3GF7A

Glutaconyl-coa decarboxylase a subunit from clostridium symbiosum apoprotein
Total Genus 204
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
204
sequence length
585
structure length
543
Chain Sequence
MYSMPGYFQNMPTIGKELVNPNPENEQEIKAVESDIHESIKKALDAGITSEEKLNERGQLSAMQRINALIDPGTWCPLNSLFNPENNKFGTTNIVNGLGRVDGKWVYIVASDNKKMAGAWVPGQAENLIRCSDAAKMMHLPLIYLLNCSGVEFPNQDKVYPNRRGGGTPFFRNSELNQLGIPVIVGIYGTNPAGGGYHSISPTILIAHQDANMAVGKVPAPGSVPIHYDETGFFREVYQNDLGVIDGIKKYISYLPAYNLEFFRVDTPKAPQLPAEDLYSIIPMNQKRPYDIYEVIARLFDNSEFSEYKKGYGPEMVTGLAKVNGLLVGVIANVQGLLMNYPEYKQNSVGIGGKLYRQGLIKMNEFVTLCARDRIPLIWLQDTTGIDVGDEAEKAELLGLGQSLIYSIENSKLPSLEITIRKASAAAHYVLGGPQGNNTNVFSIGTGACEYYVMPGETAANAMYSRKLQPIIGKMNDMIQMYTDKSRPKYCTEKGMVDEIVDMTEVRPYIQAFTEAAYQNPQSICPMHQMLTPRSTREFETFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase
molecule keywords Glutaconyl-CoA decarboxylase subunit A
publication title An asymmetric model for Na+-translocating glutaconyl-CoA decarboxylases
pubmed doi rcsb
source organism Clostridium symbiosum
total genus 204
structure length 543
sequence length 585
ec nomenclature ec 4.1.1.70: Transferred entry: 7.2.4.5.
pdb deposition date 2009-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01039 Carboxyl_trans Carboxyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.680 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Helix bin 3gf7A01
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3gf7A02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3gf7A03
4I52A 3HINA 1UYVA 4HNKA 1FC7A 4FZWC 4EMMA 3R6HA 2PBPA 3QXIA 3QYRA 3P2LA 3K50A 3KTIA 1SZOA 3GKBA 1FC6A 1EF9A 3SLLA 3U9RB 3R9TA 1HZDA 2QQ3A 3H0QA 4F47A 3T8AA 1MJ3A 5DL1A 1XNYA 4EMLA 4ASIA 4U18A 3PGQA 2BZRA 4YLHA 5E0SA 3DORA 4G2RA 2W3PA 5C9GA 3QKAA 3QWDA 4B3HA 4U1AA 4JCRA 2F9YA 3I47A 1VRGA 1WDMA 3T89A 3FDUA 3TRRA 4NEKA 1K32A 4FNBA 4Q1IA 4GM2A 3ZWCA 3RRVA 2F9YB 3SWXA 1DCIA 3QMJA 3QK8A 4FJWD 1J7XA 4Q0GA 5IKLB 3IAVA 4LK5A 1Q51A 1DUBA 2J5SA 4ZDEA 4ZU2A 2D3TA 2J5II 4FZWA 4Z0MA 3BF0A 4U0HA 4JVTA 3R9QA 2DUBA 4JOTA 4RCNA 2ZL2A 5KJPA 2ZQQA 4JWVA 1OD2A 3IBBA 1K39A 1XX4A 4JSBA 1W2XA 3M6MA 2C8TA 5KDRA 1PIXA 4WCZA 3MFMA 4FN7A 4U0GH 4JYJA 4OG1A 4QFEA 4RYFH 3MT6A 4B3IA 1ON9A 5G1SA 4HC8A 2HW5A 3GF7A 2DEOA 3IB9A 5KDRB 2EJ5A 5INGA 4OMRA 2J5GA 4L6WA 3ST9A 3T3WA 2A7SA 4ELSA 1N6EA 1Q52A 3NJDA 1UYRA 5DUCA 4DI1A 4EMPA 5C90A 4MXIA 1XNWA 4K29A 4K2NA 2A81A 3H0JA 3TV5A 3JU1A 3ZWAA 3PEAA 3GLMA 1FCFA 3L3SA 4ZDBA 3T88A 3MYBA 4U0GA 5E0NX 4JJTA 4RYFA 4L8KA 3KTKA 2F6IA 2X58A 4K3WA 5MGBA 4KPKA 2VX2A 4IZCA 5DTPA 1PJHA 5DKPA 3NJBA 3ISAA 5G1QA 1X0UA 2F9IA 3HE2A 2FBMA 4QIJA 2ZL0A 5DU6A 2VSSF 5DU8A 5DUFA 5FIFA 3RSIA 1WZ8A 2Q2XA 1TG6A 4ELWA 3H0SA 3H0UA 3BEZA 2F9IB 4FN8A 4KWBA 3QREA 1EF8A 3KTGA 1O8UA 4WZ8B 2J5IA 3T8BA 3KTHA 3QXZA 1HNUA 3ZW8A 5DTWA 3MOYA 4OLQA 5JBXA 4B3JA 1TYFA 5G1RA 1EY3A 2WTBA 4ELXA 4KNPA 2J5IB 3G64A 4MI2A 2ZL3A 3U9SB 4JCTA 3V5IA 3P5MA 1OD4A 3VIVA 2F6QA 3FF6A 4JCSA 1HNOA 1SG4A 1UIYA 3HP0A 3PZKA 2VSUF 3TZ3A 2CBYA 2VSUA 3P85A 2UZFA 5CTCA 3R9SA 4I42A 3LAOA 3OC7A 4I4ZA 3N6RB 3HRXA 4JCQA 2VREA 1N6DA 4FB8A 3TT6A 2GTRA 5DZKH 1JXZA 1WDKA 3WG5A 1Y7OA 3ZWBA 3Q1TA 3H81A 3BPPA 4IZDA 4NNQA 2ZQRA 4JYLA 1UYTA 2VSUC 4QIIA 2VSSE 3TVWA 1RJMA 3R0OA 3TLFA 4ZDCA 3H02A 2Q34A 5INFA 3TT7A 2CE3A 4MOUA 4KD6A 3KTJA 3M6NA 1WDLA 2VSSA 3Q0GA 3GF3A 1XNVA 4U19A 5DU4A 3OT6A 5CTBA 2X24A 4JFCA 5FUSA 2J5GD 5DZKA 4ZDFA 2ZL4A 3OMEA 2FZSA 1YG6A 3V5EA 5JBWA 4ZDDA 3U9TB 1ON3A 1YG8A 2A7KA 1XO6A 3TDCA 3KQFA 1N6FA 1RJNA 2IEXA 3RSTA 3ZW9A 4GHNA 3DJAA 1NZYA 5INIA 3K8XA 3GMAA 2FW2A 2PPYA 3Q7HA 3PE8A 1UYSA 3STAA 1FC9A 2VSUE 5E0SH 2NP9A 4FNDA 2PG8A 3Q0JA 4WYOB 4IZBA 3TVUA 1NZYB 3HLN1 2Q35A 3LKEA
chains in the Genus database with same CATH superfamily
1KILA 1GDTA 1UYVA 4EMMA 4WBAA 1NU1D 1ZP0C 3QYRA 3P2LA 3RL0B 5KJ7A 3K50A 1NAYA 2FKWB 3KTIA 4B86A 3U9RB 3R9TA 1OXZA 1LTTC 3H1IJ 1N7SB 2ZYAA 3RL0g 4F47A 3T8AA 1VPCA 2FYNC 4PD4I 2KS1B 4ASIA 4UB8E 3CLQA 1NTKG 1NTZD 5CHXA 1M7LA 1FZCA 3BCCJ 1FOSE 2FFDA 2E75D 2IDBA 2P7JA 1GZLA 3QWDA 1KD1Q 1K05A 1LTIC 4B3HA 3H1JJ 3MP7B 5KLVG 2O01H 2RMZA 1U7JA 3H1KD 1KC8Q 3FDUA 3TRRA 3L75J 1JMMA 4NEKA 1K32A 2K1AA 1KYOI 1YJ9P 3BVHA 3E1RA 2A06D 3V4WA 3CX5H 1RE3A 3F5HA 3ZWCA 2F9YB 4IL6E 1FZEA 2Q6QA 1SS1A 4HJGH 4EI2A 1HGZA 3QMJA 1KB9H 3HRNA 3QK8A 2KLVA 1RF0C 1M1JB 3D71A 3O6QA 2H89C 1FS0E 2WSSH 3BRVB 3IAVA 1BCCE 1MFTA 2N1TD 1DUBA 1K8AQ 2J5SA 2AXTE 2D3TA 1BSNA 2O01J 2AEJA 1SQBD 1EQ7A 2WITA 3F89A 3CD6P 2FYZA 1E79H 2YO2A 4Y99C 2ZQQA 3Q2YA 3IBBA 1X9VA 4XE5B 4JSBA 1OVRA 1DEBA 3H1IG 4YPCA 4WY4B 2R44A 4DOJA 2HYNA 5AVQB 3AE3C 1EDJA 3FXDA 5CCHA 3L4FA 1X0TA 3V2QA 1PGJA 2ZJSE 5CBOA 2NZ2A 2G3AA 3BCCG 2LXCB 3L71D 2RKLA 3A2AA 2DEOA 3H1JG 1P84D 4OMRA 2J5GA 3ST9A 4GOFA 3L75G 2PAJA 1N73B 1CI6A 2FYUK 1ZW0A 1Q52A 2YJGA 3LIDA 5DJTB 3D70A 1NKZB 3AEFC 4U7JA 3O8ZA 2L5GB 1PPJG 4PJ0E 2LR2A 2OTJP 2IBZI 1J1DB 4WVZA 3GLMA 2W90A 1NJIQ 5L8RJ 4ZDBA 1SQQG 4D6TD 3V2NA 3CCRP 1CW5A 3AEGC 3RL0D 1J1DC 4HDTA 5MGBA 2D2CB 2QE7H 4PV1B 2WSEJ 1PJHA 1N7SD 2HODA 3N4XA 3ISAA 3MGNA 3L70E 1JCCA 2W6AA 1W2EA 2AEFA 2NRGA 2W27A 4ELWA 3A0BH 3H0SA 3BEZA 4FN8A 1ZOYC 4KJMA 1GL2A 1DIPA 3QREA 2J5IA 3L74G 3Q5SA 4NARA 4OLQA 5JBXA 