3GF7A

Glutaconyl-coa decarboxylase a subunit from clostridium symbiosum apoprotein
Total Genus 204
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
204
sequence length
585
structure length
543
Chain Sequence
MYSMPGYFQNMPTIGKELVNPNPENEQEIKAVESDIHESIKKALDAGITSEEKLNERGQLSAMQRINALIDPGTWCPLNSLFNPENNKFGTTNIVNGLGRVDGKWVYIVASDNKKMAGAWVPGQAENLIRCSDAAKMMHLPLIYLLNCSGVEFPNQDKVYPNRRGGGTPFFRNSELNQLGIPVIVGIYGTNPAGGGYHSISPTILIAHQDANMAVGKVPAPGSVPIHYDETGFFREVYQNDLGVIDGIKKYISYLPAYNLEFFRVDTPKAPQLPAEDLYSIIPMNQKRPYDIYEVIARLFDNSEFSEYKKGYGPEMVTGLAKVNGLLVGVIANVQGLLMNYPEYKQNSVGIGGKLYRQGLIKMNEFVTLCARDRIPLIWLQDTTGIDVGDEAEKAELLGLGQSLIYSIENSKLPSLEITIRKASAAAHYVLGGPQGNNTNVFSIGTGACEYYVMPGETAANAMYSRKLQPIIGKMNDMIQMYTDKSRPKYCTEKGMVDEIVDMTEVRPYIQAFTEAAYQNPQSICPMHQMLTPRSTREFETFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title An asymmetric model for Na+-translocating glutaconyl-CoA decarboxylases
pubmed doi rcsb
source organism Clostridium symbiosum
molecule tags Lyase
molecule keywords Glutaconyl-CoA decarboxylase subunit A
total genus 204
structure length 543
sequence length 585
ec nomenclature ec 4.1.1.70: Transferred entry: 7.2.4.5.
pdb deposition date 2009-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01039 Carboxyl_trans Carboxyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.680 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Helix bin 3gf7A01
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3gf7A02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3gf7A03
1HZDA 3OT6A 4EMLA 3TZ3A 3RSTA 5KDRA 3H0QA 2F9IB 1SZOA 5C90A 3L3SA 3R9QA 4FJWD 3IB9A 2CE3A 4NEKA 2GTRA 4FZWC 3TT7A 3Q0JA 1TYFA 3DORA 3P85A 2DUBA 3OMEA 4JCRA 2VREA 3LAOA 2HW5A 3QMJA 1NZYB 3BF0A 3KTGA 4ZDDA 5DKPA 2UZFA 2D3TA 3KTIA 4Q0GA 1J7XA 2Q2XA 2J5II 2ZL3A 2VSSA 2W3PA 1HNOA 4ELWA 4RCNA 3Q1TA 3MYBA 4ELSA 3T8BA 2BZRA 5E0NX 4OG1A 3KTJA 4GHNA 4ZU2A 1UYSA 1DCIA 3MFMA 4L8KA 2F6QA 3NJDA 3STAA 1EY3A 3R9SA 3MOYA 1FC6A 