3GF7A

Glutaconyl-coa decarboxylase a subunit from clostridium symbiosum apoprotein
Total Genus 204
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
204
sequence length
585
structure length
543
Chain Sequence
MYSMPGYFQNMPTIGKELVNPNPENEQEIKAVESDIHESIKKALDAGITSEEKLNERGQLSAMQRINALIDPGTWCPLNSLFNPENNKFGTTNIVNGLGRVDGKWVYIVASDNKKMAGAWVPGQAENLIRCSDAAKMMHLPLIYLLNCSGVEFPNQDKVYPNRRGGGTPFFRNSELNQLGIPVIVGIYGTNPAGGGYHSISPTILIAHQDANMAVGKVPAPGSVPIHYDETGFFREVYQNDLGVIDGIKKYISYLPAYNLEFFRVDTPKAPQLPAEDLYSIIPMNQKRPYDIYEVIARLFDNSEFSEYKKGYGPEMVTGLAKVNGLLVGVIANVQGLLMNYPEYKQNSVGIGGKLYRQGLIKMNEFVTLCARDRIPLIWLQDTTGIDVGDEAEKAELLGLGQSLIYSIENSKLPSLEITIRKASAAAHYVLGGPQGNNTNVFSIGTGACEYYVMPGETAANAMYSRKLQPIIGKMNDMIQMYTDKSRPKYCTEKGMVDEIVDMTEVRPYIQAFTEAAYQNPQSICPMHQMLTPRSTREFETFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title An asymmetric model for Na+-translocating glutaconyl-CoA decarboxylases
pubmed doi rcsb
source organism Clostridium symbiosum
molecule tags Lyase
molecule keywords Glutaconyl-CoA decarboxylase subunit A
total genus 204
structure length 543
sequence length 585
ec nomenclature ec 4.1.1.70: Transferred entry: 7.2.4.5.
pdb deposition date 2009-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01039 Carboxyl_trans Carboxyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.680 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Helix bin 3gf7A01
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3gf7A02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3gf7A03
1O8UA 2CE3A 3FF6A 2X24A 3PZKA 2VSUC 3MYBA 2FZSA 3I47A 1OD4A 2PBPA 2PG8A 2DUBA 4FB8A 3PEAA 3R9TA 3IBBA 3BEZA 2A7KA 5E0NX 2VSUA 5INFA 5JBWA 1N6EA 2UZFA 1MJ3A 4OMRA 3ISAA 4IZDA 1FC6A 3TT6A 1VRGA 4MOUA 3QYRA 1J7XA 1EY3A 4JJTA 3VIVA 3T88A 4Q0GA 3QXIA 4JYJA 1WZ8A 1XNVA 2F9IB 1XNYA 4JWVA 4B3IA 5CTBA 3P5MA 2ZQQA 3GMAA 4JCTA 1UYSA 3QK8A 3ZWAA 4U0HA 2ZL0A 2Q35A 3Q7HA 3U9TB 1UYVA 3R9QA 3M6NA 3Q0JA 3T8AA 4NNQA 4ZU2A 5INGA 3RRVA 4WYOB 1YG6A 1XNWA 3P2LA 4HNKA 3LKEA 4RYFA 1HZDA 1ON3A 2J5IA 3QXZA 3QWDA 4U18A 3V5EA 1TG6A 4YLHA 3KQFA 4ELXA 1DUBA 1NZYA 3KTIA 4Z0MA 1K32A 4KD6A 3NJDA 2EJ5A 4ASIA 3PE8A 3GLMA 4FN8A 3DJAA 2X58A 3H0UA 1SZOA 2GTRA 3QKAA 4L6WA 4MI2A 3TT7A 5DTWA 1EF8A 5E0SH 2Q2XA 4LK5A 4QIIA 3ZW9A 3H02A 1Y7OA 1JXZA 3HRXA 3H81A 2NP9A 2VSSA 2VX2A 2J5GA 2C8TA 3RSIA 4GM2A 3T3WA 4FNBA 2BZRA 4I4ZA 1K39A 4I42A 2HW5A 1SG4A 1PIXA 3JU1A 4WCZA 2CBYA 1FC9A 3M6MA 3T89A 3Q0GA 3T8BA 3ST9A 3ZWCA 2ZL3A 1WDKA 4DI1A 3N6RB 4QFEA 5E0SA 2F9YA 5DU8A 3K8XA 1XO6A 3OMEA 3R0OA 3OT6A 3TDCA 4OG1A 3TRRA 4JCRA 5DL1A 2VSUE 4NEKA 5DU4A 1N6DA 3H0QA 1TYFA 3P85A 4GHNA 2Q34A 5DU6A 4JCSA 2D3TA 1UIYA 4B3HA 4ZDFA 4KNPA 2W3PA 2ZL4A 3QMJA 4K29A 1FC7A 3GF3A 3MT6A 4JVTA 4B3JA 1WDLA 3ZWBA 5DZKH 4FZWC 1PJHA 5C90A 1Q52A 2DEOA 3WG5A 4U0GH 4JSBA 1DCIA 1RJMA 2J5GD 1NZYB 3HINA 3L3SA 3TLFA 3NJBA 5DUCA 4KWBA 3LAOA 1FCFA 4RCNA 3ZW8A 2ZL2A 4ZDBA 4Q1IA 3TV5A 3R9SA 2VREA 2J5II 3OC7A 4ZDCA 4K2NA 4OLQA 5DUFA 1WDMA 3BF0A 4JFCA 2F6IA 3K50A 4EMLA 5KDRA 3HE2A 4I52A 2PPYA 1Q51A 2F6QA 5INIA 3MOYA 3Q1TA 4JCQA 5JBXA 1RJNA 2QQ3A 5KDRB 3G64A 3MFMA 5CTCA 3U9RB 4HC8A 4RYFH 5FUSA 5G1SA 1EF9A 3BPPA 3QREA 4U1AA 4F47A 1UYTA 1HNUA 2VSSE 4IZBA 4ZDDA 4ELSA 4QIJA 4EMPA 2FW2A 5DKPA 5IKLB 3KTKA 3KTJA 3GKBA 3KTGA 3SWXA 3STAA 5DZKA 4K3WA 4KPKA 1N6FA 2F9YB 4FJWD 3HLN1 1X0UA 4L8KA 1UYRA 1W2XA 5G1QA 3V5IA 5DTPA 3H0SA 4EMMA 3FDUA 5FIFA 4FZWA 3HP0A 2A7SA 3SLLA 5KJPA 2VSUF 1HNOA 3TVWA 3PGQA 3U9SB 4JYLA 3TVUA 3KTHA 3RSTA 3DORA 3IAVA 2J5IB 3H0JA 2FBMA 2ZQRA 1XX4A 3R6HA 4IZCA 2J5SA 5C9GA 2IEXA 1ON9A 4G2RA 2A81A 5G1RA 2WTBA 3GF7A 4WZ8B 1OD2A 4FN7A 4U0GA 4ZDEA 4U19A 4ELWA 2VSSF 3TZ3A 2F9IA 4JOTA 4MXIA 4FNDA 3IB9A 1YG8A 5MGBA
chains in the Genus database with same CATH superfamily
2WSEH 3FF6A 2ZT9D 2WPSA 2QM8A 1M8OB 1DEEG 3MYBA 1OW6A 2M5AB 1OD4A 1HJBA 4K3AA 3EWKA 1E5WA 3Q5RA 2DUBA 1WT6A 3H1IJ 3II6A 5APYA 3CLQA 1KQSO 1DD3A 1CW5A 1IJDB 1H88A 1LWUC 2A7KA 2OQQA 1BGYE 4NPEA 4KT0J 4NARA 1RF1A 2WZ7A 2BCCG 1JY2P 3M06A 1OMIA 3G71P 2N9BA 3HE4B 1NTZE 1N6EA 2N1TB 2J5UA 3BRVB 1NYHA 3EFGA 1RQVA 4TT3H 2FFDB 1EZVE 1FC6A 1VRGA 1LWUA 2KYVA 1KV4A 1T3UA 1SQVK 4R4MA 1JTHA 2KOGA 2IBZG 3W67A 1VF5C 1GZLA 4Q0GA 1VQMP 3QXIA 2Z4EA 4JYJA 4JWVA 3LW5J 1GL2D 1YJNP 3H1KE 2BCCD 1IO4A 3MHVA 3AEGC 1EDIA 3CXHI 3HUSB 3CCLP 2WSEJ 1JEKA 3PLNA 4U3FD 2ZQQA 2ZT9C 1UYSA 1Y47A 1FZGA 3QK8A 2Z5HA 4XA4A 3ZWAA 2LXCB 1R8EA 3Q7HA 3Q0JA 1EZVD 4J2UA 1NU1K 4GOFA 1GW4A 5INGA 2PGDA 5TJHA 1YTZI 1AJYA 4C46A 4YTPC 5AW0B 5CCHA 1QX8A 2HG5D 2A45I 1N86A 2FYUD 5AW5B 4RYFA 5GTIE 1ON3A 4CPGA 2R32A 1KYOD 1ZR4A 1R5LA 3SWKA 2YKOA 4I6MC 3MD0A 3V6IA 3QWDA 1K05A 4DOJA 5CJ4A 2XNDH 3AE9C 1U57A 1X79B 3L72E 2H7HA 3OAKA 3MGNA 1BCCG 1LTJB 1K32A 4KD6A 4ASIA 1USDA 5AW6B 4GDOA 2FXMA 1SZOA 2GTRA 3TT7A 1IFIA 1DEBA 1TU3F 2O1JA 2Q2XA 4LK5A 2V7QH 3H02A 1Y7OA 2VSSA 2FYUE 2C8TA 2Q7CA 2K3RA 1IFPA 4GM2A 5CCGD 3T3WA 2KXPB 2BZRA 4RO0A 1KILC 2YJGA 2WSSH 3AEEC 4I42A 1SQPK 2HW5A 3PP5A 2QJPB 1PIXA 1LWUB 3QWOC 4K35A 5CCHC 1BCCD 4IFFA 2P2UA 3H1LG 3M6MA 1NTZD 3CWBE 3H1JD 3AEBC 4DI1A 3RK3D 5E0SA 2F9YA 5DU8A 4ZKUA 4LC1A 4BXLA 4H0LB 1S5LH 1YI2P 3CCRP 3D71A 1JOCA 3A0HH 2M3EA 5BVZA 3TDCA 3H1HD 3AE3C 5DL1A 1GW3A 