3GF7A

Glutaconyl-coa decarboxylase a subunit from clostridium symbiosum apoprotein
Total Genus 204
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
204
sequence length
585
structure length
543
Chain Sequence
MYSMPGYFQNMPTIGKELVNPNPENEQEIKAVESDIHESIKKALDAGITSEEKLNERGQLSAMQRINALIDPGTWCPLNSLFNPENNKFGTTNIVNGLGRVDGKWVYIVASDNKKMAGAWVPGQAENLIRCSDAAKMMHLPLIYLLNCSGVEFPNQDKVYPNRRGGGTPFFRNSELNQLGIPVIVGIYGTNPAGGGYHSISPTILIAHQDANMAVGKVPAPGSVPIHYDETGFFREVYQNDLGVIDGIKKYISYLPAYNLEFFRVDTPKAPQLPAEDLYSIIPMNQKRPYDIYEVIARLFDNSEFSEYKKGYGPEMVTGLAKVNGLLVGVIANVQGLLMNYPEYKQNSVGIGGKLYRQGLIKMNEFVTLCARDRIPLIWLQDTTGIDVGDEAEKAELLGLGQSLIYSIENSKLPSLEITIRKASAAAHYVLGGPQGNNTNVFSIGTGACEYYVMPGETAANAMYSRKLQPIIGKMNDMIQMYTDKSRPKYCTEKGMVDEIVDMTEVRPYIQAFTEAAYQNPQSICPMHQMLTPRSTREFETFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutaconyl-CoA decarboxylase subunit A
publication title An asymmetric model for Na+-translocating glutaconyl-CoA decarboxylases
pubmed doi rcsb
source organism Clostridium symbiosum
molecule tags Lyase
total genus 204
structure length 543
sequence length 585
ec nomenclature ec 4.1.1.70: Transferred entry: 7.2.4.5.
pdb deposition date 2009-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01039 Carboxyl_trans Carboxyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.680 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Helix bin 3gf7A01
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3gf7A02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3gf7A03
3P85A 1WDLA 5MGBA 4IZCA 2CBYA 3HLN1 2PG8A 3VIVA 4LK5A 2VSUF 2A7KA 4Q0GA 4DI1A 1UYSA 3OT6A 4WYOB 3H0QA 4ZDEA 4QIJA 4FN7A 3R9SA 4F47A 5C9GA 3LKEA 3ZWBA 1DCIA 2J5II 4FZWA 5IKLB 2F9YA 4B3JA 5DZKH 3FDUA 4MI2A 4GHNA 3MFMA 3QMJA 4U18A 2ZQRA 3KTIA 4JCSA 1O8UA 2F6QA 4G2RA 5JBWA 1HZDA 1XNWA 3TV5A 3MT6A 3SLLA 4ASIA 3HINA 4JSBA 2ZL0A 3V5EA 1RJNA 3IAVA 2BZRA 5G1SA 2VSSF 4RYFA 3ISAA 5FIFA 4L8KA 4U19A 3T89A 5DTPA 3MYBA 4JVTA 5CTBA 4L6WA 2A7SA 5C90A 3G64A 3TT7A 1X0UA 3NJDA 4U0GH 1J7XA 1K39A 2FW2A 3T3WA 2PBPA 4JFCA 3RRVA 5DU6A 4ZDBA 1WZ8A 3BF0A 3KTHA 3TDCA 2VSUC 1UIYA 1XO6A 3H0UA 3N6RB 4JCQA 2F9YB 3DORA 5KJPA 2EJ5A 3HRXA 3GKBA 1Q52A 3RSIA 2UZFA 1N6EA 3TZ3A 3T8BA 1XNYA 3P5MA 3OC7A 4RYFH 5G1RA 3U9RB 1ON3A 4JJTA 1FC6A 3GF3A 2ZL3A 3ZW9A 1EY3A 4HC8A 2NP9A 3STAA 3JU1A 3ZWAA 5KDRA 2Q34A 2DEOA 3QWDA 3DJAA 3TVWA 3SWXA 2Q35A 3KTJA 3KQFA 4KD6A 4HNKA 2Q2XA 1YG6A 1K32A 4WCZA 1RJMA 1XX4A 3QKAA 2A81A 3TLFA 2J5GD 3QYRA 4YLHA 1N6FA 4OG1A 3MOYA 4NEKA 1MJ3A 3BPPA 3GLMA 3I47A 1FC7A 2F6IA 3K8XA 4QIIA 5INFA 2GTRA 3PE8A 3P2LA 4EMPA 4JWVA 3Q7HA 1WDKA 4EMMA 5DUCA 2J5IA 2VREA 2PPYA 3QK8A 4JYLA 4FZWC 1SG4A 4JCRA 5DU4A 4KWBA 4QFEA 3GMAA 5KDRB 1FCFA 3TT6A 3NJBA 4U0HA 4U1AA 5DTWA 3FF6A 3Q0GA 1PJHA 5INIA 1UYTA 3ST9A 4ZDFA 2WTBA 4NNQA 3M6NA 2VSUE 4JOTA 3T8AA 1Y7OA 4K3WA 4ELWA 5DKPA 2X24A 4B3IA 1W2XA 5CTCA 4EMLA 3Q1TA 1YG8A 3KTGA 2CE3A 3KTKA 5DUFA 1HNOA 1ON9A 3T88A 4FN8A 5INGA 3ZWCA 1TYFA 4MOUA 5JBXA 4I52A 1UYVA 3BEZA 3QXZA 1NZYB 2IEXA 3RSTA 4ZU2A 3H0SA 4OMRA 2J5IB 3U9TB 2DUBA 2X58A 3OMEA 2ZQQA 3Q0JA 4Z0MA 3IB9A 2C8TA 5E0NX 4ZDCA 2F9IB 2HW5A 3H0JA 2FZSA 1EF9A 1TG6A 3PZKA 3PEAA 4KPKA 4OLQA 4K2NA 4ELXA 4JCTA 2VSSE 3R6HA 4MXIA 5FUSA 4U0GA 2J5SA 5E0SA 4FJWD 2QQ3A 3LAOA 3H81A 1OD2A 1NZYA 3HP0A 3IBBA 2VSUA 2ZL4A 3L3SA 3K50A 1EF8A 4FNBA 4GM2A 1JXZA 3R9TA 4ELSA 1HNUA 4RCNA 3V5IA 1UYRA 4I4ZA 5G1QA 2F9IA 3M6MA 2FBMA 4K29A 1PIXA 4IZBA 4WZ8B 4ZDDA 2J5GA 3R9QA 3QXIA 2ZL2A 3WG5A 4FB8A 2D3TA 2VX2A 3QREA 4Q1IA 1VRGA 1XNVA 4JYJA 1Q51A 1WDMA 2W3PA 3PGQA 3ZW8A 3HE2A 1FC9A 4FNDA 5DL1A 5E0SH 4IZDA 3H02A 3GF7A 5DU8A 4KNPA 3U9SB 3R0OA 5DZKA 4B3HA 1N6DA 1DUBA 3TRRA 4I42A 1OD4A 1SZOA 3TVUA 2VSSA
chains in the Genus database with same CATH superfamily
4PD4D 1SQBK 1NU1E 2K88A 2KOGA 2WSEH 1LTJC 3VIVA 1K05A 1NVOA 3CWBE 2A45I 4JYCA 3OT6A 4BXLA 3H0QA 3HTKB 1L4AB 3AE7C 4FN7A 3V4WA 1LJ2A 2MKVA 5EFWB 1SS1A 2KI7B 3H1HE 3B5NC 3BATA 2F9YA 2NZ2A 1K9MQ 1SLQA 1HH0A 3FGAD 1J1EC 1RH5B 3L74G 1NHLA 4U18A 2ZQRA 3L72G 5CJ4A 1JM0A 1EDKA 3E1RA 4ASVA 2I1KA 1O8UA 1T3JA 1L0LG 4G2RA 3H1IE 3OJAB 1XNWA 5HUQA 2WSCJ 4W7ZA 2MJZA 2IYPA 1HTLC 3HUSC 1VQLP 4IFMA 1GD2E 4DT0A 2BZRA 3GHGB 3RBXA 3B5ND 2HLOA 1FZFA 4D6TE 2WT7B 2VSSF 1OW6A 1USEA 3TGUE 3V6IA 2KSJA 1NTKG 4L6WA 4PV1C 5AW2B 5B66H 2R5DA 5GTIE 3VMAA 2C9LY 4GOEA 2M0BA 1G2CB 1H0TB 2A06E 5TISH 2IDBA 3OW2O 1J7XA 2FW2A 2W6AA 2PBPA 1LNQA 1OVRA 5L8RJ 2YXQB 2ZT9C 2RH0A 3BF0A 4IOIH 5AVRB 2VSUC 3N6RB 2IX7C 2AEFA 4IFFA 2HODB 2EJ5A 3HRXA 2WT7A 1L4AC 4XA4A 3WU2E 1D7MA 2UZFA 3TZ3A 2D2CB 3P5MA 2BASA 4PV1D 3Q2YA 2WSFH 4C7RA 5G1RA 3U9RB 1SQPG 1ON3A 1FC6A 1NU1K 1G2CA 1AQTA 4IL6E 3BCCJ 4L74A 5AW5B 2ZT9D 2QG4A 3ABVC 2P7JA 1Y47A 1JY3N 3CXHI 3BCCD 3CX5D 2RKLA 1J1DB 3PTZA 2Q35A 4WVZA 3VYIA 3IAOA 1PP9E 2R44A 1NGMB 4HNKA 1XTGB 1BE3J 1YG6A 3GHGC 4WCZA 3AE6C 3QKAA 5CBNA 3KZIH 4JPZB 2QA4P 2B9BA 1BE3D 2P58A 1OMIA 5CCHA 1IO4A 3EWKA 1Y8AA 1MZ9A 1U7JA 1ZN5A 1BCCG 3RL0C 1R5SA 2E5YA 1N73C 1YQ4C 3H32A 3PE8A 3A0HH 3U1AA 2Q3IA 5AVSB 2H89C 1VQ7P 2OGUA 1E5WA 3Q7HA 2HPCB 3N7NA 1RE4A 3VMXA 1T8ZA 2FFDA 5DUCA 2J5IA 3QH9A 1LGHB 2VREA 3EFGA 3QK8A 3LIEA 3BASA 4FZWC 1GK6A 1VDFA 2JJLA 2W27A 3L74E 1KB9D 3G9RA 2YMYA 1PV3A 