3GF7A

Glutaconyl-coa decarboxylase a subunit from clostridium symbiosum apoprotein
Total Genus 204
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
204
sequence length
585
structure length
543
Chain Sequence
MYSMPGYFQNMPTIGKELVNPNPENEQEIKAVESDIHESIKKALDAGITSEEKLNERGQLSAMQRINALIDPGTWCPLNSLFNPENNKFGTTNIVNGLGRVDGKWVYIVASDNKKMAGAWVPGQAENLIRCSDAAKMMHLPLIYLLNCSGVEFPNQDKVYPNRRGGGTPFFRNSELNQLGIPVIVGIYGTNPAGGGYHSISPTILIAHQDANMAVGKVPAPGSVPIHYDETGFFREVYQNDLGVIDGIKKYISYLPAYNLEFFRVDTPKAPQLPAEDLYSIIPMNQKRPYDIYEVIARLFDNSEFSEYKKGYGPEMVTGLAKVNGLLVGVIANVQGLLMNYPEYKQNSVGIGGKLYRQGLIKMNEFVTLCARDRIPLIWLQDTTGIDVGDEAEKAELLGLGQSLIYSIENSKLPSLEITIRKASAAAHYVLGGPQGNNTNVFSIGTGACEYYVMPGETAANAMYSRKLQPIIGKMNDMIQMYTDKSRPKYCTEKGMVDEIVDMTEVRPYIQAFTEAAYQNPQSICPMHQMLTPRSTREFETFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutaconyl-CoA decarboxylase subunit A
publication title An asymmetric model for Na+-translocating glutaconyl-CoA decarboxylases
pubmed doi rcsb
source organism Clostridium symbiosum
molecule tags Lyase
total genus 204
structure length 543
sequence length 585
ec nomenclature ec 4.1.1.70: Transferred entry: 7.2.4.5.
pdb deposition date 2009-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01039 Carboxyl_trans Carboxyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.680 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Helix bin 3gf7A01
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3gf7A02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3gf7A03
2J5IB 4JCRA 5DL1A 4I42A 3H0SA 5JBWA 4EMPA 3U9TB 5E0NX 1YG8A 1Q51A 3PZKA 3TDCA 2FZSA 1XNVA 1VRGA 3T89A 1UYRA 3LKEA 4U0GA 5INFA 5DU8A 3WG5A 4JCQA 2A81A 2F9YA 3QREA 3GF3A 5DUCA 3GKBA 3ST9A 3DORA 3VIVA 1N6FA 1N6EA 1EY3A 4ZDCA 3QXZA 4I52A 5KDRB 4FZWA 2VSSA 4KD6A 4FN7A 4U19A 3P2LA 1ON9A 1W2XA 1DUBA 1FC6A 5INGA 4K3WA 3L3SA 1ON3A 2Q2XA 2A7SA 2ZL2A 3BF0A 5IKLB 5G1SA 3MFMA 5G1RA 4KNPA 3NJBA 3FF6A 2ZL3A 3ZWAA 4MXIA 4JJTA 1OD2A 4ZDEA 4OG1A 2VSSF 3PEAA 1SG4A 1PJHA 3HLN1 3TT7A 5JBXA 4ELSA 3OMEA 3T3WA 2J5GD 3N6RB 4JOTA 4ZDFA 2F9IA 3K50A 1UYSA 3P5MA 4LK5A 3T8BA 3RSIA 5E0SA 3R9QA 5C9GA 1EF8A 2WTBA 2BZRA 2C8TA 3H81A 3U9RB 4HNKA 4B3JA 1TG6A 4ELXA 3KTGA 3T88A 4K29A 3IAVA 4FNDA 1J7XA 1HZDA 3G64A 1OD4A 5C90A 5DUFA 4RYFA 3V5EA 4U18A 3P85A 4U1AA 2VSUC 3IBBA 1WZ8A 3M6MA 3QYRA 2FW2A 3U9SB 4FB8A 3HE2A 4KPKA 5KJPA 3ZWCA 3I47A 2PG8A 4F47A 3QK8A 3KTJA 3OC7A 4K2NA 4GM2A 2F9YB 3KQFA 1UYVA 3SWXA 4JCTA 1EF9A 1PIXA 4ELWA 2D3TA 2F6IA 4B3HA 3R0OA 3Q0JA 4IZCA 3OT6A 4GHNA 4FNBA 3V5IA 2QQ3A 4QIIA 3SLLA 2VREA 4IZBA 4U0HA 4JSBA 1RJNA 4L8KA 2HW5A 5E0SH 1FCFA 1HNOA 3LAOA 5DZKH 3M6NA 1WDLA 3R9SA 3TZ3A 2EJ5A 5DTWA 3QMJA 3FDUA 1WDKA 3HRXA 4I4ZA 3H0QA 4KWBA 2DEOA 1FC7A 3R9TA 4NNQA 5DKPA 4RCNA 4IZDA 3DJAA 2ZQRA 3T8AA 2GTRA 1YG6A 3TVWA 2FBMA 5INIA 2ZQQA 4JYJA 3TV5A 4RYFH 1WDMA 5DZKA 1HNUA 2F9IB 1MJ3A 3QWDA 4JFCA 2J5GA 3GMAA 1NZYA 4FZWC 4Q0GA 3RRVA 2VSUE 3QXIA 3R6HA 3TLFA 1SZOA 4JCSA 3H0UA 3GF7A 3RSTA 1Y7OA 2J5IA 1X0UA 3GLMA 3ZW8A 3HINA 4QIJA 2ZL0A 4G2RA 1JXZA 3MOYA 4L6WA 1UIYA 1O8UA 3JU1A 4ZDBA 2CBYA 2UZFA 1RJMA 2X24A 4JYLA 2VX2A 4WYOB 4NEKA 5G1QA 4MOUA 3BPPA 4Z0MA 1DCIA 4MI2A 3MYBA 2J5II 2PPYA 5DU4A 3ISAA 4YLHA 5KDRA 4ZU2A 4ASIA 1XX4A 3NJDA 3H02A 3H0JA 4OLQA 1XO6A 3PE8A 2NP9A 5DTPA 4WCZA 3PGQA 4EMLA 3ZWBA 1XNWA 2A7KA 3KTIA 3HP0A 3KTKA 5FIFA 5FUSA 4EMMA 3STAA 3MT6A 5CTBA 4OMRA 2VSSE 3Q1TA 4FN8A 2VSUA 1XNYA 4FJWD 2X58A 2F6QA 1K39A 1FC9A 2W3PA 3K8XA 2ZL4A 2PBPA 3KTHA 1TYFA 2DUBA 3ZW9A 4QFEA 3Q7HA 5DU6A 2J5SA 4ZDDA 1NZYB 1N6DA 1UYTA 2VSUF 2Q35A 4WZ8B 4B3IA 1Q52A 3QKAA 3IB9A 4Q1IA 5CTCA 5MGBA 4JWVA 3BEZA 3TT6A 2CE3A 2Q34A 4DI1A 3Q0GA 4U0GH 4JVTA 2IEXA 3TRRA 1K32A 3TVUA 4HC8A
chains in the Genus database with same CATH superfamily
2J5IB 5AVZB 1NTZE 5DL1A 4I42A 5K5GB 2PAJA 1VQKP 4C7NA 5E79E 1K04A 2QVAA 1N7SC 2OARA 1HJ0A 2IFMA 1XNVA 1VRGA 5TISE 1P84I 4KHXA 2HR3A 1CW5A 5DU8A 3WG5A 2N1TC 4IFMA 1SQBJ 2A81A 3QREA 3L4FA 3GF3A 5DUCA 3ST9A 1S2EA 3VIVA 1N6FA 3HUSA 1EY3A 4ZDCA 3NTNA 1JCCA 3L70J 4U19A 3P2LA 5HUQA 1OWAA 3CXHE 1NTMK 3L71J 1JMBA 3BCCD 1RF1B 3KZIE 1L0NK 3HTKB 3H1LE 1RQVA 1BDCA 1NAFA 1USEA 2ZL3A 3ZWAA 3MP7B 5KLVK 4ZDEA 2VSSF 1NAYA 4TLFA 3TNUB 1PJHA 4W7ZA 3PP5A 5JBXA 3AEAC 3T3WA 2J5GD 1NKNA 2IBZG 5KAIH 1FS0E 3GG2A 3CC7P 2F9IA 3K50A 1UYSA 1IFMA 2NZ2A 3P5MA 2XV5A 2WSEH 1DIPA 1CI6A 2MJZA 4LK5A 1LTJA 1H89A 3WUTA 1E79H 1AQTA 1SQXG 4L73A 3HRNA 3H1KG 2FBWC 3RK2D 4DOJA 1GL2D 1QL2A 1U7JA 1PGPA 1JY2O 3H81A 3U9RB 1TG6A 2WZ7A 3PH0A 1RF1C 2YO3A 1SQPJ 1LWUB 4U3FJ 3CX5E 4K35A 1LT9A 1BE3G 3RK3E 3PTZA 4FNDA 5KAFE 1J7XA 3CCUP 3VN0A 3A5TA 1YTZT 1Y47A 1CSBA 4YXWH 4N3YB 1EC5A 1GU5A 2KNCB 3I56P 2LXCB 1FDMA 2JDIH 3BATA 4D6TE 4KPKA 1QVGO 3FWLA 3CCMP 3VOPA 1N8RQ 4HKZH 1FC2C 3CC2P 1EDKA 2AEFA 3KTJA 3OC7A 3H1HE 4K2NA 1GW3A 1L4AD 2Q1KA 3KQFA 1UYVA 1EF9A 1IJDB 1SQVJ 2R3CA 2FYUJ 1GMJA 1LWUC 5CCHC 3R0OA 4IZCA 3R2PA 3L74J 1FOSE 3AECC 4GHNA 1GU4A 4I7ZB 5AVSB 1N2DC 3CCLP 1HWTC 1RF0C 3Q3DA 2M0BA 3CXHI 4L8KA 3HD7B 4QMAA 3L72G 1WMKA 3LAOA 1S9KD 5DZKH 1WRGA 2GA1A 1WDLA 3TZ3A 2WPRA 1GW4A 2PFXA 3QMJA 3FDUA 1EZVD 4DJGA 1OZHA 3L75G 4EDFA 1L0LK 2E5YA 2Q5UA 3IN6A 2C0WA 1OW6A 4I4ZA 4KWBA 2DEOA 1FC7A 5CCGD 3R9TA 1N7SA 