2KK7A 4R4LA 1PP9D 2XV5A 3HE4B 2WTBA 4QMAA 1NTME 4EIJA 2KLUA 3Q5PA 2P10A 2W8ZA 1T2KC 2PP6A 2OYHB 2ZL3A 1FE6A 2OGUA 3VTPC 1L0LE 3P5MA 1OD4A 3VIVA 3G4SP 3GW6A 1U57A 1AVYA 1HGVA 1UIYA 2KXPB 1R8EA 3PZKA 4H44C 3D6ZA 1UIIA 2VSUA 2R5BA 3P85A 2UZFA 1L0LJ 3CPWO 4BRYA 3C1LA 2Q7CA 3LAOA 3OC7A 1IK9A 3H1HD 4WY4D 2ZT9B 4I4ZA 1IJDB 2VREA 2XDJA 4GT1A 2Q3IA 1BGYE 5DZKH 3L70D 2ZT9C 4RKUJ 4HH2A 1SQPJ 3VMYA 4W80A 4UB6E 1IO4A 3NFQA 2B88A 3P8MC 3CXHH 1L4AA 4NNQA 3CCEP 5E79H 3MZWB 3M9BA 3MIWA 1JCDA 2KYVA 3TLFA 1YITP 2Q34A 1CZQA 1FDIA 4U3FJ 3V6IA 5AVRB 1KZUB 3CC7P 4L75A 3SSUA 5CBNA 2MKVA 3AE1C 5CTBA 4OWFA 4Y28J 5APUA 4K35A 4I1LA 1AJYA 3CCLP 1NTMD 5DZKA 4GIFA 2PGDA 1VQOP 4ZDDA 1JUNA 4C7RA 2D2CD 1ON3A 2QJYB 5APTA 1YG8A 1PGPA 3TDCA 4PD4D 3KQFA 2M5AB 4GOEA 4PV1D 1N6FA 2BCCJ 1RJNA 3ZW9A 3M0AA 2P2UA 5CCGA 3L72J 1S1CX 1LTJB 2NPSB 3VOPA 3DJAA 3M9QA 4J2UA 1LJ2A 1NZYA 5INIA 4I2LC 2WT7B 2FW2A 2PPYA 3CX5I 3UIAA 2IFNA 5APYA 1PL5A 1LTJC 2NPSC 2PRRA 1KB9I 2V7QH 2WWWA 1BGYD 3Q0JA 4I7ZC 2B9BA 1GMJA 3OW2O 1VQPP 1J2JB 2O3JA 1SQPG 1L0NE 2W6JH 3T97A 1KYOD 1AV1A 2Q35A 1S72P 4I52A 4HNKA 3WU2E 1FC7A 3IFMA 3R6HA 5TJHA 2J5UA 1JTHB 1SQVJ 2IBZE 4U3FG 3BRTB 2E43A 2QQ3A 2WPRA 1BDCA 2QJKB 5KAFE 3H0QA 1SFCC 5GTIH 1MJ3A 1S3JA 1KILB 3AE4C 5B5EE 1LWUC 3PGQA 2BZRA 4YLHA 2V7QJ 4G2RA 4TLFA 2W3PA 1KILC 4TT3H 5KTBA 3II6A 2OYIA 2W6BA 2KUBA 2WPVB 4JCRA 3I47A 4WWIA 1NTKE 1OZHA 3T89A 3H1LJ 2KZJA 2QIWA 3TGUG 2GUSA 2PFXA 1VF5C 2BCCG 3B5NA 1OX3A 3M06A 1FZCB 2FFDB 5KLVE 3L72G 1JO5A 1VQNP 1OVUA 1T6AA 4GM2A 1JNMA 4H13D 1G1JA 1JY2O 3SWXA 2FFDC 2Q9IA 1VQKP 3VMZA 1NU1J 2ITAA 3TYYA 5KLVJ 1MFZA 1RE4C 4Q0GA 5IKLB 1FJKA 2L91A 3KZIH 3VMAA 1L0ND 2J5II 3BF0A 2RN0A 3RK3C 3HD7C 3VP9A 4RJTA 2E76B 3R9QA 2YO3A 1RE3C 4RCNA 1SQVG 3O6QB 5C39A 4JWVA 1KILE 1SFCA 1Y9BA 1QGKB 1JY3O 1SQXJ 3B8EB 1LWUA 2QA4P 1EZVG 2WSFH 4JYJA 3U1CA 3H1IE 1AQTA 4OG1A 3MT6A 5AW5B 1S5LH 4L76A 3MUDA 3EQ2A 5G1SA 2FYNB 1X79B 1W2BO 2EJ5A 3NXSA 4L6WA 2JWDA 3H1LG 1FC2C 5B66H 3BCCE 3B4SA 4ZNCA 2A7SA 3V4QA 3KDPB 2FXPA 3FX0A 2JJLA 3L37A 2WPSA 1UYRA 5DUCA 2IX7C 3H1JE 2R3CA 4MXIA 2YKQA 2JO1A 3JCUH 2YIUC 5CCHC 3L73D 4DT0A 2HG5D 1OVVA 3M0DC 2A81A 3L75E 3AE2C 3I5CA 1P84H 3GHGC 3H0JA 1SQBJ 2O01N 3ZWAA 1OIPA 4JPZB 1CI6B 1NU1G 1RE4A 2KSJA 4EDFA 1HTLC 4IFFA 1PPJE 3P32A 2K3RA 3KTKA 1KQSO 2F6IA 1M56D 4K3WA 3HD7A 2VX2A 1LTGC 1HWTC 5AW3B 1K73Q 1VDFA 3H32A 5DTPA 4BXLA 3K5BA 1SQQE 2IZ0A 2YXRB 3A7OA 5DKPA 1NTZG 1S9KE 5BVZA 5G1QA 1PGOA 1X0UA 3G3ZA 4R4MA 3HE2A 2FBMA 4QIJA 2ZL0A 3VN0A 5KJ7D 4IFDK 5DU8A 1SQXG 1LTAC 1SQQJ 3H1KG 3MHVA 1WZ8A 2HODB 4Y99B 1SP4A 3CXHI 3H1ID 1OWAA 3CX5E 2I1JA 1IC2A 1GU5A 2A06G 4L74A 3CI9A 3KTGA 1KB9E 1JOCA 2B89A 4WZ8B 1Y47A 3T8BA 3KTHA 1HNUA 2IPPA 3HE5A 4H0LD 1MKMA 1JY3P 1GL2B 2N9YB 3B71A 1IFNA 2B87A 3L74E 3M0DA 4D6TJ 5G1RA 4KNPA 3A0HH 2E74D 2QJPC 3GHGA 2J5IB 2Q5UA 1GTWA 1SQBG 4OGQC 1GL2C 3AE8C 3TDKA 5AVWB 3L74J 3CMEP 2G8YA 2F6QA 3FF6A 1JM0A 3RBXA 1PPJD 2E76D 4ZKUA 3TZ3A 1NKNA 2QSIA 5CTCA 3AE6C 2K88A 3HRXA 1LTSC 4LC1A 3CL3D 3LW5H 3TT6A 3L71G 1EZVI 1WDKA 3ZWBA 1DD3A 4GDOA 4BRYB 5APWA 3Q1TA 1BCCD 3BPPA 2R3SA 5TISH 1NTMK 1UYTA 2VSUC 2K37A 3WUVA 2VSSE 1JY3N 5H2FH 1G1IA 1NO4A 1LNQA 1L0LK 3H02A 3TT7A 1KB9D 2CE3A 3RK2B 3ITKA 4KD6A 1L4AB 1FOSF 2M3EA 3Q5RA 1SVFA 3R4YA 2VSSA 2WVRA 3RGUA 1XNVA 5BU8B 3OT6A 2X24A 3RK2C 2J5GD 3LW5J 1FBMA 2YMYA 4D6TG 2Q1KA 1L4AC 2POHA 5H2FE 5KAIH 2ZL4A 5APSA 1WMKA 4C7NA 1GU4A 4YXDC 3S4RA 4EYYQ 1YG6A 5JBWA 1EDIA 3U9TB 2E42A 5AW9B 2HR3A 1IZNB 1GK6A 1H88A 2ZXEB 1X22A 1URQC 3K8XA 1S5LX 3A0BE 1YHQP 4RESB 1UYSA 4GKGA 2VSUE 1XTCC 3PRJA 3STAA 2GM4A 2FYUJ 1USEA 2NP9A 3G9RA 2Z5IA 1AVOA 4H44B 2QEXP 4IZBA 1NZYB 1T3UA 1BE3J 1IFJA 3LKEA 1YI2P 4FZWC 3SWYA 5CCGC 1M90Q 5GTHH 2KB7P 1HUCA 1JEKA 2WQYC 1FDOA 3BASA 3QXIA 1LP1A 1Q2NA 1UIXA 1SQPE 5APXA 2HPCA 2XNXA 2IYOA 3SLLA 1RF1C 1HZDA 3NMDA 1FZAA 2I1KA 3T97B 4N6JA 1KYOH 1VQ6P 1XNYA 2A45H 2OTKE 4U18A 1R5SA 4U3FE 2BEQD 2Y0CA 3IN6A 3G6EP 3DORA 1H0TA 3HUSA 3VYIA 1VL2A 1ZRTE 5CJ4A 3V5BA 3H1HG 1M8OB 1N2DC 3S9OA 1KMIZ 1L0NK 4JF7A 5M1BA 3QWOC 3SFDC 5AW0B 4FNBA 4Q1IA 3V2RA 3CXHE 2OYIB 1URQA 5E79E 3RRVA 3TGUE 1DCIA 2BCCE 2FYUG 2WPQA 1EDLA 1P84I 1QLED 2OYIC 3L72E 3U1AA 3B5NB 1L0LD 3AE7C 1S4XA 2E5TA 1Q51A 3TGUJ 4ZDEA 2E5YA 4ZU2A 1G2CA 1BE3G 4Z0MA 4FZWA 3B5NC 4U0HA 2P58A 4JVTA 2KSEA 3MTUE 1NVOA 2JKVA 3CCSP 5AVZB 1ZN5A 4I7ZB 3P8CE 2XZRA 5KJPA 1SQPD 1ZV8A 1RF1A 1OMIA 1OD2A 1NTKK 3G71P 1W2XA 1RQUA 2W83C 1H89A 1YQ3C 5KDRA 1PIXA 3U59A 4EOTA 3MFMA 5KLVK 4W7ZA 1SQVE 4N78E 1FZBA 2C0WA 1OW8A 1KORA 4U3FD 1NH4A 1LT9C 2RH0A 1YYCA 3KHUA 2OYOA 1NWQA 1SFCB 3CWBJ 4HC8A 3CCUP 4O9BA 2KOGA 1HH0A 5INGA 1EZVE 1AFOA 1KQLA 4M3LA 2KI7B 1LWUB 1T2KD 1LGHB 3T3WA 3PP5A 1KTMA 1N6EA 2E75C 1RY3A 4DI1A 5C90A 3A5TA 1XNWA 4K29A 2Z5HA 1KFNA 3H1LE 4H44D 1FZGA 2BCCD 2A45G 1VF5B 2M3BA 3MUDC 1K04A 5APVA 3FWNA 1PFIA 3T88A 3WUTA 5GTIE 1HJ0A 4JJTA 4L8KA 4I6MC 2ZT9D 4KPKA 2JR8A 3TF5A 1QL2A 2SPZA 1NU1E 4IZCA 2HFED 3CMAP 5KLIC 3OAKA 3P8CD 2H43A 4AYCA 1HVVA 3TNUA 5KKZC 2OQQA 2N1TC 2F9IA 2K9JA 2O1JA 5AVTB 4HYTB 2HLOA 1Q7YQ 5DUFA 3RK3B 3HD7B 1X8YA 5FIFA 3H32B 3PHLA 2Q2XA 1NTZE 3NTNA 1YBKA 4L73A 1LT9A 1VQ8P 1S2EA 2VRSA 5AVUB 3H0UA 1NAFA 1SQXE 3CWBG 2KNCA 4KWBA 1A02F 4OVNF 3WMM0 4DCKA 3L73J 1Z56A 3H1KE 