4JCRA 5DU4A 3IF4A 2QJKB 1LWUA 3F89A 2QIWA 2D2CC 3L36A 4PD4H 1L0LE 3RL0D 1KYOI 1ZP0C 1KFMA 1OVVA 1X79B 2B87B 3Q5RA 1N7SC 1NTZJ 4U1AA 3P7KA 5TISE 3Q0GA 1W2EA 1TU3F 2OYHB 4OGQC 4UB6H 4ZDFA 1NTZD 2WTBA 1LP1B 1FZEA 3PLNA 3P8CD 1URQA 5CCGC 2KP8A 1RF0A 2Y9ZA 4K3WA 2P2UA 2X24A 4B3IA 1W2XA 5CTCA 3KQGA 1Q82Q 3Q1TA 3KTGA 5AVWB 2D2CD 3H1LD 1HNOA 2B88A 3HD7A 3MGNA 5INGA 1Q2NA 2WQYC 1N7SD 1SQXJ 4JBZA 2HFED 3M9QA 1M90Q 3V2NA 3BEZA 3QXZA 4OGQD 2IEXA 3L37A 1SQXD 3H0SA 2CPBA 2WPRA 1P84D 3U9TB 5CCGD 2W6BA 3V2QA 2R3SA 4Z0MA 2Y0EA 3MTUE 3IB9A 2HR3A 1JEKA 2AEMA 2WSCH 4Y99B 3V2RA 3G4SP 1EF9A 1TG6A 2PP6A 4YPCA 5KLVD 1WT6A 1HBWA 4GIFA 3OA7A 4KPKA 1SQPE 3BRVB 3PP5A 3RK3C 1A02F 2CK3H 4ELXA 3H6PA 3HRNA 1VF5C 3TNUA 4RKUJ 4FJWD 2IBZD 3M9HA 3SWYA 2N1TB 3H1KJ 2IBZI 1CW5A 1T6AA 1HF9A 4M3LA 1X22A 1IFJA 3IBBA 2ZL4A 4WBAA 3L3SA 3A0BE 3K50A 2XDJA 1HWTC 4GM2A 3H1KD 3V5IA 1S9KE 2JWDA 2W83C 1IK9A 4PJ0E 1UYRA 1YJWP 1PL5A 2OYHC 4I4ZA 3CCSP 3AE3C 2WPVB 2PAJA 3RK3D 4WZ8B 1YJ9P 5KJ7D 3BCCG 3MD0A 1VF5D 2ZL2A 3WG5A 2VX2A 3CCJP 3L35A 2QSIA 4Q1IA 1K8AQ 2R3CA 2UWJE 4DCKA 2RN0A 4QMAA 1FJPA 1BCCE 2W3PA 1FZCB 1L0LK 4RJTA 2YXRB 2N1TA 4U3FE 1GW4A 5E0SH 1KQSO 4IZDA 3H02A 1BE3G 1RE3A 4UB8H 2SPZA 5DZKA 2G3AA 2Q9IA 2ITAA 3Q5SA 4B3HA 1KILE 1GL2B 1JTHB 4UB6E 1QEXA 5AW3B 2Q7CA 1JUNA 3CX5H 3CMAP 1NKZB 1SZOA 2E76B 3AE9C 2OTKE 3OAKA 3P85A 3PHLA 1OVUA 3BPTA 2OYIA 2P1JA 1WDLA 1NTKJ 4IZCA 4Y99C 3HLN1 3W67A 3PH0A 4YTPC 4MN4C 1NTMJ 2WSFJ 5KAIH 5CMZA 1FZCA 1LTBC 3MUDC 1UYSA 1S5LH 4ZDEA 1YYCA 2OTLP 5APTA 3R9SA 1NTMD 3S9OA 1SQQJ 1K04A 1GL2A 1JTHA 3LKEA 2WZ7A 3ZWBA 5IKLB 2Q6QA 1EZVD 2Y0DA 2LXCB 1YITP 1SQQD 5KLIC 4JQ0D 5B5EH 1NTZG 1HJ0A 3Q1MA 1CSBA 1HGZA 1N2DC 4KT0J 2F6QA 1KB9H 1Y9BA 3E7KA 3TV5A 2FYNC 3SLLA 4ASIA 1KILA 3HINA 1U57A 1PPJD 1SFCA 3CCQP 3V5EA 4NPFX 3H1LG 1NOHA 3IAVA 4L75A 1SQVD 3L71J 3AEEC 3A7OA 2AEJA 1NAFA 1YTZI 3T89A 5TJHA 4JVTA 3L71D 3M06A 1SQXG 1VQ5P 3FWNA 1R5LA 3M0DA 1ZOYC 1IZNB 2JKVA 3G64A 2E76C 3TT7A 4GT1A 3CLQA 3SFEC 2AXTH 2WITA 3T3WA 3VP9A 3RK2D 5KLVG 2W90A 3GG2A 3Q3DA 4YXDC 4C46A 1S3JA 1KMIZ 1L0NE 3CC4P 1XO6A 1IJDB 4H0LD 2F9YB 3DORA 2ZXEB 4WY4A 5AW6B 2KSEA 1DD3A 3T97A 3RSIA 2KLVA 1P84H 1N6EA 1XNYA 1VQ4P 1YHQP 3M91A 4RYFH 2YKQA 5KTBA 2QVAA 2E76D 1GTWA 3H1KG 3CPWO 1QGKB 3MHVA 1BDDA 1M7LA 3ZW9A 3Q5PA 1SQBJ 2NP9A 3STAA 5CBOA 4KHXA 2Q34A 5KAIE 4RESB 3A2AA 1SQBD 1VPCA 2Y9YA 2FXPA 3II6A 2ZXXA 3VMZA 4KD6A 2GA1A 2FXMA 1K32A 1LT9B 3AEAC 3I56P 2YNYA 2J5GD 1NKNA 4BRYB 1N6FA 3VOPA 4OG1A 2BCCJ 2R32A 5B5EE 5KAFE 1WMKA 4N78D 2DW3A 4HJGH 5INFA 1IFPA 3P2LA 2BCCD 2R5BA 1JMBA 4GKGA 5AW4B 3JCUH 2K1AA 1BGYJ 3IR9A 2M3BA 3TDKA 2WWWA 2PPYA 2N9BA 5BVZA 2FYUE 3B4SA 4JYLA 1BGYD 3HE5B 4KJMA 1SG4A 1LT9A 2AXCA 1NTMG 1BDCA 2YIUC 2NRGA 4KWBA 2YJGA 4BRYA 1YTZT 3I55P 3P8CE 2OARA 3CCRP 3WUTA 3TT6A 1EZVG 1SQQG 1JNMA 1PJHA 3L73E 2AXTE 2VRSA 2JR8A 3C1LA 1W2BO 3M6NA 3H1JJ 1L0NK 3MP7B 3CCVP 3T8AA 1Y7OA 5DKPA 4W7YA 1W5CE 3HE5A 2J58A 3H1JD 5APXA 3WUVA 4EMLA 3HE4A 1MV8A 2ZAEB 1N86A 4RO0A 3H32B 3L75J 1GU5A 3AEGC 3CXHD 2Q1KA 3IFMA 1RF1B 1TYFA 3L70D 3L71G 1YQ3C 1S1CX 2WVRA 5JBXA 1FC2C 1BSHA 3P32A 3L75D 4Z1MH 2FFDB 4ZU2A 2K3RA 1GU4A 1L4AD 4OMRA 2J5IB 1LTAC 2H7HA 2X58A 3OMEA 1UIIA 2IYOA 1NU1D 3SSUA 4ZDCA 2F9IB 3H0JA 1IFDA 1LWUB 3RL0g 3KPEA 2E5TA 1OXZA 3CWBD 2E74B 1M1JB 1U7MA 5FUSA 1AV1A 2ZVNB 3H1HJ 2J5SA 1CI6B 1RF1A 2QQ3A 2KS1A 3S4RA 1X0TA 2C0XA 3RK3E 1S72P 2JO1A 1H8AA 3R4YA 3K5BA 4H44B 3H1HD 4L76A 1URQB 4HKZH 1EF8A 2A45G 4FNBA 5AVYB 3C9IA 4ELSA 1AQ5A 1KN7A 2ZJSE 4EI2A 3JCUE 1NO4A 2F9IA 1QVFO 3L72E 1EQ7A 4B86A 2Z4EA 1PIXA 1SVFA 3H1ID 3HD7B 1KYOD 4ZDDA 1SQBG 2FYUK 3O6QA 3R9QA 2NPSB 5B66E 2XV5A 1JY2O 1M1JA 1XNVA 4JYJA 4I6MC 1KFNA 1CI6A 2K9JB 2OQQA 2KNCA 5CCHC 3A3YB 2A45H 3HE2A 5DL1A 4HDTA 3UIAA 3KXDA 5K5GB 3ITKA 4KNPA 3TGUD 3U9SB 3R0OA 1EDIA 1RE4C 3H1LJ 4TLFA 1J1DC 2FFDC 1NTKE 1OW8A 2BCCG 1OD4A 5BU5A 2A06D 1NTME 1FZBA 3TNUB 4I1LA 4GOFA 2NPSA 5KJ7A 1LWUC 5CCHD 2PG8A 3FX0A 4IL6X 4LK5A 3SWKA 4HYTB 1BGYG 2K9JA 4Q0GA 4L73A 1SQQE 2E74C 5AW7B 2XU6A 1SP4A 4WYOB 1EXJA 5KLVJ 1OW7A 4N6JA 4F47A 2IPPA 4H44C 2J5II 1URQC 2LR2A 3FXDA 3FDUA 4MI2A 5H2FH 1VL2A 2Y0CA 1RF0C 3MFMA 5AW0B 3QMJA 2Z5HA 2E75B 2FBWC 3KZIE 1UIXA 2WTYA 4JCSA 2PFXA 1PP9J 5JBWA 2QJKC 3HD7C 1IFIA 1HZDA 2FY8A 3MIWA 3L71E 3D70A 3A0HE 4ZKPA 1PP9D 3H1JG 1HJBA 2JDIH 1DEEG 5AVQB 1Z56A 2H43A 4H44D 5E79H 5G1SA 1ZXGA 1EXIA 2FXOA 3VTPC 3ISAA 5FIFA 3L70G 4U19A 4ZNCA 3NMDA 2OYIB 3AEDC 3L75G 1NWQA 3MYBA 3NXSA 5CTBA 3LW5H 2PRRA 1ZMEC 2C9NY 2WPQA 1VQOP 3JC22 3NTNA 4R4MA 4HH2A 4PD4E 3NJDA 4EIJA 5BU8B 3CD6P 2Q3EA 1WZ8A 3EFFK 3CXHH 1HUCA 3RGUA 3KTHA 5APYA 1UIYA 3H0UA 2J59M 1OIPA 3GKBA 3AE8C 1NTKK 3H1HG 2YKPA 4K35A 3O8ZA 1VQ8P 2O1KA 3JSVC 2KZIA 2E42A 2K9YA 1KQFB 2WMMA 4JYBA 3GF3A 2ZL3A 1H88A 1KILB 1SFCB 1FOSE 4HC8A 2BEZF 1RQUA 3JU1A 3ZWAA 5KDRA 1PGPA 2N1TC 2C0WA 1SQQK 1GK4A 2DEOA 3TSIA 3TVWA 3KTJA 2QRXA 1RE3C 3KQFA 4GDOA 4R4LA 1RQVA 1FDOA 3BRTB 4IFDK 3KYQA 2BCCE 1IK7A 3N4XA 1XX4A 3AEFC 3D6YA 1LTJB 1SQPK 3TGUG 5H2FE 1AFOA 4EYYQ 4I7ZB 1G1JA 4NARA 2OYIC 3MOYA 1KYOH 1SQVJ 3BPPA 5AW1B 3GLMA 1BGYE 2A06G 2GTRA 2RMZA 2N1TD 1K73Q 1FZCC 4EMPA 4WY4B 1FDIA 2M8RA 3T97B 4EMMA 3B5NB 1EDJA 1YBKA 3L4FA 2XNDH 3D6ZA 1GL2C 3CCEP 4DJGA 1E79H 1T3UA 1RHZB 