2ZQRA 3H32B 2GUVA 1M1JB 3I5CA 3LW5H 2W6AA 3TV5A 2N1TA 4PD4E 5DZKA 1HNUA 1OIPA 3QWDA 5DJTB 3RK3B 1NTZJ 4JFCA 1ZOYC 4WY4B 1JY2P 5BVZA 5CJ4A 2WPQA 1NZYA 2WQYC 4I7ZC 4Q0GA 1LP1A 2VSUE 2D2CD 1ZLLA 2WITA 2JEEA 1VPCA 3AE7C 3Q1MA 3B5NA 2O01N 3VP8A 1LGHB 4H0LD 1YTZI 1T3JA 5APQA 3RSTA 4UB6E 2J5IA 1PP9G 3GLMA 3H1JD 4A7PA 3TSIA 2R44A 3MOYA 1IFPA 1SLQA 5APSA 4GDOA 4UB8H 3TYYA 3JU1A 1M1JC 1SQQD 3V4QA 1KFNA 2UZFA 2PP6A 1QGKB 5AW9B 1JMMA 2IBZD 3MUDC 3RK3C 3H1LJ 4WYOB 4NEKA 2XNDH 3KQGA 2PGDA 4EYYQ 1KZUB 2HLOA 2KXPB 2N9YB 3FGAD 3M0AA 3AE9C 1SQXD 2ZFCA 3H1KD 3W68A 1NTME 2YKPA 5CMZA 1XX4A 3H0JA 4YXDC 1VQ9P 1L0NE 2D2CC 4Y99B 1QEXA 1S5LH 4OH8B 1YHQP 5DJUB 1OXZA 3T97B 4EIJA 4WCZA 5APWA 1RF1A 3FXDA 1PZQA 2XZRA 1NTKJ 3HTKA 1YYCA 2CPBA 5KLVE 2E43A 5B5EH 2HG5D 1N73B 4GT1A 4R4LA 4EMMA 2M5AB 2H89C 3TNUA 2JWAA 4FJWD 1BCCG 2KLUA 1K39A 1FC9A 1T2KD 1BGYE 1AA0A 1MFZA 2K9JB 2IBZI 2V7QH 3CWBJ 1YITP 1EDLA 3MGNA 1NKZB 1TYFA 3H1ID 1W2EA 3RBZA 4QFEA 2XKMA 5DU6A 2WSFJ 4AUWA 1YJWP 3CI9A 4Y99C 3G71P 4ZDDA 3E1IA 1N6DA 2Q35A 4WZ8B 1LWUA 5CCHA 4D6TJ 3N4XA 1YI2P 3QKAA 3IB9A 5CTCA 5MGBA 4J2UA 4JWVA 3F89A 3TF5A 3Q0GA 4HH2A 3U59A 2QRXA 1N73C 3TRRA 3S9OA 2OYIB 1RF0A 3TVUA 3L72D 1VQLP 2MKVA 3H1HJ 4GODA 1IFNA 2Y0DA 4RJTA 3V2QA 4I2LC 3ITKA 1FZEA 1P84E 1OX3A 3GHGB 2E76B 5H2FH 3AE3C 4EMPA 3MIWA 3AE8C 1SS1A 1URQD 2QJKB 1AVYA 3LKEA 5INFA 2E74B 4R4MA 2ITAA 1KYOD 1FAVA 4HYTB 3D71A 2H8PD 2XNXA 2M3BA 3DORA 1S1CX 3L70D 1NHLA 4HC8A 4PV1D 3QXZA 3USSA 5KDRB 2VSSA 3L71D 1ON9A 2ZT9D 1DUBA 3A0HH 4JBZA 2OYIC 1JY3N 4MN4C 1MUUA 3HD7A 4K3WA 3II6A 3A7OA 2A7SA 2ZL2A 4LGDE 3V2NA 5TJHA 1L0LE 3GHGC 3MFMA 1FBMA 4KNPA 3FF6A 1N7SD 1T6AA 5CHXA 2C9LY 2KOGA 2QJKC 1U7MA 2E74C 2N1TD 1KQSO 3H32A 1ZP0C 1M1JA 4UB8E 3HLN1 1VQNP 3OMEA 3N6RB 1URQC 3P8MC 3HE4B 1SQXK 4NPFX 3T8BA 3RSIA 1Y8AA 5E0SA 1PL5A 3BCCE 1AJYA 3B5ND 2QJPC 4WWIA 4I1LA 4H13B 2C8TA 1SQPD 3AE6C 4HNKA 4U3FD 3ABVC 1Q90D 3D6YA 1J1DB 2E42A 1KB9H 3T88A 4K29A 3IAVA 1NU1G 1IZNB 1IK9A 2ZVOB 2H43A 1EZVG 2A06D 2E75B 5AVYB 3V5EA 1FU1A 4U18A 4OVNF 3D6ZA 1NTMJ 4OGQB 1WZ8A 4EOTA 1HVVA 1BCCD 1L0NJ 1USDA 3U9SB 4FB8A 3HE2A 1R8EA 3ZWCA 2JO1A 1KQGB 3NXSA 2FKWB 3RGUA 3KXDA 4M3LA 3L73E 2BCCE 4DZOA 5KLVJ 3TK1A 1SQVD 4H44B 2KI7B 4H13C 3AEGC 2YMYA 1PGJA 3PRJA 1G1IA 3L74D 5AVXB 3M9QA 5AW7B 3B5NC 5AVUB 4YPCA 3T97A 1J1DC 1S3JA 1BGYJ 3V5IA 1HF9A 2J5UA 4QIIA 1HGZA 2QM8A 2FFDB 2VREA 5B66E 4IZBA 2HW5A 1LTSC 3H1JG 1BSHA 1N73A 1JCDA 4OGQC 2M5AA 1VQ8P 5DTWA 1SQQG 1WDKA 2B9BA 4PJ0H 2K9JA 5L8RJ 1ZR2A 2R5DA 2GTRA 3V2RA 4H44C 1YG6A 3WU2E 3TVWA 1OW7A 5INIA 1RH5B 4Z1MH 1NTZD 3AE2C 3C1LA 1ZMEC 1SP4A 5CCHD 3M9HA 1MKMA 1X79B 1GK6A 1ZV8A 1KC8Q 4FZWC 1VQMP 3RRVA 1X0TA 3CL3D 1S9KE 4NPEA 2FFDC 3VMXA 3QXIA 3TLFA 4JCSA 3B8EB 3H0UA 4GIFA 2OYIA 3R4YA 2ZVNB 3GF7A 1T3UA 4K3AA 4IFFA 2PRRA 2Y0EA 1OVUA 5M1BA 1Y7OA 3A0BH 3S4RA 1X0UA 3MTUE 3ZW8A 1KYOH 2IYPA 5CBNA 4QIJA 2FXMA 3GHGA 2K1AA 1JXZA 3CPWO 4L6WA 3SFEC 1O8UA 1LT1A 1BDDA 3A2AA 1SFCB 4ZDBA 3TGUG 3V6IA 4L76A 1RJMA 2WSCJ 3W67A 1ZRTD 1KILE 2R32A 3G6EP 1ZW0A 3H1IG 2Y9YA 3C8VA 2LR2A 1URQA 2K88A 1L0LJ 4MOUA 4Z0MA 1DCIA 4MI2A 3Q5RA 4IL6E 1K9MQ 5DU4A 4YLHA 5KDRA 4ASIA 1JB0J 3NJDA 3HD7D 3CCEP 3PE8A 1J1EB 3E1RA 3VMYA 1FOSF 2QSIA 2NP9A 1LTAC 1Q82Q 1NTKD 3ZWBA 1KQFB 4I6MC 3WMM0 5KKZB 1NU1D 2DW3A 3CMEP 3HP0A 2K37A 3KTKA 1SFCC 2IBZE 1Q2NA 2B87B 1SQBG 2AXTH 2X58A 3CX5D 3MHVA 1DD4A 2RKLA 2W3PA 3RK3D 3CWBD 1SQXE 4WY4D 3H1KE 1LJ2A 5CJ0A 3V2PA 3Q5SA 3HE4A 3QWOC 3OJAB 1M90Q 3L70G 5APTA 5GTHH 2RMZA 3Q7HA 4JYBA 1BE3E 1J1EC 5AW0B 2I1JA 1Q86Q 3L71G 2YKOA 1XTGB 3HD7C 2ZXEB 3VMZA 2VSUF 4B3IA 5EFWB 2JWDA 5KKZC 1DH3A 1KFMA 3CCVP 2CE3A 2WT7B 1GTWA 3AE1C 3L73J 4U0GH 1IFJA 2IEXA 2BCCJ 1K32A 2JR8A 1EZVI 1K05A 3FX0A 1KILB 2YXRB 1NJIQ 3FWNA 3H0SA 5JBWA 1KB9D 1QLED 5E0NX 1YG8A 4KJMA 1Q51A 2FZSA 2G3AA 1FZBA 1M7LA 3PJSK 3T89A 5KJ7C 4WY4C 1UYRA 4U0GA 2O3JA 5KAIE 1PPJG 4JCQA 2JP3A 4B86A 3KDPB 4ZNCA 2IYOA 3WUUA 1IFDA 3SWYA 2FYZA 3RBXA 3GKBA 1VQ4P 3CCQP 2KS1B 1M57D 2I1KA 1SQPG 3G4SP 3CLQA 1N6EA 3HE5B 2P2UA 4U3FG 1NOHA 3P8CE 3L72E 2AXCA 4Y28J 4I52A 3M9BA 4FZWA 1VQOP 3BPTA 4KD6A 2OTLP 1EXJA 4N78E 1W2XA 3U1CA 1YJNP 1FC6A 3AEEC 4AQRD 1MV8A 2FFDA 1FDOA 5INGA 2Y0CA 3L75E 4PD4D 2KB7P 1ON3A 2AEMA 2NPSB 2A06G 3BF0A 2KIKA 3VYIA 1ZN5A 5IKLB 3JCUH 5G1RA 5AVQB 1JY3O 2Q9IA 4MXIA 1A02F 4JJTA 3CCSP 4OG1A 5E79H 3TGUD 1S4XA 1T8ZA 1YBKA 1OMIA 3TT7A 4ELSA 5TISH 4OWFA 1SQVG 4ZDFA 2W6BA 2QM7A 2OYHB 2FYUG 1H88A 2J58A 1G2CB 3L37A 3L74G 4IOIH 1Q81Q 1JO5A 2IZ0A 2Q3IA 3R9QA 5C9GA 2WTBA 2E5TA 2GM4A 1CI6B 1NYHA 2L5GB 1PP9E 4RO0A 4B3JA 3RL0B 4ELXA 5AW6B 1QL1A 2NRGA 2QG4A 3KTGA 3M06A 1NU1K 4GOFA 5AW4B 3VMAA 2E76D 2O1JA 2KP8A 1HZDA 3G64A 2KNCA 1KMIZ 4RYFA 2HPCB 2E74D 2VSUC 3IBBA 1JTHB 1SFCA 2KSEA 4HB1A 2W8ZA 2H88C 4WBAA 3QYRA 1SQBD 2FW2A 2P10A 5KTBA 1W5CE 1RHZB 5KJPA 2OYHC 3WUVA 2P7JA 3H6PA 3BVHA 1NTZG 1NGMB 4XE5B 3GW6A 4F47A 1HBWA 4U3FE 3QK8A 1RY3A 1OVVA 4NPDA 2F9YB 2JKVA 1PIXA 3RL0C 2D3TA 4B3HA 2H7HA 2OGUA 1BGYD 1FJPA 1H0TB 2FXPA 5KLIB 2R3SA 4FNBA 1SQXJ 1FZCB 3H1KJ 1GDTA 3SLLA 3CX5H 1FJKA 1BCCE 2E76C 1RJNA 3SWFA 1VL2A 5KAFH 1JY3P 5E0SH 1MZ9A 2WMMA 1X22A 3M6NA 3B71A 1SQQK 1BE3J 2EJ5A 2WVRA 3M0DC 1XTCC 2WSFH 4LLHA 3IAOA 2W27A 2B87A 1G1JA 4RESB 1KYOI 3H1LG 4L75A 