1N6DA 5CHXA 5KLVK 3HRNA 5CBNA 3P85A 4GHNA 5KLIC 1FBMA 1XTCC 2BCCE 4WY4C 2HLOA 2FFDA 1X0TA 2IYPA 1NTZG 3G6EP 1SQVG 1QEXA 3KPEA 3AE5C 3FX0A 5H2FH 2W3PA 3C9IA 2IFNA 4PD4D 2J58A 3RK3B 1N7SA 2QSIA 1XTGB 3A5TA 1MUUA 2WTYA 1VQ8P 2FXPA 1HJ0A 1LTSC 2KS1A 4HJGH 1LT9A 3WUVA 5DZKH 4HB1A 1NHLA 1PPJG 1Q52A 1N7SB 2JKVA 3ZDMA 1J2JB 5CCGA 1VL2A 1L0ND 2WSCH 2QIWA 1SQQK 4JSBA 1DCIA 2AXTH 1P84H 1RJMA 1NU1G 1PFIA 1BE3D 3TLFA 4KWBA 1MZ9A 3ZW8A 2Q3IA 3R9SA 2C0XA 1L4AD 3I55P 2BEZF 3VYIA 3B5ND 4D6TD 4ZDCA 1SQXG 3RK2B 5GTHH 5B66H 2AXTE 3V4QA 2F6IA 3BCCE 3CXHE 1VPCA 4I52A 1PGQA 3Q1TA 2JWDA 4JCQA 5JBXA 3T97B 4C7RA 1KB9E 5KDRB 4OGQC 2ZFCA 2M0BA 4BWNA 3U9RB 4HC8A 4RYFH 2OYIC 1EF9A 3JC22 3SFDC 1FDIA 4U7JA 2B87A 1VDFA 1HNUA 2VSSE 1FZCC 3CI9A 2KSEA 1P84E 3N7NA 4D6TE 5APQA 4QIJA 5AW2B 5AVUB 3A0BE 1M1JC 3VTPC 3KTKA 2WSCJ 1FDMA 5KLVE 3GKBA 2ZYGA 1M7LA 2YIUB 1LTGC 4B86A 4ZNCA 4K3WA 1Q81Q 2CPBA 2QJYB 4L73A 3TYYA 1T6AA 2E76B 1AQTA 2F9YB 2FYUJ 1HBWA 4FJWD 2P7JA 3VOPA 3M0DC 4U3FG 1W2XA 1OW8A 5DTPA 4UB8H 2E5YA 3H1LJ 1GU4A 3CWBD 2WPQA 5H2FE 3FDUA 5FIFA 4UB8E 4FZWA 3HP0A 1L0LE 2A7SA 1KILE 2H43A 3VMZA 2VSUF 2IPPA 5APXA 1SQBJ 3PGQA 3U9SB 3TGUD 1ZOYC 3TVUA 3RL0B 4DZOA 1WMKA 2JJLA 2FBMA 1LP1B 3VMYA 3H1ID 2J5SA 1KMIZ 5CCHD 4G2RA 3AE1C 4EDFA 4IL6E 4WY4B 1LT9B 1BGYG 4WB4A 3CWBG 4ZDEA 1PL5A 2FYNC 2A06E 1PV3A 1YQ3C 2F9IA 1JB0J 3IB9A 5MGBA 1O8UA 5APTA 2E75B 2CE3A 2YMYA 3BATA 3PZKA 4RJTA 1JMBA 1S3JA 3H32A 2XV5A 2FYNB 2PG8A 1HGVA 2R5BA 1JY2O 3A0BH 3R9TA 1W2BO 3IBBA 3BEZA 2VSUA 5INFA 3CC2P 1NU1J 3CCUP 3RL0D 4U3FJ 5CBOA 2UZFA 4IOIH 4XE5B 2P1JA 3B5NA 2POHA 4IL6H 3TT6A 3A2AA 3L74G 1USEA 2KZIA 3CPWO 4JJTA 1SQXJ 3T88A 3L74D 1SQBD 4M3LA 2P67A 2F9IB 1XNYA 1Q86Q 3M0DA 1JCCA 2ZXXA 2C0WA 1NAFA 2KLVA 1KB9D 3IAOA 2ZT9B 2JDIH 1RE4C 2VRSA 2HODA 2M5AA 3H32B 1KORA 1L4AC 4JCTA 1EC5A 1HF9A 1NTMD 4U0HA 1EZVI 2B89A 3F5HA 2HODB 1GK4A 4ZU2A 2QJYC 1N2DC 3L75J 2RN0A 2LXBA 3O8ZA 1VQ9P 3IR9A 5KTBA 1OVUA 4OGQD 2E76C 1KB9I 3H1LD 3SWYA 1QVGO 2J5IA 2OYOA 2IBZI 1L0NG 1KQFB 4MN4C 2O01H 1TG6A 1T2KC 2Y0CA 1U7JA 1JCDA 1SQPD 3KQFA 3VMAA 1N73A 3D6YA 4ELXA 4ASVA 5B5EH 1JY3O 2AXCA 4Z0MA 2ITAA 3LW5H 2EJ5A 4PD4H 3PE8A 1QLED 2O01J 2A45H 4LGDE 1S72P 3AEDC 1SQVD 1AVYA 3QKAA 1EQ7A 2IBZD 4YPCA 3MTUE 3V5BA 5DTWA 1PGOA 1EF8A 2QEXP 5AW9B 5E0SH 1P84I 3B5NC 3CWBJ 3FWNA 3ITKA 3L70E 1JXZA 5KAFH 3H81A 1JMMA 4JYCA 3P8CE 2J5GA 1AV1A 3MUDC 1SQXD 5KLVJ 2QJKB 2WWWA 1EXIA 4HYTB 5DJUB 2AEMA 3G4SP 5E79H 1HWTC 4D6TJ 4I4ZA 4N3YB 1K39A 3M9QA 3S4RA 1T3JA 3CX5D 1NU1D 3AEAC 3KZIE 4JYBA 2FKWB 1Y9BA 4DCKA 3P8MC 5AVXB 3JU1A 1A02J 2KS1B 1LTBC 1NO4A 2MKVA 1PP9G 1IFJA 3B4SA 1SQQE 1FC9A 2YIUC 3ABVC 3ZWCA 5KJ7A 1URQB 4JBZA 1LTIC 2IZ1A 3K8XA 3L74J 3AE7C 3OMEA 1URQC 1NGMB 2H88C 1N7LA 2ZJSE 3JCUH 1S1CX 1FDOA 1QL1A 3MP7B 3CX5I 3D6ZA 1YJWP 2E42A 2VSUE 5DJTB 1YJ9P 1RE3A 3BASA 3H0QA 2WITA 2Q34A 4JCSA 2Y0EA 1GK6A 2D3TA 3KQGA 5AVZB 3VP9A 3Q5PA 2FXOA 3Q2YA 5AW4B 5APVA 3QMJA 4K29A 1N8RQ 1KN7A 3CCVP 1FU1A 4JVTA 5L8RJ 1S9KD 1RF1B 2QA4P 1WDLA 3ZWBA 2NZ2A 1S5LX 2QJPC 1OVRA 3L74E 4PD4E 3BCCG 3GHGA 1L0LJ 3CXHH 5E79E 3R4YA 1W2EA 4U0GH 1BDDA 1EDJA 2Y9ZA 2WPVB 4DT0A 3H1KG 1NZYB 4HKZH 4H13C 3CMEP 3NJBA 5DUCA 3LAOA 2OYHB 1OWAA 5BU8B 2ZL2A 3GHGC 1BCCJ 1LTJC 1G2CB 5APWA 3RGUA 3TGUG 1YTZT 2J5II 5TISE 1ZR2A 3L72J 1QL2A 1SLQA 4L75A 3KXDA 1IC2A 5DUFA 2K9JB 1NTZK 4JFCA 1FOSE 1NTKE 4EMLA 2OYIA 2Y9YA 1VQKP 4GIFA 2PPYA 3RL0C 3FXDA 5B5EE 1JM0A 4W7ZA 4W80A 2QQ3A 1JTHB 3G64A 5CTCA 2FYZA 5FUSA 3RK2D 4L74A 4GT1A 3H1IG 1VQLP 1K8AQ 1VQ5P 4IZBA 5GTIH 2BEQD 1J1EC 3H1KD 3HE5A 1BSNA 2J59M 4EMPA 2FW2A 1YITP 5IKLB 2KB7P 3R2PA 3KTGA 4DJGA 1URQA 2XNXA 3HE5B 1GL2B 4KPKA 3KDPB 1N6FA 2M8RA 1ZMEC 1X0UA 3V2RA 4GOEA 2KSJA 3V5IA 3H0SA 2LR2A 4EMMA 4EI2A 1HUCA 2HYNA 3H1JE 3TGUJ 4A7PA 1HNOA 1FZBA 1MV8A 3L73G 3KTHA 3BRTB 5KLIB 3IAVA 1NKNA 3P8CD 1FJKA 1M90Q 3R6HA 1KILD 2WMMA 3CMAP 5C9GA 1PPJE 1SFCA 1PZQA 5G1RA 2WTBA 2KNCA 3GF7A 4WZ8B 3G3ZA 1NJIQ 4FN7A 4O9BA 2E74C 1FZAA 4IFDK 1KTMA 3AE4C 1L2PA 2JEEA 2HFED 3SWFA 4JOTA 3HUSC 4MXIA 3M9BA 3HD7C 2V7QJ 2N1TD 2VSUC 2D2CD 2AEJA 1FZCA 1LTTC 2PBPA 3HTKA 3BCCJ 1N7SC 1H89A 3PEAA 1J1EB 1AQ5A 2R44A 1SQPG 5E0NX 3L35A 2RMZA 5JBWA 4NPDA 4OMRA 3ISAA 3CD6P 1KFMA 3LIEA 3GG2A 4IZDA 4IL6X 2FBWC 1Q90D 2H89C 3O6QB 1JNMA 3QYRA 4MOUA 3T97A 1J7XA 1SP4A 3HE4A 3VIVA 1LT1A 3L73D 2YMKA 1AVOA 4H13D 2W6BA 4B3IA 3P5MA 2XDJA 4OWFA 2PP6A 5KAFE 2OGUA 2G3AA 2OTLP 3E1RA 3BVHA 4C7NB 4WY4D 3K5BA 2ZL0A 2Q35A 1GMJA 4WVZA 2C9NY 3HUSA 2JR8A 1ZW0A 2QRXA 3HD7A 1X22A 3CCSP 1YG6A 2O1KA 2GM4A 3L73E 2WT7A 3CX5E 3IFMA 4JQ0D 3P2LA 1E79H 4PJ0H 3LKEA 2OTKE 2Q6QA 1MFTA 1SQXK 1H8AA 1BSHA 4Z1MH 3RL0g 1SFCC 3QXZA 2IFMA 1K04A 2AEFA 3V5EA 1IFMA 3H6PA 1RH5B 1GDTA 3M0AA 2W27A 2K88A 3JSVC 1NZYA 3KTIA 1KD1Q 3NJDA 1DD4A 3AE2C 3C1LA 5APUA 1RHZB 2IYOA 3GLMA 3PTZA 3WU2E 3DJAA 4ZKPA 2Q5UA 2X58A 1OXZA 3H0UA 1BE3E 3V2NA 1FS0E 4Y99B 4L6WA 2IDBA 2K9JA 3L75G 1PP9D 3HRXA 1L4AB 3CXHD 2NP9A 2RKLA 2YXQB 4OGQB 1KILB 1IK9A 1NTKG 3RSIA 2WVRA 2IZ0A 3H1KJ 2E75C 3BCCD 2I8DA 1JUNA 2FY8A 3L37A 3KYQA 4WWIA 2G8YA 2N1TA 1LNQA 3D70A 1SG4A 4H44C 2QG4A 1HVVA 3O6QA 2YNYA 3L4FA 3L70J 4WCZA 4EIJA 3Q5SA 2CBYA 2NPSA 1AA0A 1N73C 1YBKA 1KYOI 3Q0GA 3GHGB 1SFCB 2FYUK 2ZL3A 5AVWB 3TSIA 1WDKA 1KZUB 1L0NK 1S2EA 