2M5AA 2Q5UA 1LTJA 3E1IA 1NAYA 4QFEA 3GMAA 3MZWB 1FCFA 2YKOA 1JB0J 1MUUA 2CPSA 4AUWA 3FF6A 3H1JE 1S9KD 3CC7P 1KILC 2IBZG 4H13B 2Z5IA 1SFCC 4UB8E 2FYZA 4NNQA 5APVA 1KORA 3B5NA 3CXHE 1GL2D 2VSUE 4JOTA 1ZLLA 3BCCE 3CX5E 3L75E 1PP9G 4PV1B 3A5TA 4YXWH 1ZRTD 3VMYA 3AE5C 1GW3A 2E43A 1YG8A 1FZAA 5DUFA 3M0DC 4U3FD 1R8EA 3CL3D 4PD4I 3ZWCA 2ZYDA 4IL6H 3RBZA 1S4XA 5AVVB 2W6JH 2XNXA 2ZT9B 2WSSH 1BE3E 4MOUA 4I7ZC 1UYVA 1KILD 1NZYB 3HUSA 3RSTA 1S5LE 1SFCD 5APQA 3M0AA 4NPEA 4BWNA 2DUBA 3Q0JA 4OWFA 4WY4C 3G3ZA 1QVGO 2C8TA 2L5GB 2HW5A 1T2KC 1FOSF 3EQ2A 1QL1A 4Y28J 2OTJP 4OVNF 4XFJA 4OLQA 4K2NA 4O9BA 3AE2C 3R6HA 4MXIA 1KB9E 5E0SA 1ZR4A 1ZR2A 1FS0E 1FU1A 2V7QJ 1KYOE 4I2LC 3LAOA 2V4HA 1MKMA 1OD2A 2GUSA 1NZYA 3HP0A 2VSUA 2I1JA 4TT3H 3TK1A 3R9TA 3B8EB 4WY4D 1QL2A 1HNUA 1M8OB 3HTKA 1L4AA 1QX8A 3CC2P 1T2KD 5M1BA 4EOTA 2JWAA 5G1QA 4H13C 1NTZE 3HE4B 2KUBA 1XTCC 4K29A 2K37A 2L91A 4IZBA 1IFNA 4HB1A 4FB8A 2D3TA 3QREA 1VRGA 3CCUP 3RL0B 1BSNA 1PFIA 1N73B 1Q51A 3TYYA 3PGQA 3LW5J 2QJPB 3ZW8A 3H1LE 2YMKA 1L2PA 1FC9A 4FNDA 3V2PA 1FE6A 2B89A 3GF7A 3BVHA 3IN6A 1KV4A 1VQKP 1N6DA 4ZMDA 4H13D 1GZLA 1SQXE 1PPJG 3GHGA 1YIJP 4I42A 3WUUA 3FXEA 1DD4A 4XE5B 3TVUA 1P84E 3L70J 1SQVG 5APUA 2FKWB 1LT9C 2O1JA 1L0NJ 3I5CA 5MGBA 2KS1B 2CBYA 2N9YB 2IFNA 1N7SB 5KLVE 1N73A 2VSUF 1L0ND 2XKMA 2A7KA 1NU1J 1H0TA 1JOCA 4DI1A 4OGQB 1LTIC 4WB4A 4QIJA 1JY2N 1KQGB 2IBZE 3SFDC 1S5LX 3CWBJ 3KHUA 2O01J 5C9GA 2LKMA 2I8DA 2O01N 1DCIA 4FZWA 4B3JA 5DZKH 3CX5I 3O6QB 1EDLA 4GHNA 2HODA 3H1KE 3TF5A 5AW9B 4WWIA 1EC5A 3KTIA 5APWA 2KNCB 1DH3A 4DOJA 1KQLA 3CI9A 1N8RQ 1JCCA 2OYOA 1N7SA 2H88C 3CMEP 3MT6A 1NH4A 1YJNP 2LXBA 4JSBA 2QM7A 2ZL0A 3A0BH 1HVVA 2IZ1A 3H1IJ 1RJNA 1DX7A 4U3FG 2M3EA 3LIDA 2QJPC 5CCGA 1X8YA 2H8PD 4PJ0H 3AECC 3G6EP 4RYFA 4L8KA 1S2EA 5DTPA 3RK3B 3V4QA 2PGDA 1ZW0A 1USDA 4D6TJ 1KC8Q 1NTZK 5CHXA 1VF5B 2A7SA 5C90A 1JY3O 2ZYAA 3TGUJ 1KZUB 2QM8A 1FZGA 1KB9I 5CJ0A 1X0UA 4U0GH 4D6TD 1K39A 2FYUJ 4JFCA 3RRVA 1RF1C 5DU6A 4ZDBA 1VQ6P 5AVZB 5DJTB 3TDCA 2FYUD 4JCQA 5KJPA 5AVTB 2HPCA 1Q52A 3VP8A 1AVOA 3QWOC 3P8MC 1JCDA 3T8BA 1IC2A 1SQXK 3OC7A 3L73J 1OX3A 3D71A 3USSA 1NJIQ 4JJTA 4J2UA 2WPSA 1EZVE 1KTMA 1DIPA 3L73D 2ZFCA 1M1JC 1EY3A 1RY3A 3KDPB 2KXPB 5C39A 2QJYB 5KLVK 3AE4C 5AVXB 4AYCA 2B87A 2IFMA 4C7NB 4LLHA 3QWDA 3DJAA 2WSEJ 3SWXA 5GTHH 2ZVOB 1IFMA 5APSA 2OYHA 1M56D 1LT1A 1PPJE 2HG5D 1A02J 1PGOA 2Q2XA 1LP1A 2KIKA 1P84I 2V7QH 1SQVE 1RJMA 2KK7A 2A81A 3TLFA 1H89A 3QYRA 4YLHA 1NYHA 2E74D 2P67A 4NEKA 4LC1A 2NPSC 1MJ3A 5KJ7C 3I47A 1FC7A 1Q81Q 3U59A 2F6IA 3K8XA 4QIIA 3CCMP 1G1IA 3V5BA 1LTTC 4JWVA 2IZ0A 1URQD 3R2PA 1WDKA 4LGDE 4C7NA 1AA0A 4AQRD 2YO2A 3SWFA 3VN0A 1J2JB 1HGVA 1L0NG 1WRGA 5KLIB 2BEQD 2QEXP 1Q7YQ 2P10A 3HD7D 1NU1G 1AVYA 1PGQA 2NPSD 4K3AA 5KDRB 2FYNB 2JP3A 3L74J 1FDMA 3MUDA 3NJBA 1ZRTE 3RK2B 4U0HA 3L72J 3CWBG 1OWAA 5DTWA 3C8VA 5INIA 1UYTA 1L0LJ 3ST9A 3L74D 4H0LB 3W68A 3L72D 1AJYA 1ZV8A 2QJYC 3WMM0 1KD1Q 4CPGA 1L0LD 1SQBE 1YI2P 4W80A 4ELWA 1FAVA 3AE1C 1Q86Q 1NTMK 2W8ZA 3ZDMA 2CE3A 1VQMP 3KTKA 2E75C 1ON9A 3T88A 1PZQA 4FN8A 2QE7H 2O01H 3H1IG 4U7JA 1CZQA 2ZYGA 4I52A 5KKZB 3M9BA 4ZKUA 1JY2P 1PGJA 1NTKD 1JY3P 1VQ9P 4N78E 3S1KA 4DZOA 5AVUB 3GW6A 4GODA 2ZQQA 4D6TG 4EDFA 1JO5A 4JF7A 5E0NX 2M5AB 5GTHE 2FZSA 3PZKA 1DEBA 3PEAA 2E75D 2FYUG 2KB7P 1SQVK 2KZJA 1EZVI 4JCTA 2VSSE 3FWLA 4U0GA 3AEBC 3NFQA 1Q90D 5KAFH 1QLED 1M1KQ 2KYVA 1SQPJ 2HYNA 3PJSK 4ASWA 2G8YA 2O3JA 3H81A 1FJKA 1JXZA 1SQPD 1X9VA 2GM4A 3RK2C 1FBMA 3L73G 1J1EB 4RCNA 2JEEA 5E79E 3U1CA 4NPDA 2YO3A 1OFCX 3G71P 1OZHA 2KLUA 1MFTA 1VQNP 3M6MA 5GTIH 4H0LC 2FBMA 4A7PA 3H25A 3CCLP 2J5GA 1JMMA 5AW8B 1GMJA 3QXIA 3F5HA 3HUSB 1WDMA 1N7LA 1VQPP 2POHA 1GDTA 2XZRA 3B71A 5DU8A 2GUVA 5DJUB 1LTGC 3L70E 4OH8B 1BCCJ 3WU2H 1MFZA 5KKZC 4U3FJ 1DUBA 3TRRA 4N3YB 1M57D 3PRJA 1BCCD 2J5UA 2VSSA 2YIUB 1LTSC
chains in the Genus database with same CATH topology
3P85A 3BPTA 1WDLA 5MGBA 4IZCA 2CBYA 3HLN1 2PG8A 3VIVA 1K05A 4YTPC 4IL6X 4LK5A 2VSUF 2WSFJ 2A7KA 4Q0GA 2E74C 4DI1A 1UYSA 4OGQB 3OT6A 4WYOB 3H0QA 4ZDEA 4QIJA 3AE7C 1EXJA 4FN7A 3R9SA 1KQGB 3SFDC 1S5LX 2MKVA 1OW7A 3S9OA 1K04A 2O01J 4F47A 5C9GA 4H44C 3LKEA 3ZWBA 1DCIA 2J5II 4FZWA 5IKLB 2F9YA 2NZ2A 5DZKH 4B3JA 3FDUA 4MI2A 1VL2A 4GHNA 3MFMA 3FGAD 3QMJA 5KLIC 4U18A 2E75B 2FBWC 2ZQRA 1UIXA 3KTIA 1HJ0A 4JCSA 3Q1MA 4KT0J 1O8UA 2F6QA 4G2RA 5JBWA 2QJKC 1Y9BA 1HZDA 1XNWA 3TV5A 5HUQA 2WSCJ 2H88C 3D70A 2FYNC 3MT6A 3SLLA 4ASIA 3HINA 4JSBA 2ZL0A 1U57A 3V5EA 1RJNA 3IAVA 2BZRA 2QJPC 4H44D 5G1SA 3AEEC 1EXIA 2VSSF 3AECC 4RYFA 3ISAA 5FIFA 4L8KA 4U19A 1OW6A 3T89A 5DTPA 3AEDC 3MYBA 4JVTA 5CTBA 4L6WA 4PV1C 1ZMEC 1VF5B 2A7SA 5C90A 1ZOYC 3G64A 2E76C 4R4MA 2IDBA 3TT7A 1X0UA 3NJDA 4U0GH 1J7XA 3SFEC 1K39A 2FW2A 3T3WA 2PBPA 4JFCA 3RRVA 5DU6A 4ZDBA 1WZ8A 5L8RJ 2ZT9C 3Q3DA 3BF0A 4YXDC 3KTHA 3TDCA 1KMIZ 2VSUC 1UIYA 1XO6A 3H0UA 3N6RB 4H0LD 4JCQA 2F9YB 3DORA 5KJPA 1DD3A 2EJ5A 3HRXA 3GKBA 1Q52A 3RSIA 2UZFA 1N6EA 3TZ3A 3T8BA 2D2CB 1XNYA 3AE8C 3P5MA 4PV1D 3OC7A 4RYFH 3Q2YA 3D71A 5G1RA 3U9RB 2E76D 1ON3A 4JJTA 2K9YA 1FC6A 4J2UA 1KQFB 1KTMA 1DIPA 3GF3A 2ZL3A 3ZW9A 3Q5PA 1EY3A 4HC8A 2NP9A 3STAA 2BEZF 1RQUA 2ZT9D 3JU1A 3ZWAA 5KDRA 3ABVC 3AE4C 2Q34A 2DEOA 3QWDA 3DJAA 3TVWA 2WSEJ 3SWXA 2Q35A 3KTJA 2FXPA 3KQFA 4GDOA 