3WG5A 3H0JA 5MGBA 4KD6A 1UYTA 4IZBA 2C8TA 3ISAA 1XNVA 4FN8A 1SG4A 1JXZA 4FNDA 2A81A 3TVUA 5G1SA 4MI2A 5DTPA 3U9SB 4WZ8B 3T8AA 3QYRA 3R0OA 3BEZA 3H81A 5CTBA 4I42A 4U1AA 4G2RA 4ASIA 3PE8A 5IKLB 4RYFH 1FC9A 2EJ5A 4I4ZA 4U18A 4K3WA 1O8UA 4U0GA 1XNYA 2CBYA 3HRXA 4ZDEA 5DUFA 5INFA 1XNWA 2ZL0A 4OMRA 2J5GD 1OD4A 1DUBA 5INGA 1EF9A 1WDLA 2J5GA 2X24A 2VSUA 2VSSE 3GLMA 4LK5A 1YG8A 3QWDA 3GKBA 3HP0A 3PEAA 1K32A 3PZKA 1Y7OA 3N6RB 3TVWA 4KNPA 3PGQA 1RJMA 3BPPA 3RRVA 3U9RB 2ZQQA 2FBMA 3TV5A 1YG6A 3V5IA 1VRGA 3HINA 5G1QA 4KPKA 1K39A 4JCQA 4ZDCA 5DTWA 2X58A 3OC7A 4B3HA 4JSBA 5KDRB 4GM2A 3SLLA 2Q34A 3K8XA 3KTHA 3H0SA 1WZ8A 2WTBA 4B3IA 3T3WA 3G64A 1UIYA 3ST9A 5DUCA 1HNUA 3H02A 5FIFA 3P5MA 2QQ3A 2J5SA 1UYVA 1NZYA 4JCTA 4ZDFA 1N6FA 3GF7A 4NNQA 2FZSA 2A7KA 3ZW9A 2J5IA 3V5EA 4ZDBA 3TT6A 4K29A 2NP9A 4JYLA 3LKEA 2VSSF 1MJ3A 1Q52A 4QIIA 3TLFA 1XO6A 4FZWA 5G1RA 3P2LA 4EMPA 5CTCA 1PIXA 3M6NA 5DZKH 5JBWA 5E0SA 5E0SH 4IZCA 4JOTA 3K50A 1N6DA 3IBBA 4JCSA 2ZL4A 2F9YA 4U0GH 3U9TB 3JU1A 4MXIA 5DU8A 4U19A 2VSUE 4JYJA 4RYFA 1OD2A 2ZQRA 3SWXA 4EMMA 3ZWAA 1ON3A 2A7SA 3Q7HA 3QXIA 3FF6A 3DJAA 3TDCA 5FUSA 1X0UA 3ZW8A 1UYRA 3GMAA 3T88A 1W2XA 3Q0GA 1PJHA 3KTKA 5KJPA 3QK8A 3QREA 4IZDA 2PG8A 4F47A 1RJNA 4FN7A 4QFEA 2F9IA 1EF8A 3HE2A 4JJTA 3QXZA 3I47A 1FCFA 2F6IA 2VSUF 4Z0MA 3M6MA 3HLN1 3TRRA 2Q35A 2PBPA 4L6WA 3FDUA 4I52A 4WCZA 4U0HA 3MT6A 4YLHA 3ZWCA 2VX2A 4K2NA 4OLQA 1FC7A 2DEOA 3NJBA 5INIA 3GF3A 4JVTA 5DZKA 1WDMA 3R6HA 4B3JA 3H0UA 4JWVA 5DU6A 4FB8A 1ON9A 1TG6A 3QKAA 4ELXA 5C9GA 4HC8A 3ZWBA 3R9TA 2PPYA 2J5IB 4KWBA 1Q51A 3RSIA 2ZL2A 5DL1A 4DI1A 5JBXA 1XX4A 4WYOB 4Q1IA 3VIVA 1N6EA 3IAVA 4HNKA 4JFCA 3T89A 4FNBA 2FW2A 4QIJA 2VSUC 4MOUA 2F9YB 1WDKA 2IEXA 3KQFA 5DU4A
chains in the Genus database with same CATH superfamily