3VP8A 3SFEC 1QL1A 1O8UA 1NTZJ 2J59M 2IBZD 1YIJP 3QXZA 5DTWA 1NOHA 1WRGA 3SWFA 3MOYA 1QVGO 1ZXGA 3N7NA 1KFMA 1VQ7P 3KZIE 1USDA 3D6YA 2A06E 3TK1A 4LGDE 3AECC 3H1KJ 1SQQK 1FJPA 3PTZA 4ELXA 3H1LD 3EFFK 4MI2A 1FU1A 4MN4C 2JDIH 3U9SB 4JYBA 3V5IA 1TU3F 3HE5B 1NTKD 2YIUB 4JCSA 1SG4A 2NPSD 3HP0A 4UB8H 2B87B 1JMBA 3TSIA 1N8RQ 2CBYA 2J58A 1SQBE 3GHGB 3SWKA 5KLVD 3R9SA 2CPBA 2OARA 4IFMA 2JEEA 1S5LE 1N6DA 2N1TA 1VQ5P 3RK3E 3A3YB 2I8DA 1PV3A 3RL0C 3WG5A 2R32A 2WSFJ 5B66E 1OW6A 3OJAB 3H81A 1N7SC 1SLQA 1SFCD 1YJWP 4JYCA 1DEEG 3L71E 4CPGA 3JCUE 3TVWA 4IL6H 2K9YA 3R0OA 1Q90D 1SQXD 3KPEA 4ZDCA 3HTKA 1P84E 3L73G 5INFA 1BDDA 1AQ5A 2JWAA 1KILD 1JB0J 1DD4A 2XNDH 3L71J 1JY2P 2JP3A 3KTJA 3VMXA 1PZQA 3M6NA 2AXTH 1WDLA 3GF3A 1RH5B 4U19A 3CCQP 2N9BA 3IR9A 5FUSA 3M9HA 2A45I 1OFCX 1VF5D 4DJGA 4A7PA 2CK3H 3ABVC 3OA7A 1EXJA 2YKPA 3CCVP 1EC5A 2C9LY 4NPDA 4ASWA 4YXWH 4D6TE 2A7KA 2FY8A 1M1JC 1W5CE 3AEAC 3BCCD 2IEXA 5CJ0A 2QJPB 2WZ7A 5APQA 2ZYDA 2QRXA 1MZ9A 3H1JD 3PLNA 4OGQB 2YNYA 4C7NB 3Q7HA 1BCCJ 3PE8A 1E5WA 3L75D 1FC9A 4JQ0D 5E0SH 3BPTA 3RK3D 1L2PA 3HD7D 1NGMB 1FZFA 4FNDA 2FXOA 4WYOB 3IAOA 2ZAEB 4YTPC 3TVUA 3CCMP 1JY2N 1N7SA 4WY4C 3HINA 5CMZA 5AW1B 2KS1A 4XA4A 2PBPA 2GUVA 5HUQA 4KT0J 4PJ0H 1LT1A 1SZOA 3A0HE 3GKBA 1FC6A 4NPEA 1SQQD 1EF9A 3RBZA 1S9KD 1R5LA 2WSEH 1PP9E 5DL1A 1YTZI 2LXBA 4EMLA 3CC4P 2ZXXA 1KQFB 1N73C 3QH9A 1LP1B 5E0SA 1GD2E 2HPCB 3FXEA 5C9GA 1PP9J 3CX5D 1RF0A 1OW7A 3QKAA 1QX8A 2Y0DA 4U1AA 5CCHD 3KQGA 2F9YA 1ZR2A 5AVSB 5AW4B 4AUWA 1VRGA 3L35A 1WDMA 2ZVNB 1M1JA 2QVAA 5AW8B 2V4HA 1H0TB 3HUSB 2C9NY 3MD0A 3R2PA 5TISE 3H1HE 1SQPK 3GG2A 3L74D 1BCCG 2D2CC 3HUSC 3EWKA 4PV1C 4FJWD 5AW7B 2YKOA 2XU6A 1J7XA 4XFJA 3H1HJ 4C46A 2QM7A 4LK5A 4WY4A 1URQB 1K9MQ 2MJZA 1HBWA 2FYUE 1ZLLA 3L70J 1GK4A 4IOIH 1FAVA 2DUBA 4JOTA 3L36A 2ZL2A 5KAIE 4HKZH 1K39A 1XX4A 2IYPA 1BE3E 3M6MA 5DJUB 1VQMP 1N7LA 2C8TA 4PD4H 1G2CB 4WCZA 3CC2P 4FN7A 1KN7A 2M8RA 1N73A 3JSVC 4U0GH 2ZYGA 2Y9ZA 2M0BA 1RF1B 4W7YA 4QFEA 4RYFH 1IFMA 1PP9G 1XTGB 3Q3DA 4B3IA 1ON9A 1Q82Q 3GF7A 2HW5A 3IB9A 5KDRB 1QEXA 1NTMJ 1PGQA 4PD4E 1Q81Q 2OYHC 3USSA 1RQVA 2ZVOB 5AW6B 1M57D 3C8VA 4UB6H 1J1EB 4OGQD 4ELSA 1GL2D 3NJDA 3V2PA 3CCJP 4EMPA 3Q1MA 3ZDMA 5K5GB 3AEDC 4K2NA 4IL6X 3KXDA 2ZFCA 1J1EC 5GTHE 2CPSA 1HF9A 3TV5A 4H13B 3JU1A 3PEAA 1KQGB 5AW2B 3PJSK 3L3SA 1FCFA 3BATA 3MYBA 1SQVK 1IK7A 4U0GA 5E0NX 3E7KA 1KYOE 4H13C 4RYFA 4AQRD 1IFPA 3M91A 2IFMA 2X58A 2FYUD 1BGYJ 5AVYB 3L70G 1VQLP 1T3JA 3H25A 1M1KQ 5AVXB 4NPFX 3NJBA 4Z1MH 3W67A 1BE3D 5DU6A 2VSSF 2WSCH 1EDKA 1T8ZA 1IFDA 1LTBC 3RSIA 1WT6A 3AEEC 1QVFO 2QM8A 2XKMA 4JBZA 2P1JA 1TG6A 3TNUB 1A02J 2F9IB 2K9JB 3HE4A 3RK2D 1EF8A 1YQ4C 4WB4A 1L4AD 1GW3A 3LIEA 2OYHA 1NTMG 3ZW8A 1RHZB 4B3JA 1TYFA 2H88C 1YJNP 1LT9B 1D7MA 3CWBE 1NU1K 1L0LG 2QG4A 3WU2H 2QJYC 2KNCB 1VQ4P 2Y0EA 1EY3A 1EXIA 1CSBA 2KIKA 2OTLP 3FGAD 2WSCJ 3G64A 1DX7A 2YMKA 5KAFH 4JCTA 1URQD 2E75B 1ZRTD 2Q3EA 1KV4A 1Q86Q 1MUUA 1HNOA 5B5EH 1NTZK 3C9IA 3PH0A 2VSUF 1BGYG 2KP8A 1SQXK 4I42A 3CXHD 1L0NJ 3N6RB 1ZR4A 4JCQA 3TGUD 1FDMA 2C0XA 5CCGD 4FB8A 2GTRA 5BU5A 3AE9C 1JXZA 3L72D 1Y7OA 3S1KA 3P7KA 4K3AA 2QJKC 4IZDA 5KLIB 1NYHA 1YTZT 2ZQRA 4JYLA 2IZ1A 5KKZB 4QIIA 2LKMA 3EFGA 2KZIA 3I55P 1RJMA 2N1TB 4ZMDA 4BWNA 3I56P 5KJ7C 4DZOA 3WUUA 2O1KA 3AEBC 2R5DA 4MOUA 1MV8A 2H7HA 2AEMA 1SQBK 1NHLA 2FXMA 3CWBD 3Q0GA 4N3YB 5DU4A 2YXQB 4JFCA 2WMMA 1SQVD 3L73E 4N78D 2M5AA 1NTKJ 3HTKB 2P67A 4H0LB 1FZCC 3JC22 4LLHA 4ZDFA 1LTJA 2NPSA 1ZMEC 3OMEA 1HJBA 2H8PD 2WT7A 3H6PA 2FZSA 2E74B 3FWLA 3V5EA 4H0LC 1Y8AA 1EZVD 4HB1A 1XO6A 3IF4A 4GODA 1N86A 1AA0A 1VQ9P 3RSTA 2E74C 4GHNA 2DW3A 4OH8B 2Z4EA 2WTYA 3GMAA 5EFWB 1L0NG 1H8AA 2GA1A 2AXCA 2FBWC 3KYQA 3E1IA 3AE5C 3B5ND 2BEZF 4KHXA 3W68A 1U7MA 4ZKPA 2E76C 1JTHA 2PG8A 5AVVB 4RO0A 1GW4A 4ASVA 2Y9YA 1DH3A 2IBZG 2BASA 1BSHA 3HLN1 2UWJE 1IFIA
chains in the Genus database with same CATH topology
4I52A 3HINA 1UYVA 4HNKA 1FC7A 4FZWC 4EMMA 3R6HA 2PBPA 5HUQA 2J5UA 2WQYC 3QXIA 1FDOA 1ZP0C 3QYRA 3P2LA 4KT0J 3K50A 1UIXA 3KTIA 1SZOA 3GKBA 1FC6A 1EF9A 3SLLA 3U9RB 3R9TA 1HZDA 2QQ3A 3H0QA 3T97B 3RL0g 4F47A 3T8AA 2FYNC 1MJ3A 5DL1A 3AE4C 1XNYA 4EMLA 4ASIA 1KQFB 4U18A 3PGQA 2BEQD 2BZRA 4YLHA 2V7QJ 5E0SA 3IN6A 3DORA 4G2RA 2W3PA 4TT3H 2E75D 2IDBA 5C9GA 3QKAA 1OW7A 3QWDA 1K05A 4B3HA 4U1AA 1VL2A 2WPVB 1ZRTE 2F9YA 3I47A 4JCRA 3S9OA 1KMIZ 1VRGA 1WDMA 5M1BA 3T89A 3FDUA 3TRRA 2QIWA 4NEKA 1VF5C 1K32A 3SFDC 4FNBA 4Q1IA 4GM2A 4H13D 3ZWCA 3RRVA 2F9YB 3SWXA 1DCIA 2D2CC 3QMJA 3EWKA 4PV1C 3QK8A 4FJWD 1J7XA 3D71A 4XFJA 3O6QA 2H89C 4Q0GA 5IKLB 3AE7C 3IAVA 4LK5A 1Q51A 1DUBA 2J5SA 4ZDEA 4ZU2A 2D3TA 2O01J 2J5II 4FZWA 4Z0MA 3BF0A 4U0HA 4JVTA 2E76B 3R9QA 2DUBA 4JOTA 4RCNA 4I7ZB 2ZL2A 5KJPA 2ZQQA 4JWVA 3Q2YA 1OMIA 1KILE 1OD2A 3IBBA 1K39A 1XX4A 4JSBA 1W2XA 3M6MA 1RQUA 1Y9BA 2C8TA 1YQ3C 5KDRA 1PIXA 3AE3C 4WCZA 3MFMA 4FN7A 1OW8A 1KORA 4U0GH 4JYJA 2NZ2A 4OG1A 2G3AA 4QFEA 4RYFH 3MT6A 3Q3DA 4B3IA 1ON9A 5G1SA 4HC8A 2HW5A 3GF7A 2DEOA 3IB9A 5KDRB 2EJ5A 5INGA 4OMRA 2J5GA 4L6WA 3ST9A 3T3WA 1RQVA 2A7SA 3C8VA 2FXPA 1KTMA 4OGQD 4ELSA 1N6EA 2E75C 1Q52A 3NJDA 2YJGA 1UYRA 5DUCA 4DI1A 4EMPA 3Q1MA 4MXIA 5C90A 3D70A 2JO1A 1XNWA 2YIUC 4K29A 3AEFC 3AEDC 4U7JA 4K2NA 4IL6X 2A81A 4H44D 3AE2C 1HF9A 3H0JA 3TV5A 4H13B 