4NNQA 5DKPA 4IZDA 3L74E 1DD3A 1PPJD 4H13D 3C9IA 2Y9ZA 5KJ7A 2FBMA 4WY4A 1YIJP 2ZQQA 1WDMA 3I55P 1VF5B 1MJ3A 4CPGA 2N9BA 5KLIC 2LXBA 2V4HA 1NTKG 4GKGA 1R5LA 1S5LE 2R5BA 2E75D 2WT7A 2VRSA 2O1KA 3R6HA 4HDTA 2SPZA 1SZOA 2IX7C 4U7JA 4OGQD 1KILA 2L91A 1U57A 2WSEJ 3P32A 5AVWB 2HODB 5B5EE 3HINA 1BSNA 1H8AA 1NH4A 1IFIA 3JCUE 5AW8B 3L72J 1EDJA 1UIYA 3KYQA 1Q7YQ 3CWBG 3PLNA 4H44D 2C9NY 1KQLA 2Q6QA 3P7KA 3L75J 4JYLA 1L0LD 3L36A 1VF5C 5BU8B 2FYUD 1JUNA 2YO2A 5G1QA 2KS1A 4PD4H 1A02J 3BPPA 1IC2A 2A45H 3HE5A 4D6TG 1GZLA 2J5II 2XDJA 3VTPC 3ISAA 4ZU2A 5CBOA 1PV3A 2P67A 1XO6A 1LTGC 5APUA 2POHA 3G3ZA 3H1HG 2E75C 3AEDC 4EMLA 3OA7A 2NPSA 3F5HA 2A7KA 1S72P 1NO4A 3KTIA 4UB6H 2Z5IA 1ZRTE 5FIFA 3IR9A 5FUSA 1SQBK 3MT6A 3NFQA 1EDIA 5H2FE 1PP9J 4OMRA 1AQ5A 1PGQA 2VSSE 3Q1TA 4FN8A 2VSUA 5BU5A 2M3EA 2B89A 2OYOA 3K8XA 2OYHA 1QX8A 1G2CA 3Q5PA 1Y9BA 2KK7A 2XU6A 2PBPA 3KTHA 2DUBA 1K8AQ 1NTKE 1IO4A 3ZW9A 2IFNA 4KT0J 5AW3B 4O9BA 2QEXP 4JPZB 1NU1E 1AV1A 1RQUA 1UYTA 1HUCA 4YTPC 1EZVE 4ZMDA 1FZFA 2W6JH 3A0HE 4Q1IA 4TT3H 3L73D 1UIXA 2A45G 2BCCD 3LIDA 4ASVA 3LW5J 1NWQA 3RK2B 4JVTA 2G8YA 3M91A 2I8DA 1GL2B 1SFCD 2WWWA 2KYVA 2RH0A 5APYA 2W90A 3CWBE 2HPCA 1YQ4C 4JCRA 5APVA 1JTHA 2KZIA 3CXHD 1KORA 4DCKA 3O6QB 1EQ7A 3M0DA 1L2PA 3U9TB 2B88A 3H1LD 4JYCA 3PZKA 3TDCA 1TU3F 4IL6X 2YJGA 3TDKA 3A3YB 1M1KQ 1M56D 1VQ5P 4DT0A 2YMKA 1BCCJ 1LTTC 4WB4A 1JOCA 2F9YA 1NVOA 1SQPK 1N7LA 1M8OB 2GUSA 2IDBA 3H1JE 3EFFK 5GTIH 1H0TA 4FN7A 4WVZA 1FZCA 2O01J 2KZJA 3RK2C 1L4AB 1GL2C 1SQQE 2UWJE 1KB9E 3L3SA 1GK4A 1DEEG 2Q2XA 1NTMG 1IK7A 2P1JA 3JC22 3BCCJ 5G1SA 3O8ZA 3H25A 2ZYAA 1L0NG 2QIWA 3NJBA 4BRYB 1P84H 1OD2A 4ZKUA 3PEAA 5KJ7D 1SG4A 5KLVG 1SQVK 3SSUA 2JJLA 2FYUK 1KD1Q 1JNMA 4JOTA 1VQPP 3E7KA 5AVVB 1JY2N 2K3RA 3NMDA 4JF7A 2Z4EA 4D6TD 1RE4C 4XA4A 1BGYG 1KTMA 1EF8A 2BZRA 1FDIA 1L4AC 4ZKPA 1KILD 2WPVB 3K5BA 2HFED 3H1HD 3U1AA 3AE4C 2WSCH 3Q2YA 2V7QJ 1AVOA 2OTKE 3BRTB 3PHLA 2WSSH 5AW2B 4BWNA 3TGUE 2HODA 2QA4P 2IPPA 1QVFO 2D2CB 1OD4A 5C90A 5DUFA 3G9RA 1KN7A 3CX5I 1JEKA 3P85A 4U1AA 3H1IE 4H0LB 3D70A 3V5BA 1VQ7P 4PJ0E 1X9VA 3M6MA 3V4WA 4C7NB 1NTZK 3I47A 1RE3C 1JM0A 2BEQD 2PG8A 2WPSA 2O01H 5CCGC 1N86A 3S1KA 1LNQA 4GM2A 3SWKA 3SWXA 4JCTA 3N7NA 3EQ2A 4IFDK 4ELWA 2OQQA 2ZAEB 2F6IA 4W80A 3HUSB 2NPSD 3QH9A 3Q0JA 5APXA 3CCRP 3MD0A 2YKQA 3OT6A 2CK3H 1ZR4A 1VDFA 1KILC 2QQ3A 2QJYB 1YQ3C 3KHUA 4U0HA 4JSBA 3EWKA 1SQBE 2IZ1A 2P58A 3A0BE 1FCFA 2ZYGA 1BE3D 1LTBC 4H0LC 1HNOA 1KB9I 1KYOE 2LKMA 1HH0A 3R9SA 3AE5C 4JQ0D 3OW2O 4RKUJ 1NU1J 3HRXA 3L70E 1AFOA 3H0QA 1SVFA 3EFGA 1UIIA 4L74A 1L0LG 4RCNA 3DJAA 3T8AA 3L71E 2Q3EA 2KSJA 1FE6A 3RL0D 4JYJA 2QE7H 4RYFH 2F9IB 3HUSC 2BASA 1HJBA 3UIAA 1HGVA 2J5GA 1LTJB 1PGOA 1NTKK 2FYNB 3GMAA 2YXQB 3B4SA 2KUBA 1OVRA 3CCJP 1FZGA 2NPSC 3JSVC 2QJYC 4PD4I 4C46A 3CXHH 3CD6P 5GTIE 2A45I 5AVTB 3BRVB 2Z5HA 3KZIH 1LTIC 1WT6A 1DX7A 1GL2A 3BCCG 5B66H 1NTMD 2ZJSE 1LT9B 1ZXGA 3AEBC 1R5SA 1YJ9P 1L0ND 3P8CD 3LIEA 3OAKA 2ZL0A 4G2RA 3O6QA 1CZQA 1PPJE 3KPEA 5C39A 4N78D 3H1JJ 4AYCA 2K9YA 4EI2A 2AXTE 4XFJA 2CBYA 3L35A 5AW1B 1J2JB 1X8YA 5KLVD 2YIUB 3L75D 1SQPE 4LC1A 1SQQJ 1K73Q 2X24A 2FXOA 3WU2H 1T2KC 2VX2A 2KLVA 1LTJC 2FYNC 5AVRB 2BEZF 3FXEA 4ASWA 1D7MA 5GTHE 3MYBA 2WTYA 1OW8A 2PPYA 1URQB 1VQ6P 1RE4A 1PFIA 2A06E 1Z56A 3H02A 4OLQA 3L73G 1E5WA 2CPSA 1L4AA 2OTJP 2BCCG 5DTPA 3MZWB 3SFDC 1LT9C 1EXIA 3PGQA 2M8RA 2QJPB 3VP9A 1XNWA 4C7RA 3CMAP 4PV1B 1FZAA 2ZT9B 2YNYA 2RN0A 4BRYA 1PP9D 1OFCX 2ZXXA 1SQVE 3STAA 3CC4P 2YIUC 2FYUE 5CTBA 1GD2E 3AEFC 2ZYDA 1XNYA 1HTLC 2F6QA 2FY8A 1VF5D 2HYNA 1RE3A 1N7SB 2ZL4A 4BXLA 3TGUJ 1P84D 1MFTA 3IFMA 5CCGA 1S5LX 3BASA 2N1TB 1DEBA 4IL6H 1FZCC 3MUDA 3H1IJ 2J5SA 4W7YA 1NZYB 2AEJA 1W2BO 4NARA 2C0XA 3RL0g 1LP1B 4GOEA 1Q52A 4N6JA 4PV1C 2W83C 3ZDMA 3BEZA 3TT6A 2Q34A 4DI1A 5AW5B 3IF4A 3B5NB 2ZT9C 2J59M 1KV4A 4HJGH 2Q7CA
chains in the Genus database with same CATH topology
2J5IB 1YQ4C 4JCRA 5DL1A 4I42A 1KORA 3H0SA 5JBWA 2E76B 3AE3C 1K04A 4EMPA 3U9TB 5E0NX 1YG8A 1Q51A 3PZKA 3TDCA 2FZSA 1HJ0A 1TU3F 2G3AA 3AE8C 4IL6X 2YJGA 1XNVA 1VRGA 3T89A 1UYRA 3LKEA 4U0GA 5INFA 2E74B 4R4MA 5DU8A 3WG5A 2YMKA 4JCQA 2JP3A 2A81A 2F9YA 3D71A 3QREA 3GF3A 5DUCA 3GKBA 3ST9A 3DORA 3VIVA 1N6FA 1S1CX 1N6EA 1EY3A 4ZDCA 2IDBA 4PV1D 3QXZA 4Y28J 4I52A 5KDRB 4FZWA 2VSSA 3BPTA 4KD6A 4FN7A 4U19A 3P2LA 1EXJA 1ON9A 2ZT9D 1W2XA 5HUQA 2O01J 1DUBA 1FC6A 3AEEC 1FDOA 5INGA 4K3WA 3L3SA 1ON3A 2Q2XA 2A7SA 1IK7A 2ZL2A 3BF0A 1RQVA 5IKLB 5G1SA 3H25A 3MFMA 5G1RA 4KNPA 2QIWA 3NJBA 3FF6A 2ZL3A 3ZWAA 4MXIA 4JJTA 1OD2A 4ZDEA 4OG1A 2VSSF 3PEAA 1SG4A 2QJKC 2E74C 1PJHA 1OMIA 1ZP0C 3HLN1 3TT7A 5JBXA 3AEAC 4ELSA 3OMEA 3T3WA 2J5GD 3N6RB 4JOTA 4ZDFA 2F9IA 3K50A 1UYSA 2NZ2A 3P5MA 1DIPA 4LK5A 3T8BA 3RSIA 5E0SA 1PL5A 3R9QA 1KTMA 1AJYA 1EF8A 2WTBA 5C9GA 2QJPC 2BZRA 1FDIA 2FBWC 4H13B 1NYHA 2C8TA 3H81A 3U9RB 3AE6C 4HNKA 4B3JA 1TG6A 4ELXA 2WPVB 3ABVC 1Q90D 3KTGA 3AE4C 3Q2YA 2V7QJ 3D6YA 2E76D 3RK3E 3T88A 4K29A 3IAVA 4FNDA 1J7XA 1HZDA 2D2CB 3G64A 1OD4A 5C90A 5DUFA 1KMIZ 2E75B 3G9RA 4RYFA 3V5EA 4U18A 3D6ZA 3P85A 4U1AA 2E74D 4H0LB 3D70A 2VSUC 3IBBA 4OGQB 1WZ8A 2H88C 3M6MA 3QYRA 2FW2A 2P10A 3U9SB 4FB8A 3HE2A 4KPKA 1R8EA 5KJPA 3ZWCA 3I47A 2JO1A 1KQGB 2BEQD 2PG8A 1NGMB 4F47A 3QK8A 3KTJA 3OC7A 4K2NA 4GM2A 4H44B 