3GF7A

Glutaconyl-coa decarboxylase a subunit from clostridium symbiosum apoprotein
Total Genus 204
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
204
sequence length
585
structure length
543
Chain Sequence
b'MYSMPGYFQNMPTIGKELVNPNPENEQEIKAVESDIHESIKKALDAGITSEEKLNERGQLSAMQRINALIDPGTWCPLNSLFNPENNKFGTTNIVNGLGRVDGKWVYIVASDNKKMAGAWVPGQAENLIRCSDAAKMMHLPLIYLLNCSGVEFPNQDKVYPNRRGGGTPFFRNSELNQLGIPVIVGIYGTNPAGGGYHSISPTILIAHQDANMAVGKVPAPGSVPIHYDETGFFREVYQNDLGVIDGIKKYISYLPAYNLEFFRVDTPKAPQLPAEDLYSIIPMNQKRPYDIYEVIARLFDNSEFSEYKKGYGPEMVTGLAKVNGLLVGVIANVQGLLMNYPEYKQNSVGIGGKLYRQGLIKMNEFVTLCARDRIPLIWLQDTTGIDVGDEAEKAELLGLGQSLIYSIENSKLPSLEITIRKASAAAHYVLGGPQGNNTNVFSIGTGACEYYVMPGETAANAMYSRKLQPIIGKMNDMIQMYTDKSRPKYCTEKGMVDEIVDMTEVRPYIQAFTEAAYQNPQSICPMHQMLTPRSTREFETFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutaconyl-CoA decarboxylase subunit A
molecule tags Lyase
source organism Clostridium symbiosum
publication title An asymmetric model for Na+-translocating glutaconyl-CoA decarboxylases
pubmed doi rcsb
total genus 204
structure length 543
sequence length 585
ec nomenclature ec 4.1.1.70: Transferred entry: 7.2.4.5.
pdb deposition date 2009-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01039 Carboxyl_trans Carboxyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.680 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Helix bin 3gf7A01
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3gf7A02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3gf7A03
5DZKA 3V5IA 3QMJA 4FNDA 4I4ZA 3QXIA 4U1AA 4MXIA 5FIFA 3LAOA 2F9IB 2FW2A 4NNQA 3N6RB 3TT6A 2D3TA 2J5SA 3RRVA 2VSUF 4LK5A 4IZBA 3NJBA 2J5GD 4FB8A 5DTPA 4U0GA 1UYTA 3ISAA 3QK8A 2VSUA 1J7XA 2ZL0A 4JOTA 3OT6A 1HNOA 3T3WA 4G2RA 3BF0A 2DEOA 4K2NA 3SLLA 4HNKA 1FC7A 5FUSA 3TRRA 3Q0GA 2ZQRA 3R0OA 3M6MA 3KTHA 4KWBA 2Q2XA 3KQFA 4ZDCA 3IB9A 2ZQQA 3TZ3A 4U18A 4ZU2A 4GHNA 2PPYA 1PJHA 5INFA 1NZYA 3R9SA 2VSSA 3TT7A 1UYSA 1K32A 3QYRA 5KDRB 2A7KA 4EMLA 2FZSA 3MOYA 5CTBA 2IEXA 3MT6A 3DJAA 4FN8A 4FZWC 1EF8A 4JCSA 3M6NA 3GF7A 5DU4A 2EJ5A 3K8XA 2CBYA 4RYFH 3TVWA 3RSIA 1HZDA 2VSUE 1VRGA 3H81A 2WTBA 2J5IB 3HP0A 3ZW9A 1W2XA 3I47A 5DU6A 1K39A 4KD6A 2VREA 2VSUC 4OG1A 3TDCA 1WDMA 4Z0MA 3ZWCA 1DUBA 3RSTA 3QKAA 2PBPA 5DKPA 3T88A 2VSSF 4JJTA 3G64A 3BPPA 3IBBA 4U0HA 2ZL2A 2UZFA 4I42A 1TYFA 3MYBA 1SZOA 3HINA 3WG5A 3KTIA 4ZDEA 3K50A 4ELXA 5KDRA 4KPKA 5MGBA 2VSSE 4ASIA 3OMEA 2DUBA 3R6HA 2F9YA 3PGQA 3VIVA 3L3SA 4IZCA 2F9IA 2C8TA 3T8AA 3V5EA 4GM2A 2F6QA 3T8BA 1OD2A 3Q7HA 3H02A 3GLMA 4OLQA 3Q0JA 1XO6A 3FDUA 4B3JA 1FCFA 4B3IA 3BEZA 4B3HA 4EMPA 4JCRA 3ZW8A 2F9YB 3U9SB 4FNBA 4QFEA 4HC8A 1WZ8A 2W3PA 3KTKA 2Q34A 5KJPA 1YG8A 4OMRA 5JBXA 1XNYA 4Q0GA 3SWXA 4QIIA 2VX2A 3TV5A 3PEAA 3GMAA 1SG4A 1Q51A 3QWDA 1HNUA 3DORA 2FBMA 4FN7A 4JCTA 1TG6A 2QQ3A 4ZDFA 3H0QA 1Y7OA 1ON9A 5C90A 3P2LA 3H0SA 3Q1TA 4F47A 1N6FA 3ST9A 4Q1IA 1JXZA 3JU1A 4KNPA 4FJWD 4YLHA 3P5MA 3PZKA 2ZL4A 1X0UA 1Q52A 2A81A 4L6WA 3H0JA 4RCNA 4MOUA 1UIYA 1XX4A 3HRXA 5DUFA 1FC9A 3FF6A 3GF3A 4JCQA 4MI2A 5CTCA 5INGA 4JYLA 5DZKH 4L8KA 3T89A 3HE2A 2HW5A 3STAA 3QXZA 1UYRA 1WDLA 5G1SA 5E0SA 1NZYB 4K29A 3IAVA 3GKBA 3QREA 3TVUA 4QIJA 5JBWA 5DU8A 4U0GH 1EY3A 4RYFA 1XNWA 3P85A 4FZWA 5C9GA 1DCIA 2J5IA 3R9TA 3TLFA 2BZRA 1ON3A 1N6EA 5DL1A 5IKLB 5E0NX 3MFMA 2ZL3A 1EF9A 3ZWBA 3H0UA 3KTJA 2X58A 1MJ3A 1UYVA 4IZDA 3R9QA 4WYOB 5G1RA 3U9TB 1N6DA 4WCZA 1O8UA 2Q35A 4K3WA 5E0SH 3NJDA 1RJMA 5G1QA 1YG6A 1OD4A 4JSBA 1FC6A 3LKEA 3U9RB 5DUCA 3KTGA 4ZDDA 1RJNA 2J5II 2GTRA 4ELSA 4WZ8B 4U19A 3OC7A 3ZWAA 4EMMA 1WDKA 2CE3A 4DI1A 4JFCA 4JYJA 2A7SA 1XNVA 2PG8A 4ZDBA 2J5GA 4I52A 2NP9A 2F6IA 3PE8A 5INIA 4JVTA 4ELWA 3HLN1 1PIXA 2X24A 4NEKA 5DTWA 4JWVA
chains in the Genus database with same CATH superfamily
1EDIA 2FXMA 1NYHA 1URQC 3NFQA 1ZRTD 1NJIQ 3N6RB 2D3TA 3L73G 1W2EA 1Y9BA 2J5SA 2KXPB 1GL2A 3H1IJ 1AV1A 4LK5A 3NJBA 4FB8A 5AVQB 1UYTA 1U57A 3P8MC 3CCEP 5KLVD 4PJ0H 5EFWB 2FYUD 4L76A 1YJWP 2K9YA 4JOTA 3OT6A 3BF0A 1GU4A 2A06G 4K2NA 1T2KC 1SQQK 3C8VA 3H1IG 3L75E 3NTNA 3VOPA 3VN0A 4RESB 1BGYE 1KQSO 3R0OA 3N4XA 1FDIA 3KTHA 4KWBA 4WB4A 3A3YB 2O01N 4ZDCA 1S4XA 2ZQQA 1S1CX 1L0LJ 1Q86Q 2FYUJ 5KAIE 4U18A 4ZU2A 5CBOA 5AVRB 2PPYA 4DJGA 1SLQA 2K37A 2D2CB 4TT3H 1RHZB 2WITA 2VSSA 1H89A 1PP9D 3AE9C 1K32A 1M1JC 1SQXK 2WSCJ 2YMYA 3H1HE 3KZIH 3H1HG 3B5NC 4EMLA 3MOYA 1NTZE 2WSFH 5GTIH 3DJAA 4FN8A 2FYUG 3M6NA 2JKVA 3L36A 2EJ5A 4BXLA 2JDIH 3AE1C 3CPWO 3K8XA 2CBYA 4RYFH 3TVWA 5KJ7C 3RSIA 1NH4A 2JP3A 1HZDA 2YKPA 1NTMD 4H13B 5CJ4A 1RH5B 1FJKA 2KLUA 2KP8A 1SQPK 3HP0A 5APYA 3I47A 3JC22 4KD6A 1LWUA 1XTGB 1VL2A 3W68A 1NOHA 1MZ9A 1XTCC 1VQLP 1GMJA 3BATA 2HPCB 1HTLC 5DKPA 3M0AA 4HDTA 4JJTA 5AW3B 1SQXG 3HE5B 3IBBA 4U0HA 4HKZH 2UZFA 2HR3A 2IYPA 2N1TD 3HD7A 2ITAA 2O3JA 3MYBA 3QH9A 3KZIE 2ZYGA 4O9BA 2ZYAA 5GTIE 2KS1B 3V4WA 1LTBC 1GK4A 1SQPE 3N7NA 1BCCJ 4I6MC 1KB9E 3W67A 3OMEA 1PGQA 3R6HA 1X9VA 2XU6A 1QL2A 3L72G 1M1KQ 5BU8B 3T8BA 2A06D 1Q90D 1NTZG 2C0XA 2ZVNB 3H02A 2PGDA 3KHUA 3VMYA 5B5EH 1BCCE 1XO6A 3OAKA 3CXHI 4B3HA 1N2DC 4KT0J 2F9YB 4N78E 2KNCB 4HC8A 3HUSA 2OTKE 3BASA 3VP8A 2Q34A 5JBXA 1QVGO 4QIIA 2VX2A 2W83C 4R4MA 1GL2B 3TV5A 3T97B 1PP9E 3Q5SA 3A0HH 1IK7A 1HJ0A 1N7SC 3QWDA 