1EDLA 2W6AA 2GA1A 2Y0DA 3R0OA 3JCUE 4BRYA 1NAYA 4WBAA 1VQPP 1DH3A 3A0HE 1H0TA 5DU4A 2XZRA 1IFNA 1NH4A 5KLVG 1TYFA 5DU6A 3W68A 1SQBE 5GTHE 4B3HA 3H25A 2H8PD 1KYOE 4LLHA 1VQ6P 2W6JH 2W8ZA 1RQUA 2ZL4A 1FC7A 1M1JB 3GF3A 2HPCB 2QJKC 1VF5D 2NRGA 2CK3H 1ZRTE 1L0LK 5C90A 1RF1C 3CX5H 2YKPA 2B88A 1L0NJ 1YIJP 3A7OA 1BGYD 1RF0C 4H0LC 1NTMG 4RKUJ 3CC4P 4JPZB 1QVFO 1SQBG 1HGZA 3HINA 3L70G 3HD7D 3L71E 4BRYB 3Q1MA 4RCNA 1DX7A 4ZDBA 2JWAA 2R5DA 1JO5A 1ZXGA 1ZLLA 3I5CA 2W83C 2KUBA 4K2NA 4OLQA 2N9YB 5AVSB 1M56D 1WDMA 3BF0A 1ZRTD 3AE8C 3TDKA 3V2QA 3L75D 1Q51A 1G1IA 1ZV8A 3V2PA 3TK1A 1M57D 1S5LE 3PH0A 5KKZC 1RJNA 3RBZA 1NTKD 5KJ7C 1GTWA 1VQ7P 3BPPA 1K73Q 2P10A 4U1AA 3MIWA 2Q1KA 3L72G 4Y28J 3IN6A 3H1JG 4PD4I 4ELSA 1SQXE 4I2LC 3P7KA 3PJSK 1CI6B 4I7ZC 2QM7A 1FOSF 3KTJA 3U1CA 3Q3DA 3SWXA 5DZKA 1MFZA 4I7ZB 2KLUA 3FXEA 1ZP0C 1OZHA 4ASWA 5G1QA 5BU5A 4UB6E 1WRGA 3RBXA 5KJPA 4W7YA 4JYLA 2J5IB 2L5GB 3AEFC 2OYHC 3FWLA 1XX4A 4IZCA 5AVVB 1SFCD 5KJ7D 3B5NB 1PGPA 1LGHB 1ON9A 2A81A 2M3BA 2ZYDA 1EXJA 1NOHA 1Q2NA 1OD2A 1CI6A 4PV1B 5KAIE 4ELWA 1X9VA 4QMAA 3TZ3A 3RK3C 3MZWB 1PPJD 4FNDA 1L0LG 4N78D 2OARA 5C39A 1W5CE 2X24A 2QVAA 2R3CA 1LT9C 2Z5IA 4RESB 3CCJP 4PJ0E 2FZSA 1YHQP 3I47A 2WQYC 5HUQA 2A06D 4FB8A 3H1HJ 5CMZA 1D7MA 1QGKB 2ZVNB 1FE6A 3NTNA 3AE6C 3AECC 2JP3A 4OVNF 3L71D 3V4WA 2E76D 1UIIA 1LTAC 1MJ3A 1YQ4C 4KHXA 2OTJP 2DW3A 3VP8A 2K9YA 2GUVA 1EDKA 1EY3A 3H1HE 1FZEA 2KI7B 1RY3A 4H0LD 1IFDA 1WZ8A 1XNVA 1VF5B 2GUSA 3G9RA 3TNUB 1NTME 1P84D 1CSBA 4Y99C 3L71G 5CTBA 5AVTB 2D2CB 1SVFA 1HH0A 2R3SA 2WSFH 1FZCB 3B8EB 1PP9E 4AUWA 3GMAA 2E43A 1KYOH 1EZVG 3U9TB 1UYVA 2Q3EA 2YO3A 3H1JJ 3L36A 3TGUE 3M6NA 3R9QA 4L76A 3T8AA 4NNQA 3MUDA 1IZNB 2O3JA 2B9BA 2O01N 3RRVA 4WYOB 2LKMA 5AW7B 3OW2O 1XNWA 4H13B 1KILA 2ZAEB 1YYCA 4HNKA 4JF7A 1HZDA 1Q7YQ 3CC7P 1DIPA 1NWQA 1BE3J 2YO2A 2HR3A 4ZMDA 2WT7B 3H1IE 3VN0A 4U18A 4GODA 1S9KE 3TNUA 4YLHA 3BPTA 3RK2C 3P32A 3KHUA 5APSA 4EYYQ 2ZYAA 1DUBA 2NPSB 3NMDA 3USSA 2I1KA 2B87B 2Q9IA 3QH9A 1CZQA 1Y8AA 2NPSD 1OVVA 4C7NA 2N1TC 3GW6A 2V4HA 3CCMP 5B66E 1JY3P 1URQD 4FN8A 4PV1C 4YXDC 1SQPE 2D2CC 3M91A 2UWJE 4MI2A 2JO1A 4QIIA 3ZW9A 2PFXA 2KIKA 3S1KA 3NFQA 3HTKB 4U3FE 1GL2A 1NVOA 2VX2A 1SQQJ 4N78E 2IBZE 1OIPA 3M9HA 4YXWH 1AFOA 4FNBA 2BASA 1SQPJ 1FZFA 2PAJA 1BCCE 1GD2E 1NTMK 4HDTA 3WU2H 5AVQB 5AW1B 4NPFX 3H1HG 2I1JA 3WUTA 4OH8B 2HPCA 1FC2C 3RK3E 1OFCX 1NTZJ 1SQVJ 3T89A 3T8BA 3ST9A 4UB6H 1LJ2A 1PGJA 2A06G 3S9OA 1K9MQ 3N6RB 4QFEA 3WUUA 1XO6A 4PV1D 1FAVA 3OT6A 2OYHA 4OG1A 1UIXA 3TRRA 4JCRA 4NEKA 1J1DC 2ZXEB 2E74B 3CL3D 5M1BA 1M1JA 1N7SD 2K37A 5KKZB 1SS1A 1UIYA 2P58A 3L71J 4ZDFA 1T8ZA 4HH2A 4KNPA 3H1LE 4AQRD 2OYIB 2K1AA 1Z56A 1IK7A 3OA7A 1X8YA 2WPRA 1KQGB 3MT6A 1L0NE 3F89A 4B3JA 2E74D 4WY4A 3KZIH 3WMM0 2KNCB 3C8VA 4FZWC 2YKQA 1PJHA 3L73J 4H44B 5AVRB 2MJZA 1NTKK 2DEOA 3WG5A 1G2CA 1MKMA 1T2KD 2J5GD 1GL2C 2BCCJ 1SQVE 1ZN5A 3L3SA 3SFEC 1A02F 1FCFA 1BE3G 1JY3N 3L70D 3VMXA 2E5TA 5AW3B 4Q1IA 3U59A 5KLVD 1KC8Q 2PRRA 3TV5A 3UIAA 3SSUA 2NPSC 2VREA 2KP8A 3OC7A 2IX7C 4N6JA 4D6TG 2FYUG 4AYCA 3K50A 5KDRA 1VQOP 1Q82Q 1L4AA 3HE2A 1HTLC 5CCGC 2F6QA 5INIA 3MOYA 3EQ2A 1NTKJ 4GKGA 1PP9J 3HD7B 5TISH 1NU1E 1VQ4P 3MFMA 3E1IA 4KJMA 1M1KQ 4H44D 1J1DB 1KQLA 5G1SA 3QREA 2ZVOB 1JY2N 3A3YB 1KB9H 4F47A 1SQQD 1UYTA 2W90A 1NTMJ 2XKMA 3TF5A 1SQQG 4ZDDA 2L91A 2YXRB 3CCEP 3L72D 1BDCA 1VQNP 1GU5A 5EFWB 3B71A 4IFMA 2KZJA 5DKPA 3E7KA 3NXSA 3FGAD 4TLFA 3STAA 1N73B 3U1AA 4XFJA 2XU6A 1S4XA 1L0LD 2WSFJ 3HLN1 1LTJA 2KK7A 5K5GB 4L8KA 4I1LA 1BGYJ 1UYRA 3PRJA 5AW8B 3L75E 1H0TB 2SPZA 1U7MA 1SQBK 1LP1A 4R4LA 1RE4A 5KAIH 3SLLA 2QE7H 4EOTA 3TVWA 1G1JA 3RSTA 3DORA 3H0JA 1FJPA 2E75D 3OJAB 2ZQRA 2CPSA 3I56P 3CCQP 1OX3A 2A45G 2IEXA 1KFNA 5CJ0A 3N4XA 5AVYB 1R5SA 3LIDA 2FFDC 4U0GA 4U19A 2C9LY 1NKZB 1RF0A 3IF4A 2VSSF 3EFFK 1RE3C 3PHLA 1OW7A 2RH0A 1YG8A
chains in the Genus database with same CATH topology
1O8UA 2E75B 2V7QJ 2CE3A 3FF6A 2X24A 3PZKA 2ZT9D 2VSUC 2D2CD 3MYBA 1OW6A 2FZSA 3I47A 2WQYC 1OD4A 2PBPA 5HUQA 3EWKA 2PG8A 3Q5RA 2DUBA 4FB8A 3PEAA 1DD3A 3R9TA 3IBBA 3BEZA 2A7KA 2OQQA 5E0NX 2VSUA 3AE6C 5INFA 3AECC 2JP3A 4KT0J 4NARA 5JBWA 1OMIA 2E76D 1N6EA 2UZFA 1MJ3A 2J5UA 1YQ4C 4OMRA 3ISAA 1NYHA 1RQVA 2K9YA 4TT3H 4IZDA 4IL6X 2FBWC 1FC6A 3TT6A 1Q90D 1VRGA 2H89C 4MOUA 3QYRA 1J7XA 1EY3A 4JJTA 3VIVA 4R4MA 3T88A 1VF5C 4Q0GA 3QXIA 4JYJA 4H0LD 1WZ8A 1XNVA 2F9IB 1VF5B 3G9RA 1XNYA 4JWVA 3LW5J 2YMKA 4H13D 4B3IA 5CTBA 2D2CB 3AEGC 3P5MA 3IAOA 2ZT9B 2WSEJ 2G3AA 2ZQQA 3GMAA 1KORA 4JCTA 2ZT9C 1UYSA 3QK8A 1HF9A 3ZWAA 4U0HA 1R8EA 2ZL0A 2Q35A 3Q7HA 3U9TB 1GMJA 1UYVA 3R9QA 3M6NA 3Q0JA 4J2UA 3T8AA 4NNQA 4ZU2A 2QJYC 5INGA 3RRVA 4WYOB 1AJYA 1YG6A 1XNWA 4YTPC 4H13B 3P2LA 4HNKA 4OGQD 3LKEA 2E76C 4RYFA 1HZDA 1ON3A 1DIPA 4Z1MH 2J5IA 3RL0g 3QXZA 1KQFB 1K04A 3QWDA 4U18A 3V5EA 1TG6A 1K05A 4YLHA 3AE9C 3BPTA 3KQFA 3D6YA 4ELXA 1U57A 1DUBA 1NZYA 3KTIA 4Z0MA 1K32A 4KD6A 3NJDA 1DD4A 3AE2C 2EJ5A 4ASIA 3PE8A 3GLMA 4GDOA 2O01J 4FN8A 4PV1C 4YXDC 3DJAA 2D2CC 2X58A 3H0UA 3AEDC 1SZOA 2GTRA 3QKAA 4L6WA 4MI2A 3TT7A 2IDBA 2JO1A 1TU3F 5DTWA 1EF8A 5E0SH 2Q2XA 4LK5A 4QIIA 3ZW9A 3H02A 1Y7OA 1JXZA 3HRXA 3H81A 2NP9A 2VSSA 2VX2A 2J5GA 2C8TA 4OGQB 3RSIA 4GM2A 1EXIA 3T3WA 2E75C 4FNBA 2BZRA 4I4ZA 2YJGA 1K39A 2G8YA 4HDTA 