3JU1A 3ZWAA 1VF5B 3PEAA 1KQGB 1K04A 3GLMA 1FCFA 3L3SA 5L8RJ 4ZDBA 3T88A 3MYBA 1IK7A 4U0GA 5E0NX 1HJ0A 4JJTA 4H13C 4RYFA 3AEGC 4L8KA 3KTKA 2F6IA 2X58A 4HDTA 2ZT9D 4K3WA 2D2CB 5MGBA 4KPKA 2VX2A 4IZCA 4PV1B 5DTPA 5KLIC 2WSEJ 1PJHA 3H25A 5DKPA 3NJBA 5KKZC 3ISAA 2OQQA 4Z1MH 5G1QA 1X0UA 4R4MA 2F9IA 3HE2A 2FBMA 4QIJA 2ZL0A 5DU6A 2VSSF 5DU8A 5DUFA 5FIFA 3RSIA 1WZ8A 2Q2XA 3AEEC 1TG6A 4ELWA 3H0SA 3H0UA 3BEZA 2F9IB 4FN8A 1ZOYC 4KWBA 1DIPA 3QREA 1EF8A 3KTGA 3SFEC 1O8UA 1YQ4C 4WZ8B 2J5IA 3T8BA 3Q5SA 3KTHA 4NARA 3QXZA 1HNUA 3ZW8A 5DTWA 3MOYA 4OLQA 5JBXA 4B3JA 1TYFA 2H88C 4R4LA 3D6YA 4H0LD 1MKMA 3AECC 2QJYC 3B71A 5G1RA 1EY3A 2WTBA 4ELXA 1EXIA 4KNPA 3Q5PA 2E74D 2QJPC 3FGAD 2J5IB 2WSCJ 3G64A 2P10A 4MI2A 2ZL3A 2YMKA 4OGQC 3U9SB 3AE8C 4JCTA 3V5IA 3P5MA 2E75B 1OD4A 1TU3F 3VIVA 2G8YA 2F6QA 3FF6A 1U57A 4JCSA 1HNOA 1SG4A 1UIYA 3HP0A 1R8EA 3PZKA 2E76D 4H44C 3D6ZA 2VSUF 2CBYA 2VSUA 3TZ3A 3P85A 2UZFA 2QSIA 5CTCA 3R9SA 3AE6C 4I42A 3LAOA 3OC7A 2ZT9B 4I4ZA 3N6RB 3HRXA 4JCQA 2VREA 1N6DA 3RK3E 4FB8A 3TT6A 1PV3A 2GTRA 5DZKH 3AE9C 1JXZA 1WDKA 2ZT9C 3WG5A 4RKUJ 2WSFJ 1Y7OA 3ZWBA 1DD3A 1OW6A 4GDOA 2QJKC 3Q1TA 3H81A 3BPPA 4IZDA 1NYHA 4NNQA 2ZQRA 4JYLA 1UYTA 2VSUC 4QIIA 2VSSE 3TVWA 2K9YA 1RJMA 3R0OA 1Q90D 3TLFA 4ZDCA 3H02A 2Q34A 5INFA 3TT7A 1FDIA 2CE3A 3AEBC 1JB0J 1DD4A 4MOUA 4KD6A 2JP3A 3KTJA 3M6NA 3Q5RA 1WDLA 3R4YA 2VSSA 3Q0GA 3GF3A 2MKVA 1XNVA 4U19A 5DU4A 3AE1C 3OT6A 5CTBA 2X24A 4JFCA 5FUSA 4Y28J 2J5GD 3LW5J 1AJYA 1VF5D 4H0LB 5DZKA 4ZDFA 3ABVC 2ZL4A 1EXJA 1ZMEC 3OMEA 1WMKA 2FZSA 2E74B 4YXDC 1YG6A 3V5EA 4H0LC 5JBWA 4ZDDA 3U9TB 2D2CD 1ON3A 1YG8A 1XO6A 2A7KA 3TDCA 3KQFA 4PV1D 1N6FA 3AEAC 1RJNA 2IEXA 3RSTA 2E74C 3ZW9A 4GHNA 1S1CX 3DJAA 4J2UA 4OGQB 1NZYA 5INIA 3K8XA 3GMAA 2FW2A 2PPYA 3Q7HA 1S5LX 3PE8A 1PL5A 1UYSA 3STAA 1FC9A 2FBWC 2VSUE 3AE5C 5E0SH 3BPTA 2BEZF 1NGMB 2E76C 2NP9A 3G9RA 4FNDA 4H44B 2PG8A 3Q0JA 4I7ZC 4WYOB 3IAOA 4YTPC 1GMJA 4IZBA 3TVUA 1NZYB 3HLN1 2Q35A 3LKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I52 A;  3HIN A;  1UYV A;  4HNK A;  1FC7 A;  4FZW C;  4EMM A;  3R6H A;  2PBP A;  3QXI A;  3QYR A;  3P2L A;  3K50 A;  3KTI A;  1SZO A;  3GKB A;  1FC6 A;  1EF9 A;  3SLL A;  3U9R B;  3R9T A;  1HZD A;  2QQ3 A;  3H0Q A;  4F47 A;  3T8A A;  1MJ3 A;  5DL1 A;  1XNY A;  4EML A;  4ASI A;  4U18 A;  3PGQ A;  2BZR A;  4YLH A;  5E0S A;  3DOR A;  4G2R A;  2W3P A;  5C9G A;  3QKA A;  3QWD A;  4B3H A;  4U1A A;  4JCR A;  2F9Y A;  3I47 A;  1VRG A;  1WDM A;  3T89 A;  3FDU A;  3TRR A;  4NEK A;  1K32 A;  4FNB A;  4Q1I A;  4GM2 A;  3ZWC A;  3RRV A;  2F9Y B;  3SWX A;  1DCI A;  3QMJ A;  3QK8 A;  4FJW D;  1J7X A;  4Q0G A;  5IKL B;  3IAV A;  4LK5 A;  1Q51 A;  1DUB A;  2J5S A;  4ZDE A;  4ZU2 A;  2D3T A;  2J5I I;  4FZW A;  4Z0M A;  3BF0 A;  4U0H A;  4JVT A;  3R9Q A;  2DUB A;  4JOT A;  4RCN A;  2ZL2 A;  5KJP A;  2ZQQ A;  4JWV A;  1OD2 A;  3IBB A;  1K39 A;  1XX4 A;  4JSB A;  1W2X A;  3M6M A;  2C8T A;  5KDR A;  1PIX A;  4WCZ A;  3MFM A;  4FN7 A;  4U0G H;  4JYJ A;  4OG1 A;  4QFE A;  4RYF H;  3MT6 A;  4B3I A;  1ON9 A;  5G1S A;  4HC8 A;  2HW5 A;  3GF7 A;  2DEO A;  3IB9 A;  5KDR B;  2EJ5 A;  5ING A;  4OMR A;  2J5G A;  4L6W A;  3ST9 A;  3T3W A;  2A7S A;  4ELS A;  1N6E A;  1Q52 A;  3NJD A;  1UYR A;  5DUC A;  4DI1 A;  4EMP A;  5C90 A;  4MXI A;  1XNW A;  4K29 A;  4K2N A;  2A81 A;  3H0J A;  3TV5 A;  3JU1 A;  3ZWA A;  3PEA A;  3GLM A;  1FCF A;  3L3S A;  4ZDB A;  3T88 A;  3MYB A;  4U0G A;  5E0N X;  4JJT A;  4RYF A;  4L8K A;  3KTK A;  2F6I A;  2X58 A;  4K3W A;  5MGB A;  4KPK A;  2VX2 A;  4IZC A;  5DTP A;  1PJH A;  5DKP A;  3NJB A;  3ISA A;  5G1Q A;  1X0U A;  2F9I A;  3HE2 A;  2FBM A;  4QIJ A;  2ZL0 A;  5DU6 A;  2VSS F;  5DU8 A;  5DUF A;  5FIF A;  3RSI A;  1WZ8 A;  2Q2X A;  1TG6 A;  4ELW A;  3H0S A;  3H0U A;  3BEZ A;  2F9I B;  4FN8 A;  4KWB A;  3QRE A;  1EF8 A;  3KTG A;  1O8U A;  4WZ8 B;  2J5I A;  3T8B A;  3KTH A;  3QXZ A;  1HNU A;  3ZW8 A;  5DTW A;  3MOY A;  4OLQ A;  5JBX A;  4B3J A;  1TYF A;  5G1R A;  1EY3 A;  2WTB A;  4ELX A;  4KNP A;  2J5I B;  3G64 A;  4MI2 A;  2ZL3 A;  3U9S B;  4JCT A;  3V5I A;  3P5M A;  1OD4 A;  3VIV A;  2F6Q A;  3FF6 A;  4JCS A;  1HNO A;  1SG4 A;  1UIY A;  3HP0 A;  3PZK A;  2VSU F;  3TZ3 A;  2CBY A;  2VSU A;  3P85 A;  2UZF A;  5CTC A;  3R9S A;  4I42 A;  3LAO A;  3OC7 A;  4I4Z A;  3N6R B;  3HRX A;  4JCQ A;  2VRE A;  1N6D A;  4FB8 A;  3TT6 A;  2GTR A;  5DZK H;  1JXZ A;  1WDK A;  3WG5 A;  1Y7O A;  3ZWB A;  3Q1T A;  3H81 A;  3BPP A;  4IZD A;  4NNQ A;  2ZQR A;  4JYL A;  1UYT A;  2VSU C;  4QII A;  2VSS E;  3TVW A;  1RJM A;  3R0O A;  3TLF A;  4ZDC A;  3H02 A;  2Q34 A;  5INF A;  3TT7 A;  2CE3 A;  4MOU A;  4KD6 A;  3KTJ A;  3M6N A;  1WDL A;  2VSS A;  3Q0G A;  3GF3 A;  1XNV A;  4U19 A;  5DU4 A;  3OT6 A;  5CTB A;  2X24 A;  4JFC A;  5FUS A;  2J5G D;  5DZK A;  4ZDF A;  2ZL4 A;  3OME A;  2FZS A;  1YG6 A;  3V5E A;  5JBW A;  4ZDD A;  3U9T B;  1ON3 A;  1YG8 A;  2A7K A;  1XO6 A;  3TDC A;  3KQF A;  1N6F A;  1RJN A;  2IEX A;  3RST A;  3ZW9 A;  4GHN A;  3DJA A;  1NZY A;  5INI A;  3K8X A;  3GMA A;  2FW2 A;  2PPY A;  3Q7H A;  3PE8 A;  1UYS A;  3STA A;  1FC9 A;  2VSU E;  5E0S H;  2NP9 A;  4FND A;  2PG8 A;  3Q0J A;  4WYO B;  4IZB A;  3TVU A;  1NZY B;  3HLN 1;  2Q35 A;  3LKE A; 