4OVNF 3A2AA 3AE2C 1H88A 2N1TA 1URQB 1OFCX 4C7RA 3H0QA 3AE7C 4LC1A 3MP7B 1HH0A 1NU1J 5C90A 3D6ZA 3Q1TA 1N6FA 1BDCA 4Q1IA 1L0NE 1SQPJ 2AEFA 1KYOE 3WUVA 2KUBA 1HJBA 2YO2A 1NO4A 4RCNA 3O6QB 5AVWB 1UIYA 1XX4A 1NU1E 5TJHA 1EQ7A 3RL0g 2N9BA 1FZCB 2A06E 3U1CA 1G1JA 4JCQA 5CTCA 2FXOA 2IDBA 3T89A 1H0TB 3STAA 4GOFA 3QXZA 1UYRA 1KQLA 1QX8A 1FDMA 2WT7A 1NTKK 1PPJD 5KJ7A 1KTMA 4K29A 2B9BA 2IBZD 2WMMA 2Y0CA 1K73Q 1T3JA 3H1ID 1SQBG 3GKBA 3SFEC 3FXDA 1NHLA 3CL3D 3G6EP 2OTJP 2QG4A 3PRJA 5DU8A 2E75C 1SQQJ 5AW1B 1E79H 1SFCC 4IL6X 3P85A 2FXPA 4I2LC 2JWAA 2WSEH 5C9GA 3H1LG 2P10A 1G1IA 4CPGA 2Q1KA 4Y28J 3L71E 3TLFA 1ON3A 2BZRA 3WU2H 2MKVA 2IBZI 1HBWA 2OARA 4JQ0D 3MFMA 2PP6A 2V7QJ 2XV5A 1Q2NA 2BCCG 3H0UA 2B89A 2WQYC 1MJ3A 1L4AB 3BCCG 2R44A 2KK7A 4AUWA 2L5GB 2LKMA 2R32A 2FBWC 4XFJA 1O8UA 5E0SH 2WSEJ 3OA7A 3JSVC 1RJMA 2BCCJ 2OYOA 3HE4A 2C9NY 4D6TG 1QEXA 4I1LA 3IAOA 2ZT9B 1SQVG 3TGUJ 4HYTB 2JWDA 1LT9B 1OWAA 3L74E 1NTKD 4DI1A 5E79E 3KYQA 4R4LA 2V4HA 3JCUH 3BCCE 2R5BA 1M57D 4U3FJ 2BCCE 3USSA 1HF9A 4ZKUA 2KSJA 1IZNB 1SQQE 1R5LA 2X24A 1SVFA 3Q5RA 5DTWA 2QSIA 1NKZB 2FYZA 3HE4B 1SQVK 3V5IA 3CCQP 3RK3C 4U1AA 1IJDB 2RH0A 3CC7P 3LAOA 2FW2A 2WPRA 3I5CA 5AW5B 2XDJA 3TT6A 3WU2E 2O01J 2FKWB 5KAFE 1N73C 1LTTC 1SQBE 2Q3EA 3CC2P 3A5TA 3RRVA 3A0BE 3AE5C 2IPPA 4IZBA 1SQXE 2J5GD 1KYOI 3TK1A 5DTPA 3L74J 3CMEP 4U0GA 2KZIA 2ZT9D 4JYCA 3D6YA 3ISAA 2W27A 3QK8A 5CCGC 2VSUA 3TGUE 2KB7P 2FYUE 3WUTA 1J7XA 1RE3A 3T3WA 4C46A 4G2RA 2FFDB 3G3ZA 3GHGA 1FC7A 1VQ4P 1PGPA 1IFMA 4PD4H 2ZQRA 1SQPD 1VF5B 3CWBD 4ASVA 2E5YA 1EZVE 3HTKA 3RK3D 2JJLA 3RGUA 2I1KA 1K8AQ 2JEEA 1YBKA 3TZ3A 2MJZA 1PJHA 5KTBA 1KB9H 1KILD 2QE7H 4U3FD 1DD3A 2E76C 4A7PA 1NKNA 2AXTE 3FWLA 1FZAA 5KDRB 1OW6A 3OW2O 1J1EB 3HD7C 2C9LY 4FZWC 3GF7A 5DU4A 1N73B 4HB1A 3LW5J 4ZNCA 1KMIZ 1RF1B 1KILC 1LGHB 2KYVA 1FE6A 2Y9YA 4OGQD 4N6JA 1PV3A 3ZDMA 1ZLLA 3M9BA 3F89A 3EFGA 1BE3D 3ZW9A 2OYHB 2WSCH 3R2PA 2QM7A 1GL2C 2M3EA 1M1JB 1J1DB 3LW5H 4XE5B 5AVSB 1DEBA 2Y0EA 4EOTA 1WDMA 3CI9A 4Z0MA 1MUUA 1BCCD 4U7JA 3CXHH 1FOSF 2GUSA 3G64A 1BSHA 2ZL2A 1PFIA 4I42A 2E5TA 2OYHC 4D6TD 1P84I 3IN6A 1KD1Q 3E7KA 1WRGA 4IFFA 2LXBA 4ZDEA 3K50A 4KPKA 4I7ZC 3MD0A 4PV1D 2F9YA 4PJ0E 3PGQA 1YQ4C 4IZCA 1DEEG 1NAFA 5KKZB 1VQ8P 1M7LA 2F6QA 1N7SA 2Z5HA 2UWJE 5B66H 4EYYQ 4L73A 1JY3N 3GLMA 1OVRA 4OLQA 3Q0JA 2JO1A 3AEEC 1FJPA 1OXZA 5APXA 4B3JA 2N9YB 4B3IA 1S2EA 1X79B 3TGUG 1OX3A 2YNYA 3CWBG 3KQGA 3V6IA 4L74A 3L37A 4RO0A 3CCRP 5KLIC 1SFCB 4UB8E 3U9SB 4AYCA 4FNBA 1OZHA 2W3PA 2E75B 3KTKA 1NTMG 1VQ7P 2KS1A 2DW3A 2R3CA 3RK3E 4K35A 1GTWA 1G2CA 1NAYA 3R4YA 3CD6P 3HTKB 1N73A 3SWXA 3I56P 1FBMA 2E42A 3AEAC 3PEAA 1KYOH 1CW5A 5CJ0A 3GW6A 1Q81Q 1MKMA 1NU1K 1SQXD 3M0DA 1IFIA 5AVVB 1HNUA 1GW4A 2FBMA 2FFDA 3G4SP 3Q5PA 3L75G 5AW8B 1JEKA 1AJYA 3V4QA 2ZJSE 1BE3G 2PFXA 3IR9A 4DCKA 3P2LA 4JYBA 1AQTA 4YTPC 4KNPA 1SQBD 4YLHA 3P5MA 2ZL4A 2CPSA 1X0UA 2H89C 1Q52A 3ABVC 3L75J 2NPSB 3H0JA 2AXCA 3H1HJ 1HGZA 2BEZF 1DX7A 1HGVA 1CSBA 2BCCD 2HLOA 3EWKA 1A02F 5HUQA 2H7HA 3FF6A 1K9MQ 1X0TA 3H1KE 2KOGA 1EDLA 4Y99B 3CX5E 2QJPB 2BEQD 1RF0C 4H44B 1KN7A 1KILA 3JCUE 5E0SA 1NZYB 1M8OB 3IF4A 2N1TB 4PV1B 5BU5A 3QREA 3D70A 4QIJA 1T6AA 1LP1A 3L74D 2I1JA 1W2BO 1PP9G 5CCHA 3L70J 3CXHD 2LR2A 2WVRA 1EY3A 1XNWA 3BRVB 1IO4A 1S72P 2RKLA 2OYHA 1DCIA 3E1RA 3AECC 2J5IA 2FY8A 1N6EA 2E74D 1FAVA 1HVVA 2OYIB 1WMKA 1ZP0C 2XNXA 2N1TC 1HUCA 2Q3IA 4GIFA 4IZDA 1JTHB 1GU5A 3L70D 3L71G 1YQ3C 1K05A 1KQGB 3QWOC 2WPQA 3R9QA 3ITKA 4WYOB 4NPDA 5G1RA 1J2JB 3U9TB 3MUDA 1SFCD 2ZFCA 3AE6C 3L72J 4UB8H 4TLFA 3SSUA 4WCZA 1S5LE 4K3WA 1P84D 4JSBA 2WWWA 3LKEA 3U9RB 1FZBA 1VPCA 1JMBA 1USEA 2NPSD 3FXEA 3H1JJ 3B5NB 1EDKA 4ELSA 4U19A 3CX5H 4W7ZA 2O01H 4GOEA 1QLED 1RE4A 1YYCA 4JYJA 2WPVB 1SQBK 2IBZG 1XNVA 2A45I 2R3SA 1KV4A 1FOSE 3H1JG 3H1HD 1IC2A 2AXTH 2F6IA 3PE8A 5INIA 1VQ9P 1L0NJ 5APTA 1KZUB 3L73J 2B88A 1L4AD 4FNDA 4I4ZA 3M0DC 5FIFA 5H2FH 2F9IB 4NNQA 1UIXA 1L0NG 2QA4P 1OIPA 2R5DA 2VSUF 2FYUK 4W80A 1QGKB 3CX5D 2A45G 3EFFK 1SQQD 1SP4A 2W6JH 1HNOA 3SLLA 1LNQA 1ZR2A 1S9KD 4C7NA 4I7ZB 1P84H 2CK3H 4HNKA 1GZLA 1SQVE 5FUSA 3TRRA 3AE3C 4GKGA 5CHXA 5KLVE 3B71A 3M6MA 3CCSP 2V7QH 4LLHA 1W5CE 1LT9A 2K3RA 3IB9A 4GDOA 1MFZA 1GK6A 2M8RA 2ZT9C 1NZYA 3R9SA 2WSSH 3QYRA 2FZSA 5CTBA 1RF1A 4EIJA 2QRXA 2YJGA 2QVAA 5B66E 2KLVA 1AVYA 3B8EB 3H1LJ 2KIKA 1KC8Q 3P8CE 1VRGA 2OGUA 3CCUP 2XNDH 3CXHE 3H81A 2NPSA 1JY2O 3K5BA 1JOCA 3H1KG 5APVA 1W2XA 2HPCA 3MHVA 5DU6A 3AEGC 1K39A 5AW9B 3FWNA 4OG1A 3TDCA 5AW4B 4UB6H 2C0WA 2G3AA 1LTGC 3L70E 3QKAA 3GHGB 3L70G 5AVXB 2AEJA 2VRSA 2AEMA 1PGJA 3BPPA 3H1JE 2XZRA 3Q1MA 3L73E 3KPEA 1TYFA 3B5NA 3PHLA 4KJMA 3HINA 1U7MA 1OW7A 1VQOP 4BRYB 5DJUB 2P58A 3H25A 2POHA 2VSSE 1VF5C 4U3FG 4ASIA 1VF5D 5AVTB 2DUBA 3VIVA 3L3SA 1CZQA 1NTZD 1SFCA 5C39A 2Z4EA 1PL5A 3T8AA 4NPEA 1NTME 2Q6QA 3TF5A 1L0LK 1OD2A 3MIWA 1JO5A 4NARA 1E5WA 1VQKP 1N7SB 2M5AB 1LWUB 1FCFA 3VMXA 1IFNA 4GT1A 3M9QA 4EMPA 3V2PA 5AW7B 2P67A 2QJKC 1R5SA 3ZW8A 5GTHH 1LTSC 1SQVD 4QFEA 1WZ8A 3V2NA 2CPBA 2NZ2A 3L71D 1QL1A 1YG8A 5KJPA 1N8RQ 1BGYG 3G9RA 4PD4D 5M1BA 3P7KA 1LP1B 5KKZC 2P2UA 2B87B 4OGQC 1QVFO 3M06A 4WY4A 3C9IA 1K04A 4DOJA 2P7JA 3GMAA 1SG4A 1LTJC 2XKMA 1VQPP 2WTYA 1KYOD 2QJYC 3TDKA 1RY3A 1GW3A 5L8RJ 1JY3P 2KNCA 2Q9IA 1TG6A 2GA1A 3B5ND 2E74B 