3AEEC 4I42A 2HW5A 3D70A 1SG4A 3AEAC 4H44C 1PIXA 1Y9BA 3JU1A 3O6QA 3RK3E 4WCZA 2MKVA 3Q5SA 2CBYA 1FC9A 2YIUC 3M6MA 3T89A 3Q0GA 3T8BA 3ST9A 3ABVC 3ZWCA 2ZL3A 3AEBC 1WDKA 3S9OA 4DI1A 3N6RB 4QFEA 5E0SA 2F9YA 5DU8A 3K8XA 1XO6A 4H0LB 3AE7C 3OMEA 3D71A 3R0OA 1NGMB 2H88C 4PV1D 3OT6A 3TDCA 3AE3C 4OG1A 1UIXA 3TRRA 4JCRA 1S1CX 1FDOA 5DL1A 3D6ZA 2VSUE 4NEKA 5DU4A 1N6DA 3H0QA 2E74B 5M1BA 1TYFA 3P85A 4GHNA 2Q34A 5DU6A 4JCSA 5KLIC 2D3TA 1UIYA 3Q5PA 4B3HA 3H25A 4ZDFA 4KNPA 3AE5C 2W3PA 3Q2YA 1RQUA 2ZL4A 1IK7A 3QMJA 4K29A 1FC7A 2QSIA 1KQGB 3GF3A 3MT6A 4JVTA 2FXPA 5L8RJ 1HJ0A 2QJKC 1VF5D 2E74D 4B3JA 1WDLA 3ZWBA 2NZ2A 1S5LX 3C8VA 1ZRTE 5DZKH 4FZWC 1PJHA 5C90A 2QJPC 4H44B 1Q52A 3R4YA 2DEOA 1VL2A 3WG5A 4U0GH 2QIWA 4H0LC 4JSBA 1DCIA 1MKMA 2WPVB 4RKUJ 1RJMA 2J5GD 1NZYB 3HINA 3L3SA 3TLFA 4H13C 3SFEC 3NJBA 5DUCA 4KWBA 3LAOA 1FCFA 3Q1MA 4RCNA 3ZW8A 2ZL2A 4ZDBA 4Q1IA 3TV5A 3R9SA 2VREA 2J5II 3OC7A 2BEZF 4ZDCA 4K2NA 4OLQA 5DUFA 1WDMA 3BF0A 4JFCA 3AE8C 2F6IA 3K50A 4EMLA 5KDRA 3HE2A 4I52A 2PPYA 1Q51A 2F6QA 5INIA 3MOYA 3Q1TA 4JCQA 5JBXA 5KKZC 1RJNA 3T97B 2QQ3A 5KDRB 4OGQC 3G64A 3MFMA 5CTCA 3U9RB 4HC8A 4H44D 4RYFH 5FUSA 5G1SA 1EF9A 3BPPA 3QREA 3SFDC 2P10A 1FDIA 4U7JA 4U1AA 4F47A 1UYTA 4Y28J 1HNUA 2VSSE 3IN6A 4IZBA 2BEQD 4ZDDA 4ELSA 4QIJA 3B71A 4EMPA 4I7ZC 2FW2A 5DKPA 5IKLB 3KTKA 2WSCJ 3KTJA 3GKBA 3FGAD 3KTGA 3Q3DA 3SWXA 3STAA 5DZKA 4XFJA 4K3WA 4I7ZB 2WSFJ 4KPKA 2E76B 1N6FA 2F9YB 4FJWD 3HLN1 1ZP0C 1ZMEC 1X0UA 4L8KA 1UYRA 1W2XA 5G1QA 3V5IA 1OW8A 5DTPA 3H0SA 4EMMA 3FDUA 5FIFA 4R4LA 4FZWA 3HP0A 2A7SA 1KILE 3SLLA 5KJPA 2VSUF 1HNOA 3TVWA 3PGQA 3U9SB 4JYLA 1ZOYC 3TVUA 3KTHA 3RSTA 3DORA 3IAVA 2J5IB 1WMKA 3H0JA 3AEFC 2FBMA 2E75D 2ZQRA 1XX4A 3R6HA 4IZCA 2J5SA 5C9GA 1KMIZ 2IEXA 1ON9A 4G2RA 3AE1C 2A81A 5G1RA 2WTBA 3GF7A 1EXJA 4WZ8B 1OD2A 4FN7A 4U0GA 4ZDEA 2E74C 1PL5A 4PV1B 1KTMA 4U19A 4ELWA 3AE4C 2FYNC 2VSSF 3TZ3A 1PV3A 1YQ3C 2F9IA 1JB0J 4JOTA 4MXIA 4FNDA 3IB9A 1OW7A 1YG8A 5MGBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O8U A;  2CE3 A;  3FF6 A;  2X24 A;  3PZK A;  2VSU C;  3MYB A;  2FZS A;  3I47 A;  1OD4 A;  2PBP A;  2PG8 A;  2DUB A;  4FB8 A;  3PEA A;  3R9T A;  3IBB A;  3BEZ A;  2A7K A;  5E0N X;  2VSU A;  5INF A;  5JBW A;  1N6E A;  2UZF A;  1MJ3 A;  4OMR A;  3ISA A;  4IZD A;  1FC6 A;  3TT6 A;  1VRG A;  4MOU A;  3QYR A;  1J7X A;  1EY3 A;  4JJT A;  3VIV A;  3T88 A;  4Q0G A;  3QXI A;  4JYJ A;  1WZ8 A;  1XNV A;  2F9I B;  1XNY A;  4JWV A;  4B3I A;  5CTB A;  3P5M A;  2ZQQ A;  3GMA A;  4JCT A;  1UYS A;  3QK8 A;  3ZWA A;  4U0H A;  2ZL0 A;  2Q35 A;  3Q7H A;  3U9T B;  1UYV A;  3R9Q A;  3M6N A;  3Q0J A;  3T8A A;  4NNQ A;  4ZU2 A;  5ING A;  3RRV A;  4WYO B;  1YG6 A;  1XNW A;  3P2L A;  4HNK A;  3LKE A;  4RYF A;  1HZD A;  1ON3 A;  2J5I A;  3QXZ A;  3QWD A;  4U18 A;  3V5E A;  1TG6 A;  4YLH A;  3KQF A;  4ELX A;  1DUB A;  1NZY A;  3KTI A;  4Z0M A;  1K32 A;  4KD6 A;  3NJD A;  2EJ5 A;  4ASI A;  3PE8 A;  3GLM A;  4FN8 A;  3DJA A;  2X58 A;  3H0U A;  1SZO A;  2GTR A;  3QKA A;  4L6W A;  4MI2 A;  3TT7 A;  5DTW A;  1EF8 A;  5E0S H;  2Q2X A;  4LK5 A;  4QII A;  3ZW9 A;  3H02 A;  1Y7O A;  1JXZ A;  3HRX A;  3H81 A;  2NP9 A;  2VSS A;  2VX2 A;  2J5G A;  2C8T A;  3RSI A;  4GM2 A;  3T3W A;  4FNB A;  2BZR A;  4I4Z A;  1K39 A;  4I42 A;  2HW5 A;  1SG4 A;  1PIX A;  3JU1 A;  4WCZ A;  2CBY A;  1FC9 A;  3M6M A;  3T89 A;  3Q0G A;  3T8B A;  3ST9 A;  3ZWC A;  2ZL3 A;  1WDK A;  4DI1 A;  3N6R B;  4QFE A;  5E0S A;  2F9Y A;  5DU8 A;  3K8X A;  1XO6 A;  3OME A;  3R0O A;  3OT6 A;  3TDC A;  4OG1 A;  3TRR A;  4JCR A;  5DL1 A;  2VSU E;  4NEK A;  5DU4 A;  1N6D A;  3H0Q A;  1TYF A;  3P85 A;  4GHN A;  2Q34 A;  5DU6 A;  4JCS A;  2D3T A;  1UIY A;  4B3H A;  4ZDF A;  4KNP A;  2W3P A;  2ZL4 A;  3QMJ A;  4K29 A;  1FC7 A;  3GF3 A;  3MT6 A;  4JVT A;  4B3J A;  1WDL A;  3ZWB A;  5DZK H;  4FZW C;  1PJH A;  5C90 A;  1Q52 A;  2DEO A;  3WG5 A;  4U0G H;  4JSB A;  1DCI A;  1RJM A;  2J5G D;  1NZY B;  3HIN A;  3L3S A;  3TLF A;  3NJB A;  5DUC A;  4KWB A;  3LAO A;  1FCF A;  4RCN A;  3ZW8 A;  2ZL2 A;  4ZDB A;  4Q1I A;  3TV5 A;  3R9S A;  2VRE A;  2J5I I;  3OC7 A;  4ZDC A;  4K2N A;  4OLQ A;  5DUF A;  1WDM A;  3BF0 A;  4JFC A;  2F6I A;  3K50 A;  4EML A;  5KDR A;  3HE2 A;  4I52 A;  2PPY A;  1Q51 A;  2F6Q A;  5INI A;  3MOY A;  3Q1T A;  4JCQ A;  5JBX A;  1RJN A;  2QQ3 A;  5KDR B;  3G64 A;  3MFM A;  5CTC A;  3U9R B;  4HC8 A;  4RYF H;  5FUS A;  5G1S A;  1EF9 A;  3BPP A;  3QRE A;  4U1A A;  4F47 A;  1UYT A;  1HNU A;  2VSS E;  4IZB A;  4ZDD A;  4ELS A;  4QIJ A;  4EMP A;  2FW2 A;  5DKP A;  5IKL B;  3KTK A;  3KTJ A;  3GKB A;  3KTG A;  3SWX A;  3STA A;  5DZK A;  4K3W A;  4KPK A;  1N6F A;  2F9Y B;  4FJW D;  3HLN 1;  1X0U A;  4L8K A;  1UYR A;  1W2X A;  5G1Q A;  3V5I A;  5DTP A;  3H0S A;  4EMM A;  3FDU A;  5FIF A;  4FZW A;  3HP0 A;  2A7S A;  3SLL A;  5KJP A;  2VSU F;  1HNO A;  3TVW A;  3PGQ A;  3U9S B;  4JYL A;  3TVU A;  3KTH A;  3RST A;  3DOR A;  3IAV A;  2J5I B;  3H0J A;  2FBM A;  2ZQR A;  1XX4 A;  3R6H A;  4IZC A;  2J5S A;  5C9G A;  2IEX A;  1ON9 A;  4G2R A;  2A81 A;  5G1R A;  2WTB A;  3GF7 A;  4WZ8 B;  1OD2 A;  4FN7 A;  4U0G A;  4ZDE A;  4U19 A;  4ELW A;  2VSS F;  3TZ3 A;  2F9I A;  4JOT A;  4MXI A;  4FND A;  3IB9 A;  1YG8 A;  5MGB A; 