#chains in the Genus database with same CATH topology
 1KIL A;  1GDT A;  1UYV A;  4EMM A;  4WBA A;  1NU1 D;  1ZP0 C;  3QYR A;  3P2L A;  3RL0 B;  5KJ7 A;  3K50 A;  1NAY A;  2FKW B;  3KTI A;  4B86 A;  3U9R B;  3R9T A;  1OXZ A;  1LTT C;  3H1I J;  1N7S B;  2ZYA A;  3RL0 g;  4F47 A;  3T8A A;  1VPC A;  2FYN C;  4PD4 I;  2KS1 B;  4ASI A;  4UB8 E;  3CLQ A;  1NTK G;  1NTZ D;  5CHX A;  1M7L A;  1FZC A;  3BCC J;  1FOS E;  2FFD A;  2E75 D;  2IDB A;  2P7J A;  1GZL A;  3QWD A;  1KD1 Q;  1K05 A;  1LTI C;  4B3H A;  3H1J J;  3MP7 B;  5KLV G;  2O01 H;  2RMZ A;  1U7J A;  3H1K D;  1KC8 Q;  3FDU A;  3TRR A;  3L75 J;  1JMM A;  4NEK A;  1K32 A;  2K1A A;  1KYO I;  1YJ9 P;  3BVH A;  3E1R A;  2A06 D;  3V4W A;  3CX5 H;  1RE3 A;  3F5H A;  3ZWC A;  2F9Y B;  4IL6 E;  1FZE A;  2Q6Q A;  1SS1 A;  4HJG H;  4EI2 A;  1HGZ A;  3QMJ A;  1KB9 H;  3HRN A;  3QK8 A;  2KLV A;  1RF0 C;  1M1J B;  3D71 A;  3O6Q A;  2H89 C;  1FS0 E;  2WSS H;  3BRV B;  3IAV A;  1BCC E;  1MFT A;  2N1T D;  1DUB A;  1K8A Q;  2J5S A;  2AXT E;  2D3T A;  1BSN A;  2O01 J;  2AEJ A;  1SQB D;  1EQ7 A;  2WIT A;  3F89 A;  3CD6 P;  2FYZ A;  1E79 H;  2YO2 A;  4Y99 C;  2ZQQ A;  3Q2Y A;  3IBB A;  1X9V A;  4XE5 B;  4JSB A;  1OVR A;  1DEB A;  3H1I G;  4YPC A;  4WY4 B;  2R44 A;  4DOJ A;  2HYN A;  5AVQ B;  3AE3 C;  1EDJ A;  3FXD A;  5CCH A;  3L4F A;  1X0T A;  3V2Q A;  1PGJ A;  2ZJS E;  5CBO A;  2NZ2 A;  2G3A A;  3BCC G;  2LXC B;  3L71 D;  2RKL A;  3A2A A;  2DEO A;  3H1J G;  1P84 D;  4OMR A;  2J5G A;  3ST9 A;  4GOF A;  3L75 G;  2PAJ A;  1N73 B;  1CI6 A;  2FYU K;  1ZW0 A;  1Q52 A;  2YJG A;  3LID A;  5DJT B;  3D70 A;  1NKZ B;  3AEF C;  4U7J A;  3O8Z A;  2L5G B;  1PPJ G;  4PJ0 E;  2LR2 A;  2OTJ P;  2IBZ I;  1J1D B;  4WVZ A;  3GLM A;  2W90 A;  1NJI Q;  5L8R J;  4ZDB A;  1SQQ G;  4D6T D;  3V2N A;  3CCR P;  1CW5 A;  3AEG C;  3RL0 D;  1J1D C;  4HDT A;  5MGB A;  2D2C B;  2QE7 H;  4PV1 B;  2WSE J;  1PJH A;  1N7S D;  2HOD A;  3N4X A;  3ISA A;  3MGN A;  3L70 E;  1JCC A;  2W6A A;  1W2E A;  2AEF A;  2NRG A;  2W27 A;  4ELW A;  3A0B H;  3H0S A;  3BEZ A;  4FN8 A;  1ZOY C;  4KJM A;  1GL2 A;  1DIP A;  3QRE A;  2J5I A;  3L74 G;  3Q5S A;  4NAR A;  4OLQ A;  5JBX A;  2KK7 A;  4R4L A;  1PP9 D;  2XV5 A;  3HE4 B;  2WTB A;  4QMA A;  1NTM E;  4EIJ A;  2KLU A;  3Q5P A;  2P10 A;  2W8Z A;  1T2K C;  2PP6 A;  2OYH B;  2ZL3 A;  1FE6 A;  2OGU A;  3VTP C;  1L0L E;  3P5M A;  1OD4 A;  3VIV A;  3G4S P;  3GW6 A;  1U57 A;  1AVY A;  1HGV A;  1UIY A;  2KXP B;  1R8E A;  3PZK A;  4H44 C;  3D6Z A;  1UII A;  2VSU A;  2R5B A;  3P85 A;  2UZF A;  1L0L J;  3CPW O;  4BRY A;  3C1L A;  2Q7C A;  3LAO A;  3OC7 A;  1IK9 A;  3H1H D;  4WY4 D;  2ZT9 B;  4I4Z A;  1IJD B;  2VRE A;  2XDJ A;  4GT1 A;  2Q3I A;  1BGY E;  5DZK H;  3L70 D;  2ZT9 C;  4RKU J;  4HH2 A;  1SQP J;  3VMY A;  4W80 A;  4UB6 E;  1IO4 A;  3NFQ A;  2B88 A;  3P8M C;  3CXH H;  1L4A A;  4NNQ A;  3CCE P;  5E79 H;  3MZW B;  3M9B A;  3MIW A;  1JCD A;  2KYV A;  3TLF A;  1YIT P;  2Q34 A;  1CZQ A;  1FDI A;  4U3F J;  3V6I A;  5AVR B;  1KZU B;  3CC7 P;  4L75 A;  3SSU A;  5CBN A;  2MKV A;  3AE1 C;  5CTB A;  4OWF A;  4Y28 J;  5APU A;  4K35 A;  4I1L A;  1AJY A;  3CCL P;  1NTM D;  5DZK A;  4GIF A;  2PGD A;  1VQO P;  4ZDD A;  1JUN A;  4C7R A;  2D2C D;  1ON3 A;  2QJY B;  5APT A;  1YG8 A;  1PGP A;  3TDC A;  4PD4 D;  3KQF A;  2M5A B;  4GOE A;  4PV1 D;  1N6F A;  2BCC J;  1RJN A;  3ZW9 A;  3M0A A;  2P2U A;  5CCG A;  3L72 J;  1S1C X;  1LTJ B;  2NPS B;  3VOP A;  3DJA A;  3M9Q A;  4J2U A;  1LJ2 A;  1NZY A;  5INI A;  4I2L C;  2WT7 B;  2FW2 A;  2PPY A;  3CX5 I;  3UIA A;  2IFN A;  5APY A;  1PL5 A;  1LTJ C;  2NPS C;  2PRR A;  1KB9 I;  2V7Q H;  2WWW A;  1BGY D;  3Q0J A;  4I7Z C;  2B9B A;  1GMJ A;  3OW2 O;  1VQP P;  1J2J B;  2O3J A;  1SQP G;  1L0N E;  2W6J H;  3T97 A;  1KYO D;  1AV1 A;  2Q35 A;  1S72 P;  4I52 A;  4HNK A;  3WU2 E;  1FC7 A;  3IFM A;  3R6H A;  5TJH A;  2J5U A;  1JTH B;  1SQV J;  2IBZ E;  4U3F G;  3BRT B;  2E43 A;  2QQ3 A;  2WPR A;  1BDC A;  2QJK B;  5KAF E;  3H0Q A;  1SFC C;  5GTI H;  1MJ3 A;  1S3J A;  1KIL B;  3AE4 C;  5B5E E;  1LWU C;  3PGQ A;  2BZR A;  4YLH A;  2V7Q J;  4G2R A;  4TLF A;  2W3P A;  1KIL C;  4TT3 H;  5KTB A;  3II6 A;  2OYI A;  2W6B A;  2KUB A;  2WPV B;  4JCR A;  3I47 A;  4WWI A;  1NTK E;  1OZH A;  3T89 A;  3H1L J;  2KZJ A;  2QIW A;  3TGU G;  2GUS A;  2PFX A;  1VF5 C;  2BCC G;  3B5N A;  1OX3 A;  3M06 A;  1FZC B;  2FFD B;  5KLV E;  3L72 G;  1JO5 A;  1VQN P;  1OVU A;  1T6A A;  4GM2 A;  1JNM A;  4H13 D;  1G1J A;  1JY2 O;  3SWX A;  2FFD C;  2Q9I A;  1VQK P;  3VMZ A;  1NU1 J;  2ITA A;  3TYY A;  5KLV J;  1MFZ A;  1RE4 C;  4Q0G A;  5IKL B;  1FJK A;  2L91 A;  3KZI H;  3VMA A;  1L0N D;  2J5I I;  3BF0 A;  2RN0 A;  3RK3 C;  3HD7 C;  3VP9 A;  4RJT A;  2E76 B;  3R9Q A;  2YO3 A;  1RE3 C;  4RCN A;  1SQV G;  3O6Q B;  5C39 A;  4JWV A;  1KIL E;  1SFC A;  1Y9B A;  1QGK B;  1JY3 O;  1SQX J;  3B8E B;  1LWU A;  2QA4 P;  1EZV G;  2WSF H;  4JYJ A;  3U1C A;  3H1I E;  1AQT A;  4OG1 A;  3MT6 A;  5AW5 B;  1S5L H;  4L76 A;  3MUD A;  3EQ2 A;  5G1S A;  2FYN B;  1X79 B;  1W2B O;  2EJ5 A;  3NXS A;  4L6W A;  2JWD A;  3H1L G;  1FC2 C;  5B66 