3BRTB 3T97A 3LIDA 2P1JA 1DD4A 3RK2C 1Y7OA 2IFMA 1S3JA 2E76D 4EI2A 3H1LE 1YIJP 3PH0A 1JXZA 3JU1A 2Z5IA 4QMAA 3II6A 5E79H 3HUSB 4FJWD 1LT9C 1PZQA 3PZKA 4H13D 4C7NB 4U3FE 1EDJA 1RE4C 4MOUA 3RK2B 3OJAB 1ZMEC 1NU1G 1N86A 4PD4E 1ZV8A 5DUFA 1JCDA 5AVYB 1LJ2A 3GF3A 1JB0J 1YJ9P 1LTIC 2RN0A 1FZFA 4EDFA 1GD2E 5DZKH 1AQ5A 3RBXA 1DH3A 1M90Q 4NPFX 1SQQG 1NGMB 1WDLA 3HD7D 2KZJA 3RBZA 1YJNP 2HFED 5APWA 2WT7B 3A0BH 2E43A 3TVUA 1FZGA 1KFNA 4JWVA 5JBWA 1JY2P 2YKOA 4K3AA 3RL0D 4RJTA 1GDTA 3RK3B 2YXRB 4RYFA 1EC5A 3HRNA 2WPSA 2IYOA 4FZWA 2W6AA 4IOIH 3CCJP 1TU3F 3U59A 2O1JA 5H2FE 4WVZA 3KXDA 4DZOA 2J58A 1FU1A 5AW0B 1ZW0A 3H1KJ 1H0TA 2OTLP 2PAJA 3KTJA 4W7YA 2X58A 3H1JD 1AA0A 4D6TJ 4PV1C 2D2CC 1X8YA 2IZ0A 2IZ1A 1RE3C 2W6BA 3BCCD 1N6DA 5AW6B 2Q35A 1YITP 1OD4A 2L91A 2E75D 3VMZA 3FX0A 2Y9ZA 3KTGA 1ZR4A 1MV8A 2J5II 1LWUC 2W90A 2BASA 2ZXXA 5BVZA 1MFTA 3CWBJ 2B87A 1NU1D 3G71P 4EMMA 2E76B 2FYNB 4UB6E 2J5UA 3V5BA 1BCCG 4YPCA 4YXDC 3V2RA 1BE3E 1IFPA 4XA4A 1OVVA 1SQVJ 2J5GA 1JY2N 3H32A 4I52A 3Q2YA 2YIUB 3AE4C 2H88C 2NP9A 3PLNA 1Y8AA 2HG5D 3WUUA 2ZYDA 1LTJB 4OWFA 4NEKA 1ZOYC 4LGDE 3IFMA 5CCHC 5DZKA 1NTKJ 1J1DC 2HODB 2K1AA 1S5LX 3QMJA 3WMM0 4N3YB 1H8AA 1M56D 4OGQB 4Y99C 3QXIA 3BVHA 4MXIA 1L2PA 1Q82Q 2KI7B 4WY4C 4PD4I 3MZWB 1BE3J 3CC4P 1NWQA 4JF7A 4BRYA 4HJGH 4OH8B 1VQNP 2I8DA 5KJ7D 3CWBE 5APSA 3HD7B 2ZL0A 2IFNA 2DEOA 1J1EC 5KAFH 1USDA 2WSFJ 2QIWA 3Q0GA 3TNUB 3P32A 2J59M 1DIPA 2Q2XA 3KQFA 3H6PA 4GHNA 1SQPG 5INFA 3LIEA 1KB9D 2OQQA 4RKUJ 3D71A 1KQFB 1NVOA 3NMDA 3TT7A 1UYSA 1BGYD 3GG2A 1IFJA 1S5LH 4B86A 3Q3DA 2A7KA 1JTHA 2IEXA 3MT6A 1EF8A 4JCSA 3SWFA 3U1AA 4H0LD 2A45H 1A02J 1URQD 1NTZK 2VSUE 3M91A 5APUA 1YI2P 3H32B 3O6QA 2WTBA 1RQUA 5KLVK 3CMAP 2QJYB 2J5IB 1FDOA 1FS0E 5K5GB 2M0BA 3C1LA 1VQ6P 3MGNA 2E74C 4JPZB 3L71J 2VREA 2HODA 1SQBJ 2VSUC 2YIUC 1UIIA 1NTMK 3TYYA 1LTAC 2QJKB 1X22A 3ZWCA 1DUBA 3RSTA 2PBPA 1URQA 3T88A 1L0NK 2VSSF 2O1KA 4H44D 3CCVP 1L0LE 3L72D 1JCCA 4H0LB 4J2UA 1KORA 2W8ZA 3RK2D 1SZOA 3RL0B 1L0LD 1JY3O 4WBAA 3VYIA 1T2KD 3KTIA 3WG5A 3BCCJ 4ELXA 5KDRA 5MGBA 5CCGD 2K9JB 2YO3A 2WZ7A 4YXWH 3L75D 4L75A 3S9OA 4H0LC 5GTHE 3SFDC 2GM4A 2F9IA 3VP9A 4IL6H 2C8TA 3V5EA 3V2QA 4GM2A 2M5AA 2JR8A 3SWYA 1P84E 1BSNA 3Q7HA 3AEFC 3FDUA 3TNUA 3BEZA 5AVZB 1OVUA 1L4AC 4JCRA 1VDFA 1KILE 5TISE 5CCGA 3AE8C 3H1KD 1HWTC 3S1KA 4OMRA 3MTUE 1ZN5A 5B5EE 1XNYA 4Q0GA 4BWNA 2ZVOB 1CI6A 3H1IE 4H13C 3NXSA 5AVUB 1ZRTE 4DT0A 1Y47A 1JNMA 1Q51A 5KLVG 1N7LA 1FZEA 2YKQA 1NTKG 1VQ5P 3DORA 3H1LD 5CCHD 4FN7A 1Q7YQ 1NTMJ 4JCTA 1JMMA 3P8CD 2QQ3A 4ZDFA 3I55P 3BPTA 1EZVD 3TSIA 5KLIB 3EQ2A 1ON9A 1G2CB 1L0LG 1T8ZA 3H0SA 4F47A 1LTJA 3ST9A 5KLVJ 3UIAA 5CBNA 3A0HE 2OYIA 3VMAA 1FZCA 4IFDK 3L74G 2A81A 4L6WA 1ZXGA 5KAIH 5APQA 1YTZT 4KHXA 1YTZI 3S4RA 4IL6E 2Q7CA 3GHGC 3CCMP 3HRXA 1GL2D 2K88A 1L0ND 3RL0C 1FC9A 1EZVI 2K9JA 2FYNC 1RF0A 3HUSC 4MI2A 5INGA 4JYLA 4L8KA 3HE2A 1T3UA 2NRGA 2HW5A 2ZAEB 1OW8A 1PP9J 3CLQA 1BDDA 5G1SA 5TISH 1FC2C 1D7MA 1YHQP 4Z1MH 2H43A 2OYIC 1EXIA 4ASWA 3IAVA 3PP5A 4WY4B 4HH2A 4AQRD 2ZXEB 1NTKE 4D6TE 1PPJG 1R8EA 4U0GH 4GODA 3F5HA 2GUVA 2G8YA 2M3BA 1M1JA 3M9HA 4JBZA 2QM8A 2FFDC 1SQXJ 4N78D 4ZMDA 2LXCB 2QJPC 1EZVG 1KILB 3R9TA 3PTZA 1EXJA 5DL1A 2H8PD 5IKLB 5E0NX 2ZL3A 1AVOA 1EF9A 3ZWBA 2IX7C 1LT1A 3SWKA 1UYVA 1N7SD 3L35A 3B4SA 4H44C 3AEBC 5CMZA 3VTPC 4MN4C 1JM0A 1JUNA 5DJTB 1KB9I 4WWIA 1SS1A 1AFOA 1Z56A 3NJDA 2YXQB 1YG6A 5G1QA 1FC6A 2Q5UA 1NTZJ 5DUCA 2Y0DA 3AEDC 4ZDDA 1RJNA 1PPJE 3PJSK 2NPSC 1OMIA 1IFDA 3MUDC 2GTRA 1S9KE 4WZ8B 3OC7A 1L4AA 1CI6B 2RMZA 3L73D 3ZWAA 3KDPB 5AW2B 1WDKA 2PRRA 1VQMP 2CE3A 3E1IA 4JFCA 1IK9A 2D2CD 4IFMA 3L4FA 1WT6A 1FZCC 2A7SA 2SPZA 3FGAD 2PG8A 1RQVA 3HE5A 2KSEA 1BGYJ 4M3LA 4ZDBA 1KFMA 3L72E 1RF1C 3A7OA 4ZKPA 1PGOA 2QEXP 4JVTA 3TGUD 4ELWA 3HLN1 1PIXA 3CCLP 2IBZE 3CX5I 3O8ZA 4WY4D 1U7JA 2HYNA 2YMKA
chains in the Genus database with same CATH topology
5DZKA 1S5LX 3V5IA 3QMJA 1NYHA 4FNDA 4I4ZA 4OGQB 3QXIA 4U1AA 4MXIA 5FIFA 3LAOA 2F9IB 2FW2A 4NNQA 1UIXA 3N6RB 3TT6A 2D3TA 2O01J 1Y9BA 2J5SA 3RRVA 3AE5C 2VSUF 4LK5A 4IZBA 3NJBA 2J5GD 4FB8A 5DTPA 4U0GA 2ZT9D 1UYTA 1U57A 3D6YA 3ISAA 3QK8A 2VSUA 1J7XA 2ZL0A 2K9YA 4JOTA 3OT6A 1HNOA 3T3WA 4G2RA 3BF0A 2DEOA 4K2NA 3SLLA 3C8VA 4I7ZB 4HNKA 1FC7A 2WSFJ 5FUSA 2QIWA 3TRRA 3AE3C 3Q0GA 2ZQRA 3R0OA 1VF5B 3M6MA 3B71A 1FDIA 3KTHA 1DIPA 2Q2XA 4KWBA 3KQFA 4ZDCA 3IB9A 2ZQQA 1S1CX 3TZ3A 4GDOA 4U18A 4ZU2A 4GHNA 2PPYA 1PJHA 2ZT9C 1NZYA 5INFA 2OQQA 2D2CB 4RKUJ 4TT3H 3D71A 3R9SA 1KQFB 2VSSA 3TT7A 1UYSA 3AE9C 1DD3A 2E76C 1K32A 3QYRA 2WSCJ 5KDRB 3Q3DA 1OW6A 2A7KA 4EMLA 2FZSA 3MOYA 5CTBA 2IEXA 3MT6A 3DJAA 4FN8A 4FZWC 2YJGA 1EF8A 4JCSA 3M6NA 3GF7A 5DU4A 2EJ5A 3LW5J 3AE1C 4H0LD 3K8XA 2CBYA 4RYFH 1KMIZ 3TVWA 3RSIA 2JP3A 1HZDA 2VSUE 1VRGA 4H13B 4OGQD 3O6QA 2WTBA 1RQUA 3H81A 1PV3A 2J5IB 3HP0A 3ZW9A 1W2XA 1FDOA 3I47A 5DU6A 3AEGC 1K39A 2E74C 4KD6A 2VREA 1VL2A 2VSUC 2YIUC 4OG1A 3TDCA 1WDMA 4Z0MA 3ZWCA 1DUBA 2G3AA 3RSTA 1GMJA 4U7JA 3QKAA 2PBPA 5DKPA 4HDTA 3T88A 2VSSF 4JJTA 3G64A 4H44D 3BPPA 3IBBA 4U0HA 3Q1MA 2ZL2A 4H0LB 2UZFA 4J2UA 1KORA 4I42A 1TYFA 3MYBA 1SZOA 3IN6A 3HINA 1OW7A 3WG5A 3KTIA 4ZDEA 3K50A 4ELXA 5KDRA 4KPKA 3H25A 5MGBA 2VSSE 4I7ZC 1VF5C 4ASIA 1VF5D 3OMEA 4PV1D 2DUBA 3R6HA 2F9YA 3PGQA 3VIVA 3L3SA 