#chains in the Genus database with same CATH topology
 2WSE H;  3FF6 A;  2ZT9 D;  2WPS A;  2QM8 A;  1M8O B;  1DEE G;  3MYB A;  1OW6 A;  2M5A B;  1OD4 A;  1HJB A;  4K3A A;  3EWK A;  1E5W A;  3Q5R A;  2DUB A;  1WT6 A;  3H1I J;  3II6 A;  5APY A;  3CLQ A;  1KQS O;  1DD3 A;  1CW5 A;  1IJD B;  1H88 A;  1LWU C;  2A7K A;  2OQQ A;  1BGY E;  4NPE A;  4KT0 J;  4NAR A;  1RF1 A;  2WZ7 A;  2BCC G;  1JY2 P;  3M06 A;  1OMI A;  3G71 P;  2N9B A;  3HE4 B;  1NTZ E;  1N6E A;  2N1T B;  2J5U A;  3BRV B;  1NYH A;  3EFG A;  1RQV A;  4TT3 H;  2FFD B;  1EZV E;  1FC6 A;  1VRG A;  1LWU A;  2KYV A;  1KV4 A;  1T3U A;  1SQV K;  4R4M A;  1JTH A;  2KOG A;  2IBZ G;  3W67 A;  1VF5 C;  1GZL A;  4Q0G A;  1VQM P;  3QXI A;  2Z4E A;  4JYJ A;  4JWV A;  3LW5 J;  1GL2 D;  1YJN P;  3H1K E;  2BCC D;  1IO4 A;  3MHV A;  3AEG C;  1EDI A;  3CXH I;  3HUS B;  3CCL P;  2WSE J;  1JEK A;  3PLN A;  4U3F D;  2ZQQ A;  2ZT9 C;  1UYS A;  1Y47 A;  1FZG A;  3QK8 A;  2Z5H A;  4XA4 A;  3ZWA A;  2LXC B;  1R8E A;  3Q7H A;  3Q0J A;  1EZV D;  4J2U A;  1NU1 K;  4GOF A;  1GW4 A;  5ING A;  2PGD A;  5TJH A;  1YTZ I;  1AJY A;  4C46 A;  4YTP C;  5AW0 B;  5CCH A;  1QX8 A;  2HG5 D;  2A45 I;  1N86 A;  2FYU D;  5AW5 B;  4RYF A;  5GTI E;  1ON3 A;  4CPG A;  2R32 A;  1KYO D;  1ZR4 A;  1R5L A;  3SWK A;  2YKO A;  4I6M C;  3MD0 A;  3V6I A;  3QWD A;  1K05 A;  4DOJ A;  5CJ4 A;  2XND H;  3AE9 C;  1U57 A;  1X79 B;  3L72 E;  2H7H A;  3OAK A;  3MGN A;  1BCC G;  1LTJ B;  1K32 A;  4KD6 A;  4ASI A;  1USD A;  5AW6 B;  4GDO A;  2FXM A;  1SZO A;  2GTR A;  3TT7 A;  1IFI A;  1DEB A;  1TU3 F;  2O1J A;  2Q2X A;  4LK5 A;  2V7Q H;  3H02 A;  1Y7O A;  2VSS A;  2FYU E;  2C8T A;  2Q7C A;  2K3R A;  1IFP A;  4GM2 A;  5CCG D;  3T3W A;  2KXP B;  2BZR A;  4RO0 A;  1KIL C;  2YJG A;  2WSS H;  3AEE C;  4I42 A;  1SQP K;  2HW5 A;  3PP5 A;  2QJP B;  1PIX A;  1LWU B;  3QWO C;  4K35 A;  5CCH C;  1BCC D;  4IFF A;  2P2U A;  3H1L G;  3M6M A;  1NTZ D;  3CWB E;  3H1J D;  3AEB C;  4DI1 A;  3RK3 D;  5E0S A;  2F9Y A;  5DU8 A;  4ZKU A;  4LC1 A;  4BXL A;  4H0L B;  1S5L H;  1YI2 P;  3CCR P;  3D71 A;  1JOC A;  3A0H H;  2M3E A;  5BVZ A;  3TDC A;  3H1H D;  3AE3 C;  5DL1 A;  1GW3 A;  1N6D A;  5CHX A;  5KLV K;  3HRN A;  5CBN A;  3P85 A;  4GHN A;  5KLI C;  1FBM A;  1XTC C;  2BCC E;  4WY4 C;  2HLO A;  2FFD A;  1X0T A;  2IYP A;  1NTZ G;  3G6E P;  1SQV G;  1QEX A;  3KPE A;  3AE5 C;  3FX0 A;  5H2F H;  2W3P A;  3C9I A;  2IFN A;  4PD4 D;  2J58 A;  3RK3 B;  1N7S A;  2QSI A;  1XTG B;  3A5T A;  1MUU A;  2WTY A;  1VQ8 P;  2FXP A;  1HJ0 A;  1LTS C;  2KS1 A;  4HJG H;  1LT9 A;  3WUV A;  5DZK H;  4HB1 A;  1NHL A;  1PPJ G;  1Q52 A;  1N7S B;  2JKV A;  3ZDM A;  1J2J B;  5CCG A;  1VL2 A;  1L0N D;  2WSC H;  2QIW A;  1SQQ K;  4JSB A;  1DCI A;  2AXT H;  1P84 H;  1RJM A;  1NU1 G;  1PFI A;  1BE3 D;  3TLF A;  4KWB A;  1MZ9 A;  3ZW8 A;  2Q3I A;  3R9S A;  2C0X A;  1L4A D;  3I55 P;  2BEZ F;  3VYI A;  3B5N D;  4D6T D;  4ZDC A;  1SQX G;  3RK2 B;  5GTH H;  5B66 H;  2AXT E;  3V4Q A;  2F6I A;  3BCC E;  3CXH E;  1VPC A;  4I52 A;  1PGQ A;  3Q1T A;  2JWD A;  4JCQ A;  5JBX A;  3T97 B;  4C7R A;  1KB9 E;  5KDR B;  4OGQ C;  2ZFC A;  2M0B A;  4BWN A;  3U9R B;  4HC8 A;  4RYF H;  2OYI C;  1EF9 A;  3JC2 2;  3SFD C;  1FDI A;  4U7J A;  2B87 A;  1VDF A;  1HNU A;  2VSS E;  1FZC C;  3CI9 A;  2KSE A;  1P84 E;  3N7N A;  4D6T E;  5APQ A;  4QIJ A;  5AW2 B;  5AVU B;  3A0B E;  1M1J C;  3VTP C;  3KTK A;  2WSC J;  1FDM A;  5KLV E;  3GKB A;  2ZYG A;  1M7L A;  2YIU B;  1LTG C;  4B86 A;  4ZNC A;  4K3W A;  1Q81 Q;  2CPB A;  2QJY B;  4L73 A;  3TYY A;  1T6A A;  2E76 B;  1AQT A;  2F9Y B;  2FYU J;  1HBW A;  4FJW D;  2P7J A;  3VOP A;  3M0D C;  4U3F G;  1W2X A;  1OW8 A;  5DTP A;  4UB8 H;  2E5Y A;  3H1L J;  1GU4 A;  3CWB D;  2WPQ A;  5H2F E;  3FDU A;  5FIF A;  4UB8 E;  4FZW A;  3HP0 A;  1L0L E;  2A7S A;  1KIL E;  2H43 A;  3VMZ A;  2VSU F;  2IPP A;  5APX A;  1SQB J;  3PGQ A;  3U9S B;  3TGU D;  1ZOY C;  3TVU A;  3RL0 B;  4DZO A;  1WMK A;  2JJL A;  2FBM A;  1LP1 B;  3VMY A;  3H1I D;  2J5S A;  1KMI Z;  5CCH D;  4G2R A;  3AE1 C;  4EDF A;  4IL6 E;  4WY4 B;  1LT9 B;  1BGY G;  4WB4 A;  3CWB G;  4ZDE A;  1PL5 A;  2FYN C;  2A06 E;  1PV3 A;  1YQ3 C;  2F9I A;  1JB0 J;  3IB9 A;  5MGB A;  1O8U A;  5APT A;  2E75 B;  2CE3 A;  2YMY A;  3BAT A;  3PZK A;  4RJT A;  1JMB A;  1S3J A;  3H32 A;  2XV5 A;  2FYN B;  2PG8 A;  1HGV A;  2R5B A;  1JY2 O;  3A0B H;  3R9T A;  1W2B O;  3IBB A;  3BEZ A;  2VSU A;  5INF A;  3CC2 P;  1NU1 J;  3CCU P;  3RL0 D;  4U3F J;  5CBO A;  2UZF A;  4IOI H;  4XE5 B;  2P1J A;  3B5N A;  2POH A;  4IL6 H;  3TT6 A;  3A2A A;  3L74 G;  1USE A;  2KZI A;  3CPW O;  4JJT A;  1SQX J;  3T88 A;  3L74 D;  1SQB D;  4M3L A;  2P67 A;  2F9I B;  1XNY A;  1Q86 Q;  3M0D A;  1JCC A;  2ZXX A;  2C0W A;  1NAF A;  2KLV A;  1KB9 D;  3IAO A;  2ZT9 B;  2JDI H;  1RE4 C;  2VRS A;  2HOD A;  2M5A A;  3H32 B;  1KOR A;  1L4A C;  4JCT A;  1EC5 A;  1HF9 A;  1NTM D;  4U0H A;  1EZV I;  2B89 A;  3F5H A;  2HOD B;  1GK4 A;  4ZU2 A;  2QJY C;  1N2D C;  3L75 J;  2RN0 A;  2LXB A;  3O8Z A;  1VQ9 P;  3IR9 A;  5KTB A;  1OVU A;  4OGQ D;  2E76 C;  1KB9 I;  3H1L D;  3SWY A;  1QVG