H;  3BCC E;  3B4S A;  4ZNC A;  2A7S A;  3V4Q A;  3KDP B;  2FXP A;  3FX0 A;  2JJL A;  3L37 A;  2WPS A;  1UYR A;  5DUC A;  2IX7 C;  3H1J E;  2R3C A;  4MXI A;  2YKQ A;  2JO1 A;  3JCU H;  2YIU C;  5CCH C;  3L73 D;  4DT0 A;  2HG5 D;  1OVV A;  3M0D C;  2A81 A;  3L75 E;  3AE2 C;  3I5C A;  1P84 H;  3GHG C;  3H0J A;  1SQB J;  2O01 N;  3ZWA A;  1OIP A;  4JPZ B;  1CI6 B;  1NU1 G;  1RE4 A;  2KSJ A;  4EDF A;  1HTL C;  4IFF A;  1PPJ E;  3P32 A;  2K3R A;  3KTK A;  1KQS O;  2F6I A;  1M56 D;  4K3W A;  3HD7 A;  2VX2 A;  1LTG C;  1HWT C;  5AW3 B;  1K73 Q;  1VDF A;  3H32 A;  5DTP A;  4BXL A;  3K5B A;  1SQQ E;  2IZ0 A;  2YXR B;  3A7O A;  5DKP A;  1NTZ G;  1S9K E;  5BVZ A;  5G1Q A;  1PGO A;  1X0U A;  3G3Z A;  4R4M A;  3HE2 A;  2FBM A;  4QIJ A;  2ZL0 A;  3VN0 A;  5KJ7 D;  4IFD K;  5DU8 A;  1SQX G;  1LTA C;  1SQQ J;  3H1K G;  3MHV A;  1WZ8 A;  2HOD B;  4Y99 B;  1SP4 A;  3CXH I;  3H1I D;  1OWA A;  3CX5 E;  2I1J A;  1IC2 A;  1GU5 A;  2A06 G;  4L74 A;  3CI9 A;  3KTG A;  1KB9 E;  1JOC A;  2B89 A;  4WZ8 B;  1Y47 A;  3T8B A;  3KTH A;  1HNU A;  2IPP A;  3HE5 A;  4H0L D;  1MKM A;  1JY3 P;  1GL2 B;  2N9Y B;  3B71 A;  1IFN A;  2B87 A;  3L74 E;  3M0D A;  4D6T J;  5G1R A;  4KNP A;  3A0H H;  2E74 D;  2QJP C;  3GHG A;  2J5I B;  2Q5U A;  1GTW A;  1SQB G;  4OGQ C;  1GL2 C;  3AE8 C;  3TDK A;  5AVW B;  3L74 J;  3CME P;  2G8Y A;  2F6Q A;  3FF6 A;  1JM0 A;  3RBX A;  1PPJ D;  2E76 D;  4ZKU A;  3TZ3 A;  1NKN A;  2QSI A;  5CTC A;  3AE6 C;  2K88 A;  3HRX A;  1LTS C;  4LC1 A;  3CL3 D;  3LW5 H;  3TT6 A;  3L71 G;  1EZV I;  1WDK A;  3ZWB A;  1DD3 A;  4GDO A;  4BRY B;  5APW A;  3Q1T A;  1BCC D;  3BPP A;  2R3S A;  5TIS H;  1NTM K;  1UYT A;  2VSU C;  2K37 A;  3WUV A;  2VSS E;  1JY3 N;  5H2F H;  1G1I A;  1NO4 A;  1LNQ A;  1L0L K;  3H02 A;  3TT7 A;  1KB9 D;  2CE3 A;  3RK2 B;  3ITK A;  4KD6 A;  1L4A B;  1FOS F;  2M3E A;  3Q5R A;  1SVF A;  3R4Y A;  2VSS A;  2WVR A;  3RGU A;  1XNV A;  5BU8 B;  3OT6 A;  2X24 A;  3RK2 C;  2J5G D;  3LW5 J;  1FBM A;  2YMY A;  4D6T G;  2Q1K A;  1L4A C;  2POH A;  5H2F E;  5KAI H;  2ZL4 A;  5APS A;  1WMK A;  4C7N A;  1GU4 A;  4YXD C;  3S4R A;  4EYY Q;  1YG6 A;  5JBW A;  1EDI A;  3U9T B;  2E42 A;  5AW9 B;  2HR3 A;  1IZN B;  1GK6 A;  1H88 A;  2ZXE B;  1X22 A;  1URQ C;  3K8X A;  1S5L X;  3A0B E;  1YHQ P;  4RES B;  1UYS A;  4GKG A;  2VSU E;  1XTC C;  3PRJ A;  3STA A;  2GM4 A;  2FYU J;  1USE A;  2NP9 A;  3G9R A;  2Z5I A;  1AVO A;  4H44 B;  2QEX P;  4IZB A;  1NZY B;  1T3U A;  1BE3 J;  1IFJ A;  3LKE A;  1YI2 P;  4FZW C;  3SWY A;  5CCG C;  1M90 Q;  5GTH H;  2KB7 P;  1HUC A;  1JEK A;  2WQY C;  1FDO A;  3BAS A;  3QXI A;  1LP1 A;  1Q2N A;  1UIX A;  1SQP E;  5APX A;  2HPC A;  2XNX A;  2IYO A;  3SLL A;  1RF1 C;  1HZD A;  3NMD A;  1FZA A;  2I1K A;  3T97 B;  4N6J A;  1KYO H;  1VQ6 P;  1XNY A;  2A45 H;  2OTK E;  4U18 A;  1R5S A;  4U3F E;  2BEQ D;  2Y0C A;  3IN6 A;  3G6E P;  3DOR A;  1H0T A;  3HUS A;  3VYI A;  1VL2 A;  1ZRT E;  5CJ4 A;  3V5B A;  3H1H G;  1M8O B;  1N2D C;  3S9O A;  1KMI Z;  1L0N K;  4JF7 A;  5M1B A;  3QWO C;  3SFD C;  5AW0 B;  4FNB A;  4Q1I A;  3V2R A;  3CXH E;  2OYI B;  1URQ A;  5E79 E;  3RRV A;  3TGU E;  1DCI A;  2BCC E;  2FYU G;  2WPQ A;  1EDL A;  1P84 I;  1QLE D;  2OYI C;  3L72 E;  3U1A A;  3B5N B;  1L0L D;  3AE7 C;  1S4X A;  2E5T A;  1Q51 A;  3TGU J;  4ZDE A;  2E5Y A;  4ZU2 A;  1G2C A;  1BE3 G;  4Z0M A;  4FZW A;  3B5N C;  4U0H A;  2P58 A;  4JVT A;  2KSE A;  3MTU E;  1NVO A;  2JKV A;  3CCS P;  5AVZ B;  1ZN5 A;  4I7Z B;  3P8C E;  2XZR A;  5KJP A;  1SQP D;  1ZV8 A;  1RF1 A;  1OMI A;  1OD2 A;  1NTK K;  3G71 P;  1W2X A;  1RQU A;  2W83 C;  1H89 A;  1YQ3 C;  5KDR A;  1PIX A;  3U59 A;  4EOT A;  3MFM A;  5KLV K;  4W7Z A;  1SQV E;  4N78 E;  1FZB A;  2C0W A;  1OW8 A;  1KOR A;  4U3F D;  1NH4 A;  1LT9 C;  2RH0 A;  1YYC A;  3KHU A;  2OYO A;  1NWQ A;  1SFC B;  3CWB J;  4HC8 A;  3CCU P;  4O9B A;  2KOG A;  1HH0 A;  5ING A;  1EZV E;  1AFO A;  1KQL A;  4M3L A;  2KI7 B;  1LWU B;  1T2K D;  1LGH B;  3T3W A;  3PP5 A;  1KTM A;  1N6E A;  2E75 C;  1RY3 A;  4DI1 A;  5C90 A;  3A5T A;  1XNW A;  4K29 A;  2Z5H A;  1KFN A;  3H1L E;  4H44 D;  1FZG A;  2BCC D;  2A45 G;  1VF5 B;  2M3B A;  3MUD C;  1K04 A;  5APV A;  3FWN A;  1PFI A;  3T88 A;  3WUT A;  5GTI E;  1HJ0 A;  4JJT A;  4L8K A;  4I6M C;  2ZT9 D;  4KPK A;  2JR8 A;  3TF5 A;  1QL2 A;  2SPZ A;  1NU1 E;  4IZC A;  2HFE D;  3CMA P;  5KLI C;  3OAK A;  3P8C D;  2H43 A;  4AYC A;  1HVV A;  3TNU A;  5KKZ C;  2OQQ A;  2N1T C;  2F9I A;  2K9J A;  2O1J A;  5AVT B;  4HYT B;  2HLO A;  1Q7Y Q;  5DUF A;  3RK3 B;  3HD7 B;  1X8Y A;  5FIF A;  3H32 B;  3PHL A;  2Q2X A;  1NTZ E;  3NTN A;  1YBK A;  4L73 A;  1LT9 A;  1VQ8 P;  1S2E A;  2VRS A;  5AVU B;  3H0U A;  1NAF A;  1SQX E;  3CWB G;  2KNC A;  4KWB A;  1A02 F;  4OVN F;  3WMM 0;  4DCK A;  3L73 J;  1Z56 A;  3H1K E;  3VP8 A;  3SFE C;  1QL1 A;  1O8U A;  1NTZ J;  2J59 M;  2IBZ D;  1YIJ P;  3QXZ A;  5DTW A;  1NOH A;  1WRG A;  3SWF A;  3MOY A;  1QVG O;  1ZXG A;  3N7N A;  1KFM A;  1VQ7 P;  3KZI E;  1USD A;  3D6Y A;  2A06 E;  3TK1 A;  4LGD E;  3AEC C;  3H1K J;  1SQQ K;  1FJP A;  3PTZ A;  4ELX A;  3H1L D;  3EFF K;  4MI2 A;  1FU1 A;  4MN4 C;  2JDI H;  3U9S