1YQ4C 4IZCA 3S9OA 4H0LC 2F9IA 3SFDC 1PL5A 2C8TA 3T8AA 3V5EA 4GM2A 2F6QA 3T8BA 1Q90D 1OD2A 3Q7HA 3H02A 3GLMA 4NARA 3Q0JA 1XO6A 4OLQA 3AEFC 3FDUA 2JO1A 3AEEC 4B3JA 1FCFA 4B3IA 3BEZA 4B3HA 4EMPA 4KT0J 4JCRA 2QJKC 3ZW8A 1KILE 2F9YB 5KLIC 3U9SB 4FNBA 4QFEA 4HC8A 3AE8C 1WZ8A 2W3PA 2E75B 3KTKA 2Q34A 2NZ2A 5KJPA 1YG8A 4OMRA 5JBXA 3RK3E 3G9RA 3R4YA 5M1BA 1XNYA 4Q0GA 3SWXA 5KKZC 4QIIA 2VX2A 3AEAC 4OGQC 4R4MA 4H13C 3TV5A 3PEAA 3T97B 1K04A 1ZRTE 3Q5SA 3GMAA 1SG4A 1MKMA 1Q51A 1IK7A 1HJ0A 3QWDA 3AE2C 1HNUA 2QJYC 3DORA 2FBMA 4FN7A 5L8RJ 4JCTA 3Q5PA 1TG6A 2QQ3A 4ZDFA 2E74B 3H0QA 3AE7C 3BPTA 1DD4A 1Y7OA 1AJYA 2E76D 1ON9A 5C90A 3D6ZA 3P2LA 3H0SA 3Q1TA 4F47A 1N6FA 3ST9A 4Q1IA 1JXZA 3JU1A 4YTPC 4KNPA 4FJWD 4YLHA 3P5MA 3PZKA 2ZL4A 1X0UA 2H89C 4H13D 1Q52A 3ABVC 2A81A 4L6WA 3H0JA 4RCNA 2BEZF 4MOUA 1ZMEC 1UIYA 1XX4A 3RL0g 3HRXA 5DUFA 1FC9A 3EWKA 5HUQA 3FF6A 2FYNC 3GF3A 1JB0J 4JCQA 4MI2A 5CTCA 5INGA 4JYLA 2IDBA 5DZKH 4L8KA 3T89A 3HE2A 2BEQD 2HW5A 1OW8A 3STAA 3QXZA 1UYRA 1NGMB 1WDLA 5G1SA 4H44B 4Z1MH 1KTMA 1NZYB 4K29A 5E0SA 1EXIA 3IAVA 4PV1B 3GKBA 3QREA 3TVUA 3SFEC 3D70A 4JWVA 4QIJA 5JBWA 5DU8A 1R8EA 2E75C 4U0GH 2G8YA 1EY3A 4RYFA 1XNWA 4IL6X 3P85A 4FZWA 2FXPA 2QJPC 5C9GA 2P10A 1TU3F 1DCIA 3AECC 2J5IA 4Y28J 1EXJA 3R9TA 1ON3A 2BZRA 3TLFA 1N6EA 5DL1A 5IKLB 2MKVA 2E74D 5E0NX 3MFMA 2ZL3A 1WMKA 2V7QJ 1ZP0C 1EF9A 3ZWBA 3H0UA 3KTJA 2X58A 2WQYC 1MJ3A 1UYVA 4H44C 4IZDA 4PV1C 2D2CC 1YQ3C 1K05A 1KQGB 3AEBC 3R9QA 4WYOB 2FBWC 4XFJA 5G1RA 3U9TB 1N6DA 3AE6C 4WCZA 1O8UA 2Q35A 4K3WA 5E0SH 2WSEJ 3NJDA 1RJMA 1YG6A 1OD4A 5G1QA 4JSBA 1FC6A 3LKEA 3U9RB 2E75D 5DUCA 3KTGA 3AEDC 4ZDDA 1RJNA 2J5II 1OMIA 2GTRA 3IAOA 2ZT9B 4ELSA 4WZ8B 4U19A 3OC7A 3ZWAA 4EMMA 2E76B 1WDKA 2CE3A 4DI1A 4JFCA 2D2CD 4JYJA 2J5UA 2WPVB 4R4LA 2A7SA 3FGAD 1XNVA 2PG8A 4YXDC 1RQVA 4ZDBA 1HF9A 2J5GA 4I52A 3Q2YA 3AE4C 2H88C 2NP9A 2F6IA 3PE8A 4JVTA 5INIA 4ELWA 3HLN1 1PIXA 2X24A 3Q5RA 4NEKA 5DTWA 1ZOYC 2QSIA 2YMKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DZK A;  3V5I A;  3QMJ A;  4FND A;  4I4Z A;  3QXI A;  4U1A A;  4MXI A;  5FIF A;  3LAO A;  2F9I B;  2FW2 A;  4NNQ A;  3N6R B;  3TT6 A;  2D3T A;  2J5S A;  3RRV A;  2VSU F;  4LK5 A;  4IZB A;  3NJB A;  2J5G D;  4FB8 A;  5DTP A;  4U0G A;  1UYT A;  3ISA A;  3QK8 A;  2VSU A;  1J7X A;  2ZL0 A;  4JOT A;  3OT6 A;  1HNO A;  3T3W A;  4G2R A;  3BF0 A;  2DEO A;  4K2N A;  3SLL A;  4HNK A;  1FC7 A;  5FUS A;  3TRR A;  3Q0G A;  2ZQR A;  3R0O A;  3M6M A;  3KTH A;  4KWB A;  2Q2X A;  3KQF A;  4ZDC A;  3IB9 A;  2ZQQ A;  3TZ3 A;  4U18 A;  4ZU2 A;  4GHN A;  2PPY A;  1PJH A;  5INF A;  1NZY A;  3R9S A;  2VSS A;  3TT7 A;  1UYS A;  1K32 A;  3QYR A;  5KDR B;  2A7K A;  4EML A;  2FZS A;  3MOY A;  5CTB A;  2IEX A;  3MT6 A;  3DJA A;  4FN8 A;  4FZW C;  1EF8 A;  4JCS A;  3M6N A;  3GF7 A;  5DU4 A;  2EJ5 A;  3K8X A;  2CBY A;  4RYF H;  3TVW A;  3RSI A;  1HZD A;  2VSU E;  1VRG A;  3H81 A;  2WTB A;  2J5I B;  3HP0 A;  3ZW9 A;  1W2X A;  3I47 A;  5DU6 A;  1K39 A;  4KD6 A;  2VRE A;  2VSU C;  4OG1 A;  3TDC A;  1WDM A;  4Z0M A;  3ZWC A;  1DUB A;  3RST A;  3QKA A;  2PBP A;  5DKP A;  3T88 A;  2VSS F;  4JJT A;  3G64 A;  3BPP A;  3IBB A;  4U0H A;  2ZL2 A;  2UZF A;  4I42 A;  1TYF A;  3MYB A;  1SZO A;  3HIN A;  3WG5 A;  3KTI A;  4ZDE A;  3K50 A;  4ELX A;  5KDR A;  4KPK A;  5MGB A;  2VSS E;  4ASI A;  3OME A;  2DUB A;  3R6H A;  2F9Y A;  3PGQ A;  3VIV A;  3L3S A;  4IZC A;  2F9I A;  2C8T A;  3T8A A;  3V5E A;  4GM2 A;  2F6Q A;  3T8B A;  1OD2 A;  3Q7H A;  3H02 A;  3GLM A;  4OLQ A;  3Q0J A;  1XO6 A;  3FDU A;  4B3J A;  1FCF A;  4B3I A;  3BEZ A;  4B3H A;  4EMP A;  4JCR A;  3ZW8 A;  2F9Y B;  3U9S B;  4FNB A;  4QFE A;  4HC8 A;  1WZ8 A;  2W3P A;  3KTK A;  2Q34 A;  5KJP A;  1YG8 A;  4OMR A;  5JBX A;  1XNY A;  4Q0G A;  3SWX A;  4QII A;  2VX2 A;  3TV5 A;  3PEA A;  3GMA A;  1SG4 A;  1Q51 A;  3QWD A;  1HNU A;  3DOR A;  2FBM A;  4FN7 A;  4JCT A;  1TG6 A;  2QQ3 A;  4ZDF A;  3H0Q A;  1Y7O A;  1ON9 A;  5C90 A;  3P2L A;  3H0S A;  3Q1T A;  4F47 A;  1N6F A;  3ST9 A;  4Q1I A;  1JXZ A;  3JU1 A;  4KNP A;  4FJW D;  4YLH A;  3P5M A;  3PZK A;  2ZL4 A;  1X0U A;  1Q52 A;  2A81 A;  4L6W A;  3H0J A;  4RCN A;  4MOU A;  1UIY A;  1XX4 A;  3HRX A;  5DUF A;  1FC9 A;  3FF6 A;  3GF3 A;  4JCQ A;  4MI2 A;  5CTC A;  5ING A;  4JYL A;  5DZK H;  4L8K A;  3T89 A;  3HE2 A;  2HW5 A;  3STA A;  3QXZ A;  1UYR A;  1WDL A;  5G1S A;  5E0S A;  1NZY B;  4K29 A;  3IAV A;  3GKB A;  3QRE A;  3TVU A;  4QIJ A;  5JBW A;  5DU8 A;  4U0G H;  1EY3 A;  4RYF A;  1XNW A;  3P85 A;  4FZW A;  5C9G A;  1DCI A;  2J5I A;  3R9T A;  3TLF A;  2BZR A;  1ON3 A;  1N6E A;  5DL1 A;  5IKL B;  5E0N X;  3MFM A;  2ZL3 A;  1EF9 A;  3ZWB A;  3H0U A;  3KTJ A;  2X58 A;  1MJ3 A;  1UYV A;  4IZD A;  3R9Q A;  4WYO B;  5G1R A;  3U9T B;  1N6D A;  4WCZ A;  1O8U A;  2Q35 A;  4K3W A;  5E0S H;  3NJD A;  1RJM A;  5G1Q A;  1YG6 A;  1OD4 A;  4JSB A;  1FC6 A;  3LKE A;  3U9R B;  5DUC A;  3KTG A;  4ZDD A;  1RJN A;  2J5I I;  2GTR A;  4ELS A;  4WZ8 B;  4U19 A;  3OC7 A;  3ZWA A;  4EMM A;  1WDK A;  2CE3 A;  4DI1 A;  4JFC A;  4JYJ A;  2A7S A;  1XNV A;  2PG8 A;  4ZDB A;  2J5G A;  4I52 A;  2NP9 A;  2F6I A;  3PE8 A;  5INI A;  4JVT A;  4ELW A;  3HLN 1;  1PIX A;  2X24 A;  4NEK A;  5DTW A;  4JWV A; 
