E;  4QIJ A;  2P2U A;  2N9Y B;  4IZB A;  1DEB A;  5KLV E;  3M0D A;  3E7K A;  3QWO C;  2KLV A;  2OYI B;  4OGQ C;  5KLI C;  4R4L A;  3RL0 C;  3E1R A;  1WT6 A;  2FBW C;  3CC4 P;  1RQV A;  3BEZ A;  1J1E C;  1EDK A;  5APS A;  3IAV A;  2J5G D;  3U1A A;  3TT6 A;  1LTA C;  4GKG A;  3IB9 A;  2E76 B;  4UB8 H;  4JYB A;  1DH3 A;  3V5B A;  4NPE A;  2B88 A;  1WDK A;  5G1R A;  4L76 A;  2WPQ A;  5INF A;  5DTW A;  4LK5 A;  2OTL P;  4JOT A;  3AEA C;  2P1J A;  3PLN A;  3I56 P;  1UYS A;  3RST A;  4GIF A;  4WY4 B;  2YKQ A;  1SQV G;  3AEE C;  1RE4 C;  2HPC A;  1NTZ D;  2E76 D;  3STA A;  2H89 C;  1NTK J;  2Z5H A;  3RBZ A;  5CCG A;  1NYH A;  4Q1I A;  2R5D A;  4PJ0 E;  1N7L A;  1N6F A;  4HNK A;  3Q0J A;  3FGA D;  5GTH E;  2ZXE B;  2FY8 A;  3IF4 A;  4JSB A;  1RE3 A;  1Z56 A;  4N78 E;  3L72 E;  3AEB C;  3ABV C;  1IJD B;  2WPS A;  5BU5 A;  3K5B A;  3BCC J;  3EFF K;  3QK8 A;  2YO2 A;  2FKW B;  3MHV A;  5AW9 B;  4PV1 D;  4IFF A;  4ELW A;  1FJK A;  2KP8 A;  1PP9 G;  4ZNC A;  4N6J A;  2FBM A;  2J58 A;  3CWB G;  4EIJ A;  1HGV A;  2F9I B;  1BGY G; 
#chains in the Genus database with same CATH homology
 3KTG A;  1KIL E;  2E75 D;  5DU6 A;  3P85 A;  1ZME C;  2P10 A;  3QMJ A;  2D2C C;  1Q51 A;  3WG5 A;  4I52 A;  2FXP A;  3TVU A;  2BEZ F;  3U9T B;  2QSI A;  1J7X A;  3KTH A;  2DUB A;  4I7Z C;  4ZDC A;  2J5G A;  1PV3 A;  3Q0G A;  2ZT9 D;  4JJT A;  5E0N X;  5E0S H;  5DKP A;  2WSC J;  3R0O A;  1UYT A;  4L8K A;  4Y28 J;  1Y9B A;  1N6E A;  4FND A;  1OW7 A;  5ING A;  4OGQ B;  3Q2Y A;  3H81 A;  2J5I I;  3RL0 g;  2QJP C;  2J5I A;  3NJD A;  4OLQ A;  3IN6 A;  3RSI A;  2Q35 A;  4MOU A;  4J2U A;  1OW8 A;  1UYR A;  3Q5R A;  2D2C D;  3AE7 C;  4FN7 A;  3LW5 J;  3ZWC A;  2J5S A;  3KTI A;  4U0G H;  1HJ0 A;  3G64 A;  5FIF A;  1PJH A;  2GTR A;  1RQU A;  3QXZ A;  1UIX A;  1WDM A;  2BZR A;  4K3W A;  4U19 A;  1YQ4 C;  3P5M A;  1JB0 J;  1WMK A;  3SWX A;  5DZK A;  3OME A;  5KDR B;  1HZD A;  3PZK A;  3MFM A;  3TVW A;  3SFE C;  5G1S A;  2VSU C;  5KDR A;  1EXI A;  4KPK A;  1ZOY C;  2YMK