B;  4JYB A;  3V5I A;  1TU3 F;  3HE5 B;  1NTK D;  2YIU B;  4JCS A;  1SG4 A;  2NPS D;  3HP0 A;  4UB8 H;  2B87 B;  1JMB A;  3TSI A;  1N8R Q;  2CBY A;  2J58 A;  1SQB E;  3GHG B;  3SWK A;  5KLV D;  3R9S A;  2CPB A;  2OAR A;  4IFM A;  2JEE A;  1S5L E;  1N6D A;  2N1T A;  1VQ5 P;  3RK3 E;  3A3Y B;  2I8D A;  1PV3 A;  3RL0 C;  3WG5 A;  2R32 A;  2WSF J;  5B66 E;  1OW6 A;  3OJA B;  3H81 A;  1N7S C;  1SLQ A;  1SFC D;  1YJW P;  4JYC A;  1DEE G;  3L71 E;  4CPG A;  3JCU E;  3TVW A;  4IL6 H;  2K9Y A;  3R0O A;  1Q90 D;  1SQX D;  3KPE A;  4ZDC A;  3HTK A;  1P84 E;  3L73 G;  5INF A;  1BDD A;  1AQ5 A;  2JWA A;  1KIL D;  1JB0 J;  1DD4 A;  2XND H;  3L71 J;  1JY2 P;  2JP3 A;  3KTJ A;  3VMX A;  1PZQ A;  3M6N A;  2AXT H;  1WDL A;  3GF3 A;  1RH5 B;  4U19 A;  3CCQ P;  2N9B A;  3IR9 A;  5FUS A;  3M9H A;  2A45 I;  1OFC X;  1VF5 D;  4DJG A;  4A7P A;  2CK3 H;  3ABV C;  3OA7 A;  1EXJ A;  2YKP A;  3CCV P;  1EC5 A;  2C9L Y;  4NPD A;  4ASW A;  4YXW H;  4D6T E;  2A7K A;  2FY8 A;  1M1J C;  1W5C E;  3AEA C;  3BCC D;  2IEX A;  5CJ0 A;  2QJP B;  2WZ7 A;  5APQ A;  2ZYD A;  2QRX A;  1MZ9 A;  3H1J D;  3PLN A;  4OGQ B;  2YNY A;  4C7N B;  3Q7H A;  1BCC J;  3PE8 A;  1E5W A;  3L75 D;  1FC9 A;  4JQ0 D;  5E0S H;  3BPT A;  3RK3 D;  1L2P A;  3HD7 D;  1NGM B;  1FZF A;  4FND A;  2FXO A;  4WYO B;  3IAO A;  2ZAE B;  4YTP C;  3TVU A;  3CCM P;  1JY2 N;  1N7S A;  4WY4 C;  3HIN A;  5CMZ A;  5AW1 B;  2KS1 A;  4XA4 A;  2PBP A;  2GUV A;  5HUQ A;  4KT0 J;  4PJ0 H;  1LT1 A;  1SZO A;  3A0H E;  3GKB A;  1FC6 A;  4NPE A;  1SQQ D;  1EF9 A;  3RBZ A;  1S9K D;  1R5L A;  2WSE H;  1PP9 E;  5DL1 A;  1YTZ I;  2LXB A;  4EML A;  3CC4 P;  2ZXX A;  1KQF B;  1N73 C;  3QH9 A;  1LP1 B;  5E0S A;  1GD2 E;  2HPC B;  3FXE A;  5C9G A;  1PP9 J;  3CX5 D;  1RF0 A;  1OW7 A;  3QKA A;  1QX8 A;  2Y0D A;  4U1A A;  5CCH D;  3KQG A;  2F9Y A;  1ZR2 A;  5AVS B;  5AW4 B;  4AUW A;  1VRG A;  3L35 A;  1WDM A;  2ZVN B;  1M1J A;  2QVA A;  5AW8 B;  2V4H A;  1H0T B;  3HUS B;  2C9N Y;  3MD0 A;  3R2P A;  5TIS E;  3H1H E;  1SQP K;  3GG2 A;  3L74 D;  1BCC G;  2D2C C;  3HUS C;  3EWK A;  4PV1 C;  4FJW D;  5AW7 B;  2YKO A;  2XU6 A;  1J7X A;  4XFJ A;  3H1H J;  4C46 A;  2QM7 A;  4LK5 A;  4WY4 A;  1URQ B;  1K9M Q;  2MJZ A;  1HBW A;  2FYU E;  1ZLL A;  3L70 J;  1GK4 A;  4IOI H;  1FAV A;  2DUB A;  4JOT A;  3L36 A;  2ZL2 A;  5KAI E;  4HKZ H;  1K39 A;  1XX4 A;  2IYP A;  1BE3 E;  3M6M A;  5DJU B;  1VQM P;  1N7L A;  2C8T A;  4PD4 H;  1G2C B;  4WCZ A;  3CC2 P;  4FN7 A;  1KN7 A;  2M8R A;  1N73 A;  3JSV C;  4U0G H;  2ZYG A;  2Y9Z A;  2M0B A;  1RF1 B;  4W7Y A;  4QFE A;  4RYF H;  1IFM A;  1PP9 G;  1XTG B;  3Q3D A;  4B3I A;  1ON9 A;  1Q82 Q;  3GF7 A;  2HW5 A;  3IB9 A;  5KDR B;  1QEX A;  1NTM J;  1PGQ A;  4PD4 E;  1Q81 Q;  2OYH C;  3USS A;  1RQV A;  2ZVO B;  5AW6 B;  1M57 D;  3C8V A;  4UB6 H;  1J1E B;  4OGQ D;  4ELS A;  1GL2 D;  3NJD A;  3V2P A;  3CCJ P;  4EMP A;  3Q1M A;  3ZDM A;  5K5G B;  3AED C;  4K2N A;  4IL6 X;  3KXD A;  2ZFC A;  1J1E C;  5GTH E;  2CPS A;  1HF9 A;  3TV5 A;  4H13 B;  3JU1 A;  3PEA A;  1KQG B;  5AW2 B;  3PJS K;  3L3S A;  1FCF A;  3BAT A;  3MYB A;  1SQV K;  1IK7 A;  4U0G A;  5E0N X;  3E7K A;  1KYO E;  4H13 C;  4RYF A;  4AQR D;  1IFP A;  3M91 A;  2IFM A;  2X58 A;  2FYU D;  1BGY J;  5AVY B;  3L70 G;  1VQL P;  1T3J A;  3H25 A;  1M1K Q;  5AVX B;  4NPF X;  3NJB A;  4Z1M H;  3W67 A;  1BE3 D;  5DU6 A;  2VSS F;  2WSC H;  1EDK A;  1T8Z A;  1IFD A;  1LTB C;  3RSI A;  1WT6 A;  3AEE C;  1QVF O;  2QM8 A;  2XKM A;  4JBZ A;  2P1J A;  1TG6 A;  3TNU B;  1A02 J;  2F9I B;  2K9J B;  3HE4 A;  3RK2 D;  1EF8 A;  1YQ4 C;  4WB4 A;  1L4A D;  1GW3 A;  3LIE A;  2OYH A;  1NTM G;  3ZW8 A;  1RHZ B;  4B3J A;  1TYF A;  2H88 C;  1YJN P;  1LT9 B;  1D7M A;  3CWB E;  1NU1 K;  1L0L G;  2QG4 A;  3WU2 H;  2QJY C;  2KNC B;  1VQ4 P;  2Y0E A;  1EY3 A;  1EXI A;  1CSB A;  2KIK A;  2OTL P;  3FGA D;  2WSC J;  3G64 A;  1DX7 A;  2YMK A;  5KAF H;  4JCT A;  1URQ D;  2E75 B;  1ZRT D;  2Q3E A;  1KV4 A;  1Q86 Q;  1MUU A;  1HNO A;  5B5E H;  1NTZ K;  3C9I A;  3PH0 A;  2VSU F;  1BGY G;  2KP8 A;  1SQX K;  4I42 A;  3CXH D;  1L0N J;  3N6R B;  1ZR4 A;  4JCQ A;  3TGU D;  1FDM A;  2C0X A;  5CCG D;  4FB8 A;  2GTR A;  5BU5 A;  3AE9 C;  1JXZ A;  3L72 D;  1Y7O A;  3S1K A;  3P7K A;  4K3A A;  2QJK C;  4IZD A;  5KLI B;  1NYH A;  1YTZ T;  2ZQR A;  4JYL A;  2IZ1 A;  5KKZ B;  4QII A;  2LKM A;  3EFG A;  2KZI A;  3I55 P;  1RJM A;  2N1T B;  4ZMD A;  4BWN A;  3I56 P;  5KJ7 C;  4DZO A;  3WUU A;  2O1K A;  3AEB C;  2R5D A;  4MOU A;  1MV8 A;  2H7H A;  2AEM A;  1SQB K;  1NHL A;  2FXM A;  3CWB D;  3Q0G A;  4N3Y B;  5DU4 A;  2YXQ B;  4JFC A;  2WMM A;  1SQV D;  3L73 E;  4N78 D;  2M5A A;  1NTK J;  3HTK B;  2P67 A;  4H0L B;  1FZC C;  3JC2 2;  4LLH A;  4ZDF A;  1LTJ A;  2NPS A;  1ZME C;  3OME A;  1HJB A;  2H8P D;  2WT7 A;  3H6P A;  2FZS A;  2E74 B;  3FWL A;  3V5E A;  4H0L C;  1Y8A A;  1EZV D;  4HB1 A;  1XO6 A;  3IF4 A;  4GOD A;  1N86 A;  1AA0 A;  1VQ9 P;  3RST A;  2E74 C;  4GHN A;  2DW3 A;  4OH8 B;  2Z4E A;  2WTY A;  3GMA A;  5EFW B;  1L0N G;  1H8A A;  2GA1 A;  2AXC A;  2FBW C;  3KYQ A;  3E1I A;  3AE5 C;  3B5N D;  2BEZ F;  4KHX A;  3W68 A;  1U7M A;  4ZKP A;  2E76 C;  1JTH A;  2PG8 A;  5AVV B;  4RO0 A;  1GW4 A;  4ASV A;  2Y9Y A;  1DH3 A;  2IBZ G;  2BAS A;  1BSH A;  3HLN 1;  2UWJ E;  1IFI A; 