#chains in the Genus database with same CATH topology
 1EDI A;  2FXM A;  1NYH A;  1URQ C;  3NFQ A;  1ZRT D;  1NJI Q;  3N6R B;  2D3T A;  3L73 G;  1W2E A;  1Y9B A;  2J5S A;  2KXP B;  1GL2 A;  3H1I J;  1AV1 A;  4LK5 A;  3NJB A;  4FB8 A;  5AVQ B;  1UYT A;  1U57 A;  3P8M C;  3CCE P;  5KLV D;  4PJ0 H;  5EFW B;  2FYU D;  4L76 A;  1YJW P;  2K9Y A;  4JOT A;  3OT6 A;  3BF0 A;  1GU4 A;  2A06 G;  4K2N A;  1T2K C;  1SQQ K;  3C8V A;  3H1I G;  3L75 E;  3NTN A;  3VOP A;  3VN0 A;  4RES B;  1BGY E;  1KQS O;  3R0O A;  3N4X A;  1FDI A;  3KTH A;  4KWB A;  4WB4 A;  3A3Y B;  2O01 N;  4ZDC A;  1S4X A;  2ZQQ A;  1S1C X;  1L0L J;  1Q86 Q;  2FYU J;  5KAI E;  4U18 A;  4ZU2 A;  5CBO A;  5AVR B;  2PPY A;  4DJG A;  1SLQ A;  2K37 A;  2D2C B;  4TT3 H;  1RHZ B;  2WIT A;  2VSS A;  1H89 A;  1PP9 D;  3AE9 C;  1K32 A;  1M1J C;  1SQX K;  2WSC J;  2YMY A;  3H1H E;  3KZI H;  3H1H G;  3B5N C;  4EML A;  3MOY A;  1NTZ E;  2WSF H;  5GTI H;  3DJA A;  4FN8 A;  2FYU G;  3M6N A;  2JKV A;  3L36 A;  2EJ5 A;  4BXL A;  2JDI H;  3AE1 C;  3CPW O;  3K8X A;  2CBY A;  4RYF H;  3TVW A;  5KJ7 C;  3RSI A;  1NH4 A;  2JP3 A;  1HZD A;  2YKP A;  1NTM D;  4H13 B;  5CJ4 A;  1RH5 B;  1FJK A;  2KLU A;  2KP8 A;  1SQP K;  3HP0 A;  5APY A;  3I47 A;  3JC2 2;  4KD6 A;  1LWU A;  1XTG B;  1VL2 A;  3W68 A;  1NOH A;  1MZ9 A;  1XTC C;  1VQL P;  1GMJ A;  3BAT A;  2HPC B;  1HTL C;  5DKP A;  3M0A A;  4HDT A;  4JJT A;  5AW3 B;  1SQX G;  3HE5 B;  3IBB A;  4U0H A;  4HKZ H;  2UZF A;  2HR3 A;  2IYP A;  2N1T D;  3HD7 A;  2ITA A;  2O3J A;  3MYB A;  3QH9 A;  3KZI E;  2ZYG A;  4O9B A;  2ZYA A;  5GTI E;  2KS1 B;  3V4W A;  1LTB C;  1GK4 A;  1SQP E;  3N7N A;  1BCC J;  4I6M C;  1KB9 E;  3W67 A;  3OME A;  1PGQ A;  3R6H A;  1X9V A;  2XU6 A;  1QL2 A;  3L72 G;  1M1K Q;  5BU8 B;  3T8B A;  2A06 D;  1Q90 D;  1NTZ G;  2C0X A;  2ZVN B;  3H02 A;  2PGD A;  3KHU A;  3VMY A;  5B5E H;  1BCC E;  1XO6 A;  3OAK A;  3CXH I;  4B3H A;  1N2D C;  4KT0 J;  2F9Y B;  4N78 E;  2KNC B;  4HC8 A;  3HUS A;  2OTK E;  3BAS A;  3VP8 A;  2Q34 A;  5JBX A;  1QVG O;  4QII A;  2VX2 A;  2W83 C;  4R4M A;  1GL2 B;  3TV5 A;  3T97 B;  1PP9 E;  3Q5S A;  3A0H H;  1IK7 A;  1HJ0 A;  1N7S C;  3QWD A;  4OVN F;  3A2A A;  3AE2 C;  1H88 A;  2N1T A;  1URQ B;  1OFC X;  4C7R A;  3H0Q A;  3AE7 C;  4LC1 A;  3MP7 B;  1HH0 A;  1NU1 J;  5C90 A;  3D6Z A;  3Q1T A;  1N6F A;  1BDC A;  4Q1I A;  1L0N E;  1SQP J;  2AEF A;  1KYO E;  3WUV A;  2KUB A;  1HJB A;  2YO2 A;  1NO4 A;  4RCN A;  3O6Q B;  5AVW B;  1UIY A;  1XX4 A;  1NU1 E;  5TJH A;  1EQ7 A;  3RL0 g;  2N9B A;  1FZC B;  2A06 E;  3U1C A;  1G1J A;  4JCQ A;  5CTC A;  2FXO A;  2IDB A;  3T89 A;  1H0T B;  3STA A;  4GOF A;  3QXZ A;  1UYR A;  1KQL A;  1QX8 A;  1FDM A;  2WT7 A;  1NTK K;  1PPJ D;  5KJ7 A;  1KTM A;  4K29 A;  2B9B A;  2IBZ D;  2WMM A;  2Y0C A;  1K73 Q;  1T3J A;  3H1I D;  1SQB G;  3GKB A;  3SFE C;  3FXD A;  1NHL A;  3CL3 D;  3G6E P;  2OTJ P;  2QG4 A;  3PRJ A;  5DU8 A;  2E75 C;  1SQQ J;  5AW1 B;  1E79 H;  1SFC C;  4IL6 X;  3P85 A;  2FXP A;  4I2L C;  2JWA A;  2WSE H;  5C9G A;  3H1L G;  2P10 A;  1G1I A;  4CPG A;  2Q1K A;  4Y28 J;  3L71 E;  3TLF A;  1ON3 A;  2BZR A;  3WU2 H;  2MKV A;  2IBZ I;  1HBW A;  2OAR A;  4JQ0 D;  3MFM A;  2PP6 A;  2V7Q J;  2XV5 A;  1Q2N A;  2BCC G;  3H0U A;  2B89 A;  2WQY C;  1MJ3 A;  1L4A B;  3BCC G;  2R44 A;  2KK7 A;  4AUW A;  2L5G B;  2LKM A;  2R32 A;  2FBW C;  4XFJ A;  1O8U A;  5E0S H;  2WSE J;  3OA7 A;  3JSV C;  1RJM A;  2BCC J;  2OYO A;  3HE4 A;  2C9N Y;  4D6T G;  1QEX A;  4I1L A;  3IAO A;  2ZT9 B;  1SQV G;  3TGU J;  4HYT B;  2JWD A;  1LT9 B;  1OWA A;  3L74 E;  1NTK D;  4DI1 A;  5E79 E;  3KYQ A;  4R4L A;  2V4H A;  3JCU H;  3BCC E;  2R5B A;  1M57 D;  4U3F J;  2BCC E;  3USS A;  1HF9 A;  4ZKU A;  2KSJ A;  1IZN B;  1SQQ E;  1R5L A;  2X24 A;  1SVF A;  3Q5R A;  5DTW A;  2QSI A;  1NKZ B;  2FYZ A;  3HE4 B;  1SQV K;  3V5I A;  3CCQ P;  3RK3 C;  4U1A A;  1IJD B;  2RH0 A;  3CC7 P;  3LAO A;  2FW2 A;  2WPR A;  3I5C A;  5AW5 B;  2XDJ A;  3TT6 A;  3WU2 E;  2O01 J;  2FKW B;  5KAF E;  1N73 C;  1LTT C;  1SQB E;  2Q3E A;  3CC2 P;  3A5T A;  3RRV A;  3A0B E;  3AE5 C;  2IPP A;  4IZB A;  1SQX E;  2J5G D;  1KYO I;  3TK1 A;  5DTP A;  3L74 J;  3CME P;  4U0G A;  2KZI A;  2ZT9 D;  4JYC A;  3D6Y A;  3ISA A;  2W27 A;  3QK8 A;  5CCG C;  2VSU A;  3TGU E;  2KB7 P;  2FYU E;  3WUT A;  1J7X A;  1RE3 A;  3T3W A;  4C46 A;  4G2R A;  2FFD B;  3G3Z A;  3GHG A;  1FC7 A;  1VQ4 P;  1PGP A;  1IFM A;  4PD4 H;  2ZQR A;  1SQP D;  1VF5 B;  3CWB D;  4ASV A;  2E5Y A;  1EZV E;  3HTK A;  3RK3 D;  2JJL A;  3RGU A;  2I1K A;  1K8A Q;  2JEE A;  1YBK A;  3TZ3 A;  2MJZ A;  1PJH A;  5KTB A;  1KB9 H;  1KIL D;  2QE7 H;  4U3F D;  1DD3 A;  2E76 C;  4A7P A;  1NKN A;  2AXT E;  3FWL A;  1FZA A;  5KDR B;  1OW6 A;  3OW2 O;  1J1E B;  3HD7 C;  2C9L Y;  4FZW C;  3GF7 A;  5DU4 A;  1N73 B;  4HB1 A;  3LW5 J;  4ZNC A;  1KMI Z;  1RF1 B;  1KIL C;  1LGH B;  2KYV A;  1FE6 A;  2Y9Y A;  4OGQ D;  4N6J A;  1PV3 A;  3ZDM A;  1ZLL A;  3M9B A;  3F89 A;  3EFG A;  1BE3 D;  3ZW9 A;  2OYH B;  2WSC H;  3R2P A;  2QM7 A;  1GL2 C;  2M3E A;  1M1J B;  1J1D B;  3LW5 H;  4XE5 B;  5AVS B;  1DEB A;  2Y0E