2F9YB 3KQFA 1UYVA 4H13C 3SWXA 4JCTA 3AEGC 1EF9A 1PIXA 4ELWA 2OQQA 2D3TA 2F6IA 1GMJA 4B3HA 3R0OA 3Q0JA 4IZCA 3OT6A 2FXPA 3AECC 4GHNA 4FNBA 4I7ZB 3V5IA 1HF9A 2QQ3A 2J5UA 4QIIA 1YQ3C 3SLLA 3Q3DA 2VREA 4IZBA 4U0HA 4JSBA 2E76C 3EWKA 1RJNA 4L8KA 2HW5A 1VL2A 5E0SH 1FCFA 1WMKA 4H0LC 1HNOA 3LAOA 4OGQC 5DZKH 3M6NA 3B71A 1WDLA 3R9SA 3AE5C 3TZ3A 2EJ5A 4RKUJ 5DTWA 3QMJA 3FDUA 3IAOA 1WDKA 3HRXA 3IN6A 1OW6A 4I4ZA 3H0QA 4KWBA 5L8RJ 2DEOA 1FC7A 3R9TA 4NNQA 5DKPA 4RCNA 4IZDA 3DJAA 2ZQRA 3T8AA 1DD3A 2GTRA 4H44C 1YG6A 4H13D 3TVWA 2FBMA 1OW7A 5INIA 2ZQQA 4Z1MH 4JYJA 3TV5A 4RYFH 1WDMA 5DZKA 1HNUA 3AE2C 2F9IB 1ZMEC 1VF5B 1MJ3A 3QWDA 4JFCA 1MKMA 2J5GA 1ZOYC 3GMAA 1NZYA 4FZWC 5KLIC 2WQYC 4I7ZC 4Q0GA 3RRVA 2QJYC 2VSUE 2D2CD 2E75D 3QXIA 3R6HA 4HDTA 3AE7C 3Q1MA 3TLFA 1SZOA 4H0LD 4JCSA 4U7JA 3H0UA 4OGQD 3R4YA 3GF7A 5M1BA 1Y7OA 3RSTA 1U57A 2J5IA 2WSEJ 1X0UA 3GLMA 3ZW8A 3AEBC 3HINA 4QIJA 2ZL0A 4G2RA 3O6QA 1JXZA 3MOYA 4L6WA 2K9YA 1UIYA 3SFEC 1O8UA 4GDOA 3JU1A 4ZDBA 4XFJA 2CBYA 4H44D 2UZFA 1RJMA 2WSCJ 1KILE 2X24A 4JYLA 1VF5C 3C8VA 2VX2A 4WYOB 2FYNC 4NEKA 5G1QA 4MOUA 2BEZF 3BPPA 4Z0MA 1DCIA 4MI2A 3Q5RA 3MYBA 3FGAD 2J5II 1OW8A 3AE9C 2PPYA 5DU4A 3ISAA 4YLHA 5KDRA 4ZU2A 4ASIA 1XX4A 1JB0J 3NJDA 3H02A 3H0JA 4OLQA 1PV3A 1XO6A 4YXDC 3PE8A 2D2CC 2QSIA 2NP9A 3T97B 5DTPA 2E75C 3SFDC 3AEDC 4WCZA 1EXIA 3PGQA 4EMLA 3ZWBA 1KQFB 1XNWA 2A7KA 4PV1B 3KTIA 3HP0A 1ZRTE 2ZT9B 3KTKA 5FIFA 4R4LA 5FUSA 4EMMA 3STAA 2H89C 3MT6A 2YIUC 5CTBA 3AEFC 4OMRA 2VSSE 3Q1TA 4FN8A 2VSUA 1XNYA 4FJWD 2X58A 2F6QA 1DD4A 1VF5D 1K39A 1FC9A 2W3PA 3K8XA 2ZL4A 3Q5SA 3Q5PA 1Y9BA 2PBPA 3KTHA 1TYFA 2DUBA 1S5LX 3ZW9A 4QFEA 4KT0J 3Q7HA 5DU6A 2WSFJ 2J5SA 4ZDDA 1NZYB 1N6DA 4NARA 1RQUA 1UYTA 2VSUF 4YTPC 3RL0g 2Q35A 4WZ8B 4B3IA 1Q52A 3QKAA 5KKZC 3IB9A 4Q1IA 4TT3H 5CTCA 4PV1C 4J2UA 5MGBA 4JWVA 3BEZA 1UIXA 2CE3A 3TT6A 2Q34A 4DI1A 3Q0GA 3AE1C 4U0GH 3LW5J 2ZT9C 4JVTA 2G8YA 2IEXA 3TRRA 1K32A 3S9OA 3TVUA 2MKVA 1K05A 4HC8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J5I B;  4JCR A;  5DL1 A;  4I42 A;  3H0S A;  5JBW A;  4EMP A;  3U9T B;  5E0N X;  1YG8 A;  1Q51 A;  3PZK A;  3TDC A;  2FZS A;  1XNV A;  1VRG A;  3T89 A;  1UYR A;  3LKE A;  4U0G A;  5INF A;  5DU8 A;  3WG5 A;  4JCQ A;  2A81 A;  2F9Y A;  3QRE A;  3GF3 A;  5DUC A;  3GKB A;  3ST9 A;  3DOR A;  3VIV A;  1N6F A;  1N6E A;  1EY3 A;  4ZDC A;  3QXZ A;  4I52 A;  5KDR B;  4FZW A;  2VSS A;  4KD6 A;  4FN7 A;  4U19 A;  3P2L A;  1ON9 A;  1W2X A;  1DUB A;  1FC6 A;  5ING A;  4K3W A;  3L3S A;  1ON3 A;  2Q2X A;  2A7S A;  2ZL2 A;  3BF0 A;  5IKL B;  5G1S A;  3MFM A;  5G1R A;  4KNP A;  3NJB A;  3FF6 A;  2ZL3 A;  3ZWA A;  4MXI A;  4JJT A;  1OD2 A;  4ZDE A;  4OG1 A;  2VSS F;  3PEA A;  1SG4 A;  1PJH A;  3HLN 1;  3TT7 A;  5JBX A;  4ELS A;  3OME A;  3T3W A;  2J5G D;  3N6R B;  4JOT A;  4ZDF A;  2F9I A;  3K50 A;  1UYS A;  3P5M A;  4LK5 A;  3T8B A;  3RSI A;  5E0S A;  3R9Q A;  5C9G A;  1EF8 A;  2WTB A;  2BZR A;  2C8T A;  3H81 A;  3U9R B;  4HNK A;  4B3J A;  1TG6 A;  4ELX A;  3KTG A;  3T88 A;  4K29 A;  3IAV A;  4FND A;  1J7X A;  1HZD A;  3G64 A;  1OD4 A;  5C90 A;  5DUF A;  4RYF A;  3V5E A;  4U18 A;  3P85 A;  4U1A A;  2VSU C;  3IBB A;  1WZ8 A;  3M6M A;  3QYR A;  2FW2 A;  3U9S B;  4FB8 A;  3HE2 A;  4KPK A;  5KJP A;  3ZWC A;  3I47 A;  2PG8 A;  4F47 A;  3QK8 A;  3KTJ A;  3OC7 A;  4K2N A;  4GM2 A;  2F9Y B;  3KQF A;  1UYV A;  3SWX A;  4JCT A;  1EF9 A;  1PIX A;  4ELW A;  2D3T A;  2F6I A;  4B3H A;  3R0O A;  3Q0J A;  4IZC A;  3OT6 A;  4GHN A;  4FNB A;  3V5I A;  2QQ3 A;  4QII A;  3SLL A;  2VRE A;  4IZB A;  4U0H A;  4JSB A;  1RJN A;  4L8K A;  2HW5 A;  5E0S H;  1FCF A;  1HNO A;  3LAO A;  5DZK H;  3M6N A;  1WDL A;  3R9S A;  3TZ3 A;  2EJ5 A;  5DTW A;  3QMJ A;  3FDU A;  1WDK A;  3HRX A;  4I4Z A;  3H0Q A;  4KWB A;  2DEO A;  1FC7 A;  3R9T A;  4NNQ A;  5DKP A;  4RCN A;  4IZD A;  3DJA A;  2ZQR A;  3T8A A;  2GTR A;  1YG6 A;  3TVW A;  2FBM A;  5INI A;  2ZQQ A;  4JYJ A;  3TV5 A;  4RYF H;  1WDM A;  5DZK A;  1HNU A;  2F9I B;  1MJ3 A;  3QWD A;  4JFC A;  2J5G A;  3GMA A;  1NZY A;  4FZW C;  4Q0G A;  3RRV A;  2VSU E;  3QXI A;  3R6H A;  3TLF A;  1SZO A;  4JCS A;  3H0U A;  3GF7 A;  3RST A;  1Y7O A;  2J5I A;  1X0U A;  3GLM A;  3ZW8 A;  3HIN A;  4QIJ A;  2ZL0 A;  4G2R A;  1JXZ A;  3MOY A;  4L6W A;  1UIY A;  1O8U A;  3JU1 A;  4ZDB A;  2CBY A;  2UZF A;  1RJM A;  2X24 A;  4JYL A;  2VX2 A;  4WYO B;  4NEK A;  5G1Q A;  4MOU A;  3BPP A;  4Z0M A;  1DCI A;  4MI2 A;  3MYB A;  2J5I I;  2PPY A;  5DU4 A;  3ISA A;  4YLH A;  5KDR A;  4ZU2 A;  4ASI A;  1XX4 A;  3NJD A;  3H02 A;  3H0J A;  4OLQ A;  1XO6 A;  3PE8 A;  2NP9 A;  5DTP A;  4WCZ A;  3PGQ A;  4EML A;  3ZWB A;  1XNW A;  2A7K A;  3KTI A;  3HP0 A;  3KTK A;  5FIF A;  5FUS A;  4EMM A;  3STA A;  3MT6 A;  5CTB A;  4OMR A;  2VSS E;  3Q1T A;  4FN8 A;  2VSU A;  1XNY A;  4FJW D;  2X58 A;  2F6Q A;  1K39 A;  1FC9 A;  2W3P A;  3K8X A;  2ZL4 A;  2PBP A;  3KTH A;  1TYF A;  2DUB A;  3ZW9 A;  4QFE A;  3Q7H A;  5DU6 A;  2J5S A;  4ZDD A;  1NZY B;  1N6D A;  1UYT A;  2VSU F;  2Q35 A;  4WZ8 B;  4B3I A;  1Q52 A;  3QKA A;  3IB9 A;  4Q1I A;  5CTC A;  5MGB A;  4JWV A;  3BEZ A;  3TT6 A;  2CE3 A;  2Q34 A;  4DI1 A;  3Q0G A;  4U0G H;  4JVT A;  2IEX A;  3TRR A;  1K32 A;  3TVU A;  4HC8 A; 