#chains in the Genus database with same CATH homology
 4I52 A;  3HIN A;  1UYV A;  4HNK A;  1FC7 A;  4FZW C;  4EMM A;  3R6H A;  2PBP A;  5HUQ A;  2J5U A;  2WQY C;  3QXI A;  1FDO A;  1ZP0 C;  3QYR A;  3P2L A;  4KT0 J;  3K50 A;  1UIX A;  3KTI A;  1SZO A;  3GKB A;  1FC6 A;  1EF9 A;  3SLL A;  3U9R B;  3R9T A;  1HZD A;  2QQ3 A;  3H0Q A;  3T97 B;  3RL0 g;  4F47 A;  3T8A A;  2FYN C;  1MJ3 A;  5DL1 A;  3AE4 C;  1XNY A;  4EML A;  4ASI A;  1KQF B;  4U18 A;  3PGQ A;  2BEQ D;  2BZR A;  4YLH A;  2V7Q J;  5E0S A;  3IN6 A;  3DOR A;  4G2R A;  2W3P A;  4TT3 H;  2E75 D;  2IDB A;  5C9G A;  3QKA A;  1OW7 A;  3QWD A;  1K05 A;  4B3H A;  4U1A A;  1VL2 A;  2WPV B;  1ZRT E;  2F9Y A;  3I47 A;  4JCR A;  3S9O A;  1KMI Z;  1VRG A;  1WDM A;  5M1B A;  3T89 A;  3FDU A;  3TRR A;  2QIW A;  4NEK A;  1VF5 C;  1K32 A;  3SFD C;  4FNB A;  4Q1I A;  4GM2 A;  4H13 D;  3ZWC A;  3RRV A;  2F9Y B;  3SWX A;  1DCI A;  2D2C C;  3QMJ A;  3EWK A;  4PV1 C;  3QK8 A;  4FJW D;  1J7X A;  3D71 A;  4XFJ A;  3O6Q A;  2H89 C;  4Q0G A;  5IKL B;  3AE7 C;  3IAV A;  4LK5 A;  1Q51 A;  1DUB A;  2J5S A;  4ZDE A;  4ZU2 A;  2D3T A;  2O01 J;  2J5I I;  4FZW A;  4Z0M A;  3BF0 A;  4U0H A;  4JVT A;  2E76 B;  3R9Q A;  2DUB A;  4JOT A;  4RCN A;  4I7Z B;  2ZL2 A;  5KJP A;  2ZQQ A;  4JWV A;  3Q2Y A;  1OMI A;  1KIL E;  1OD2 A;  3IBB A;  1K39 A;  1XX4 A;  4JSB A;  1W2X A;  3M6M A;  1RQU A;  1Y9B A;  2C8T A;  1YQ3 C;  5KDR A;  1PIX A;  3AE3 C;  4WCZ A;  3MFM A;  4FN7 A;  1OW8 A;  1KOR A;  4U0G H;  4JYJ A;  2NZ2 A;  4OG1 A;  2G3A A;  4QFE A;  4RYF H;  3MT6 A;  3Q3D A;  4B3I A;  1ON9 A;  5G1S A;  4HC8 A;  2HW5 A;  3GF7 A;  2DEO A;  3IB9 A;  5KDR B;  2EJ5 A;  5ING A;  4OMR A;  2J5G A;  4L6W A;  3ST9 A;  3T3W A;  1RQV A;  2A7S A;  3C8V A;  2FXP A;  1KTM A;  4OGQ D;  4ELS A;  1N6E A;  2E75 C;  1Q52 A;  3NJD A;  2YJG A;  1UYR A;  5DUC A;  4DI1 A;  4EMP A;  3Q1M A;  4MXI A;  5C90 A;  3D70 A;  2JO1 A;  1XNW A;  2YIU C;  4K29 A;  3AEF C;  3AED C;  4U7J A;  4K2N A;  4IL6 X;  2A81 A;  4H44 D;  3AE2 C;  1HF9 A;  3H0J A;  3TV5 A;  4H13 B;  3JU1 A;  3ZWA A;  1VF5 B;  3PEA A;  1KQG B;  1K04 A;  3GLM A;  1FCF A;  3L3S A;  5L8R J;  4ZDB A;  3T88 A;  3MYB A;  1IK7 A;  4U0G A;  5E0N X;  1HJ0 A;  4JJT A;  4H13 C;  4RYF A;  3AEG C;  4L8K A;  3KTK A;  2F6I A;  2X58 A;  4HDT A;  2ZT9 D;  4K3W A;  2D2C B;  5MGB A;  4KPK A;  2VX2 A;  4IZC A;  4PV1 B;  5DTP A;  5KLI C;  2WSE J;  1PJH A;  3H25 A;  5DKP A;  3NJB A;  5KKZ C;  3ISA A;  2OQQ A;  4Z1M H;  5G1Q A;  1X0U A;  4R4M A;  2F9I A;  3HE2 A;  2FBM A;  4QIJ A;  2ZL0 A;  5DU6 A;  2VSS F;  5DU8 A;  5DUF A;  5FIF A;  3RSI A;  1WZ8 A;  2Q2X A;  3AEE C;  1TG6 A;  4ELW A;  3H0S A;  3H0U A;  3BEZ A;  2F9I B;  4FN8 A;  1ZOY C;  4KWB A;  1DIP A;  3QRE A;  1EF8 A;  3KTG A;  3SFE C;  1O8U A;  1YQ4 C;  4WZ8 B;  2J5I A;  3T8B A;  3Q5S A;  3KTH A;  4NAR A;  3QXZ A;  1HNU A;  3ZW8 A;  5DTW A;  3MOY A;  4OLQ A;  5JBX A;  4B3J A;  1TYF A;  2H88 C;  4R4L A;  3D6Y A;  4H0L D;  1MKM A;  3AEC C;  2QJY C;  3B71 A;  5G1R A;  1EY3 A;  2WTB A;  4ELX A;  1EXI A;  4KNP A;  3Q5P A;  2E74 D;  2QJP C;  3FGA D;  2J5I B;  2WSC J;  3G64 A;  2P10 A;  4MI2 A;  2ZL3 A;  2YMK A;  4OGQ C;  3U9S B;  3AE8 C;  4JCT A;  3V5I A;  3P5M A;  2E75 B;  1OD4 A;  1TU3 F;  3VIV A;  2G8Y A;  2F6Q A;  3FF6 A;  1U57 A;  4JCS A;  1HNO A;  1SG4 A;  1UIY A;  3HP0 A;  1R8E A;  3PZK A;  2E76 D;  4H44 C;  3D6Z A;  2VSU F;  2CBY A;  2VSU A;  3TZ3 A;  3P85 A;  2UZF A;  2QSI A;  5CTC A;  3R9S A;  3AE6 C;  4I42 A;  3LAO A;  3OC7 A;  2ZT9 B;  4I4Z A;  3N6R B;  3HRX A;  4JCQ A;  2VRE A;  1N6D A;  3RK3 E;  4FB8 A;  3TT6 A;  1PV3 A;  2GTR A;  5DZK H;  3AE9 C;  1JXZ A;  1WDK A;  2ZT9 C;  3WG5 A;  4RKU J;  2WSF J;  1Y7O A;  3ZWB A;  1DD3 A;  1OW6 A;  4GDO A;  2QJK C;  3Q1T A;  3H81 A;  3BPP A;  4IZD A;  1NYH A;  4NNQ A;  2ZQR A;  4JYL A;  1UYT A;  2VSU C;  4QII A;  2VSS E;  3TVW A;  2K9Y A;  1RJM A;  3R0O A;  1Q90 D;  3TLF A;  4ZDC A;  3H02 A;  2Q34 A;  5INF A;  3TT7 A;  1FDI A;  2CE3 A;  3AEB C;  1JB0 J;  1DD4 A;  4MOU A;  4KD6 A;  2JP3 A;  3KTJ A;  3M6N A;  3Q5R A;  1WDL A;  3R4Y A;  2VSS A;  3Q0G A;  3GF3 A;  2MKV A;  1XNV A;  4U19 A;  5DU4 A;  3AE1 C;  3OT6 A;  5CTB A;  2X24 A;  4JFC A;  5FUS A;  4Y28 J;  2J5G D;  3LW5 J;  1AJY A;  1VF5 D;  4H0L B;  5DZK A;  4ZDF A;  3ABV C;  2ZL4 A;  1EXJ A;  1ZME C;  3OME A;  1WMK A;  2FZS A;  2E74 B;  4YXD C;  1YG6 A;  3V5E A;  4H0L C;  5JBW A;  4ZDD A;  3U9T B;  2D2C D;  1ON3 A;  1YG8 A;  1XO6 A;  2A7K A;  3TDC A;  3KQF A;  4PV1 D;  1N6F A;  3AEA C;  1RJN A;  2IEX A;  3RST A;  2E74 C;  3ZW9 A;  4GHN A;  1S1C X;  3DJA A;  4J2U A;  4OGQ B;  1NZY A;  5INI A;  3K8X A;  3GMA A;  2FW2 A;  2PPY A;  3Q7H A;  1S5L X;  3PE8 A;  1PL5 A;  1UYS A;  3STA A;  1FC9 A;  2FBW C;  2VSU E;  3AE5 C;  5E0S H;  3BPT A;  2BEZ F;  1NGM B;  2E76 C;  2NP9 A;  3G9R A;  4FND A;  4H44 B;  2PG8 A;  3Q0J A;  4I7Z C;  4WYO B;  3IAO A;  4YTP C;  1GMJ A;  4IZB A;  3TVU A;  1NZY B;  3HLN 1;  2Q35 A;  3LKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...