A;  3I47 A;  4PV1 B;  4F47 A;  1HNU A;  2VSS A;  1ZP0 C;  4QII A;  3LKE A;  3MT6 A;  4H44 C;  1K32 A;  3M6M A;  4RYF H;  1Y7O A;  4YXD C;  1RJN A;  5FUS A;  4NNQ A;  5DTP A;  5CTC A;  5CTB A;  3K8X A;  2E75 B;  3BF0 A;  3KTK A;  3QXI A;  5JBW A;  1FC9 A;  4H13 C;  2Q2X A;  3OT6 A;  3T3W A;  2A7K A;  4FNB A;  5L8R J;  4JWV A;  3H0Q A;  3B71 A;  1RJM A;  4QFE A;  4I42 A;  1VF5 C;  1O8U A;  3T8A A;  2FZS A;  4ZDF A;  4FZW A;  3R9S A;  1X0U A;  3RRV A;  4JVT A;  2ZL0 A;  1NGM B;  2WTB A;  3AE2 C;  4ZDD A;  4U1A A;  5DUF A;  4JCR A;  4H0L C;  4FB8 A;  3HP0 A;  4K2N A;  3FF6 A;  2VX2 A;  4IZC A;  4WZ8 B;  1HNO A;  2F9I A;  3KTJ A;  1DD3 A;  3GMA A;  1KQF B;  1XX4 A;  1ON3 A;  3T97 B;  3QKA A;  2VRE A;  4JFC A;  1XNY A;  3MOY A;  3LAO A;  2O01 J;  4MI2 A;  1KOR A;  4I4Z A;  2D2C B;  2WSF J;  2F9Y B;  3AEG C;  1KMI Z;  2PPY A;  2UZF A;  4Q0G A;  4GM2 A;  4ZU2 A;  1DCI A;  3QYR A;  4I7Z B;  1VF5 D;  3ZW9 A;  1EXJ A;  3PE8 A;  2YIU C;  4WYO B;  2VSU F;  2VSS F;  3ZWB A;  2ZL4 A;  3TV5 A;  5MGB A;  1SG4 A;  1DIP A;  2QIW A;  4U7J A;  1WZ8 A;  3SFD C;  2D3T A;  5KKZ C;  2E76 C;  3Q5P A;  3ZWA A;  4L6W A;  2BEQ D;  4FJW D;  4GHN A;  4Z1M H;  1Q90 D;  5G1Q A;  2PBP A;  5DL1 A;  2OQQ A;  3OC7 A;  2X58 A;  4B3J A;  3C8V A;  3AE5 C;  3T8B A;  3VIV A;  4FN8 A;  5INI A;  4EMP A;  2QJY C;  4TT3 H;  1GMJ A;  2C8T A;  3GKB A;  3QRE A;  1N6D A;  1FC6 A;  2W3P A;  3IBB A;  2E74 C;  3K50 A;  1U57 A;  1HF9 A;  4KNP A;  3AED C;  2WPV B;  2QQ3 A;  4JCS A;  4GDO A;  3AEC C;  5DZK H;  1NZY B;  3G9R A;  4RCN A;  2IEX A;  1YG6 A;  1OW6 A;  3Q7H A;  3D6Z A;  4KT0 J;  3RK3 E;  2J5U A;  2A81 A;  4JCT A;  3NJB A;  3AEF C;  1EF9 A;  4ZDB A;  1UIY A;  3R9T A;  3S9O A;  2ZL3 A;  2F6I A;  4JCQ A;  2CBY A;  2MKV A;  1PL5 A;  1XNV A;  3D71 A;  1S5L X;  4H44 B;  1ZRT E;  3HRX A;  1YG8 A;  3O6Q A;  2FYN C;  2JO1 A;  5C90 A;  1K05 A;  3TZ3 A;  1Q52 A;  1OMI A;  3HE2 A;  3TT7 A;  4FZW C;  3GF7 A;  2NP9 A;  2ZQR A;  4G2R A;  2QJK C;  4XFJ A;  4U0H A;  2V7Q J;  2FW2 