1OW7A 1G1IA 1HZDA 4EDFA 2O01J 2AXCA 3OT6A 4EMLA 3WU2H 3JSVC 3TZ3A 3RSTA 5KDRA 3H0QA 1S5LX 2F9IB 2ZVOB 1SZOA 1SFCB 4FJWD 3CPWO 4EI2A 2CE3A 4NEKA 1JB0J 1AJYA 2K9JA 1SQQD 3P85A 3P7KA 1PFIA 3A0HE 2KB7P 2GUVA 3E7KA 1FU1A 1R8EA 5L8RJ 2P58A 1L4AA 1QL1A 4W7ZA 2ZYGA 3BF0A 4OH8B 5DKPA 1M90Q 3KTIA 2FBWC 4LC1A 4Q0GA 2ZL3A 2R5DA 3AE1C 1JCCA 4JBZA 1URQD 4ELSA 2YMKA 3A0BE 5E0NX 1M1KQ 2WPRA 4L74A 4GHNA 4NPFX 1BSNA 1LJ2A 4YPCA 4H44C 2VRSA 2W8ZA 2IYPA 1DCIA 1UYSA 4ZMDA 2YJGA 1FDMA 1AFOA 1FZBA 3CWBD 1FC6A 3CCMP 4C7NA 2P7JA 2I1JA 1MV8A 3FX0A 1CI6A 3ISAA 1EZVD 1XNVA 1LTAC 2K1AA 1FOSE 1HUCA 2JEEA 1K8AQ 2M3BA 4IL6X 4GIFA 4Y99B 5APTA 1OX3A 5TISH 5AW2B 1G2CA 1M57D 3BEZA 3CI9A 1JCDA 2G8YA 1L0LG 5CCGC 4ASIA 3W68A 4BRYA 1GMJA 1NAYA 3L71G 4H44D 4NARA 2HODA 3TNUB 4U0GA 1GU4A 3RK3D 2O1KA 3CCVP 3G6EP 2ZFCA 2CBYA 1BCCJ 3RL0B 1NAFA 2RN0A 2OYHB 1KQGB 1VQLP 5CCGD 1SQPG 2E74D 1OVUA 2QRXA 3PH0A 1PL5A 4LK5A 3H1JE 1L4AB 3L75J 1LTGC 1KB9E 3V2NA 3D6YA 3C8VA 1VQKP 3N6RB 1AQ5A 5KKZB 3VMAA 4IFFA 2FYUD 3PGQA 3H1HE 3RRVA 3D71A 2OTKE 2FBMA 4RKUJ 3MD0A 1H0TB 1OVRA 1VRGA 1JY2N 3L35A 4I7ZB 5DTWA 4JSBA 3SLLA 1PPJE 3KZIE 3MUDA 2KNCB 3M9HA 3U59A 1ZV8A 1PP9E 3K8XA 1RF1C 2WITA 4H13C 3GG2A 1SQXJ 3AE9C 3CXHH 5GTIE 1UIYA 2OYHC 5DUCA 3CC4P 1HNUA 4KT0J 1JMBA 3ABVC 2B87B 2E43A 4JCTA 1LWUB 3KZIH 3M06A 4NNQA 3V4WA 2XDJA 1NTKG 2J5IA 1AVOA 4HDTA 1PP9J 1KC8Q 4K29A 2LXBA 3LKEA 1MJ3A 3CX5E 4U3FG 3CD6P 1XO6A 1SQBJ 1GTWA 3SWYA 1IFDA 3P2LA 2R5BA 2WT7A 3M6NA 5E0SH 5B66H 4U7JA 5H2FH 2QJKB 4H13B 2OTJP 3BCCE 3IN6A 3H32B 2ZL4A 1T2KD 3NXSA 1FDIA 3TSIA 5CCGA 1U7JA 3D70A 4I6MC 3M0DA 2Y0DA 3JU1A 4MXIA 5DU8A 4U19A 1AVYA 1RF1A 2FYUE 1YBKA 3L74G 1YTZI 1NTZD 4EMMA 3T97B 5B66E 3AE2C 5KAFE 1SFCD 3TDKA 1NTMG 3IFMA 1JY2P 2Z5HA 3KHUA 1X0UA 4W80A 3T88A 1W2XA 3Q0GA 3A7OA 2OGUA 3CC2P 3AEGC 1PJHA 4N78D 4IZDA 2WSSH 2PG8A 1DH3A 1SQVE 1RJNA 4M3LA 3H1LJ 1EF8A 3TF5A 2OARA 3I56P 2K37A 2QJYB 1FCFA 3VMXA 3QH9A 1L0LK 5KAFH 3TRRA 2QM8A 2FXPA 1SQXE 3G9RA 4WCZA 2H8PD 2N9BA 2WWWA 2FY8A 3H32A 4U0HA 2KUBA 5AVTB 2VX2A 4GOFA 3RK2B 4ASVA 1HVVA 4EIJA 1D7MA 1EQ7A 1IFNA 5DZKA 1E79H 1LNQA 4HJGH 2O01N 1FOSF 5DU6A 1GW3A 3AEEC 1TG6A 2AEJA 3HE5B 1EC5A 2E76D 3R2PA 1NKNA 2NZ2A 5APXA 1XX4A 