O;  2J5I A;  2OYO A;  2IBZ I;  1L0N G;  1KQF B;  4MN4 C;  2O01 H;  1TG6 A;  1T2K C;  2Y0C A;  1U7J A;  1JCD A;  1SQP D;  3KQF A;  3VMA A;  1N73 A;  3D6Y A;  4ELX A;  4ASV A;  5B5E H;  1JY3 O;  2AXC A;  4Z0M A;  2ITA A;  3LW5 H;  2EJ5 A;  4PD4 H;  3PE8 A;  1QLE D;  2O01 J;  2A45 H;  4LGD E;  1S72 P;  3AED C;  1SQV D;  1AVY A;  3QKA A;  1EQ7 A;  2IBZ D;  4YPC A;  3MTU E;  3V5B A;  5DTW A;  1PGO A;  1EF8 A;  2QEX P;  5AW9 B;  5E0S H;  1P84 I;  3B5N C;  3CWB J;  3FWN A;  3ITK A;  3L70 E;  1JXZ A;  5KAF H;  3H81 A;  1JMM A;  4JYC A;  3P8C E;  2J5G A;  1AV1 A;  3MUD C;  1SQX D;  5KLV J;  2QJK B;  2WWW A;  1EXI A;  4HYT B;  5DJU B;  2AEM A;  3G4S P;  5E79 H;  1HWT C;  4D6T J;  4I4Z A;  4N3Y B;  1K39 A;  3M9Q A;  3S4R A;  1T3J A;  3CX5 D;  1NU1 D;  3AEA C;  3KZI E;  4JYB A;  2FKW B;  1Y9B A;  4DCK A;  3P8M C;  5AVX B;  3JU1 A;  1A02 J;  2KS1 B;  1LTB C;  1NO4 A;  2MKV A;  1PP9 G;  1IFJ A;  3B4S A;  1SQQ E;  1FC9 A;  2YIU C;  3ABV C;  3ZWC A;  5KJ7 A;  1URQ B;  4JBZ A;  1LTI C;  2IZ1 A;  3K8X A;  3L74 J;  3AE7 C;  3OME A;  1URQ C;  1NGM B;  2H88 C;  1N7L A;  2ZJS E;  3JCU H;  1S1C X;  1FDO A;  1QL1 A;  3MP7 B;  3CX5 I;  3D6Z A;  1YJW P;  2E42 A;  2VSU E;  5DJT B;  1YJ9 P;  1RE3 A;  3BAS A;  3H0Q A;  2WIT A;  2Q34 A;  4JCS A;  2Y0E A;  1GK6 A;  2D3T A;  3KQG A;  5AVZ B;  3VP9 A;  3Q5P A;  2FXO A;  3Q2Y A;  5AW4 B;  5APV A;  3QMJ A;  4K29 A;  1N8R Q;  1KN7 A;  3CCV P;  1FU1 A;  4JVT A;  5L8R J;  1S9K D;  1RF1 B;  2QA4 P;  1WDL A;  3ZWB A;  2NZ2 A;  1S5L X;  2QJP C;  1OVR A;  3L74 E;  4PD4 E;  3BCC G;  3GHG A;  1L0L J;  3CXH H;  5E79 E;  3R4Y A;  1W2E A;  4U0G H;  1BDD A;  1EDJ A;  2Y9Z A;  2WPV B;  4DT0 A;  3H1K G;  1NZY B;  4HKZ H;  4H13 C;  3CME P;  3NJB A;  5DUC A;  3LAO A;  2OYH B;  1OWA A;  5BU8 B;  2ZL2 A;  3GHG C;  1BCC J;  1LTJ C;  1G2C B;  5APW A;  3RGU A;  3TGU G;  1YTZ T;  2J5I I;  5TIS E;  1ZR2 A;  3L72 J;  1QL2 A;  1SLQ A;  4L75 A;  3KXD A;  1IC2 A;  5DUF A;  2K9J B;  1NTZ K;  4JFC A;  1FOS E;  1NTK E;  4EML A;  2OYI A;  2Y9Y A;  1VQK P;  4GIF A;  2PPY A;  3RL0 C;  3FXD A;  5B5E E;  1JM0 A;  4W7Z A;  4W80 A;  2QQ3 A;  1JTH B;  3G64 A;  5CTC A;  2FYZ A;  5FUS A;  3RK2 D;  4L74 A;  4GT1 A;  3H1I G;  1VQL P;  1K8A Q;  1VQ5 P;  4IZB A;  5GTI H;  2BEQ D;  1J1E C;  3H1K D;  3HE5 A;  1BSN A;  2J59 M;  4EMP A;  2FW2 A;  1YIT P;  5IKL B;  2KB7 P;  3R2P A;  3KTG A;  4DJG A;  1URQ A;  2XNX A;  3HE5 B;  1GL2 B;  4KPK A;  3KDP B;  1N6F A;  2M8R A;  1ZME C;  1X0U A;  3V2R A;  4GOE A;  2KSJ A;  3V5I A;  3H0S A;  2LR2 A;  4EMM A;  4EI2 A;  1HUC A;  2HYN A;  3H1J E;  3TGU J;  4A7P A;  1HNO A;  1FZB A;  1MV8 A;  3L73 G;  3KTH A;  3BRT B;  5KLI B;  3IAV A;  1NKN A;  3P8C D;  1FJK A;  1M90 Q;  3R6H A;  1KIL D;  2WMM A;  3CMA P;  5C9G A;  1PPJ E;  1SFC A;  1PZQ A;  5G1R A;  2WTB A;  2KNC A;  3GF7 A;  4WZ8 B;  3G3Z A;  1NJI Q;  4FN7 A;  4O9B A;  2E74 C;  1FZA A;  4IFD K;  1KTM A;  3AE4 C;  1L2P A;  2JEE A;  2HFE D;  3SWF A;  4JOT A;  3HUS C;  4MXI A;  3M9B A;  3HD7 C;  2V7Q J;  2N1T D;  2VSU C;  2D2C D;  2AEJ A;  1FZC A;  1LTT C;  2PBP A;  3HTK A;  3BCC J;  1N7S C;  1H89 A;  3PEA A;  1J1E B;  1AQ5 A;  2R44 A;  1SQP G;  5E0N X;  3L35 A;  2RMZ A;  5JBW A;  4NPD A;  4OMR A;  3ISA A;  3CD6 P;  1KFM A;  3LIE A;  3GG2 A;  4IZD A;  4IL6 X;  2FBW C;  1Q90 D;  2H89 C;  3O6Q B;  1JNM A;  3QYR A;  4MOU A;  3T97 A;  1J7X A;  1SP4 A;  3HE4 A;  3VIV A;  1LT1 A;  3L73 D;  2YMK A;  1AVO A;  4H13 D;  2W6B A;  4B3I A;  3P5M A;  2XDJ A;  4OWF A;  2PP6 A;  5KAF E;  2OGU A;  2G3A A;  2OTL P;  3E1R A;  3BVH A;  4C7N B;  4WY4 D;  3K5B A;  2ZL0 A;  2Q35 A;  1GMJ A;  4WVZ A;  2C9N Y;  3HUS A;  2JR8 A;  1ZW0 A;  2QRX A;  3HD7 A;  1X22 A;  3CCS P;  1YG6 A;  2O1K A;  2GM4 A;  3L73 E;  2WT7 A;  3CX5 E;  3IFM A;  4JQ0 D;  3P2L A;  1E79 H;  4PJ0 H;  3LKE A;  2OTK E;  2Q6Q A;  1MFT A;  1SQX K;  1H8A A;  1BSH A;  4Z1M H;  3RL0 g;  1SFC C;  3QXZ A;  2IFM A;  1K04 A;  2AEF A;  3V5E A;  1IFM A;  3H6P A;  1RH5 B;  1GDT A;  3M0A A;  2W27 A;  2K88 A;  3JSV C;  1NZY A;  3KTI A;  1KD1 Q;  3NJD A;  1DD4 A;  3AE2 C;  3C1L A;  5APU A;  1RHZ B;  2IYO A;  3GLM A;  3PTZ A;  3WU2 E;  3DJA A;  4ZKP A;  2Q5U A;  2X58 A;  1OXZ A;  3H0U A;  1BE3 E;  3V2N A;  1FS0 E;  4Y99 B;  4L6W A;  2IDB A;  2K9J A;  3L75 G;  1PP9 D;  3HRX A;  1L4A B;  3CXH D;  2NP9 A;  2RKL A;  2YXQ B;  4OGQ B;  1KIL B;  1IK9 A;  1NTK G;  3RSI A;  2WVR A;  2IZ0 A;  3H1K J;  2E75 C;  3BCC D;  2I8D A;  1JUN A;  2FY8 A;  3L37 A;  3KYQ A;  4WWI A;  2G8Y A;  2N1T A;  1LNQ A;  3D70 A;  1SG4 A;  4H44 C;  2QG4 A;  1HVV A;  3O6Q A;  2YNY A;  3L4F A;  3L70 J;  4WCZ A;  4EIJ A;  3Q5S A;  2CBY A;  2NPS A;  1AA0 A;  1N73 C;  1YBK A;  1KYO I;  3Q0G A;  3GHG B;  1SFC B;  2FYU K;  2ZL3 A;  5AVW B;  3TSI A;  1WDK A;  1KZU B;  1L0N K;  1S2E A;  1EDL A;  2W6A A;  2GA1 A;  2Y0D A;  3R0O A;  3JCU E;  4BRY A;  1NAY A;  4WBA A;  1VQP P;  1DH3 A;  3A0H E;  1H0T A;  5DU4 A;  2XZR A;  1IFN A;  1NH4 A;  5KLV G;  1TYF A;  5DU6 A;  3W68 A;  1SQB E;  5GTH E;  4B3H A;  3H25 A;  2H8P D;  1KYO E;  4LLH A;  1VQ6 P;  2W6J H;  2W8Z A;  1RQU A;  2ZL4 A;  1FC7 A;  1M1J B;  3GF3 A;  2HPC B;  2QJK C;  1VF5 