A;  4H13 B;  1FDO A;  4HC8 A;  3IAO A;  3N6R B;  2ZT9 C;  1FDI A;  5KJP A;  3AE6 C;  1MKM A;  1DUB A;  4MXI A;  2K9Y A;  1VF5 B;  3AE4 C;  3Q1T A;  3M6N A;  4HDT A;  3SLL A;  1OD4 A;  3EWK A;  4H44 D;  4IL6 X;  1K39 A;  5C9G A;  3AE9 C;  3R9Q A;  4JYL A;  3ST9 A;  3TRR A;  2ZL2 A;  4EMM A;  2G8Y A;  1R8E A;  1AJY A;  1PIX A;  4H0L B;  5DU4 A;  3TLF A;  5IKL B;  1EF8 A;  3H25 A;  1YQ3 C;  4H13 D;  2IDB A;  3BPP A;  3U9R B;  1WDL A;  3AE3 C;  5JBX A;  1ON9 A;  3GF3 A;  1FC7 A;  1OD2 A;  5E0S A;  1TG6 A;  2F9Y A;  4QIJ A;  4IZB A;  3ISA A;  2F6Q A;  4U18 A;  4ELS A;  3R6H A;  1TYF A;  3H0U A;  4NAR A;  4IZD A;  2WSE J;  3DJA A;  3R4Y A;  3V5I A;  1XO6 A;  4R4M A;  2WQY C;  3AE1 C;  2NZ2 A;  4OGQ C;  4Z0M A;  4H0L D;  5KLI C;  2YJG A;  2ZQQ A;  4R4L A;  2PG8 A;  1XNW A;  3TDC A;  2FBW C;  1KQG B;  5M1B A;  1RQV A;  3BEZ A;  2DEO A;  2JP3 A;  5DUC A;  4K29 A;  1DD4 A;  3IAV A;  2J5G D;  2J5I B;  3TT6 A;  2CE3 A;  3T89 A;  3MYB A;  4U0G A;  1VL2 A;  3IB9 A;  2E76 B;  3H0J A;  3DOR A;  4ASI A;  3D70 A;  3KQF A;  1UYV A;  1WDK A;  5G1R A;  5INF A;  5DTW A;  2VSU E;  3HIN A;  4LK5 A;  2VSS E;  3H0S A;  4YLH A;  4B3H A;  4JOT A;  3AEA C;  2H88 C;  5DU8 A;  4B3I A;  1UYS A;  4PV1 C;  1SZO A;  3RST A;  1VRG A;  4NEK A;  3D6Y A;  3Q3D A;  4KWB A;  3AEE C;  2EJ5 A;  2E74 B;  4RYF A;  2E76 D;  3QWD A;  4OGQ D;  3STA A;  2H89 C;  1NZY A;  1W2X A;  3U9S B;  3HLN 1;  3T88 A;  1NYH A;  4Q1I A;  4ZDE A;  2E75 C;  3Q1M A;  1N6F A;  3Q5S A;  2VSU A;  2A7S A;  1S1C X;  3JU1 A;  4HNK A;  3Q0J A;  3FGA D;  4KD6 A;  4RKU J;  2X24 A;  3BPT A;  4JSB A;  4OG1 A;  3AEB C;  3ABV C;  3V5E A;  3PEA A;  1FCF A;  1IK7 A;  2E74 D;  3L3S A;  3ZW8 A;  1EY3 A;  3QK8 A;  4DI1 A;  3AE8 C;  4OMR A;  1JXZ A;  3FDU A;  2HW5 A;  3P2L A;  3GLM A;  4PV1 D;  1K04 A;  4ELW A;  4WCZ A;  4JYJ A;  1MJ3 A;  4EML A;  2G3A A;  4ELX A;  3H02 A;  1KTM A;  2FBM A;  2Q34 A;  5HUQ A;  2ZT9 B;  3PGQ A;  1TU3 F;  4YTP C;  2F9I B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...