A;  4EOT A;  1WDM A;  3CI9 A;  4Z0M A;  1MUU A;  1BCC D;  4U7J A;  3CXH H;  1FOS F;  2GUS A;  3G64 A;  1BSH A;  2ZL2 A;  1PFI A;  4I42 A;  2E5T A;  2OYH C;  4D6T D;  1P84 I;  3IN6 A;  1KD1 Q;  3E7K A;  1WRG A;  4IFF A;  2LXB A;  4ZDE A;  3K50 A;  4KPK A;  4I7Z C;  3MD0 A;  4PV1 D;  2F9Y A;  4PJ0 E;  3PGQ A;  1YQ4 C;  4IZC A;  1DEE G;  1NAF A;  5KKZ B;  1VQ8 P;  1M7L A;  2F6Q A;  1N7S A;  2Z5H A;  2UWJ E;  5B66 H;  4EYY Q;  4L73 A;  1JY3 N;  3GLM A;  1OVR A;  4OLQ A;  3Q0J A;  2JO1 A;  3AEE C;  1FJP A;  1OXZ A;  5APX A;  4B3J A;  2N9Y B;  4B3I A;  1S2E A;  1X79 B;  3TGU G;  1OX3 A;  2YNY A;  3CWB G;  3KQG A;  3V6I A;  4L74 A;  3L37 A;  4RO0 A;  3CCR P;  5KLI C;  1SFC B;  4UB8 E;  3U9S B;  4AYC A;  4FNB A;  1OZH A;  2W3P A;  2E75 B;  3KTK A;  1NTM G;  1VQ7 P;  2KS1 A;  2DW3 A;  2R3C A;  3RK3 E;  4K35 A;  1GTW A;  1G2C A;  1NAY A;  3R4Y A;  3CD6 P;  3HTK B;  1N73 A;  3SWX A;  3I56 P;  1FBM A;  2E42 A;  3AEA C;  3PEA A;  1KYO H;  1CW5 A;  5CJ0 A;  3GW6 A;  1Q81 Q;  1MKM A;  1NU1 K;  1SQX D;  3M0D A;  1IFI A;  5AVV B;  1HNU A;  1GW4 A;  2FBM A;  2FFD A;  3G4S P;  3Q5P A;  3L75 G;  5AW8 B;  1JEK A;  1AJY A;  3V4Q A;  2ZJS E;  1BE3 G;  2PFX A;  3IR9 A;  4DCK A;  3P2L A;  4JYB A;  1AQT A;  4YTP C;  4KNP A;  1SQB D;  4YLH A;  3P5M A;  2ZL4 A;  2CPS A;  1X0U A;  2H89 C;  1Q52 A;  3ABV C;  3L75 J;  2NPS B;  3H0J A;  2AXC A;  3H1H J;  1HGZ A;  2BEZ F;  1DX7 A;  1HGV A;  1CSB A;  2BCC D;  2HLO A;  3EWK A;  1A02 F;  5HUQ A;  2H7H A;  3FF6 A;  1K9M Q;  1X0T A;  3H1K E;  2KOG A;  1EDL A;  4Y99 B;  3CX5 E;  2QJP B;  2BEQ D;  1RF0 C;  4H44 B;  1KN7 A;  1KIL A;  3JCU E;  5E0S A;  1NZY B;  1M8O B;  3IF4 A;  2N1T B;  4PV1 B;  5BU5 A;  3QRE A;  3D70 A;  4QIJ A;  1T6A A;  1LP1 A;  3L74 D;  2I1J A;  1W2B O;  1PP9 G;  5CCH A;  3L70 J;  3CXH D;  2LR2 A;  2WVR A;  1EY3 A;  1XNW A;  3BRV B;  1IO4 A;  1S72 P;  2RKL A;  2OYH A;  1DCI A;  3E1R A;  3AEC C;  2J5I A;  2FY8 A;  1N6E A;  2E74 D;  1FAV A;  1HVV A;  2OYI B;  1WMK A;  1ZP0 C;  2XNX A;  2N1T C;  1HUC A;  2Q3I A;  4GIF A;  4IZD A;  1JTH B;  1GU5 A;  3L70 D;  3L71 G;  1YQ3 C;  1K05 A;  1KQG B;  3QWO C;  2WPQ A;  3R9Q A;  3ITK A;  4WYO B;  4NPD A;  5G1R A;  1J2J B;  3U9T B;  3MUD A;  1SFC D;  2ZFC A;  3AE6 C;  3L72 J;  4UB8 H;  4TLF A;  3SSU A;  4WCZ A;  1S5L E;  4K3W A;  1P84 D;  4JSB A;  2WWW A;  3LKE A;  3U9R B;  1FZB A;  1VPC A;  1JMB A;  1USE A;  2NPS D;  3FXE A;  3H1J J;  3B5N B;  1EDK A;  4ELS A;  4U19 A;  3CX5 H;  4W7Z A;  2O01 H;  4GOE A;  1QLE D;  1RE4 A;  1YYC A;  4JYJ A;  2WPV B;  1SQB K;  2IBZ G;  1XNV A;  2A45 I;  2R3S A;  1KV4 A;  1FOS E;  3H1J G;  3H1H D;  1IC2 A;  2AXT H;  2F6I A;  3PE8 A;  5INI A;  1VQ9 P;  1L0N J;  5APT A;  1KZU B;  3L73 J;  2B88 A;  1L4A D;  4FND A;  4I4Z A;  3M0D C;  5FIF A;  5H2F H;  2F9I B;  4NNQ A;  1UIX A;  1L0N G;  2QA4 P;  1OIP A;  2R5D A;  2VSU F;  2FYU K;  4W80 A;  1QGK B;  3CX5 D;  2A45 G;  3EFF K;  1SQQ D;  1SP4 A;  2W6J H;  1HNO A;  3SLL A;  1LNQ A;  1ZR2 A;  1S9K D;  4C7N A;  4I7Z B;  1P84 H;  2CK3 H;  4HNK A;  1GZL A;  1SQV E;  5FUS A;  3TRR A;  3AE3 C;  4GKG A;  5CHX A;  5KLV E;  3B71 A;  3M6M A;  3CCS P;  2V7Q H;  4LLH A;  1W5C E;  1LT9 A;  2K3R A;  3IB9 A;  4GDO A;  1MFZ A;  1GK6 A;  2M8R A;  2ZT9 C;  1NZY A;  3R9S A;  2WSS H;  3QYR A;  2FZS A;  5CTB A;  1RF1 A;  4EIJ A;  2QRX A;  2YJG A;  2QVA A;  5B66 E;  2KLV A;  1AVY A;  3B8E B;  3H1L J;  2KIK A;  1KC8 Q;  3P8C E;  1VRG A;  2OGU A;  3CCU P;  2XND H;  3CXH E;  3H81 A;  2NPS A;  1JY2 O;  3K5B A;  1JOC A;  3H1K G;  5APV A;  1W2X A;  2HPC A;  3MHV A;  5DU6 A;  3AEG C;  1K39 A;  5AW9 B;  3FWN A;  4OG1 A;  3TDC A;  5AW4 B;  4UB6 H;  2C0W A;  2G3A A;  1LTG C;  3L70 E;  3QKA A;  3GHG B;  3L70 G;  5AVX B;  2AEJ A;  2VRS A;  2AEM A;  1PGJ A;  3BPP A;  3H1J E;  2XZR A;  3Q1M A;  3L73 E;  3KPE A;  1TYF A;  3B5N A;  3PHL A;  4KJM A;  3HIN A;  1U7M A;  1OW7 A;  1VQO P;  4BRY B;  5DJU B;  2P58 A;  3H25 A;  2POH A;  2VSS E;  1VF5 C;  4U3F G;  4ASI A;  1VF5 D;  5AVT B;  2DUB A;  3VIV A;  3L3S A;  1CZQ A;  1NTZ D;  1SFC A;  5C39 A;  2Z4E A;  1PL5 A;  3T8A A;  4NPE A;  1NTM E;  2Q6Q A;  3TF5 A;  1L0L K;  1OD2 A;  3MIW A;  1JO5 A;  4NAR A;  1E5W A;  1VQK P;  1N7S B;  2M5A B;  1LWU B;  1FCF A;  3VMX A;  1IFN A;  4GT1 A;  3M9Q A;  4EMP A;  3V2P A;  5AW7 B;  2P67 A;  2QJK C;  1R5S A;  3ZW8 A;  5GTH H;  1LTS C;  1SQV D;  4QFE A;  1WZ8 A;  3V2N A;  2CPB A;  2NZ2 A;  3L71 D;  1QL1 A;  1YG8 A;  5KJP A;  1N8R Q;  1BGY G;  3G9R A;  4PD4 D;  5M1B A;  3P7K A;  1LP1 B;  5KKZ C;  2P2U A;  2B87 B;  4OGQ C;  1QVF O;  3M06 A;  4WY4 A;  3C9I A;  1K04 A;  4DOJ A;  2P7J A;  3GMA A;  1SG4 A;  1LTJ C;  2XKM A;  1VQP P;  2WTY A;  1KYO D;  2QJY C;  3TDK A;  1RY3 A;  1GW3 A;  5L8R J;  1JY3 P;  2KNC A;  2Q9I A;  1TG6 A;  2GA1 A;  3B5N D;  2E74 B;  3BRT B;  3T97 A;  3LID A;  2P1J A;  1DD4 A;  3RK2 C;  1Y7O A;  2IFM A;  1S3J A;  2E76 D;  4EI2 A;  3H1L E;  1YIJ P;  3PH0 A;  1JXZ A;  3JU1 A;  2Z5I A;  4QMA A;  3II6 A;  5E79 H;  3HUS B;  4FJW D;  1LT9 C;  1PZQ A;  3PZK A;  4H13 D;  4C7N B;  4U3F E;  1EDJ A;  1RE4 C;  4MOU A;  3RK2 B;  3OJA B;  1ZME C;  1NU1 G;  1N86 A;  4PD4 E;  1ZV8 