D;  2NRG A;  2CK3 H;  1ZRT E;  1L0L K;  5C90 A;  1RF1 C;  3CX5 H;  2YKP A;  2B88 A;  1L0N J;  1YIJ P;  3A7O A;  1BGY D;  1RF0 C;  4H0L C;  1NTM G;  4RKU J;  3CC4 P;  4JPZ B;  1QVF O;  1SQB G;  1HGZ A;  3HIN A;  3L70 G;  3HD7 D;  3L71 E;  4BRY B;  3Q1M A;  4RCN A;  1DX7 A;  4ZDB A;  2JWA A;  2R5D A;  1JO5 A;  1ZXG A;  1ZLL A;  3I5C A;  2W83 C;  2KUB A;  4K2N A;  4OLQ A;  2N9Y B;  5AVS B;  1M56 D;  1WDM A;  3BF0 A;  1ZRT D;  3AE8 C;  3TDK A;  3V2Q A;  3L75 D;  1Q51 A;  1G1I A;  1ZV8 A;  3V2P A;  3TK1 A;  1M57 D;  1S5L E;  3PH0 A;  5KKZ C;  1RJN A;  3RBZ A;  1NTK D;  5KJ7 C;  1GTW A;  1VQ7 P;  3BPP A;  1K73 Q;  2P10 A;  4U1A A;  3MIW A;  2Q1K A;  3L72 G;  4Y28 J;  3IN6 A;  3H1J G;  4PD4 I;  4ELS A;  1SQX E;  4I2L C;  3P7K A;  3PJS K;  1CI6 B;  4I7Z C;  2QM7 A;  1FOS F;  3KTJ A;  3U1C A;  3Q3D A;  3SWX A;  5DZK A;  1MFZ A;  4I7Z B;  2KLU A;  3FXE A;  1ZP0 C;  1OZH A;  4ASW A;  5G1Q A;  5BU5 A;  4UB6 E;  1WRG A;  3RBX A;  5KJP A;  4W7Y A;  4JYL A;  2J5I B;  2L5G B;  3AEF C;  2OYH C;  3FWL A;  1XX4 A;  4IZC A;  5AVV B;  1SFC D;  5KJ7 D;  3B5N B;  1PGP A;  1LGH B;  1ON9 A;  2A81 A;  2M3B A;  2ZYD A;  1EXJ A;  1NOH A;  1Q2N A;  1OD2 A;  1CI6 A;  4PV1 B;  5KAI E;  4ELW A;  1X9V A;  4QMA A;  3TZ3 A;  3RK3 C;  3MZW B;  1PPJ D;  4FND A;  1L0L G;  4N78 D;  2OAR A;  5C39 A;  1W5C E;  2X24 A;  2QVA A;  2R3C A;  1LT9 C;  2Z5I A;  4RES B;  3CCJ P;  4PJ0 E;  2FZS A;  1YHQ P;  3I47 A;  2WQY C;  5HUQ A;  2A06 D;  4FB8 A;  3H1H J;  5CMZ A;  1D7M A;  1QGK B;  2ZVN B;  1FE6 A;  3NTN A;  3AE6 C;  3AEC C;  2JP3 A;  4OVN F;  3L71 D;  3V4W A;  2E76 D;  1UII A;  1LTA C;  1MJ3 A;  1YQ4 C;  4KHX A;  2OTJ P;  2DW3 A;  3VP8 A;  2K9Y A;  2GUV A;  1EDK A;  1EY3 A;  3H1H E;  1FZE A;  2KI7 B;  1RY3 A;  4H0L D;  1IFD A;  1WZ8 A;  1XNV A;  1VF5 B;  2GUS A;  3G9R A;  3TNU B;  1NTM E;  1P84 D;  1CSB A;  4Y99 C;  3L71 G;  5CTB A;  5AVT B;  2D2C B;  1SVF A;  1HH0 A;  2R3S A;  2WSF H;  1FZC B;  3B8E B;  1PP9 E;  4AUW A;  3GMA A;  2E43 A;  1KYO H;  1EZV G;  3U9T B;  1UYV A;  2Q3E A;  2YO3 A;  3H1J J;  3L36 A;  3TGU E;  3M6N A;  3R9Q A;  4L76 A;  3T8A A;  4NNQ A;  3MUD A;  1IZN B;  2O3J A;  2B9B A;  2O01 N;  3RRV A;  4WYO B;  2LKM A;  5AW7 B;  3OW2 O;  1XNW A;  4H13 B;  1KIL A;  2ZAE B;  1YYC A;  4HNK A;  4JF7 A;  1HZD A;  1Q7Y Q;  3CC7 P;  1DIP A;  1NWQ A;  1BE3 J;  2YO2 A;  2HR3 A;  4ZMD A;  2WT7 B;  3H1I E;  3VN0 A;  4U18 A;  4GOD A;  1S9K E;  3TNU A;  4YLH A;  3BPT A;  3RK2 C;  3P32 A;  3KHU A;  5APS A;  4EYY Q;  2ZYA A;  1DUB A;  2NPS B;  3NMD A;  3USS A;  2I1K A;  2B87 B;  2Q9I A;  3QH9 A;  1CZQ A;  1Y8A A;  2NPS D;  1OVV A;  4C7N A;  2N1T C;  3GW6 A;  2V4H A;  3CCM P;  5B66 E;  1JY3 P;  1URQ D;  4FN8 A;  4PV1 C;  4YXD C;  1SQP E;  2D2C C;  3M91 A;  2UWJ E;  4MI2 A;  2JO1 A;  4QII A;  3ZW9 A;  2PFX A;  2KIK A;  3S1K A;  3NFQ A;  3HTK B;  4U3F E;  1GL2 A;  1NVO A;  2VX2 A;  1SQQ J;  4N78 E;  2IBZ E;  1OIP A;  3M9H A;  4YXW H;  1AFO A;  4FNB A;  2BAS A;  1SQP J;  1FZF A;  2PAJ A;  1BCC E;  1GD2 E;  1NTM K;  4HDT A;  3WU2 H;  5AVQ B;  5AW1 B;  4NPF X;  3H1H G;  2I1J A;  3WUT A;  4OH8 B;  2HPC A;  1FC2 C;  3RK3 E;  1OFC X;  1NTZ J;  1SQV J;  3T89 A;  3T8B A;  3ST9 A;  4UB6 H;  1LJ2 A;  1PGJ A;  2A06 G;  3S9O A;  1K9M Q;  3N6R B;  4QFE A;  3WUU A;  1XO6 A;  4PV1 D;  1FAV A;  3OT6 A;  2OYH A;  4OG1 A;  1UIX A;  3TRR A;  4JCR A;  4NEK A;  1J1D C;  2ZXE B;  2E74 B;  3CL3 D;  5M1B A;  1M1J A;  1N7S D;  2K37 A;  5KKZ B;  1SS1 A;  1UIY A;  2P58 A;  3L71 J;  4ZDF A;  1T8Z A;  4HH2 A;  4KNP A;  3H1L E;  4AQR D;  2OYI B;  2K1A A;  1Z56 A;  1IK7 A;  3OA7 A;  1X8Y A;  2WPR A;  1KQG B;  3MT6 A;  1L0N E;  3F89 A;  4B3J A;  2E74 D;  4WY4 A;  3KZI H;  3WMM 0;  2KNC B;  3C8V A;  4FZW C;  2YKQ A;  1PJH A;  3L73 J;  4H44 B;  5AVR B;  2MJZ A;  1NTK K;  2DEO A;  3WG5 A;  1G2C A;  1MKM A;  1T2K D;  2J5G D;  1GL2 C;  2BCC J;  1SQV E;  1ZN5 A;  3L3S A;  3SFE C;  1A02 F;  1FCF A;  1BE3 G;  1JY3 N;  3L70 D;  3VMX A;  2E5T A;  5AW3 B;  4Q1I A;  3U59 A;  5KLV D;  1KC8 Q;  2PRR A;  3TV5 A;  3UIA A;  3SSU A;  2NPS C;  2VRE A;  2KP8 A;  3OC7 A;  2IX7 C;  4N6J A;  4D6T G;  2FYU G;  4AYC A;  3K50 A;  5KDR A;  1VQO P;  1Q82 Q;  1L4A A;  3HE2 A;  1HTL C;  5CCG C;  2F6Q A;  5INI A;  3MOY A;  3EQ2 A;  1NTK J;  4GKG A;  1PP9 J;  3HD7 B;  5TIS H;  1NU1 E;  1VQ4 P;  3MFM A;  3E1I A;  4KJM A;  1M1K Q;  4H44 D;  1J1D B;  1KQL A;  5G1S A;  3QRE A;  2ZVO B;  1JY2 N;  3A3Y B;  1KB9 H;  4F47 A;  1SQQ D;  1UYT A;  2W90 A;  1NTM J;  2XKM A;  3TF5 A;  1SQQ G;  4ZDD A;  2L91 A;  2YXR B;  3CCE P;  3L72 D;  1BDC A;  1VQN P;  1GU5 A;  5EFW B;  3B71 A;  4IFM A;  2KZJ A;  5DKP A;  3E7K A;  3NXS A;  3FGA D;  4TLF A;  3STA A;  1N73 B;  3U1A A;  4XFJ A;  2XU6 A;  1S4X A;  1L0L D;  2WSF J;  3HLN 1;  1LTJ A;  2KK7 A;  5K5G B;  4L8K A;  4I1L A;  1BGY J;  1UYR A;  3PRJ A;  5AW8 B;  3L75 E;  1H0T B;  2SPZ A;  1U7M A;  1SQB K;  1LP1 A;  4R4L A;  1RE4 A;  5KAI H;  3SLL A;  2QE7 H;  4EOT A;  3TVW A;  1G1J A;  3RST A;  3DOR A;  3H0J A;  1FJP A;  2E75 D;  3OJA B;  2ZQR A;  2CPS A;  3I56 P;  3CCQ P;  1OX3 A;  2A45 G;  2IEX A;  1KFN A;  5CJ0 A;  3N4X A;  5AVY B;  1R5S A;  3LID A;  2FFD C;  4U0G A;  4U19 A;  2C9L Y;  1NKZ B;  1RF0 A;  3IF4 A;  2VSS F;  3EFF K;  1RE3 C;  3PHL A;  1OW7 A;  2RH0 A;  1YG8 A; 