#chains in the Genus database with same CATH topology
 2J5I B;  5AVZ B;  1NTZ E;  5DL1 A;  4I42 A;  5K5G B;  2PAJ A;  1VQK P;  4C7N A;  5E79 E;  1K04 A;  2QVA A;  1N7S C;  2OAR A;  1HJ0 A;  2IFM A;  1XNV A;  1VRG A;  5TIS E;  1P84 I;  4KHX A;  2HR3 A;  1CW5 A;  5DU8 A;  3WG5 A;  2N1T C;  4IFM A;  1SQB J;  2A81 A;  3QRE A;  3L4F A;  3GF3 A;  5DUC A;  3ST9 A;  1S2E A;  3VIV A;  1N6F A;  3HUS A;  1EY3 A;  4ZDC A;  3NTN A;  1JCC A;  3L70 J;  4U19 A;  3P2L A;  5HUQ A;  1OWA A;  3CXH E;  1NTM K;  3L71 J;  1JMB A;  3BCC D;  1RF1 B;  3KZI E;  1L0N K;  3HTK B;  3H1L E;  1RQV A;  1BDC A;  1NAF A;  1USE A;  2ZL3 A;  3ZWA A;  3MP7 B;  5KLV K;  4ZDE A;  2VSS F;  1NAY A;  4TLF A;  3TNU B;  1PJH A;  4W7Z A;  3PP5 A;  5JBX A;  3AEA C;  3T3W A;  2J5G D;  1NKN A;  2IBZ G;  5KAI H;  1FS0 E;  3GG2 A;  3CC7 P;  2F9I A;  3K50 A;  1UYS A;  1IFM A;  2NZ2 A;  3P5M A;  2XV5 A;  2WSE H;  1DIP A;  1CI6 A;  2MJZ A;  4LK5 A;  1LTJ A;  1H89 A;  3WUT A;  1E79 H;  1AQT A;  1SQX G;  4L73 A;  3HRN A;  3H1K G;  2FBW C;  3RK2 D;  4DOJ A;  1GL2 D;  1QL2 A;  1U7J A;  1PGP A;  1JY2 O;  3H81 A;  3U9R B;  1TG6 A;  2WZ7 A;  3PH0 A;  1RF1 C;  2YO3 A;  1SQP J;  1LWU B;  4U3F J;  3CX5 E;  4K35 A;  1LT9 A;  1BE3 G;  3RK3 E;  3PTZ A;  4FND A;  5KAF E;  1J7X A;  3CCU P;  3VN0 A;  3A5T A;  1YTZ T;  1Y47 A;  1CSB A;  4YXW H;  4N3Y B;  1EC5 A;  1GU5 A;  2KNC B;  3I56 P;  2LXC B;  1FDM A;  2JDI H;  3BAT A;  4D6T E;  4KPK A;  1QVG O;  3FWL A;  3CCM P;  3VOP A;  1N8R Q;  4HKZ H;  1FC2 C;  3CC2 P;  1EDK A;  2AEF A;  3KTJ A;  3OC7 A;  3H1H E;  4K2N A;  1GW3 A;  1L4A D;  2Q1K A;  3KQF A;  1UYV A;  1EF9 A;  1IJD B;  1SQV J;  2R3C A;  2FYU J;  1GMJ A;  1LWU C;  5CCH C;  3R0O A;  4IZC A;  3R2P A;  3L74 J;  1FOS E;  3AEC C;  4GHN A;  1GU4 A;  4I7Z B;  5AVS B;  1N2D C;  3CCL P;  1HWT C;  1RF0 C;  3Q3D A;  2M0B A;  3CXH I;  4L8K A;  3HD7 B;  4QMA A;  3L72 G;  1WMK A;  3LAO A;  1S9K D;  5DZK H;  1WRG A;  2GA1 A;  1WDL A;  3TZ3 A;  2WPR A;  1GW4 A;  2PFX A;  3QMJ A;  3FDU A;  1EZV D;  4DJG A;  1OZH A;  3L75 G;  4EDF A;  1L0L K;  2E5Y A;  2Q5U A;  3IN6 A;  2C0W A;  1OW6 A;  4I4Z A;  4KWB A;  2DEO A;  1FC7 A;  5CCG D;  3R9T A;  1N7S A;  2ZQR A;  3H32 B;  2GUV A;  1M1J B;  3I5C A;  3LW5 H;  2W6A A;  3TV5 A;  2N1T A;  4PD4 E;  5DZK A;  1HNU A;  1OIP A;  3QWD A;  5DJT B;  3RK3 B;  1NTZ J;  4JFC A;  1ZOY C;  4WY4 B;  1JY2 P;  5BVZ A;  5CJ4 A;  2WPQ A;  1NZY A;  2WQY C;  4I7Z C;  4Q0G A;  1LP1 A;  2VSU E;  2D2C D;  1ZLL A;  2WIT A;  2JEE A;  1VPC A;  3AE7 C;  3Q1M A;  3B5N A;  2O01 N;  3VP8 A;  1LGH B;  4H0L D;  1YTZ I;  1T3J A;  5APQ A;  3RST A;  4UB6 E;  2J5I A;  1PP9 G;  3GLM A;  3H1J D;  4A7P A;  3TSI A;  2R44 A;  3MOY A;  1IFP A;  1SLQ A;  5APS A;  4GDO A;  4UB8 H;  3TYY A;  3JU1 A;  1M1J C;  1SQQ D;  3V4Q A;  1KFN A;  2UZF A;  2PP6 A;  1QGK B;  5AW9 B;  1JMM A;  2IBZ D;  3MUD C;  3RK3 C;  3H1L J;  4WYO B;  4NEK A;  2XND H;  3KQG A;  2PGD A;  4EYY Q;  1KZU B;  2HLO A;  2KXP B;  2N9Y B;  3FGA D;  3M0A A;  3AE9 C;  1SQX D;  2ZFC A;  3H1K D;  3W68 A;  1NTM E;  2YKP A;  5CMZ A;  1XX4 A;  3H0J A;  4YXD C;  1VQ9 P;  1L0N E;  2D2C C;  4Y99 B;  1QEX A;  1S5L H;  4OH8 B;  1YHQ P;  5DJU B;  1OXZ A;  3T97 B;  4EIJ A;  4WCZ A;  5APW A;  1RF1 A;  3FXD A;  1PZQ A;  2XZR A;  1NTK J;  3HTK A;  1YYC A;  2CPB A;  5KLV E;  2E43 A;  5B5E H;  2HG5 D;  1N73 B;  4GT1 A;  4R4L A;  4EMM A;  2M5A B;  2H89 C;  3TNU A;  2JWA A;  4FJW D;  1BCC G;  2KLU A;  1K39 A;  1FC9 A;  1T2K D;  1BGY E;  1AA0 A;  1MFZ A;  2K9J B;  2IBZ I;  2V7Q H;  3CWB J;  1YIT P;  1EDL A;  3MGN A;  1NKZ B;  1TYF A;  3H1I D;  1W2E A;  3RBZ A;  4QFE A;  2XKM A;  5DU6 A;  2WSF J;  4AUW A;  1YJW P;  3CI9 A;  4Y99 C;  3G71 P;  4ZDD A;  3E1I A;  1N6D A;  2Q35 A;  4WZ8 B;  1LWU A;  5CCH A;  4D6T J;  3N4X A;  1YI2 P;  3QKA A;  3IB9 A;  5CTC A;  5MGB A;  4J2U A;  4JWV A;  3F89 A;  3TF5 A;  3Q0G A;  4HH2 A;  3U59 A;  2QRX A;  1N73 C;  3TRR A;  3S9O A;  2OYI B;  1RF0 A;  3TVU A;  3L72 D;  1VQL P;  2MKV A;  3H1H J;  4GOD A;  1IFN A;  2Y0D A;  4RJT A;  3V2Q A;  4I2L C;  3ITK A;  1FZE A;  1P84 E;  1OX3 A;  3GHG B;  2E76 B;  5H2F H;  3AE3 C;  4EMP A;  3MIW A;  3AE8 C;  1SS1 A;  1URQ D;  2QJK B;  1AVY A;  3LKE A;  5INF A;  2E74 B;  4R4M A;  2ITA A;  1KYO D;  1FAV A;  4HYT B;  3D71 A;  2H8P D;  2XNX A;  2M3B A;  3DOR A;  1S1C X;  3L70 D;  1NHL A;  4HC8 A;  4PV1 D;  3QXZ A;  3USS A;  5KDR B;  2VSS A;  3L71 D;  1ON9 A;  2ZT9 D;  1DUB A;  3A0H H;  4JBZ A;  2OYI C;  1JY3 N;  4MN4 C;  1MUU A;  3HD7 A;  4K3W A;  3II6 A;  3A7O A;  2A7S A;  2ZL2 A;  4LGD E;  3V2N A;  5TJH A;  1L0L E;  3GHG C;  3MFM A;  1FBM A;  4KNP A;  3FF6 A;  1N7S D;  1T6A A;  5CHX A;  2C9L Y;  2KOG A;  2QJK C;  1U7M A;  2E74 C;  2N1T D;  1KQS O;  3H32 A;  1ZP0 C;  1M1J A;  4UB8 E;  3HLN 1;  1VQN P;  3OME A;  3N6R B;  1URQ C;  3P8M C;  3HE4 B;  1SQX K;  4NPF X;  3T8B A;  3RSI A;  1Y8A A;  5E0S A;  1PL5 A;  3BCC E;  1AJY A;  3B5N D;  2QJP C;  4WWI A;  4I1L A;  4H13 B;  2C8T A;  1SQP D;  3AE6 C;  4HNK A;  4U3F D;  3ABV C;  1Q90 D;  3D6Y A;  1J1D B;  2E42 A;  1KB9 H;  3T88 A;  4K29 A;  3IAV A;  1NU1 G;  1IZN