A;  5DUF A;  1JCD A;  5AVY B;  1LJ2 A;  3GF3 A;  1JB0 J;  1YJ9 P;  1LTI C;  2RN0 A;  1FZF A;  4EDF A;  1GD2 E;  5DZK H;  1AQ5 A;  3RBX A;  1DH3 A;  1M90 Q;  4NPF X;  1SQQ G;  1NGM B;  1WDL A;  3HD7 D;  2KZJ A;  3RBZ A;  1YJN P;  2HFE D;  5APW A;  2WT7 B;  3A0B H;  2E43 A;  3TVU A;  1FZG A;  1KFN A;  4JWV A;  5JBW A;  1JY2 P;  2YKO A;  4K3A A;  3RL0 D;  4RJT A;  1GDT A;  3RK3 B;  2YXR B;  4RYF A;  1EC5 A;  3HRN A;  2WPS A;  2IYO A;  4FZW A;  2W6A A;  4IOI H;  3CCJ P;  1TU3 F;  3U59 A;  2O1J A;  5H2F E;  4WVZ A;  3KXD A;  4DZO A;  2J58 A;  1FU1 A;  5AW0 B;  1ZW0 A;  3H1K J;  1H0T A;  2OTL P;  2PAJ A;  3KTJ A;  4W7Y A;  2X58 A;  3H1J D;  1AA0 A;  4D6T J;  4PV1 C;  2D2C C;  1X8Y A;  2IZ0 A;  2IZ1 A;  1RE3 C;  2W6B A;  3BCC D;  1N6D A;  5AW6 B;  2Q35 A;  1YIT P;  1OD4 A;  2L91 A;  2E75 D;  3VMZ A;  3FX0 A;  2Y9Z A;  3KTG A;  1ZR4 A;  1MV8 A;  2J5I I;  1LWU C;  2W90 A;  2BAS A;  2ZXX A;  5BVZ A;  1MFT A;  3CWB J;  2B87 A;  1NU1 D;  3G71 P;  4EMM A;  2E76 B;  2FYN B;  4UB6 E;  2J5U A;  3V5B A;  1BCC G;  4YPC A;  4YXD C;  3V2R A;  1BE3 E;  1IFP A;  4XA4 A;  1OVV A;  1SQV J;  2J5G A;  1JY2 N;  3H32 A;  4I52 A;  3Q2Y A;  2YIU B;  3AE4 C;  2H88 C;  2NP9 A;  3PLN A;  1Y8A A;  2HG5 D;  3WUU A;  2ZYD A;  1LTJ B;  4OWF A;  4NEK A;  1ZOY C;  4LGD E;  3IFM A;  5CCH C;  5DZK A;  1NTK J;  1J1D C;  2HOD B;  2K1A A;  1S5L X;  3QMJ A;  3WMM 0;  4N3Y B;  1H8A A;  1M56 D;  4OGQ B;  4Y99 C;  3QXI A;  3BVH A;  4MXI A;  1L2P A;  1Q82 Q;  2KI7 B;  4WY4 C;  4PD4 I;  3MZW B;  1BE3 J;  3CC4 P;  1NWQ A;  4JF7 A;  4BRY A;  4HJG H;  4OH8 B;  1VQN P;  2I8D A;  5KJ7 D;  3CWB E;  5APS A;  3HD7 B;  2ZL0 A;  2IFN A;  2DEO A;  1J1E C;  5KAF H;  1USD A;  2WSF J;  2QIW A;  3Q0G A;  3TNU B;  3P32 A;  2J59 M;  1DIP A;  2Q2X A;  3KQF A;  3H6P A;  4GHN A;  1SQP G;  5INF A;  3LIE A;  1KB9 D;  2OQQ A;  4RKU J;  3D71 A;  1KQF B;  1NVO A;  3NMD A;  3TT7 A;  1UYS A;  1BGY D;  3GG2 A;  1IFJ A;  1S5L H;  4B86 A;  3Q3D A;  2A7K A;  1JTH A;  2IEX A;  3MT6 A;  1EF8 A;  4JCS A;  3SWF A;  3U1A A;  4H0L D;  2A45 H;  1A02 J;  1URQ D;  1NTZ K;  2VSU E;  3M91 A;  5APU A;  1YI2 P;  3H32 B;  3O6Q A;  2WTB A;  1RQU A;  5KLV K;  3CMA P;  2QJY B;  2J5I B;  1FDO A;  1FS0 E;  5K5G B;  2M0B A;  3C1L A;  1VQ6 P;  3MGN A;  2E74 C;  4JPZ B;  3L71 J;  2VRE A;  2HOD A;  1SQB J;  2VSU C;  2YIU C;  1UII A;  1NTM K;  3TYY A;  1LTA C;  2QJK B;  1X22 A;  3ZWC A;  1DUB A;  3RST A;  2PBP A;  1URQ A;  3T88 A;  1L0N K;  2VSS F;  2O1K A;  4H44 D;  3CCV P;  1L0L E;  3L72 D;  1JCC A;  4H0L B;  4J2U A;  1KOR A;  2W8Z A;  3RK2 D;  1SZO A;  3RL0 B;  1L0L D;  1JY3 O;  4WBA A;  3VYI A;  1T2K D;  3KTI A;  3WG5 A;  3BCC J;  4ELX A;  5KDR A;  5MGB A;  5CCG D;  2K9J B;  2YO3 A;  2WZ7 A;  4YXW H;  3L75 D;  4L75 A;  3S9O A;  4H0L C;  5GTH E;  3SFD C;  2GM4 A;  2F9I A;  3VP9 A;  4IL6 H;  2C8T A;  3V5E A;  3V2Q A;  4GM2 A;  2M5A A;  2JR8 A;  3SWY A;  1P84 E;  1BSN A;  3Q7H A;  3AEF C;  3FDU A;  3TNU A;  3BEZ A;  5AVZ B;  1OVU A;  1L4A C;  4JCR A;  1VDF A;  1KIL E;  5TIS E;  5CCG A;  3AE8 C;  3H1K D;  1HWT C;  3S1K A;  4OMR A;  3MTU E;  1ZN5 A;  5B5E E;  1XNY A;  4Q0G A;  4BWN A;  2ZVO B;  1CI6 A;  3H1I E;  4H13 C;  3NXS A;  5AVU B;  1ZRT E;  4DT0 A;  1Y47 A;  1JNM A;  1Q51 A;  5KLV G;  1N7L A;  1FZE A;  2YKQ A;  1NTK G;  1VQ5 P;  3DOR A;  3H1L D;  5CCH D;  4FN7 A;  1Q7Y Q;  1NTM J;  4JCT A;  1JMM A;  3P8C D;  2QQ3 A;  4ZDF A;  3I55 P;  3BPT A;  1EZV D;  3TSI A;  5KLI B;  3EQ2 A;  1ON9 A;  1G2C B;  1L0L G;  1T8Z A;  3H0S A;  4F47 A;  1LTJ A;  3ST9 A;  5KLV J;  3UIA A;  5CBN A;  3A0H E;  2OYI A;  3VMA A;  1FZC A;  4IFD K;  3L74 G;  2A81 A;  4L6W A;  1ZXG A;  5KAI H;  5APQ A;  1YTZ T;  4KHX A;  1YTZ I;  3S4R A;  4IL6 E;  2Q7C A;  3GHG C;  3CCM P;  3HRX A;  1GL2 D;  2K88 A;  1L0N D;  3RL0 C;  1FC9 A;  1EZV I;  2K9J A;  2FYN C;  1RF0 A;  3HUS C;  4MI2 A;  5ING A;  4JYL A;  4L8K A;  3HE2 A;  1T3U A;  2NRG A;  2HW5 A;  2ZAE B;  1OW8 A;  1PP9 J;  3CLQ A;  1BDD A;  5G1S A;  5TIS H;  1FC2 C;  1D7M A;  1YHQ P;  4Z1M H;  2H43 A;  2OYI C;  1EXI A;  4ASW A;  3IAV A;  3PP5 A;  4WY4 B;  4HH2 A;  4AQR D;  2ZXE B;  1NTK E;  4D6T E;  1PPJ G;  1R8E A;  4U0G H;  4GOD A;  3F5H A;  2GUV A;  2G8Y A;  2M3B A;  1M1J A;  3M9H A;  4JBZ A;  2QM8 A;  2FFD C;  1SQX J;  4N78 D;  4ZMD A;  2LXC B;  2QJP C;  1EZV G;  1KIL B;  3R9T A;  3PTZ A;  1EXJ A;  5DL1 A;  2H8P D;  5IKL B;  5E0N X;  2ZL3 A;  1AVO A;  1EF9 A;  3ZWB A;  2IX7 C;  1LT1 A;  3SWK A;  1UYV A;  1N7S D;  3L35 A;  3B4S A;  4H44 C;  3AEB C;  5CMZ A;  3VTP C;  4MN4 C;  1JM0 A;  1JUN A;  5DJT B;  1KB9 I;  4WWI A;  1SS1 A;  1AFO A;  1Z56 A;  3NJD A;  2YXQ B;  1YG6 A;  5G1Q A;  1FC6 A;  2Q5U A;  1NTZ J;  5DUC A;  2Y0D A;  3AED C;  4ZDD A;  1RJN A;  1PPJ E;  3PJS K;  2NPS C;  1OMI A;  1IFD A;  3MUD C;  2GTR A;  1S9K E;  4WZ8 B;  3OC7 A;  1L4A A;  1CI6 B;  2RMZ A;  3L73 D;  3ZWA A;  3KDP B;  5AW2 B;  1WDK A;  2PRR A;  1VQM P;  2CE3 A;  3E1I A;  4JFC A;  1IK9 A;  2D2C D;  4IFM A;  3L4F A;  1WT6 A;  1FZC C;  2A7S A;  2SPZ A;  3FGA D;  2PG8 A;  1RQV A;  3HE5 A;  2KSE A;  1BGY J;  4M3L A;  4ZDB A;  1KFM A;  3L72 E;  1RF1 C;  3A7O A;  4ZKP A;  1PGO A;  2QEX P;  4JVT A;  3TGU D;  4ELW A;  3HLN 1;  1PIX A;  3CCL P;  2IBZ E;  3CX5 I;  3O8Z A;  4WY4 D;  1U7J A;  2HYN A;  2YMK A; 