3IAOA 4R4LA 1NGMB 1RQVA 4KD6A 1FDOA 4HNKA 2Q2XA 1YG6A 1K32A 1IK7A 4WCZA 1RJMA 3AEAC 1XX4A 3AE6C 3QKAA 2A81A 3TLFA 3AEFC 2J5GD 3D6YA 3QYRA 4YLHA 1N6FA 1NYHA 4OG1A 2E74D 4I7ZB 4NARA 3MOYA 1OMIA 4NEKA 1MJ3A 3EWKA 3BPPA 3GLMA 3I47A 1WMKA 1FC7A 2F6IA 3K8XA 4QIIA 5INFA 1YQ4C 2GTRA 3PE8A 3P2LA 4EMPA 2H89C 1FDIA 4JWVA 3Q7HA 3T97B 1WDKA 4EMMA 5DUCA 2J5IA 2VREA 2PPYA 3D6ZA 3QK8A 4JYLA 4FZWC 2BEQD 1SG4A 2P10A 3G9RA 1PV3A 4JCRA 5DU4A 2YIUC 4KWBA 2YJGA 2QIWA 4QFEA 3GMAA 2D2CC 5KDRB 1FCFA 1ZP0C 2JP3A 3TT6A 1JB0J 3NJBA 1ZRTE 3Q5RA 4U0HA 4U1AA 5DTWA 3FF6A 3Q0GA 3C8VA 1PJHA 5INIA 1UYTA 1TU3F 3ST9A 4OGQC 4ZDFA 4H13B 4H0LB 2WTBA 1AJYA 2QJYC 4NNQA 1KORA 3M6NA 2VSUE 4JOTA 3T8AA 1Y7OA 4K3WA 4ELWA 4PV1B 5DKPA 3AE1C 2X24A 3AE5C 4B3IA 1W2XA 5CTCA 4EMLA 3Q1TA 1YG8A 3KTGA 2CE3A 2D2CD 3KTKA 5DUFA 1HNOA 2E75C 1ON9A 3T88A 1R8EA 4FN8A 5INGA 3ZWCA 2WQYC 3AEGC 1TYFA 4U7JA 2ZT9B 1YQ3C 1S1CX 4MOUA 5JBXA 4I52A 4I7ZC 1UYVA 3BEZA 3QXZA 4OGQD 1NZYB 4Z1MH 2IEXA 3RSTA 4ZU2A 3H0SA 4OMRA 2J5IB 3U9TB 2DUBA 2X58A 3OMEA 2ZQQA 3Q0JA 4Z0MA 3IB9A 2C8TA 5E0NX 4ZDCA 2F9IB 2HW5A 3H0JA 2FZSA 1EF9A 1TG6A 3PZKA 3RL0g 3PEAA 4Y28J 4KPKA 2E75D 4XFJA 4OLQA 4K2NA 2E74B 4ELXA 4JCTA 3AE2C 2VSSE 3R6HA 1VF5C 4MXIA 5FUSA 4U0GA 3AEBC 1Q90D 4RKUJ 2J5SA 5E0SA 4FJWD 2QQ3A 3RK3E 2V7QJ 2JO1A 3LAOA 2G8YA 1HF9A 1MKMA 3R4YA 1OD2A 1NZYA 4H44B 3H81A 3HP0A 3IBBA 2VSUA 2ZL4A 3L3SA 3K50A 1EF8A 4TT3H 4FNBA 4GM2A 1JXZA 3R9TA 4ELSA 1HNUA 4RCNA 3V5IA 1UYRA 1PL5A 5M1BA 4I4ZA 5G1QA 2F9IA 3M6MA 4H13C 3AE3C 2FBMA 2WPVB 4H0LC 4K29A 1PIXA 3H25A 4IZBA 4WZ8B 4ZDDA 2J5GA 3O6QA 1VF5D 1GMJA 3R9QA 3QXIA 2ZL2A 3WG5A 4FB8A 2D3TA 2VX2A 3QREA 4Q1IA 2QSIA 1VRGA 1XNVA 4JYJA 1Q51A 1WDMA 2OQQA 2W3PA 3PGQA 3LW5J 3ZW8A 3HE2A 2YMKA 1FC9A 4FNDA 5DL1A 5E0SH 4HDTA 4IZDA 3B71A 3H02A 3GF7A 5DU8A 3IN6A 4KNPA 3U9SB 3R0OA 5DZKA 2G3AA 4B3HA 3Q5SA 5KKZC 1KILE 1N6DA 4H13D 1DUBA 3TRRA 4I42A 1OW8A 1DD4A 1OD4A 1SZOA 3TVUA 2J5UA 2E76B 2VSSA 3AE9C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P85 A;  1WDL A;  5MGB A;  4IZC A;  2CBY A;  3HLN 1;  2PG8 A;  3VIV A;  4LK5 A;  2VSU F;  2A7K A;  4Q0G A;  4DI1 A;  1UYS A;  3OT6 A;  4WYO B;  3H0Q A;  4ZDE A;  4QIJ A;  4FN7 A;  3R9S A;  4F47 A;  5C9G A;  3LKE A;  3ZWB A;  1DCI A;  2J5I I;  4FZW A;  5IKL B;  2F9Y A;  4B3J A;  5DZK H;  3FDU A;  4MI2 A;  4GHN A;  3MFM A;  3QMJ A;  4U18 A;  2ZQR A;  3KTI A;  4JCS A;  1O8U A;  2F6Q A;  4G2R A;  5JBW A;  1HZD A;  1XNW A;  3TV5 A;  3MT6 A;  3SLL A;  4ASI A;  3HIN A;  4JSB A;  2ZL0 A;  3V5E A;  1RJN A;  3IAV A;  2BZR A;  5G1S A;  2VSS F;  4RYF A;  3ISA A;  5FIF A;  4L8K A;  4U19 A;  3T89 A;  5DTP A;  3MYB A;  4JVT A;  5CTB A;  4L6W A;  2A7S A;  5C90 A;  3G64 A;  3TT7 A;  1X0U A;  3NJD A;  4U0G H;  1J7X A;  1K39 A;  2FW2 A;  3T3W A;  2PBP A;  4JFC A;  3RRV A;  5DU6 A;  4ZDB A;  1WZ8 A;  3BF0 A;  3KTH A;  3TDC A;  2VSU C;  1UIY A;  1XO6 A;  3H0U A;  3N6R B;  4JCQ A;  2F9Y B;  3DOR A;  5KJP A;  2EJ5 A;  3HRX A;  3GKB A;  1Q52 A;  3RSI A;  2UZF A;  1N6E A;  3TZ3 A;  3T8B A;  1XNY A;  3P5M A;  3OC7 A;  4RYF H;  5G1R A;  3U9R B;  1ON3 A;  4JJT A;  1FC6 A;  3GF3 A;  2ZL3 A;  3ZW9 A;  1EY3 A;  4HC8 A;  2NP9 A;  3STA A;  3JU1 A;  3ZWA A;  5KDR A;  2Q34 A;  2DEO A;  3QWD A;  3DJA A;  3TVW A;  3SWX A;  2Q35 A;  3KTJ A;  3KQF A;  4KD6 A;  4HNK A;  2Q2X A;  1YG6 A;  1K32 A;  4WCZ A;  1RJM A;  1XX4 A;  3QKA A;  2A81 A;  3TLF A;  2J5G D;  3QYR A;  4YLH A;  1N6F A;  4OG1 A;  3MOY A;  4NEK A;  1MJ3 A;  3BPP A;  3GLM A;  3I47 A;  1FC7 A;  2F6I A;  3K8X A;  4QII A;  5INF A;  2GTR A;  3PE8 A;  3P2L A;  4EMP A;  4JWV A;  3Q7H A;  1WDK A;  4EMM A;  5DUC A;  2J5I A;  2VRE A;  2PPY A;  3QK8 A;  4JYL A;  4FZW C;  1SG4 A;  4JCR A;  5DU4 A;  4KWB A;  4QFE A;  3GMA A;  5KDR B;  1FCF A;  3TT6 A;  3NJB A;  4U0H A;  4U1A A;  5DTW A;  3FF6 A;  3Q0G A;  1PJH A;  5INI A;  1UYT A;  3ST9 A;  4ZDF A;  2WTB A;  4NNQ A;  3M6N A;  2VSU E;  4JOT A;  3T8A A;  1Y7O A;  4K3W A;  4ELW A;  5DKP A;  2X24 A;  4B3I A;  1W2X A;  5CTC A;  4EML A;  3Q1T A;  1YG8 A;  3KTG A;  2CE3 A;  3KTK A;  5DUF A;  1HNO A;  1ON9 A;  3T88 A;  4FN8 A;  5ING A;  3ZWC A;  1TYF A;  4MOU A;  5JBX A;  4I52 A;  1UYV A;  3BEZ A;  3QXZ A;  1NZY B;  2IEX A;  3RST A;  4ZU2 A;  3H0S A;  4OMR A;  2J5I B;  3U9T B;  2DUB A;  2X58 A;  3OME A;  2ZQQ A;  3Q0J A;  4Z0M A;  3IB9 A;  2C8T A;  5E0N X;  4ZDC A;  2F9I B;  2HW5 A;  3H0J A;  2FZS A;  1EF9 A;  1TG6 A;  3PZK A;  3PEA A;  4KPK A;  4OLQ A;  4K2N A;  4ELX A;  4JCT A;  2VSS E;  3R6H A;  4MXI A;  5FUS A;  4U0G A;  2J5S A;  5E0S A;  4FJW D;  2QQ3 A;  3LAO A;  3H81 A;  1OD2 A;  1NZY A;  3HP0 A;  3IBB A;  2VSU A;  2ZL4 A;  3L3S A;  3K50 A;  1EF8 A;  4FNB A;  4GM2 A;  1JXZ A;  3R9T A;  4ELS A;  1HNU A;  4RCN A;  3V5I A;  1UYR A;  4I4Z A;  5G1Q A;  2F9I A;  3M6M A;  2FBM A;  4K29 A;  1PIX A;  4IZB A;  4WZ8 B;  4ZDD A;  2J5G A;  3R9Q A;  3QXI A;  2ZL2 A;  3WG5 A;  4FB8 A;  2D3T A;  2VX2 A;  3QRE A;  4Q1I A;  1VRG A;  1XNV A;  4JYJ A;  1Q51 A;  1WDM A;  2W3P A;  3PGQ A;  3ZW8 A;  3HE2 A;  1FC9 A;  4FND A;  5DL1 A;  5E0S H;  4IZD A;  3H02 A;  3GF7 A;  5DU8 A;  4KNP A;  3U9S B;  3R0O A;  5DZK A;  4B3H A;  1N6D A;  1DUB A;  3TRR A;  4I42 A;  1OD4 A;  1SZO A;  3TVU A;  2VSS A; 