3P8CE 1OFCX 1GZLA 3L73E 1T8ZA 1SQBE 1A02F 4JYBA 4HNKA 4JFCA 2IBZE 4FNBA 2YXRB 1OZHA 3CC7P 1S4XA 1FZEA 4H0LD 1IK9A 3USSA 5CHXA 5DU4A 3PRJA 2KYVA 1M1JA 4RJTA 2Y0CA 2FYZA 1KB9D 5AW1B 5AW9B 3H1LD 2ZXEB 3T97A 1EXJA 1NTMJ 3L74D 2P67A 3IB9A 3RL0D 1U7MA 2M5AB 4FZWC 3TT7A 2Z5IA 1TYFA 5APQA 4C7RA 1NJIQ 1Y9BA 3DORA 1K9MQ 4XE5B 2MKVA 2DUBA 1EDKA 3OMEA 5AVUB 3TYYA 4DOJA 3AE5C 4UB6H 2PFXA 2HODB 2HW5A 4L73A 4L76A 1NZYB 1M56D 3PTZA 2WT7B 1L4AD 1S5LE 2BCCD 3KTGA 4ZDDA 1JMMA 4H13D 3L73G 3KDPB 3HE4A 1VF5D 2D3TA 3CCUP 2J5II 2AXTE 1VQ6P 4HKZH 1GL2A 3S4RA 2I8DA 4ELWA 3Q1TA 1KTMA 1HJ0A 1SQVK 3S9OA 3U1AA 4OG1A 3KTJA 1OIPA 3CLQA 2QM7A 2SPZA 1JY3O 1EZVE 1S5LH 3AE8C 1EY3A 3R9SA 3MOYA 4RO0A 4O9BA 1LT9C 1FC2C 3H0JA 2FFDA 5MGBA 2M0BA 3AECC 1VQ8P 4KD6A 3C1LA 1NTKK 3MHVA 2N9YB 3Q3DA 1N8RQ 5KAIH 1VDFA 1KD1Q 4FNDA 1IFMA 1NU1G 1S1CX 2E75D 1NYHA 3M0DC 3O6QB 3HUSA 2JWAA 4WZ8B 4K35A 3R0OA 2OYHA 1MFTA 1HBWA 5C39A 2J5UA 1N7SD 2KIKA 3H1HJ 1OMIA 3L71J 3VMYA 1VQ4P 1BDDA 4JPZB 4RYFH 2OYIB 1FC9A 1USDA 1NWQA 4I4ZA 4U18A 4DJGA 3L75D 1O8UA 2KP8A 3H1JG 4H0LC 3RGUA 2E74B 1KYOD 4BRYB 3HRXA 1FJPA 5GTIH 5INFA 2KZIA 1XNWA 1YIJP 2ZL0A 4HYTB 4C7NB 2XKMA 3BCCG 1OD4A 2KOGA 1WDLA 4GDOA 4LLHA 2RMZA 1BGYJ 1NU1E 2Q3IA 2QEXP 2Q7CA 1SP4A 4H44B 3GKBA 1OW8A 3PEAA 3PP5A 2YKQA 1K32A 3B5NC 4DZOA 1EDLA 3TVWA 1RQUA 3H1HD 1BGYE 1OW6A 3CXHD 1NTZE 2ZQQA 3AE6C 1L0LD 2NPSD 3GHGB 4ZKPA 2HPCB 1YG6A 3V5IA 1Q2NA 2BCCE 1GL2D 2ZAEB 3HINA 4KPKA 1IFJA 1YJNP 2H89C 1NU1K 1QLED 1NVOA 1BE3D 4GM2A 1USEA 5APUA 4R4MA 3ST9A 2Q3EA 3VYIA 2QQ3A 4NPDA 1VQ7P 1TU3F 2E76B 1ZLLA 3BRVB 2IYOA 5BVZA 2J5SA 3U1CA 2K3RA 1NZYA 1J1DC 1DEEG 1PPJG 2IZ1A 1JNMA 3S1KA 2FZSA 2DW3A 2A7KA 1KFMA 4Z1MH 2C0WA 3BATA 3V5EA 3RL0C 3TT6A 3MZWB 2C0XA 4JYLA 2VSSF 3L72D 1Q52A 4QIIA 2J59M 2W6AA 1NTZJ 2FYNB 4WY4D 4FZWA 1IFPA 1VQOP 1NGMB 1BE3J 1CW5A 2A06E 4D6TJ 5CTCA 1PIXA 5E0SA 3K50A 3H1IE 1K73Q 3L4FA 1N7SB 4I2LC 1N6DA 1EDJA 2XZRA 1LTJC 2IDBA 4WY4A 3A2AA 3FGAD 2FYUK 3G71P 3P32A 4RYFA 3L74J 1RF0A 