B;  1IK9 A;  2ZVO B;  2H43 A;  1EZV G;  2A06 D;  2E75 B;  5AVY B;  3V5E A;  1FU1 A;  4U18 A;  4OVN F;  3D6Z A;  1NTM J;  4OGQ B;  1WZ8 A;  4EOT A;  1HVV A;  1BCC D;  1L0N J;  1USD A;  3U9S B;  4FB8 A;  3HE2 A;  1R8E A;  3ZWC A;  2JO1 A;  1KQG B;  3NXS A;  2FKW B;  3RGU A;  3KXD A;  4M3L A;  3L73 E;  2BCC E;  4DZO A;  5KLV J;  3TK1 A;  1SQV D;  4H44 B;  2KI7 B;  4H13 C;  3AEG C;  2YMY A;  1PGJ A;  3PRJ A;  1G1I A;  3L74 D;  5AVX B;  3M9Q A;  5AW7 B;  3B5N C;  5AVU B;  4YPC A;  3T97 A;  1J1D C;  1S3J A;  1BGY J;  3V5I A;  1HF9 A;  2J5U A;  4QII A;  1HGZ A;  2QM8 A;  2FFD B;  2VRE A;  5B66 E;  4IZB A;  2HW5 A;  1LTS C;  3H1J G;  1BSH A;  1N73 A;  1JCD A;  4OGQ C;  2M5A A;  1VQ8 P;  5DTW A;  1SQQ G;  1WDK A;  2B9B A;  4PJ0 H;  2K9J A;  5L8R J;  1ZR2 A;  2R5D A;  2GTR A;  3V2R A;  4H44 C;  1YG6 A;  3WU2 E;  3TVW A;  1OW7 A;  5INI A;  1RH5 B;  4Z1M H;  1NTZ D;  3AE2 C;  3C1L A;  1ZME C;  1SP4 A;  5CCH D;  3M9H A;  1MKM A;  1X79 B;  1GK6 A;  1ZV8 A;  1KC8 Q;  4FZW C;  1VQM P;  3RRV A;  1X0T A;  3CL3 D;  1S9K E;  4NPE A;  2FFD C;  3VMX A;  3QXI A;  3TLF A;  4JCS A;  3B8E B;  3H0U A;  4GIF A;  2OYI A;  3R4Y A;  2ZVN B;  3GF7 A;  1T3U A;  4K3A A;  4IFF A;  2PRR A;  2Y0E A;  1OVU A;  5M1B A;  1Y7O A;  3A0B H;  3S4R A;  1X0U A;  3MTU E;  3ZW8 A;  1KYO H;  2IYP A;  5CBN A;  4QIJ A;  2FXM A;  3GHG A;  2K1A A;  1JXZ A;  3CPW O;  4L6W A;  3SFE C;  1O8U A;  1LT1 A;  1BDD A;  3A2A A;  1SFC B;  4ZDB A;  3TGU G;  3V6I A;  4L76 A;  1RJM A;  2WSC J;  3W67 A;  1ZRT D;  1KIL E;  2R32 A;  3G6E P;  1ZW0 A;  3H1I G;  2Y9Y A;  3C8V A;  2LR2 A;  1URQ A;  2K88 A;  1L0L J;  4MOU A;  4Z0M A;  1DCI A;  4MI2 A;  3Q5R A;  4IL6 E;  1K9M Q;  5DU4 A;  4YLH A;  5KDR A;  4ASI A;  1JB0 J;  3NJD A;  3HD7 D;  3CCE P;  3PE8 A;  1J1E B;  3E1R A;  3VMY A;  1FOS F;  2QSI A;  2NP9 A;  1LTA C;  1Q82 Q;  1NTK D;  3ZWB A;  1KQF B;  4I6M C;  3WMM 0;  5KKZ B;  1NU1 D;  2DW3 A;  3CME P;  3HP0 A;  2K37 A;  3KTK A;  1SFC C;  2IBZ E;  1Q2N A;  2B87 B;  1SQB G;  2AXT H;  2X58 A;  3CX5 D;  3MHV A;  1DD4 A;  2RKL A;  2W3P A;  3RK3 D;  3CWB D;  1SQX E;  4WY4 D;  3H1K E;  1LJ2 A;  5CJ0 A;  3V2P A;  3Q5S A;  3HE4 A;  3QWO C;  3OJA B;  1M90 Q;  3L70 G;  5APT A;  5GTH H;  2RMZ A;  3Q7H A;  4JYB A;  1BE3 E;  1J1E C;  5AW0 B;  2I1J A;  1Q86 Q;  3L71 G;  2YKO A;  1XTG B;  3HD7 C;  2ZXE B;  3VMZ A;  2VSU F;  4B3I A;  5EFW B;  2JWD A;  5KKZ C;  1DH3 A;  1KFM A;  3CCV P;  2CE3 A;  2WT7 B;  1GTW A;  3AE1 C;  3L73 J;  4U0G H;  1IFJ A;  2IEX A;  2BCC J;  1K32 A;  2JR8 A;  1EZV I;  1K05 A;  3FX0 A;  1KIL B;  2YXR B;  1NJI Q;  3FWN A;  3H0S A;  5JBW A;  1KB9 D;  1QLE D;  5E0N X;  1YG8 A;  4KJM A;  1Q51 A;  2FZS A;  2G3A A;  1FZB A;  1M7L A;  3PJS K;  3T89 A;  5KJ7 C;  4WY4 C;  1UYR A;  4U0G A;  2O3J A;  5KAI E;  1PPJ G;  4JCQ A;  2JP3 A;  4B86 A;  3KDP B;  4ZNC A;  2IYO A;  3WUU A;  1IFD A;  3SWY A;  2FYZ A;  3RBX A;  3GKB A;  1VQ4 P;  3CCQ P;  2KS1 B;  1M57 D;  2I1K A;  1SQP G;  3G4S P;  3CLQ A;  1N6E A;  3HE5 B;  2P2U A;  4U3F G;  1NOH A;  3P8C E;  3L72 E;  2AXC A;  4Y28 J;  4I52 A;  3M9B A;  4FZW A;  1VQO P;  3BPT A;  4KD6 A;  2OTL P;  1EXJ A;  4N78 E;  1W2X A;  3U1C A;  1YJN P;  1FC6 A;  3AEE C;  4AQR D;  1MV8 A;  2FFD A;  1FDO A;  5ING A;  2Y0C A;  3L75 E;  4PD4 D;  2KB7 P;  1ON3 A;  2AEM A;  2NPS B;  2A06 G;  3BF0 A;  2KIK A;  3VYI A;  1ZN5 A;  5IKL B;  3JCU H;  5G1R A;  5AVQ B;  1JY3 O;  2Q9I A;  4MXI A;  1A02 F;  4JJT A;  3CCS P;  4OG1 A;  5E79 H;  3TGU D;  1S4X A;  1T8Z A;  1YBK A;  1OMI A;  3TT7 A;  4ELS A;  5TIS H;  4OWF A;  1SQV G;  4ZDF A;  2W6B A;  2QM7 A;  2OYH B;  2FYU G;  1H88 A;  2J58 A;  1G2C B;  3L37 A;  3L74 G;  4IOI H;  1Q81 Q;  1JO5 A;  2IZ0 A;  2Q3I A;  3R9Q A;  5C9G A;  2WTB A;  2E5T A;  2GM4 A;  1CI6 B;  1NYH A;  2L5G B;  1PP9 E;  4RO0 A;  4B3J A;  3RL0 B;  4ELX A;  5AW6 B;  1QL1 A;  2NRG A;  2QG4 A;  3KTG A;  3M06 A;  1NU1 K;  4GOF A;  5AW4 B;  3VMA A;  2E76 D;  2O1J A;  2KP8 A;  1HZD A;  3G64 A;  2KNC A;  1KMI Z;  4RYF A;  2HPC B;  2E74 D;  2VSU C;  3IBB A;  1JTH B;  1SFC A;  2KSE A;  4HB1 A;  2W8Z A;  2H88 C;  4WBA A;  3QYR A;  1SQB D;  2FW2 A;  2P10 A;  5KTB A;  1W5C E;  1RHZ B;  5KJP A;  2OYH C;  3WUV A;  2P7J A;  3H6P A;  3BVH A;  1NTZ G;  1NGM B;  4XE5 B;  3GW6 A;  4F47 A;  1HBW A;  4U3F E;  3QK8 A;  1RY3 A;  1OVV A;  4NPD A;  2F9Y B;  2JKV A;  1PIX A;  3RL0 C;  2D3T A;  4B3H A;  2H7H A;  2OGU A;  1BGY D;  1FJP A;  1H0T B;  2FXP A;  5KLI B;  2R3S A;  4FNB A;  1SQX J;  1FZC B;  3H1K J;  1GDT A;  3SLL A;  3CX5 H;  1FJK A;  1BCC E;  2E76 C;  1RJN A;  3SWF A;  1VL2 A;  5KAF H;  1JY3 P;  5E0S H;  1MZ9 A;  2WMM A;  1X22 A;  3M6N A;  3B71 A;  1SQQ K;  1BE3 J;  2EJ5 A;  2WVR A;  3M0D C;  1XTC C;  2WSF H;  4LLH A;  3IAO A;  2W27 A;  2B87 A;  1G1J A;  4RES B;  1KYO I;  3H1L G;  4L75 A;  4NNQ A;  5DKP A;  4IZD A;  3L74 E;  1DD3 A;  1PPJ D;  4H13 D;  3C9I A;  2Y9Z A;  5KJ7 A;  2FBM A;  4WY4 A;  1YIJ P;  2ZQQ A;  1WDM A;  3I55 P;  1VF5 B;  1MJ3 A;  4CPG A;  2N9B A;  5KLI C;  2LXB A;  2V4H A;  1NTK G;  4GKG A;  1R5L A;  1S5L E;  2R5B A;  2E75 D;  2WT7 A;  2VRS A;  2O1K A;  3R6H A;  4HDT A;  2SPZ A;  1SZO A;  2IX7 C;  4U7J