#chains in the Genus database with same CATH topology
 4PD4 D;  1SQB K;  1NU1 E;  2K88 A;  2KOG A;  2WSE H;  1LTJ C;  3VIV A;  1K05 A;  1NVO A;  3CWB E;  2A45 I;  4JYC A;  3OT6 A;  4BXL A;  3H0Q A;  3HTK B;  1L4A B;  3AE7 C;  4FN7 A;  3V4W A;  1LJ2 A;  2MKV A;  5EFW B;  1SS1 A;  2KI7 B;  3H1H E;  3B5N C;  3BAT A;  2F9Y A;  2NZ2 A;  1K9M Q;  1SLQ A;  1HH0 A;  3FGA D;  1J1E C;  1RH5 B;  3L74 G;  1NHL A;  4U18 A;  2ZQR A;  3L72 G;  5CJ4 A;  1JM0 A;  1EDK A;  3E1R A;  4ASV A;  2I1K A;  1O8U A;  1T3J A;  1L0L G;  4G2R A;  3H1I E;  3OJA B;  1XNW A;  5HUQ A;  2WSC J;  4W7Z A;  2MJZ A;  2IYP A;  1HTL C;  3HUS C;  1VQL P;  4IFM A;  1GD2 E;  4DT0 A;  2BZR A;  3GHG B;  3RBX A;  3B5N D;  2HLO A;  1FZF A;  4D6T E;  2WT7 B;  2VSS F;  1OW6 A;  1USE A;  3TGU E;  3V6I A;  2KSJ A;  1NTK G;  4L6W A;  4PV1 C;  5AW2 B;  5B66 H;  2R5D A;  5GTI E;  3VMA A;  2C9L Y;  4GOE A;  2M0B A;  1G2C B;  1H0T B;  2A06 E;  5TIS H;  2IDB A;  3OW2 O;  1J7X A;  2FW2 A;  2W6A A;  2PBP A;  1LNQ A;  1OVR A;  5L8R J;  2YXQ B;  2ZT9 C;  2RH0 A;  3BF0 A;  4IOI H;  5AVR B;  2VSU C;  3N6R B;  2IX7 C;  2AEF A;  4IFF A;  2HOD B;  2EJ5 A;  3HRX A;  2WT7 A;  1L4A C;  4XA4 A;  3WU2 E;  1D7M A;  2UZF A;  3TZ3 A;  2D2C B;  3P5M A;  2BAS A;  4PV1 D;  3Q2Y A;  2WSF H;  4C7R A;  5G1R A;  3U9R B;  1SQP G;  1ON3 A;  1FC6 A;  1NU1 K;  1G2C A;  1AQT A;  4IL6 E;  3BCC J;  4L74 A;  5AW5 B;  2ZT9 D;  2QG4 A;  3ABV C;  2P7J A;  1Y47 A;  1JY3 N;  3CXH I;  3BCC D;  3CX5 D;  2RKL A;  1J1D B;  3PTZ A;  2Q35 A;  4WVZ A;  3VYI A;  3IAO A;  1PP9 E;  2R44 A;  1NGM B;  4HNK A;  1XTG B;  1BE3 J;  1YG6 A;  3GHG C;  4WCZ A;  3AE6 C;  3QKA A;  5CBN A;  3KZI H;  4JPZ B;  2QA4 P;  2B9B A;  1BE3 D;  2P58 A;  1OMI A;  5CCH A;  1IO4 A;  3EWK A;  1Y8A A;  1MZ9 A;  1U7J A;  1ZN5 A;  1BCC G;  3RL0 C;  1R5S A;  2E5Y A;  1N73 C;  1YQ4 C;  3H32 A;  3PE8 A;  3A0H H;  3U1A A;  2Q3I A;  5AVS B;  2H89 C;  1VQ7 P;  2OGU A;  1E5W A;  3Q7H A;  2HPC B;  3N7N A;  1RE4 A;  3VMX A;  1T8Z A;  2FFD A;  5DUC A;  2J5I A;  3QH9 A;  1LGH B;  2VRE A;  3EFG A;  3QK8 A;  3LIE A;  3BAS A;  4FZW C;  1GK6 A;  1VDF A;  2JJL A;  2W27 A;  3L74 E;  1KB9 D;  3G9R A;  2YMY A;  1PV3 A;  4JCR A;  5DU4 A;  3IF4 A;  2QJK B;  1LWU A;  3F89 A;  2QIW A;  2D2C C;  3L36 A;  4PD4 H;  1L0L E;  3RL0 D;  1KYO I;  1ZP0 C;  1KFM A;  1OVV A;  1X79 B;  2B87 B;  3Q5R A;  1N7S C;  1NTZ J;  4U1A A;  3P7K A;  5TIS E;  3Q0G A;  1W2E A;  1TU3 F;  2OYH B;  4OGQ C;  4UB6 H;  4ZDF A;  1NTZ D;  2WTB A;  1LP1 B;  1FZE A;  3PLN A;  3P8C D;  1URQ A;  5CCG C;  2KP8 A;  1RF0 A;  2Y9Z A;  4K3W A;  2P2U A;  2X24 A;  4B3I A;  1W2X A;  5CTC A;  3KQG A;  1Q82 Q;  3Q1T A;  3KTG A;  5AVW B;  2D2C D;  3H1L D;  1HNO A;  2B88 A;  3HD7 A;  3MGN A;  5ING A;  1Q2N A;  2WQY C;  1N7S D;  1SQX J;  4JBZ A;  2HFE D;  3M9Q A;  1M90 Q;  3V2N A;  3BEZ A;  3QXZ A;  4OGQ D;  2IEX A;  3L37 A;  1SQX D;  3H0S A;  2CPB A;  2WPR A;  1P84 D;  3U9T B;  5CCG D;  2W6B A;  3V2Q A;  2R3S A;  4Z0M A;  2Y0E A;  3MTU E;  3IB9 A;  2HR3 A;  1JEK A;  2AEM A;  2WSC H;  4Y99 B;  3V2R A;  3G4S P;  1EF9 A;  1TG6 A;  2PP6 A;  4YPC A;  5KLV D;  1WT6 A;  1HBW A;  4GIF A;  3OA7 A;  4KPK A;  1SQP E;  3BRV B;  3PP5 A;  3RK3 C;  1A02 F;  2CK3 H;  4ELX A;  3H6P A;  3HRN A;  1VF5 C;  3TNU A;  4RKU J;  4FJW D;  2IBZ D;  3M9H A;  3SWY A;  2N1T B;  3H1K J;  2IBZ I;  1CW5 A;  1T6A A;  1HF9 A;  4M3L A;  1X22 A;  1IFJ A;  3IBB A;  2ZL4 A;  4WBA A;  3L3S A;  3A0B E;  3K50 A;  2XDJ A;  1HWT C;  4GM2 A;  3H1K D;  3V5I A;  1S9K E;  2JWD A;  2W83 C;  1IK9 A;  4PJ0 E;  1UYR A;  1YJW P;  1PL5 A;  2OYH C;  4I4Z A;  3CCS P;  3AE3 C;  2WPV B;  2PAJ A;  3RK3 D;  4WZ8 B;  1YJ9 P;  5KJ7 D;  3BCC G;  3MD0 A;  1VF5 D;  2ZL2 A;  3WG5 A;  2VX2 A;  3CCJ P;  3L35 A;  2QSI A;  4Q1I A;  1K8A Q;  2R3C A;  2UWJ E;  4DCK A;  2RN0 A;  4QMA A;  1FJP A;  1BCC E;  2W3P A;  1FZC B;  1L0L K;  4RJT A;  2YXR B;  2N1T A;  4U3F E;  1GW4 A;  5E0S H;  1KQS O;  4IZD A;  3H02 A;  1BE3 G;  1RE3 A;  4UB8 H;  2SPZ A;  5DZK A;  2G3A A;  2Q9I A;  2ITA A;  3Q5S A;  4B3H A;  1KIL E;  1GL2 B;  1JTH B;  4UB6 E;  1QEX A;  5AW3 B;  2Q7C A;  1JUN A;  3CX5 H;  3CMA P;  1NKZ B;  1SZO A;  2E76 B;  3AE9 C;  2OTK E;  3OAK A;  3P85 A;  3PHL A;  1OVU A;  3BPT A;  2OYI A;  2P1J A;  1WDL A;  1NTK J;  4IZC A;  4Y99 C;  3HLN 1;  3W67 A;  3PH0 A;  4YTP C;  4MN4 C;  1NTM J;  2WSF J;  5KAI H;  5CMZ A;  1FZC A;  1LTB C;  3MUD C;  1UYS A;  1S5L H;  4ZDE A;  1YYC A;  2OTL P;  5APT A;  3R9S A;  1NTM D;  3S9O A;  1SQQ J;  1K04 A;  1GL2 A;  1JTH A;  3LKE A;  2WZ7 A;  3ZWB A;  5IKL B;  2Q6Q A;  1EZV D;  2Y0D A;  2LXC B;  1YIT P;  1SQQ D;  5KLI C;  4JQ0 D;  5B5E H;  1NTZ G;  1HJ0 A;  3Q1M A;  1CSB A;  1HGZ A;  1N2D C;  4KT0 J;  2F6Q A;  1KB9 H;  1Y9B A;  3E7K A;  3TV5 A;  2FYN C;  3SLL A;  4ASI A;  1KIL A;  3HIN A;  1U57 A;  1PPJ D;  1SFC A;  3CCQ P;  3V5E A;  4NPF X;  3H1L G;  1NOH A;  3IAV A;  4L75 A;  1SQV D;  3L71 J;  3AEE C;  3A7O A;  2AEJ A;  1NAF A;  1YTZ I;  3T89 A;  5TJH A;  4JVT A;  3L71 D;  3M06 A;  1SQX G;  1VQ5 P;  3FWN A;  1R5L A;  3M0D A;  1ZOY C;  1IZN B;  2JKV A;  3G64 A;  2E76 C;  3TT7 