4WB4A 1ZP0C 1KQSO 1LTIC 5KLVE 3SWXA 4EOTA 1L0ND 3ZDMA 4B86A 5M1BA 2GUSA 3H1LG 2A7SA 5KLIB 1XTCC 3WU2E 3SFDC 3QXIA 3TDCA 5FUSA 1UYRA 3GMAA 1H89A 2FYNC 1YQ3C 4AUWA 2I1KA 3GW6A 4FN7A 4QFEA 3A5TA 4KJMA 3L70E 3I47A 4WBAA 3PLNA 4WY4C 2VSUF 3L75E 4D6TG 2Q35A 3Q5PA 1SLQA 1T3UA 2AEMA 4I52A 2QSIA 1HJBA 1YYCA 1NTZG 2ZXXA 1LWUA 3AE3C 3VP8A 3II6A 1Q90D 4OLQA 2KI7B 1WRGA 3KYQA 4JYCA 2DEOA 5INIA 2JR8A 1JTHA 1KYOI 2XNDH 1AQTA 4GODA 3VMZA 3VTPC 1N73C 3V2RA 3G3ZA 4JVTA 1SFCA 3R6HA 4B3JA 4JWVA 1FE6A 2G3AA 1SQVG 3VP9A 4ELXA 5C9GA 1KORA 4UB6E 1ZR2A 2O01H 3WUTA 2J5IB 3H1IJ 3GHGC 3L74E 4KWBA 1ZR4A 1N2DC 5DL1A 1AV1A 3BCCJ 3VIVA 1BE3E 5AW3B 4ZNCA 1N6EA 1DD3A 4GT1A 4EYYQ 2H43A 3I55P 1IFIA 4WY4B 2FW2A 2AXTH 3AEFC 1RF0C 2N1TB 4WWIA 1L0NE 3MTUE 3KQFA 3FWNA 1DIPA 3K5BA 4JF7A 4C46A 1NTMD 2BASA 4I7ZC 1LT1A 5C90A 3R9QA 1HTLC 1LP1A 2NPSA 1KB9I 4AQRD 3E1IA 3Q0JA 3CCSP 1L0LE 4ASWA 5KAIE 1SQQK 2QA4P 3N4XA 3BPTA 1FAVA 1EXIA 1N7LA 2KS1A 1QL2A 1FJKA 3Q2YA 3JCUE 1KN7A 3RK3B 3CCLP 2Q2XA 1PGPA 2VSSA 1HNOA 5CJ4A 1J2JB 1L2PA 4RCNA 2PRRA 2WPQA 2WMMA 1YITP 2BCCJ 2O3JA 2E75B 2R3SA 1KILD 1DEBA 1SQVD 3FXDA 4ZU2A 4ZKUA 5AW8B 3LW5H 2F6QA 1GK4A 3FWLA 2QJPB 4GOEA 1QVFO 3STAA 2QE7H 2Y9ZA 2ZYAA 3CCQP 3WG5A 2B87A 3CL3D 2R44A 5APWA 1S2EA 3N7NA 2E5TA 5AVWB 2PGDA 5E79H 2OQQA 4PV1D 2WQYC 2ZT9B 2C8TA 2NPSC 4FN8A 5KLVK 2OYIC 1L0NJ 1FZGA 1JXZA 4D6TD 1N73A 4PV1C 1SQPK 5DTPA 3U9SB 4IFMA 1LT9B 3QYRA 4N3YB 2A45G 2YNYA 3NTNA 5CTBA 2NRGA 4U1AA 3O6QA 2B89A 3M9BA 3CCEP 4G2RA 1W5CE 3SSUA 5E79E 2E42A 1ZN5A 1YJWP 2WSCH 1NU1D 1URQB 2YIUB 5IKLB 3LIEA 2EJ5A 2IBZG 4UB8E 4LGDE 2MJZA 3L71E 4K3WA 3TNUA 3A0HH 1Y8AA 1SQBG 4GKGA 3M91A 1XNYA 2RH0A 1HH0A 4CPGA 5KJ7D 1Q82Q 4U3FE 2HPCA 1H0TA 3B5NB 2XV5A 1KQLA 1VPCA 4PD4E 4OMRA 1PGOA 5CBNA 3MGNA 2ZT9C 3P8MC 3HUSB 1HWTC 1GD2E 5CCHD 3GLMA 1IO4A 4KHXA 4A7PA 1YJ9P 5AVRB 1LWUC 2HG5D 4PV1B 2V7QJ 1JY3N 3A0BH 4HH2A 4PD4H 5KTBA 3L71D 2YO2A 1W2EA 3U9RB 4W7YA 2V4HA 2POHA 3TV5A 2IX7C 5KLVD 3H1KE 2YIUC 3MIWA 1GU5A 1RE4A 1NO4A 