A;  4OGQ D;  1KIL A;  2L91 A;  1U57 A;  2WSE J;  3P32 A;  5AVW B;  2HOD B;  5B5E E;  3HIN A;  1BSN A;  1H8A A;  1NH4 A;  1IFI A;  3JCU E;  5AW8 B;  3L72 J;  1EDJ A;  1UIY A;  3KYQ A;  1Q7Y Q;  3CWB G;  3PLN A;  4H44 D;  2C9N Y;  1KQL A;  2Q6Q A;  3P7K A;  3L75 J;  4JYL A;  1L0L D;  3L36 A;  1VF5 C;  5BU8 B;  2FYU D;  1JUN A;  2YO2 A;  5G1Q A;  2KS1 A;  4PD4 H;  1A02 J;  3BPP A;  1IC2 A;  2A45 H;  3HE5 A;  4D6T G;  1GZL A;  2J5I I;  2XDJ A;  3VTP C;  3ISA A;  4ZU2 A;  5CBO A;  1PV3 A;  2P67 A;  1XO6 A;  1LTG C;  5APU A;  2POH A;  3G3Z A;  3H1H G;  2E75 C;  3AED C;  4EML A;  3OA7 A;  2NPS A;  3F5H A;  2A7K A;  1S72 P;  1NO4 A;  3KTI A;  4UB6 H;  2Z5I A;  1ZRT E;  5FIF A;  3IR9 A;  5FUS A;  1SQB K;  3MT6 A;  3NFQ A;  1EDI A;  5H2F E;  1PP9 J;  4OMR A;  1AQ5 A;  1PGQ A;  2VSS E;  3Q1T A;  4FN8 A;  2VSU A;  5BU5 A;  2M3E A;  2B89 A;  2OYO A;  3K8X A;  2OYH A;  1QX8 A;  1G2C A;  3Q5P A;  1Y9B A;  2KK7 A;  2XU6 A;  2PBP A;  3KTH A;  2DUB A;  1K8A Q;  1NTK E;  1IO4 A;  3ZW9 A;  2IFN A;  4KT0 J;  5AW3 B;  4O9B A;  2QEX P;  4JPZ B;  1NU1 E;  1AV1 A;  1RQU A;  1UYT A;  1HUC A;  4YTP C;  1EZV E;  4ZMD A;  1FZF A;  2W6J H;  3A0H E;  4Q1I A;  4TT3 H;  3L73 D;  1UIX A;  2A45 G;  2BCC D;  3LID A;  4ASV A;  3LW5 J;  1NWQ A;  3RK2 B;  4JVT A;  2G8Y A;  3M91 A;  2I8D A;  1GL2 B;  1SFC D;  2WWW A;  2KYV A;  2RH0 A;  5APY A;  2W90 A;  3CWB E;  2HPC A;  1YQ4 C;  4JCR A;  5APV A;  1JTH A;  2KZI A;  3CXH D;  1KOR A;  4DCK A;  3O6Q B;  1EQ7 A;  3M0D A;  1L2P A;  3U9T B;  2B88 A;  3H1L D;  4JYC A;  3PZK A;  3TDC A;  1TU3 F;  4IL6 X;  2YJG A;  3TDK A;  3A3Y B;  1M1K Q;  1M56 D;  1VQ5 P;  4DT0 A;  2YMK A;  1BCC J;  1LTT C;  4WB4 A;  1JOC A;  2F9Y A;  1NVO A;  1SQP K;  1N7L A;  1M8O B;  2GUS A;  2IDB A;  3H1J E;  3EFF K;  5GTI H;  1H0T A;  4FN7 A;  4WVZ A;  1FZC A;  2O01 J;  2KZJ A;  3RK2 C;  1L4A B;  1GL2 C;  1SQQ E;  2UWJ E;  1KB9 E;  3L3S A;  1GK4 A;  1DEE G;  2Q2X A;  1NTM G;  1IK7 A;  2P1J A;  3JC2 2;  3BCC J;  5G1S A;  3O8Z A;  3H25 A;  2ZYA A;  1L0N G;  2QIW A;  3NJB A;  4BRY B;  1P84 H;  1OD2 A;  4ZKU A;  3PEA A;  5KJ7 D;  1SG4 A;  5KLV G;  1SQV K;  3SSU A;  2JJL A;  2FYU K;  1KD1 Q;  1JNM A;  4JOT A;  1VQP P;  3E7K A;  5AVV B;  1JY2 N;  2K3R A;  3NMD A;  4JF7 A;  2Z4E A;  4D6T D;  1RE4 C;  4XA4 A;  1BGY G;  1KTM A;  1EF8 A;  2BZR A;  1FDI A;  1L4A C;  4ZKP A;  1KIL D;  2WPV B;  3K5B A;  2HFE D;  3H1H D;  3U1A A;  3AE4 C;  2WSC H;  3Q2Y A;  2V7Q J;  1AVO A;  2OTK E;  3BRT B;  3PHL A;  2WSS H;  5AW2 B;  4BWN A;  3TGU E;  2HOD A;  2QA4 P;  2IPP A;  1QVF O;  2D2C B;  1OD4 A;  5C90 A;  5DUF A;  3G9R A;  1KN7 A;  3CX5 I;  1JEK A;  3P85 A;  4U1A A;  3H1I E;  4H0L B;  3D70 A;  3V5B A;  1VQ7 P;  4PJ0 E;  1X9V A;  3M6M A;  3V4W A;  4C7N B;  1NTZ K;  3I47 A;  1RE3 C;  1JM0 A;  2BEQ D;  2PG8 A;  2WPS A;  2O01 H;  5CCG C;  1N86 A;  3S1K A;  1LNQ A;  4GM2 A;  3SWK A;  3SWX A;  4JCT A;  3N7N A;  3EQ2 A;  4IFD K;  4ELW A;  2OQQ A;  2ZAE B;  2F6I A;  4W80 A;  3HUS B;  2NPS D;  3QH9 A;  3Q0J A;  5APX A;  3CCR P;  3MD0 A;  2YKQ A;  3OT6 A;  2CK3 H;  1ZR4 A;  1VDF A;  1KIL C;  2QQ3 A;  2QJY B;  1YQ3 C;  3KHU A;  4U0H A;  4JSB A;  3EWK A;  1SQB E;  2IZ1 A;  2P58 A;  3A0B E;  1FCF A;  2ZYG A;  1BE3 D;  1LTB C;  4H0L C;  1HNO A;  1KB9 I;  1KYO E;  2LKM A;  1HH0 A;  3R9S A;  3AE5 C;  4JQ0 D;  3OW2 O;  4RKU J;  1NU1 J;  3HRX A;  3L70 E;  1AFO A;  3H0Q A;  1SVF A;  3EFG A;  1UII A;  4L74 A;  1L0L G;  4RCN A;  3DJA A;  3T8A A;  3L71 E;  2Q3E A;  2KSJ A;  1FE6 A;  3RL0 D;  4JYJ A;  2QE7 H;  4RYF H;  2F9I B;  3HUS C;  2BAS A;  1HJB A;  3UIA A;  1HGV A;  2J5G A;  1LTJ B;  1PGO A;  1NTK K;  2FYN B;  3GMA A;  2YXQ B;  3B4S A;  2KUB A;  1OVR A;  3CCJ P;  1FZG A;  2NPS C;  3JSV C;  2QJY C;  4PD4 I;  4C46 A;  3CXH H;  3CD6 P;  5GTI E;  2A45 I;  5AVT B;  3BRV B;  2Z5H A;  3KZI H;  1LTI C;  1WT6 A;  1DX7 A;  1GL2 A;  3BCC G;  5B66 H;  1NTM D;  2ZJS E;  1LT9 B;  1ZXG A;  3AEB C;  1R5S A;  1YJ9 P;  1L0N D;  3P8C D;  3LIE A;  3OAK A;  2ZL0 A;  4G2R A;  3O6Q A;  1CZQ A;  1PPJ E;  3KPE A;  5C39 A;  4N78 D;  3H1J J;  4AYC A;  2K9Y A;  4EI2 A;  2AXT E;  4XFJ A;  2CBY A;  3L35 A;  5AW1 B;  1J2J B;  1X8Y A;  5KLV D;  2YIU B;  3L75 D;  1SQP E;  4LC1 A;  1SQQ J;  1K73 Q;  2X24 A;  2FXO A;  3WU2 H;  1T2K C;  2VX2 A;  2KLV A;  1LTJ C;  2FYN C;  5AVR B;  2BEZ F;  3FXE A;  4ASW A;  1D7M A;  5GTH E;  3MYB A;  2WTY A;  1OW8 A;  2PPY A;  1URQ B;  1VQ6 P;  1RE4 A;  1PFI A;  2A06 E;  1Z56 A;  3H02 A;  4OLQ A;  3L73 G;  1E5W A;  2CPS A;  1L4A A;  2OTJ P;  2BCC G;  5DTP A;  3MZW B;  3SFD C;  1LT9 C;  1EXI A;  3PGQ A;  2M8R A;  2QJP B;  3VP9 A;  1XNW A;  4C7R A;  3CMA P;  4PV1 B;  1FZA A;  2ZT9 B;  2YNY A;  2RN0 A;  4BRY A;  1PP9 D;  1OFC X;  2ZXX A;  1SQV E;  3STA A;  3CC4 P;  2YIU C;  2FYU E;  5CTB A;  1GD2 E;  3AEF C;  2ZYD A;  1XNY A;  1HTL C;  2F6Q A;  2FY8 A;  1VF5 D;  2HYN A;  1RE3 A;  1N7S B;  2ZL4 A;  4BXL A;  3TGU J;  1P84 D;  1MFT A;  3IFM A;  5CCG A;  1S5L X;  3BAS A;  2N1T B;  1DEB A;  4IL6 H;  1FZC C;  3MUD A;  3H1I J;  2J5S A;  4W7Y A;  1NZY B;  2AEJ A;  1W2B O;  4NAR A;  2C0X A;  3RL0 g;  1LP1 B;  4GOE A;  1Q52 A;  4N6J A;  4PV1 C;  2W83 C;  3ZDM A;  3BEZ A;  3TT6 A;  2Q34 A;  4DI1 A;  5AW5 B;  3IF4 A;  3B5N B;  2ZT9 C;  2J59 M;  1KV4 A;  4HJG H;  2Q7C A; 