A;  4GT1 A;  3CLQ A;  3SFE C;  2AXT H;  2WIT A;  3T3W A;  3VP9 A;  3RK2 D;  5KLV G;  2W90 A;  3GG2 A;  3Q3D A;  4YXD C;  4C46 A;  1S3J A;  1KMI Z;  1L0N E;  3CC4 P;  1XO6 A;  1IJD B;  4H0L D;  2F9Y B;  3DOR A;  2ZXE B;  4WY4 A;  5AW6 B;  2KSE A;  1DD3 A;  3T97 A;  3RSI A;  2KLV A;  1P84 H;  1N6E A;  1XNY A;  1VQ4 P;  1YHQ P;  3M91 A;  4RYF H;  2YKQ A;  5KTB A;  2QVA A;  2E76 D;  1GTW A;  3H1K G;  3CPW O;  1QGK B;  3MHV A;  1BDD A;  1M7L A;  3ZW9 A;  3Q5P A;  1SQB J;  2NP9 A;  3STA A;  5CBO A;  4KHX A;  2Q34 A;  5KAI E;  4RES B;  3A2A A;  1SQB D;  1VPC A;  2Y9Y A;  2FXP A;  3II6 A;  2ZXX A;  3VMZ A;  4KD6 A;  2GA1 A;  2FXM A;  1K32 A;  1LT9 B;  3AEA C;  3I56 P;  2YNY A;  2J5G D;  1NKN A;  4BRY B;  1N6F A;  3VOP A;  4OG1 A;  2BCC J;  2R32 A;  5B5E E;  5KAF E;  1WMK A;  4N78 D;  2DW3 A;  4HJG H;  5INF A;  1IFP A;  3P2L A;  2BCC D;  2R5B A;  1JMB A;  4GKG A;  5AW4 B;  3JCU H;  2K1A A;  1BGY J;  3IR9 A;  2M3B A;  3TDK A;  2WWW A;  2PPY A;  2N9B A;  5BVZ A;  2FYU E;  3B4S A;  4JYL A;  1BGY D;  3HE5 B;  4KJM A;  1SG4 A;  1LT9 A;  2AXC A;  1NTM G;  1BDC A;  2YIU C;  2NRG A;  4KWB A;  2YJG A;  4BRY A;  1YTZ T;  3I55 P;  3P8C E;  2OAR A;  3CCR P;  3WUT A;  3TT6 A;  1EZV G;  1SQQ G;  1JNM A;  1PJH A;  3L73 E;  2AXT E;  2VRS A;  2JR8 A;  3C1L A;  1W2B O;  3M6N A;  3H1J J;  1L0N K;  3MP7 B;  3CCV P;  3T8A A;  1Y7O A;  5DKP A;  4W7Y A;  1W5C E;  3HE5 A;  2J58 A;  3H1J D;  5APX A;  3WUV A;  4EML A;  3HE4 A;  1MV8 A;  2ZAE B;  1N86 A;  4RO0 A;  3H32 B;  3L75 J;  1GU5 A;  3AEG C;  3CXH D;  2Q1K A;  3IFM A;  1RF1 B;  1TYF A;  3L70 D;  3L71 G;  1YQ3 C;  1S1C X;  2WVR A;  5JBX A;  1FC2 C;  1BSH A;  3P32 A;  3L75 D;  4Z1M H;  2FFD B;  4ZU2 A;  2K3R A;  1GU4 A;  1L4A D;  4OMR A;  2J5I B;  1LTA C;  2H7H A;  2X58 A;  3OME A;  1UII A;  2IYO A;  1NU1 D;  3SSU A;  4ZDC A;  2F9I B;  3H0J A;  1IFD A;  1LWU B;  3RL0 g;  3KPE A;  2E5T A;  1OXZ A;  3CWB D;  2E74 B;  1M1J B;  1U7M A;  5FUS A;  1AV1 A;  2ZVN B;  3H1H J;  2J5S A;  1CI6 B;  1RF1 A;  2QQ3 A;  2KS1 A;  3S4R A;  1X0T A;  2C0X A;  3RK3 E;  1S72 P;  2JO1 A;  1H8A A;  3R4Y A;  3K5B A;  4H44 B;  3H1H D;  4L76 A;  1URQ B;  4HKZ H;  1EF8 A;  2A45 G;  4FNB A;  5AVY B;  3C9I A;  4ELS A;  1AQ5 A;  1KN7 A;  2ZJS E;  4EI2 A;  3JCU E;  1NO4 A;  2F9I A;  1QVF O;  3L72 E;  1EQ7 A;  4B86 A;  2Z4E A;  1PIX A;  1SVF A;  3H1I D;  3HD7 B;  1KYO D;  4ZDD A;  1SQB G;  2FYU K;  3O6Q A;  3R9Q A;  2NPS B;  5B66 E;  2XV5 A;  1JY2 O;  1M1J A;  1XNV A;  4JYJ A;  4I6M C;  1KFN A;  1CI6 A;  2K9J B;  2OQQ A;  2KNC A;  5CCH C;  3A3Y B;  2A45 H;  3HE2 A;  5DL1 A;  4HDT A;  3UIA A;  3KXD A;  5K5G B;  3ITK A;  4KNP A;  3TGU D;  3U9S B;  3R0O A;  1EDI A;  1RE4 C;  3H1L J;  4TLF A;  1J1D C;  2FFD C;  1NTK E;  1OW8 A;  2BCC G;  1OD4 A;  5BU5 A;  2A06 D;  1NTM E;  1FZB A;  3TNU B;  4I1L A;  4GOF A;  2NPS A;  5KJ7 A;  1LWU C;  5CCH D;  2PG8 A;  3FX0 A;  4IL6 X;  4LK5 A;  3SWK A;  4HYT B;  1BGY G;  2K9J A;  4Q0G A;  4L73 A;  1SQQ E;  2E74 C;  5AW7 B;  2XU6 A;  1SP4 A;  4WYO B;  1EXJ A;  5KLV J;  1OW7 A;  4N6J A;  4F47 A;  2IPP A;  4H44 C;  2J5I I;  1URQ C;  2LR2 A;  3FXD A;  3FDU A;  4MI2 A;  5H2F H;  1VL2 A;  2Y0C A;  1RF0 C;  3MFM A;  5AW0 B;  3QMJ A;  2Z5H A;  2E75 B;  2FBW C;  3KZI E;  1UIX A;  2WTY A;  4JCS A;  2PFX A;  1PP9 J;  5JBW A;  2QJK C;  3HD7 C;  1IFI A;  1HZD A;  2FY8 A;  3MIW A;  3L71 E;  3D70 A;  3A0H E;  4ZKP A;  1PP9 D;  3H1J G;  1HJB A;  2JDI H;  1DEE G;  5AVQ B;  1Z56 A;  2H43 A;  4H44 D;  5E79 H;  5G1S A;  1ZXG A;  1EXI A;  2FXO A;  3VTP C;  3ISA A;  5FIF A;  3L70 G;  4U19 A;  4ZNC A;  3NMD A;  2OYI B;  3AED C;  3L75 G;  1NWQ A;  3MYB A;  3NXS A;  5CTB A;  3LW5 H;  2PRR A;  1ZME C;  2C9N Y;  2WPQ A;  1VQO P;  3JC2 2;  3NTN A;  4R4M A;  4HH2 A;  4PD4 E;  3NJD A;  4EIJ A;  5BU8 B;  3CD6 P;  2Q3E A;  1WZ8 A;  3EFF K;  3CXH H;  1HUC A;  3RGU A;  3KTH A;  5APY A;  1UIY A;  3H0U A;  2J59 M;  1OIP A;  3GKB A;  3AE8 C;  1NTK K;  3H1H G;  2YKP A;  4K35 A;  3O8Z A;  1VQ8 P;  2O1K A;  3JSV C;  2KZI A;  2E42 A;  2K9Y A;  1KQF B;  2WMM A;  4JYB A;  3GF3 A;  2ZL3 A;  1H88 A;  1KIL B;  1SFC B;  1FOS E;  4HC8 A;  2BEZ F;  1RQU A;  3JU1 A;  3ZWA A;  5KDR A;  1PGP A;  2N1T C;  2C0W A;  1SQQ K;  1GK4 A;  2DEO A;  3TSI A;  3TVW A;  3KTJ A;  2QRX A;  1RE3 C;  3KQF A;  4GDO A;  4R4L A;  1RQV A;  1FDO A;  3BRT B;  4IFD K;  3KYQ A;  2BCC E;  1IK7 A;  3N4X A;  1XX4 A;  3AEF C;  3D6Y A;  1LTJ B;  1SQP K;  3TGU G;  5H2F E;  1AFO A;  4EYY Q;  4I7Z B;  1G1J A;  4NAR A;  2OYI C;  3MOY A;  1KYO H;  1SQV J;  3BPP A;  5AW1 B;  3GLM A;  1BGY E;  2A06 G;  2GTR A;  2RMZ A;  2N1T D;  1K73 Q;  1FZC C;  4EMP A;  4WY4 B;  1FDI A;  2M8R A;  3T97 B;  4EMM A;  3B5N B;  1EDJ A;  1YBK A;  3L4F A;  2XND H;  3D6Z A;  1GL2 C;  3CCE P;  4DJG A;  1E79 H;  1T3U A;  1RHZ B;  2M5A A;  2Q5U A;  1LTJ A;  3E1I A;  1NAY A;  4QFE A;  3GMA A;  3MZW B;  1FCF A;  2YKO A;  1JB0 J;  1MUU A;  2CPS A;  4AUW A;  3FF6 A;  3H1J E;  1S9K D;  3CC7 P;  1KIL C;  2IBZ G;  4H13 B;  2Z5I A;  1SFC C;  4UB8 E;  2FYZ A;  4NNQ A;  5APV A;  1KOR A;  3B5N A;  3CXH E;  1GL2 D;  2VSU E;  4JOT A;  1ZLL A;  3BCC E;  3CX5 E;  3L75 E;  1PP9 