#chains in the Genus database with same CATH homology
 1O8U A;  2E75 B;  2V7Q J;  2CE3 A;  3FF6 A;  2X24 A;  3PZK A;  2ZT9 D;  2VSU C;  2D2C D;  3MYB A;  1OW6 A;  2FZS A;  3I47 A;  2WQY C;  1OD4 A;  2PBP A;  5HUQ A;  3EWK A;  2PG8 A;  3Q5R A;  2DUB A;  4FB8 A;  3PEA A;  1DD3 A;  3R9T A;  3IBB A;  3BEZ A;  2A7K A;  2OQQ A;  5E0N X;  2VSU A;  3AE6 C;  5INF A;  3AEC C;  2JP3 A;  4KT0 J;  4NAR A;  5JBW A;  1OMI A;  2E76 D;  1N6E A;  2UZF A;  1MJ3 A;  2J5U A;  1YQ4 C;  4OMR A;  3ISA A;  1NYH A;  1RQV A;  2K9Y A;  4TT3 H;  4IZD A;  4IL6 X;  2FBW C;  1FC6 A;  3TT6 A;  1Q90 D;  1VRG A;  2H89 C;  4MOU A;  3QYR A;  1J7X A;  1EY3 A;  4JJT A;  3VIV A;  4R4M A;  3T88 A;  1VF5 C;  4Q0G A;  3QXI A;  4JYJ A;  4H0L D;  1WZ8 A;  1XNV A;  2F9I B;  1VF5 B;  3G9R A;  1XNY A;  4JWV A;  3LW5 J;  2YMK A;  4H13 D;  4B3I A;  5CTB A;  2D2C B;  3AEG C;  3P5M A;  3IAO A;  2ZT9 B;  2WSE J;  2G3A A;  2ZQQ A;  3GMA A;  1KOR A;  4JCT A;  2ZT9 C;  1UYS A;  3QK8 A;  1HF9 A;  3ZWA A;  4U0H A;  1R8E A;  2ZL0 A;  2Q35 A;  3Q7H A;  3U9T B;  1GMJ A;  1UYV A;  3R9Q A;  3M6N A;  3Q0J A;  4J2U A;  3T8A A;  4NNQ A;  4ZU2 A;  2QJY C;  5ING A;  3RRV A;  4WYO B;  1AJY A;  1YG6 A;  1XNW A;  4YTP C;  4H13 B;  3P2L A;  4HNK A;  4OGQ D;  3LKE A;  2E76 C;  4RYF A;  1HZD A;  1ON3 A;  1DIP A;  4Z1M H;  2J5I A;  3RL0 g;  3QXZ A;  1KQF B;  1K04 A;  3QWD A;  4U18 A;  3V5E A;  1TG6 A;  1K05 A;  4YLH A;  3AE9 C;  3BPT A;  3KQF A;  3D6Y A;  4ELX A;  1U57 A;  1DUB A;  1NZY A;  3KTI A;  4Z0M A;  1K32 A;  4KD6 A;  3NJD A;  1DD4 A;  3AE2 C;  2EJ5 A;  4ASI A;  3PE8 A;  3GLM A;  4GDO A;  2O01 J;  4FN8 A;  4PV1 C;  4YXD C;  3DJA A;  2D2C C;  2X58 A;  3H0U A;  3AED C;  1SZO A;  2GTR A;  3QKA A;  4L6W A;  4MI2 A;  3TT7 A;  2IDB A;  2JO1 A;  1TU3 F;  5DTW A;  1EF8 A;  5E0S H;  2Q2X A;  4LK5 A;  4QII A;  3ZW9 A;  3H02 A;  1Y7O A;  1JXZ A;  3HRX A;  3H81 A;  2NP9 A;  2VSS A;  2VX2 A;  2J5G A;  2C8T A;  4OGQ B;  3RSI A;  4GM2 A;  1EXI A;  3T3W A;  2E75 C;  4FNB A;  2BZR A;  4I4Z A;  2YJG A;  1K39 A;  2G8Y A;  4HDT A;  3AEE C;  4I42 A;  2HW5 A;  3D70 A;  1SG4 A;  3AEA C;  4H44 C;  1PIX A;  1Y9B A;  3JU1 A;  3O6Q A;  3RK3 E;  4WCZ A;  2MKV A;  3Q5S A;  2CBY A;  1FC9 A;  2YIU C;  3M6M A;  3T89 A;  3Q0G A;  3T8B A;  3ST9 A;  3ABV C;  3ZWC A;  2ZL3 A;  3AEB C;  1WDK A;  3S9O A;  4DI1 A;  3N6R B;  4QFE A;  5E0S A;  2F9Y A;  5DU8 A;  3K8X A;  1XO6 A;  4H0L B;  3AE7 C;  3OME A;  3D71 A;  3R0O A;  1NGM B;  2H88 C;  4PV1 D;  3OT6 A;  3TDC A;  3AE3 C;  4OG1 A;  1UIX A;  3TRR A;  4JCR A;  1S1C X;  1FDO A;  5DL1 A;  3D6Z A;  2VSU E;  4NEK A;  5DU4 A;  1N6D A;  3H0Q A;  2E74 B;  5M1B A;  1TYF A;  3P85 A;  4GHN A;  2Q34 A;  5DU6 A;  4JCS A;  5KLI C;  2D3T A;  1UIY A;  3Q5P A;  4B3H A;  3H25 A;  4ZDF A;  4KNP A;  3AE5 C;  2W3P A;  3Q2Y A;  1RQU A;  2ZL4 A;  1IK7 A;  3QMJ A;  4K29 A;  1FC7 A;  2QSI A;  1KQG B;  3GF3 A;  3MT6 A;  4JVT A;  2FXP A;  5L8R J;  1HJ0 A;  2QJK C;  1VF5 D;  2E74 D;  4B3J A;  1WDL A;  3ZWB A;  2NZ2 A;  1S5L X;  3C8V A;  1ZRT E;  5DZK H;  4FZW C;  1PJH A;  5C90 A;  2QJP C;  4H44 B;  1Q52 A;  3R4Y A;  2DEO A;  1VL2 A;  3WG5 A;  4U0G H;  2QIW A;  4H0L C;  4JSB A;  1DCI A;  1MKM A;  2WPV B;  4RKU J;  1RJM A;  2J5G D;  1NZY B;  3HIN A;  3L3S A;  3TLF A;  4H13 C;  3SFE C;  3NJB A;  5DUC A;  4KWB A;  3LAO A;  1FCF A;  3Q1M A;  4RCN A;  3ZW8 A;  2ZL2 A;  4ZDB A;  4Q1I A;  3TV5 A;  3R9S A;  2VRE A;  2J5I I;  3OC7 A;  2BEZ F;  4ZDC A;  4K2N A;  4OLQ A;  5DUF A;  1WDM A;  3BF0 A;  4JFC A;  3AE8 C;  2F6I A;  3K50 A;  4EML A;  5KDR A;  3HE2 A;  4I52 A;  2PPY A;  1Q51 A;  2F6Q A;  5INI A;  3MOY A;  3Q1T A;  4JCQ A;  5JBX A;  5KKZ C;  1RJN A;  3T97 B;  2QQ3 A;  5KDR B;  4OGQ C;  3G64 A;  3MFM A;  5CTC A;  3U9R B;  4HC8 A;  4H44 D;  4RYF H;  5FUS A;  5G1S A;  1EF9 A;  3BPP A;  3QRE A;  3SFD C;  2P10 A;  1FDI A;  4U7J A;  4U1A A;  4F47 A;  1UYT A;  4Y28 J;  1HNU A;  2VSS E;  3IN6 A;  4IZB A;  2BEQ D;  4ZDD A;  4ELS A;  4QIJ A;  3B71 A;  4EMP A;  4I7Z C;  2FW2 A;  5DKP A;  5IKL B;  3KTK A;  2WSC J;  3KTJ A;  3GKB A;  3FGA D;  3KTG A;  3Q3D A;  3SWX A;  3STA A;  5DZK A;  4XFJ A;  4K3W A;  4I7Z B;  2WSF J;  4KPK A;  2E76 B;  1N6F A;  2F9Y B;  4FJW D;  3HLN 1;  1ZP0 C;  1ZME C;  1X0U A;  4L8K A;  1UYR A;  1W2X A;  5G1Q A;  3V5I A;  1OW8 A;  5DTP A;  3H0S A;  4EMM A;  3FDU A;  5FIF A;  4R4L A;  4FZW A;  3HP0 A;  2A7S A;  1KIL E;  3SLL A;  5KJP A;  2VSU F;  1HNO A;  3TVW A;  3PGQ A;  3U9S B;  4JYL A;  1ZOY C;  3TVU A;  3KTH A;  3RST A;  3DOR A;  3IAV A;  2J5I B;  1WMK A;  3H0J A;  3AEF C;  2FBM A;  2E75 D;  2ZQR A;  1XX4 A;  3R6H A;  4IZC A;  2J5S A;  5C9G A;  1KMI Z;  2IEX A;  1ON9 A;  4G2R A;  3AE1 C;  2A81 A;  5G1R A;  2WTB A;  3GF7 A;  1EXJ A;  4WZ8 B;  1OD2 A;  4FN7 A;  4U0G A;  4ZDE A;  2E74 C;  1PL5 A;  4PV1 B;  1KTM A;  4U19 A;  4ELW A;  3AE4 C;  2FYN C;  2VSS F;  3TZ3 A;  1PV3 A;  1YQ3 C;  2F9I A;  1JB0 J;  4JOT A;  4MXI A;  4FND A;  3IB9 A;  1OW7 A;  1YG8 A;  5MGB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...