#chains in the Genus database with same CATH homology
 5DZK A;  1S5L X;  3V5I A;  3QMJ A;  1NYH A;  4FND A;  4I4Z A;  4OGQ B;  3QXI A;  4U1A A;  4MXI A;  5FIF A;  3LAO A;  2F9I B;  2FW2 A;  4NNQ A;  1UIX A;  3N6R B;  3TT6 A;  2D3T A;  2O01 J;  1Y9B A;  2J5S A;  3RRV A;  3AE5 C;  2VSU F;  4LK5 A;  4IZB A;  3NJB A;  2J5G D;  4FB8 A;  5DTP A;  4U0G A;  2ZT9 D;  1UYT A;  1U57 A;  3D6Y A;  3ISA A;  3QK8 A;  2VSU A;  1J7X A;  2ZL0 A;  2K9Y A;  4JOT A;  3OT6 A;  1HNO A;  3T3W A;  4G2R A;  3BF0 A;  2DEO A;  4K2N A;  3SLL A;  3C8V A;  4I7Z B;  4HNK A;  1FC7 A;  2WSF J;  5FUS A;  2QIW A;  3TRR A;  3AE3 C;  3Q0G A;  2ZQR A;  3R0O A;  1VF5 B;  3M6M A;  3B71 A;  1FDI A;  3KTH A;  1DIP A;  2Q2X A;  4KWB A;  3KQF A;  4ZDC A;  3IB9 A;  2ZQQ A;  1S1C X;  3TZ3 A;  4GDO A;  4U18 A;  4ZU2 A;  4GHN A;  2PPY A;  1PJH A;  2ZT9 C;  1NZY A;  5INF A;  2OQQ A;  2D2C B;  4RKU J;  4TT3 H;  3D71 A;  3R9S A;  1KQF B;  2VSS A;  3TT7 A;  1UYS A;  3AE9 C;  1DD3 A;  2E76 C;  1K32 A;  3QYR A;  2WSC J;  5KDR B;  3Q3D A;  1OW6 A;  2A7K A;  4EML A;  2FZS A;  3MOY A;  5CTB A;  2IEX A;  3MT6 A;  3DJA A;  4FN8 A;  4FZW C;  2YJG A;  1EF8 A;  4JCS A;  3M6N A;  3GF7 A;  5DU4 A;  2EJ5 A;  3LW5 J;  3AE1 C;  4H0L D;  3K8X A;  2CBY A;  4RYF H;  1KMI Z;  3TVW A;  3RSI A;  2JP3 A;  1HZD A;  2VSU E;  1VRG A;  4H13 B;  4OGQ D;  3O6Q A;  2WTB A;  1RQU A;  3H81 A;  1PV3 A;  2J5I B;  3HP0 A;  3ZW9 A;  1W2X A;  1FDO A;  3I47 A;  5DU6 A;  3AEG C;  1K39 A;  2E74 C;  4KD6 A;  2VRE A;  1VL2 A;  2VSU C;  2YIU C;  4OG1 A;  3TDC A;  1WDM A;  4Z0M A;  3ZWC A;  1DUB A;  2G3A A;  3RST A;  1GMJ A;  4U7J A;  3QKA A;  2PBP A;  5DKP A;  4HDT A;  3T88 A;  2VSS F;  4JJT A;  3G64 A;  4H44 D;  3BPP A;  3IBB A;  4U0H A;  3Q1M A;  2ZL2 A;  4H0L B;  2UZF A;  4J2U A;  1KOR A;  4I42 A;  1TYF A;  3MYB A;  1SZO A;  3IN6 A;  3HIN A;  1OW7 A;  3WG5 A;  3KTI A;  4ZDE A;  3K50 A;  4ELX A;  5KDR A;  4KPK A;  3H25 A;  5MGB A;  2VSS E;  4I7Z C;  1VF5 C;  4ASI A;  1VF5 D;  3OME A;  4PV1 D;  2DUB A;  3R6H A;  2F9Y A;  3PGQ A;  3VIV A;  3L3S A;  1YQ4 C;  4IZC A;  3S9O A;  4H0L C;  2F9I A;  3SFD C;  1PL5 A;  2C8T A;  3T8A A;  3V5E A;  4GM2 A;  2F6Q A;  3T8B A;  1Q90 D;  1OD2 A;  3Q7H A;  3H02 A;  3GLM A;  4NAR A;  3Q0J A;  1XO6 A;  4OLQ A;  3AEF C;  3FDU A;  2JO1 A;  3AEE C;  4B3J A;  1FCF A;  4B3I A;  3BEZ A;  4B3H A;  4EMP A;  4KT0 J;  4JCR A;  2QJK C;  3ZW8 A;  1KIL E;  2F9Y B;  5KLI C;  3U9S B;  4FNB A;  4QFE A;  4HC8 A;  3AE8 C;  1WZ8 A;  2W3P A;  2E75 B;  3KTK A;  2Q34 A;  2NZ2 A;  5KJP A;  1YG8 A;  4OMR A;  5JBX A;  3RK3 E;  3G9R A;  3R4Y A;  5M1B A;  1XNY A;  4Q0G A;  3SWX A;  5KKZ C;  4QII A;  2VX2 A;  3AEA C;  4OGQ C;  4R4M A;  4H13 C;  3TV5 A;  3PEA A;  3T97 B;  1K04 A;  1ZRT E;  3Q5S A;  3GMA A;  1SG4 A;  1MKM A;  1Q51 A;  1IK7 A;  1HJ0 A;  3QWD A;  3AE2 C;  1HNU A;  2QJY C;  3DOR A;  2FBM A;  4FN7 A;  5L8R J;  4JCT A;  3Q5P A;  1TG6 A;  2QQ3 A;  4ZDF A;  2E74 B;  3H0Q A;  3AE7 C;  3BPT A;  1DD4 A;  1Y7O A;  1AJY A;  2E76 D;  1ON9 A;  5C90 A;  3D6Z A;  3P2L A;  3H0S A;  3Q1T A;  4F47 A;  1N6F A;  3ST9 A;  4Q1I A;  1JXZ A;  3JU1 A;  4YTP C;  4KNP A;  4FJW D;  4YLH A;  3P5M A;  3PZK A;  2ZL4 A;  1X0U A;  2H89 C;  4H13 D;  1Q52 A;  3ABV C;  2A81 A;  4L6W A;  3H0J A;  4RCN A;  2BEZ F;  4MOU A;  1ZME C;  1UIY A;  1XX4 A;  3RL0 g;  3HRX A;  5DUF A;  1FC9 A;  3EWK A;  5HUQ A;  3FF6 A;  2FYN C;  3GF3 A;  1JB0 J;  4JCQ A;  4MI2 A;  5CTC A;  5ING A;  4JYL A;  2IDB A;  5DZK H;  4L8K A;  3T89 A;  3HE2 A;  2BEQ D;  2HW5 A;  1OW8 A;  3STA A;  3QXZ A;  1UYR A;  1NGM B;  1WDL A;  5G1S A;  4H44 B;  4Z1M H;  1KTM A;  1NZY B;  4K29 A;  5E0S A;  1EXI A;  3IAV A;  4PV1 B;  3GKB A;  3QRE A;  3TVU A;  3SFE C;  3D70 A;  4JWV A;  4QIJ A;  5JBW A;  5DU8 A;  1R8E A;  2E75 C;  4U0G H;  2G8Y A;  1EY3 A;  4RYF A;  1XNW A;  4IL6 X;  3P85 A;  4FZW A;  2FXP A;  2QJP C;  5C9G A;  2P10 A;  1TU3 F;  1DCI A;  3AEC C;  2J5I A;  4Y28 J;  1EXJ A;  3R9T A;  1ON3 A;  2BZR A;  3TLF A;  1N6E A;  5DL1 A;  5IKL B;  2MKV A;  2E74 D;  5E0N X;  3MFM A;  2ZL3 A;  1WMK A;  2V7Q J;  1ZP0 C;  1EF9 A;  3ZWB A;  3H0U A;  3KTJ A;  2X58 A;  2WQY C;  1MJ3 A;  1UYV A;  4H44 C;  4IZD A;  4PV1 C;  2D2C C;  1YQ3 C;  1K05 A;  1KQG B;  3AEB C;  3R9Q A;  4WYO B;  2FBW C;  4XFJ A;  5G1R A;  3U9T B;  1N6D A;  3AE6 C;  4WCZ A;  1O8U A;  2Q35 A;  4K3W A;  5E0S H;  2WSE J;  3NJD A;  1RJM A;  1YG6 A;  1OD4 A;  5G1Q A;  4JSB A;  1FC6 A;  3LKE A;  3U9R B;  2E75 D;  5DUC A;  3KTG A;  3AED C;  4ZDD A;  1RJN A;  2J5I I;  1OMI A;  2GTR A;  3IAO A;  2ZT9 B;  4ELS A;  4WZ8 B;  4U19 A;  3OC7 A;  3ZWA A;  4EMM A;  2E76 B;  1WDK A;  2CE3 A;  4DI1 A;  4JFC A;  2D2C D;  4JYJ A;  2J5U A;  2WPV B;  4R4L A;  2A7S A;  3FGA D;  1XNV A;  2PG8 A;  4YXD C;  1RQV A;  4ZDB A;  1HF9 A;  2J5G A;  4I52 A;  3Q2Y A;  3AE4 C;  2H88 C;  2NP9 A;  2F6I A;  3PE8 A;  4JVT A;  5INI A;  4ELW A;  3HLN 1;  1PIX A;  2X24 A;  3Q5R A;  4NEK A;  5DTW A;  1ZOY C;  2QSI A;  2YMK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...