G;  4PV1 B;  3A5T A;  4YXW H;  1ZRT D;  3VMY A;  3AE5 C;  1GW3 A;  2E43 A;  1YG8 A;  1FZA A;  5DUF A;  3M0D C;  4U3F D;  1R8E A;  3CL3 D;  4PD4 I;  3ZWC A;  2ZYD A;  4IL6 H;  3RBZ A;  1S4X A;  5AVV B;  2W6J H;  2XNX A;  2ZT9 B;  2WSS H;  1BE3 E;  4MOU A;  4I7Z C;  1UYV A;  1KIL D;  1NZY B;  3HUS A;  3RST A;  1S5L E;  1SFC D;  5APQ A;  3M0A A;  4NPE A;  4BWN A;  2DUB A;  3Q0J A;  4OWF A;  4WY4 C;  3G3Z A;  1QVG O;  2C8T A;  2L5G B;  2HW5 A;  1T2K C;  1FOS F;  3EQ2 A;  1QL1 A;  4Y28 J;  2OTJ P;  4OVN F;  4XFJ A;  4OLQ A;  4K2N A;  4O9B A;  3AE2 C;  3R6H A;  4MXI A;  1KB9 E;  5E0S A;  1ZR4 A;  1ZR2 A;  1FS0 E;  1FU1 A;  2V7Q J;  1KYO E;  4I2L C;  3LAO A;  2V4H A;  1MKM A;  1OD2 A;  2GUS A;  1NZY A;  3HP0 A;  2VSU A;  2I1J A;  4TT3 H;  3TK1 A;  3R9T A;  3B8E B;  4WY4 D;  1QL2 A;  1HNU A;  1M8O B;  3HTK A;  1L4A A;  1QX8 A;  3CC2 P;  1T2K D;  5M1B A;  4EOT A;  2JWA A;  5G1Q A;  4H13 C;  1NTZ E;  3HE4 B;  2KUB A;  1XTC C;  4K29 A;  2K37 A;  2L91 A;  4IZB A;  1IFN A;  4HB1 A;  4FB8 A;  2D3T A;  3QRE A;  1VRG A;  3CCU P;  3RL0 B;  1BSN A;  1PFI A;  1N73 B;  1Q51 A;  3TYY A;  3PGQ A;  3LW5 J;  2QJP B;  3ZW8 A;  3H1L E;  2YMK A;  1L2P A;  1FC9 A;  4FND A;  3V2P A;  1FE6 A;  2B89 A;  3GF7 A;  3BVH A;  3IN6 A;  1KV4 A;  1VQK P;  1N6D A;  4ZMD A;  4H13 D;  1GZL A;  1SQX E;  1PPJ G;  3GHG A;  1YIJ P;  4I42 A;  3WUU A;  3FXE A;  1DD4 A;  4XE5 B;  3TVU A;  1P84 E;  3L70 J;  1SQV G;  5APU A;  2FKW B;  1LT9 C;  2O1J A;  1L0N J;  3I5C A;  5MGB A;  2KS1 B;  2CBY A;  2N9Y B;  2IFN A;  1N7S B;  5KLV E;  1N73 A;  2VSU F;  1L0N D;  2XKM A;  2A7K A;  1NU1 J;  1H0T A;  1JOC A;  4DI1 A;  4OGQ B;  1LTI C;  4WB4 A;  4QIJ A;  1JY2 N;  1KQG B;  2IBZ E;  3SFD C;  1S5L X;  3CWB J;  3KHU A;  2O01 J;  5C9G A;  2LKM A;  2I8D A;  2O01 N;  1DCI A;  4FZW A;  4B3J A;  5DZK H;  3CX5 I;  3O6Q B;  1EDL A;  4GHN A;  2HOD A;  3H1K E;  3TF5 A;  5AW9 B;  4WWI A;  1EC5 A;  3KTI A;  5APW A;  2KNC B;  1DH3 A;  4DOJ A;  1KQL A;  3CI9 A;  1N8R Q;  1JCC A;  2OYO A;  1N7S A;  2H88 C;  3CME P;  3MT6 A;  1NH4 A;  1YJN P;  2LXB A;  4JSB A;  2QM7 A;  2ZL0 A;  3A0B H;  1HVV A;  2IZ1 A;  3H1I J;  1RJN A;  1DX7 A;  4U3F G;  2M3E A;  3LID A;  2QJP C;  5CCG A;  1X8Y A;  2H8P D;  4PJ0 H;  3AEC C;  3G6E P;  4RYF A;  4L8K A;  1S2E A;  5DTP A;  3RK3 B;  3V4Q A;  2PGD A;  1ZW0 A;  1USD A;  4D6T J;  1KC8 Q;  1NTZ K;  5CHX A;  1VF5 B;  2A7S A;  5C90 A;  1JY3 O;  2ZYA A;  3TGU J;  1KZU B;  2QM8 A;  1FZG A;  1KB9 I;  5CJ0 A;  1X0U A;  4U0G H;  4D6T D;  1K39 A;  2FYU J;  4JFC A;  3RRV A;  1RF1 C;  5DU6 A;  4ZDB A;  1VQ6 P;  5AVZ B;  5DJT B;  3TDC A;  2FYU D;  4JCQ A;  5KJP A;  5AVT B;  2HPC A;  1Q52 A;  3VP8 A;  1AVO A;  3QWO C;  3P8M C;  1JCD A;  3T8B A;  1IC2 A;  1SQX K;  3OC7 A;  3L73 J;  1OX3 A;  3D71 A;  3USS A;  1NJI Q;  4JJT A;  4J2U A;  2WPS A;  1EZV E;  1KTM A;  1DIP A;  3L73 D;  2ZFC A;  1M1J C;  1EY3 A;  1RY3 A;  3KDP B;  2KXP B;  5C39 A;  2QJY B;  5KLV K;  3AE4 C;  5AVX B;  4AYC A;  2B87 A;  2IFM A;  4C7N B;  4LLH A;  3QWD A;  3DJA A;  2WSE J;  3SWX A;  5GTH H;  2ZVO B;  1IFM A;  5APS A;  2OYH A;  1M56 D;  1LT1 A;  1PPJ E;  2HG5 D;  1A02 J;  1PGO A;  2Q2X A;  1LP1 A;  2KIK A;  1P84 I;  2V7Q H;  1SQV E;  1RJM A;  2KK7 A;  2A81 A;  3TLF A;  1H89 A;  3QYR A;  4YLH A;  1NYH A;  2E74 D;  2P67 A;  4NEK A;  4LC1 A;  2NPS C;  1MJ3 A;  5KJ7 C;  3I47 A;  1FC7 A;  1Q81 Q;  3U59 A;  2F6I A;  3K8X A;  4QII A;  3CCM P;  1G1I A;  3V5B A;  1LTT C;  4JWV A;  2IZ0 A;  1URQ D;  3R2P A;  1WDK A;  4LGD E;  4C7N A;  1AA0 A;  4AQR D;  2YO2 A;  3SWF A;  3VN0 A;  1J2J B;  1HGV A;  1L0N G;  1WRG A;  5KLI B;  2BEQ D;  2QEX P;  1Q7Y Q;  2P10 A;  3HD7 D;  1NU1 G;  1AVY A;  1PGQ A;  2NPS D;  4K3A A;  5KDR B;  2FYN B;  2JP3 A;  3L74 J;  1FDM A;  3MUD A;  3NJB A;  1ZRT E;  3RK2 B;  4U0H A;  3L72 J;  3CWB G;  1OWA A;  5DTW A;  3C8V A;  5INI A;  1UYT A;  1L0L J;  3ST9 A;  3L74 D;  4H0L B;  3W68 A;  3L72 D;  1AJY A;  1ZV8 A;  2QJY C;  3WMM 0;  1KD1 Q;  4CPG A;  1L0L D;  1SQB E;  1YI2 P;  4W80 A;  4ELW A;  1FAV A;  3AE1 C;  1Q86 Q;  1NTM K;  2W8Z A;  3ZDM A;  2CE3 A;  1VQM P;  3KTK A;  2E75 C;  1ON9 A;  3T88 A;  1PZQ A;  4FN8 A;  2QE7 H;  2O01 H;  3H1I G;  4U7J A;  1CZQ A;  2ZYG A;  4I52 A;  5KKZ B;  3M9B A;  4ZKU A;  1JY2 P;  1PGJ A;  1NTK D;  1JY3 P;  1VQ9 P;  4N78 E;  3S1K A;  4DZO A;  5AVU B;  3GW6 A;  4GOD A;  2ZQQ A;  4D6T G;  4EDF A;  1JO5 A;  4JF7 A;  5E0N X;  2M5A B;  5GTH E;  2FZS A;  3PZK A;  1DEB A;  3PEA A;  2E75 D;  2FYU G;  2KB7 P;  1SQV K;  2KZJ A;  1EZV I;  4JCT A;  2VSS E;  3FWL A;  4U0G A;  3AEB C;  3NFQ A;  1Q90 D;  5KAF H;  1QLE D;  1M1K Q;  2KYV A;  1SQP J;  2HYN A;  3PJS K;  4ASW A;  2G8Y A;  2O3J A;  3H81 A;  1FJK A;  1JXZ A;  1SQP D;  1X9V A;  2GM4 A;  3RK2 C;  1FBM A;  3L73 G;  1J1E B;  4RCN A;  2JEE A;  5E79 E;  3U1C A;  4NPD A;  2YO3 A;  1OFC X;  3G71 P;  1OZH A;  2KLU A;  1MFT A;  1VQN P;  3M6M A;  5GTI H;  4H0L C;  2FBM A;  4A7P A;  3H25 A;  3CCL P;  2J5G A;  1JMM A;  5AW8 B;  1GMJ A;  3QXI A;  3F5H A;  3HUS B;  1WDM A;  1N7L A;  1VQP P;  2POH A;  1GDT A;  2XZR A;  3B71 A;  5DU8 A;  2GUV A;  5DJU B;  1LTG C;  3L70 E;  4OH8 B;  1BCC J;  3WU2 H;  1MFZ A;  5KKZ C;  4U3F J;  1DUB A;  3TRR A;  4N3Y B;  1M57 D;  3PRJ A;  1BCC D;  2J5U A;  2VSS A;  2YIU B;  1LTS C; 