#chains in the Genus database with same CATH homology
 2J5I B;  1YQ4 C;  4JCR A;  5DL1 A;  4I42 A;  1KOR A;  3H0S A;  5JBW A;  2E76 B;  3AE3 C;  1K04 A;  4EMP A;  3U9T B;  5E0N X;  1YG8 A;  1Q51 A;  3PZK A;  3TDC A;  2FZS A;  1HJ0 A;  1TU3 F;  2G3A A;  3AE8 C;  4IL6 X;  2YJG A;  1XNV A;  1VRG A;  3T89 A;  1UYR A;  3LKE A;  4U0G A;  5INF A;  2E74 B;  4R4M A;  5DU8 A;  3WG5 A;  2YMK A;  4JCQ A;  2JP3 A;  2A81 A;  2F9Y A;  3D71 A;  3QRE A;  3GF3 A;  5DUC A;  3GKB A;  3ST9 A;  3DOR A;  3VIV A;  1N6F A;  1S1C X;  1N6E A;  1EY3 A;  4ZDC A;  2IDB A;  4PV1 D;  3QXZ A;  4Y28 J;  4I52 A;  5KDR B;  4FZW A;  2VSS A;  3BPT A;  4KD6 A;  4FN7 A;  4U19 A;  3P2L A;  1EXJ A;  1ON9 A;  2ZT9 D;  1W2X A;  5HUQ A;  2O01 J;  1DUB A;  1FC6 A;  3AEE C;  1FDO A;  5ING A;  4K3W A;  3L3S A;  1ON3 A;  2Q2X A;  2A7S A;  1IK7 A;  2ZL2 A;  3BF0 A;  1RQV A;  5IKL B;  5G1S A;  3H25 A;  3MFM A;  5G1R A;  4KNP A;  2QIW A;  3NJB A;  3FF6 A;  2ZL3 A;  3ZWA A;  4MXI A;  4JJT A;  1OD2 A;  4ZDE A;  4OG1 A;  2VSS F;  3PEA A;  1SG4 A;  2QJK C;  2E74 C;  1PJH A;  1OMI A;  1ZP0 C;  3HLN 1;  3TT7 A;  5JBX A;  3AEA C;  4ELS A;  3OME A;  3T3W A;  2J5G D;  3N6R B;  4JOT A;  4ZDF A;  2F9I A;  3K50 A;  1UYS A;  2NZ2 A;  3P5M A;  1DIP A;  4LK5 A;  3T8B A;  3RSI A;  5E0S A;  1PL5 A;  3R9Q A;  1KTM A;  1AJY A;  1EF8 A;  2WTB A;  5C9G A;  2QJP C;  2BZR A;  1FDI A;  2FBW C;  4H13 B;  1NYH A;  2C8T A;  3H81 A;  3U9R B;  3AE6 C;  4HNK A;  4B3J A;  1TG6 A;  4ELX A;  2WPV B;  3ABV C;  1Q90 D;  3KTG A;  3AE4 C;  3Q2Y A;  2V7Q J;  3D6Y A;  2E76 D;  3RK3 E;  3T88 A;  4K29 A;  3IAV A;  4FND A;  1J7X A;  1HZD A;  2D2C B;  3G64 A;  1OD4 A;  5C90 A;  5DUF A;  1KMI Z;  2E75 B;  3G9R A;  4RYF A;  3V5E A;  4U18 A;  3D6Z A;  3P85 A;  4U1A A;  2E74 D;  4H0L B;  3D70 A;  2VSU C;  3IBB A;  4OGQ B;  1WZ8 A;  2H88 C;  3M6M A;  3QYR A;  2FW2 A;  2P10 A;  3U9S B;  4FB8 A;  3HE2 A;  4KPK A;  1R8E A;  5KJP A;  3ZWC A;  3I47 A;  2JO1 A;  1KQG B;  2BEQ D;  2PG8 A;  1NGM B;  4F47 A;  3QK8 A;  3KTJ A;  3OC7 A;  4K2N A;  4GM2 A;  4H44 B;  2F9Y B;  3KQF A;  1UYV A;  4H13 C;  3SWX A;  4JCT A;  3AEG C;  1EF9 A;  1PIX A;  4ELW A;  2OQQ A;  2D3T A;  2F6I A;  1GMJ A;  4B3H A;  3R0O A;  3Q0J A;  4IZC A;  3OT6 A;  2FXP A;  3AEC C;  4GHN A;  4FNB A;  4I7Z B;  3V5I A;  1HF9 A;  2QQ3 A;  2J5U A;  4QII A;  1YQ3 C;  3SLL A;  3Q3D A;  2VRE A;  4IZB A;  4U0H A;  4JSB A;  2E76 C;  3EWK A;  1RJN A;  4L8K A;  2HW5 A;  1VL2 A;  5E0S H;  1FCF A;  1WMK A;  4H0L C;  1HNO A;  3LAO A;  4OGQ C;  5DZK H;  3M6N A;  3B71 A;  1WDL A;  3R9S A;  3AE5 C;  3TZ3 A;  2EJ5 A;  4RKU J;  5DTW A;  3QMJ A;  3FDU A;  3IAO A;  1WDK A;  3HRX A;  3IN6 A;  1OW6 A;  4I4Z A;  3H0Q A;  4KWB A;  5L8R J;  2DEO A;  1FC7 A;  3R9T A;  4NNQ A;  5DKP A;  4RCN A;  4IZD A;  3DJA A;  2ZQR A;  3T8A A;  1DD3 A;  2GTR A;  4H44 C;  1YG6 A;  4H13 D;  3TVW A;  2FBM A;  1OW7 A;  5INI A;  2ZQQ A;  4Z1M H;  4JYJ A;  3TV5 A;  4RYF H;  1WDM A;  5DZK A;  1HNU A;  3AE2 C;  2F9I B;  1ZME C;  1VF5 B;  1MJ3 A;  3QWD A;  4JFC A;  1MKM A;  2J5G A;  1ZOY C;  3GMA A;  1NZY A;  4FZW C;  5KLI C;  2WQY C;  4I7Z C;  4Q0G A;  3RRV A;  2QJY C;  2VSU E;  2D2C D;  2E75 D;  3QXI A;  3R6H A;  4HDT A;  3AE7 C;  3Q1M A;  3TLF A;  1SZO A;  4H0L D;  4JCS A;  4U7J A;  3H0U A;  4OGQ D;  3R4Y A;  3GF7 A;  5M1B A;  1Y7O A;  3RST A;  1U57 A;  2J5I A;  2WSE J;  1X0U A;  3GLM A;  3ZW8 A;  3AEB C;  3HIN A;  4QIJ A;  2ZL0 A;  4G2R A;  3O6Q A;  1JXZ A;  3MOY A;  4L6W A;  2K9Y A;  1UIY A;  3SFE C;  1O8U A;  4GDO A;  3JU1 A;  4ZDB A;  4XFJ A;  2CBY A;  4H44 D;  2UZF A;  1RJM A;  2WSC J;  1KIL E;  2X24 A;  4JYL A;  1VF5 C;  3C8V A;  2VX2 A;  4WYO B;  2FYN C;  4NEK A;  5G1Q A;  4MOU A;  2BEZ F;  3BPP A;  4Z0M A;  1DCI A;  4MI2 A;  3Q5R A;  3MYB A;  3FGA D;  2J5I I;  1OW8 A;  3AE9 C;  2PPY A;  5DU4 A;  3ISA A;  4YLH A;  5KDR A;  4ZU2 A;  4ASI A;  1XX4 A;  1JB0 J;  3NJD A;  3H02 A;  3H0J A;  4OLQ A;  1PV3 A;  1XO6 A;  4YXD C;  3PE8 A;  2D2C C;  2QSI A;  2NP9 A;  3T97 B;  5DTP A;  2E75 C;  3SFD C;  3AED C;  4WCZ A;  1EXI A;  3PGQ A;  4EML A;  3ZWB A;  1KQF B;  1XNW A;  2A7K A;  4PV1 B;  3KTI A;  3HP0 A;  1ZRT E;  2ZT9 B;  3KTK A;  5FIF A;  4R4L A;  5FUS A;  4EMM A;  3STA A;  2H89 C;  3MT6 A;  2YIU C;  5CTB A;  3AEF C;  4OMR A;  2VSS E;  3Q1T A;  4FN8 A;  2VSU A;  1XNY A;  4FJW D;  2X58 A;  2F6Q A;  1DD4 A;  1VF5 D;  1K39 A;  1FC9 A;  2W3P A;  3K8X A;  2ZL4 A;  3Q5S A;  3Q5P A;  1Y9B A;  2PBP A;  3KTH A;  1TYF A;  2DUB A;  1S5L X;  3ZW9 A;  4QFE A;  4KT0 J;  3Q7H A;  5DU6 A;  2WSF J;  2J5S A;  4ZDD A;  1NZY B;  1N6D A;  4NAR A;  1RQU A;  1UYT A;  2VSU F;  4YTP C;  3RL0 g;  2Q35 A;  4WZ8 B;  4B3I A;  1Q52 A;  3QKA A;  5KKZ C;  3IB9 A;  4Q1I A;  4TT3 H;  5CTC A;  4PV1 C;  4J2U A;  5MGB A;  4JWV A;  3BEZ A;  1UIX A;  2CE3 A;  3TT6 A;  2Q34 A;  4DI1 A;  3Q0G A;  3AE1 C;  4U0G H;  3LW5 J;  2ZT9 C;  4JVT A;  2G8Y A;  2IEX A;  3TRR A;  1K32 A;  3S9O A;  3TVU A;  2MKV A;  1K05 A;  4HC8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...