#chains in the Genus database with same CATH homology
 3P85 A;  3BPT A;  1WDL A;  5MGB A;  4IZC A;  2CBY A;  3HLN 1;  2PG8 A;  3VIV A;  1K05 A;  4YTP C;  4IL6 X;  4LK5 A;  2VSU F;  2WSF J;  2A7K A;  4Q0G A;  2E74 C;  4DI1 A;  1UYS A;  4OGQ B;  3OT6 A;  4WYO B;  3H0Q A;  4ZDE A;  4QIJ A;  3AE7 C;  1EXJ A;  4FN7 A;  3R9S A;  1KQG B;  3SFD C;  1S5L X;  2MKV A;  1OW7 A;  3S9O A;  1K04 A;  2O01 J;  4F47 A;  5C9G A;  4H44 C;  3LKE A;  3ZWB A;  1DCI A;  2J5I I;  4FZW A;  5IKL B;  2F9Y A;  2NZ2 A;  5DZK H;  4B3J A;  3FDU A;  4MI2 A;  1VL2 A;  4GHN A;  3MFM A;  3FGA D;  3QMJ A;  5KLI C;  4U18 A;  2E75 B;  2FBW C;  2ZQR A;  1UIX A;  3KTI A;  1HJ0 A;  4JCS A;  3Q1M A;  4KT0 J;  1O8U A;  2F6Q A;  4G2R A;  5JBW A;  2QJK C;  1Y9B A;  1HZD A;  1XNW A;  3TV5 A;  5HUQ A;  2WSC J;  2H88 C;  3D70 A;  2FYN C;  3MT6 A;  3SLL A;  4ASI A;  3HIN A;  4JSB A;  2ZL0 A;  1U57 A;  3V5E A;  1RJN A;  3IAV A;  2BZR A;  2QJP C;  4H44 D;  5G1S A;  3AEE C;  1EXI A;  2VSS F;  3AEC C;  4RYF A;  3ISA A;  5FIF A;  4L8K A;  4U19 A;  1OW6 A;  3T89 A;  5DTP A;  3AED C;  3MYB A;  4JVT A;  5CTB A;  4L6W A;  4PV1 C;  1ZME C;  1VF5 B;  2A7S A;  5C90 A;  1ZOY C;  3G64 A;  2E76 C;  4R4M A;  2IDB A;  3TT7 A;  1X0U A;  3NJD A;  4U0G H;  1J7X A;  3SFE C;  1K39 A;  2FW2 A;  3T3W A;  2PBP A;  4JFC A;  3RRV A;  5DU6 A;  4ZDB A;  1WZ8 A;  5L8R J;  2ZT9 C;  3Q3D A;  3BF0 A;  4YXD C;  3KTH A;  3TDC A;  1KMI Z;  2VSU C;  1UIY A;  1XO6 A;  3H0U A;  3N6R B;  4H0L D;  4JCQ A;  2F9Y B;  3DOR A;  5KJP A;  1DD3 A;  2EJ5 A;  3HRX A;  3GKB A;  1Q52 A;  3RSI A;  2UZF A;  1N6E A;  3TZ3 A;  3T8B A;  2D2C B;  1XNY A;  3AE8 C;  3P5M A;  4PV1 D;  3OC7 A;  4RYF H;  3Q2Y A;  3D71 A;  5G1R A;  3U9R B;  2E76 D;  1ON3 A;  4JJT A;  2K9Y A;  1FC6 A;  4J2U A;  1KQF B;  1KTM A;  1DIP A;  3GF3 A;  2ZL3 A;  3ZW9 A;  3Q5P A;  1EY3 A;  4HC8 A;  2NP9 A;  3STA A;  2BEZ F;  1RQU A;  2ZT9 D;  3JU1 A;  3ZWA A;  5KDR A;  3ABV C;  3AE4 C;  2Q34 A;  2DEO A;  3QWD A;  3DJA A;  3TVW A;  2WSE J;  3SWX A;  2Q35 A;  3KTJ A;  2FXP A;  3KQF A;  4GDO A;  3IAO A;  4R4L A;  1NGM B;  1RQV A;  4KD6 A;  1FDO A;  4HNK A;  2Q2X A;  1YG6 A;  1K32 A;  1IK7 A;  4WCZ A;  1RJM A;  3AEA C;  1XX4 A;  3AE6 C;  3QKA A;  2A81 A;  3TLF A;  3AEF C;  2J5G D;  3D6Y A;  3QYR A;  4YLH A;  1N6F A;  1NYH A;  4OG1 A;  2E74 D;  4I7Z B;  4NAR A;  3MOY A;  1OMI A;  4NEK A;  1MJ3 A;  3EWK A;  3BPP A;  3GLM A;  3I47 A;  1WMK A;  1FC7 A;  2F6I A;  3K8X A;  4QII A;  5INF A;  1YQ4 C;  2GTR A;  3PE8 A;  3P2L A;  4EMP A;  2H89 C;  1FDI A;  4JWV A;  3Q7H A;  3T97 B;  1WDK A;  4EMM A;  5DUC A;  2J5I A;  2VRE A;  2PPY A;  3D6Z A;  3QK8 A;  4JYL A;  4FZW C;  2BEQ D;  1SG4 A;  2P10 A;  3G9R A;  1PV3 A;  4JCR A;  5DU4 A;  2YIU C;  4KWB A;  2YJG A;  2QIW A;  4QFE A;  3GMA A;  2D2C C;  5KDR B;  1FCF A;  1ZP0 C;  2JP3 A;  3TT6 A;  1JB0 J;  3NJB A;  1ZRT E;  3Q5R A;  4U0H A;  4U1A A;  5DTW A;  3FF6 A;  3Q0G A;  3C8V A;  1PJH A;  5INI A;  1UYT A;  1TU3 F;  3ST9 A;  4OGQ C;  4ZDF A;  4H13 B;  4H0L B;  2WTB A;  1AJY A;  2QJY C;  4NNQ A;  1KOR A;  3M6N A;  2VSU E;  4JOT A;  3T8A A;  1Y7O A;  4K3W A;  4ELW A;  4PV1 B;  5DKP A;  3AE1 C;  2X24 A;  3AE5 C;  4B3I A;  1W2X A;  5CTC A;  4EML A;  3Q1T A;  1YG8 A;  3KTG A;  2CE3 A;  2D2C D;  3KTK A;  5DUF A;  1HNO A;  2E75 C;  1ON9 A;  3T88 A;  1R8E A;  4FN8 A;  5ING A;  3ZWC A;  2WQY C;  3AEG C;  1TYF A;  4U7J A;  2ZT9 B;  1YQ3 C;  1S1C X;  4MOU A;  5JBX A;  4I52 A;  4I7Z C;  1UYV A;  3BEZ A;  3QXZ A;  4OGQ D;  1NZY B;  4Z1M H;  2IEX A;  3RST A;  4ZU2 A;  3H0S A;  4OMR A;  2J5I B;  3U9T B;  2DUB A;  2X58 A;  3OME A;  2ZQQ A;  3Q0J A;  4Z0M A;  3IB9 A;  2C8T A;  5E0N X;  4ZDC A;  2F9I B;  2HW5 A;  3H0J A;  2FZS A;  1EF9 A;  1TG6 A;  3PZK A;  3RL0 g;  3PEA A;  4Y28 J;  4KPK A;  2E75 D;  4XFJ A;  4OLQ A;  4K2N A;  2E74 B;  4ELX A;  4JCT A;  3AE2 C;  2VSS E;  3R6H A;  1VF5 C;  4MXI A;  5FUS A;  4U0G A;  3AEB C;  1Q90 D;  4RKU J;  2J5S A;  5E0S A;  4FJW D;  2QQ3 A;  3RK3 E;  2V7Q J;  2JO1 A;  3LAO A;  2G8Y A;  1HF9 A;  1MKM A;  3R4Y A;  1OD2 A;  1NZY A;  4H44 B;  3H81 A;  3HP0 A;  3IBB A;  2VSU A;  2ZL4 A;  3L3S A;  3K50 A;  1EF8 A;  4TT3 H;  4FNB A;  4GM2 A;  1JXZ A;  3R9T A;  4ELS A;  1HNU A;  4RCN A;  3V5I A;  1UYR A;  1PL5 A;  5M1B A;  4I4Z A;  5G1Q A;  2F9I A;  3M6M A;  4H13 C;  3AE3 C;  2FBM A;  2WPV B;  4H0L C;  4K29 A;  1PIX A;  3H25 A;  4IZB A;  4WZ8 B;  4ZDD A;  2J5G A;  3O6Q A;  1VF5 D;  1GMJ A;  3R9Q A;  3QXI A;  2ZL2 A;  3WG5 A;  4FB8 A;  2D3T A;  2VX2 A;  3QRE A;  4Q1I A;  2QSI A;  1VRG A;  1XNV A;  4JYJ A;  1Q51 A;  1WDM A;  2OQQ A;  2W3P A;  3PGQ A;  3LW5 J;  3ZW8 A;  3HE2 A;  2YMK A;  1FC9 A;  4FND A;  5DL1 A;  5E0S H;  4HDT A;  4IZD A;  3B71 A;  3H02 A;  3GF7 A;  5DU8 A;  3IN6 A;  4KNP A;  3U9S B;  3R0O A;  5DZK A;  2G3A A;  4B3H A;  3Q5S A;  5KKZ C;  1KIL E;  1N6D A;  4H13 D;  1DUB A;  3TRR A;  4I42 A;  1OW8 A;  1DD4 A;  1OD4 A;  1SZO A;  3TVU A;  2J5U A;  2E76 B;  2VSS A;  3AE9 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...