3WMM0 2YKPA 1K39A 4JCQA 3PJSK 4B3HA 5KDRB 2Q34A 3TGUE 1ZW0A 2OYIA 3KTHA 1SQQG 3H0SA 5KLIC 3VOPA 4PD4I 1WZ8A 2WTBA 2K9JB 3T3WA 2FXOA 2WTYA 4PJ0H 3G64A 1H88A 2JKVA 2L5GB 1L0NG 3V6IA 3H02A 2E5YA 1SS1A 1NTME 3HE4B 5BU5A 3AE7C 1FBMA 1N86A 1SQVJ 3CWBG 2KS1B 4H0LB 3CWBE 1BE3G 1PZQA 2JDIH 3ITKA 1N7SC 3EFGA 4ZDBA 1T6AA 2BEZF 2OTLP 2YMYA 1KFNA 1IK7A 2NP9A 2ZYDA 1J1EC 1P84E 3MUDC 4WVZA 1UIIA 2CK3H 3TLFA 1GK6A 2E75C 2YO3A 1S72P 2QVAA 1LTSC 1J1DB 1RQVA 3SFEC 3WUUA 1FZFA 2IBZI 4EMPA 5JBWA 5DZKH 2QJPC 2O1JA 2KSJA 4IZCA 2W27A 1QEXA 2KLVA 3H1KG 3IBBA 4JCSA 1FS0E 1SVFA 2N1TD 2A45I 1NOHA 1P84H 1SQXD 4U0GH 1NTMK 3U9TB 1IC2A 1NTKE 4JYJA 2FFDB 1KILC 2M5AA 2OYOA 3V2QA 1K04A 3CX5D 3CXHI 4Y99C 1RE4C 1G1JA 2HLOA 1RE3C 2JP3A 1M1JC 2IBZD 1XTGB 2H7HA 3FF6A 3DJAA 3L70D 1LTBC 3HRNA 1JO5A 2IFNA 1T2KC 3CWBJ 3QREA 3H1LE 1ZMEC 2F9IA 3OA7A 3HE2A 5KLVG 4JJTA 1YHQP 1PGQA 4N6JA 4Z0MA 3H1HG 1ZRTE 2LR2A 4I1LA 4YTPC 1RHZB 3TGUD 1GL2C 2K88A 2Q5UA 3ZWCA 1RE3A 4K2NA 1H8AA 1KILB 3H1IG 2M8RA 4DT0A 4OVNF 3R4YA 4IFDK 4BWNA 1NTKJ 1AA0A 4TLFA 2V7QH 1Q81Q 3CX5H 4R4LA 1JTHB 5AVYB 1ON9A 3H1ID 1KILA 1SQPE 1R5LA 2WSFJ 1DD4A 2QIWA 5AVQB 4HC8A 1CZQA 1KV4A 5AVZB 3RBZA 5H2FE 1JY2O 3TGUG 3H1JD 1Q51A 2ZL2A 4DI1A 1OXZA 2IFMA 4Q1IA 3G4SP 1X22A 4JQ0D 1PGJA 3IAVA 1MUUA 2A45H 2LXCB 3L73D 1FZAA 3CCRP 1RF1B 5AW5B 4QIJA 1OVVA 1K05A 1KILE 2H88C 1L0NK 1WDKA 2IEXA 3CX5I 3EWKA 1QGKB 1PV3A 1HGZA 1GDTA 2W6BA 2W6JH 3L70G 2PP6A 3OAKA 1CSBA 3HD7B 1X8YA 3L3SA 1Q7YQ 1JUNA 1MFZA 1QVGO 2FKWB 5APVA 1RH5B 2KXPB 2GTRA 5EFWB 3OW2O 2Y0EA 1SQXG 3EQ2A 4JCRA 5B5EE 4RESB 2VREA 1PP9G 3LAOA 1VQ5P 2D2CD 4QMAA 1NKZB 3D6ZA 3QMJA 3RK3E 3EFFK 1X9VA 4IL6E 2P2UA 5GTHH 1VL2A 2XU6A 2HFED 4TT3H 2UZFA 1G2CB 2P10A 1J7XA 1LT9A 2RKLA 1GW4A 3TGUJ 3AEBC 2W3PA 5B5EH 4UB8H 2FXMA 4K3AA 3SWFA 3MYBA 3T8BA 1N7SA 3H25A 3OJAB 2BZRA 4PD4D 3RBXA 2KNCA 5DJTB 1VF5B 1FZCC 3MFMA 4L8KA 2KSEA 3Q1MA 3NJDA 3WUVA 3IAOA 5AVSB 2P1JA 3Q5RA 5KKZC 5CMZA 2WVRA 5APSA 1BCCD 1UYTA 4IZBA 3H1KJ 1LGHB 3CMAP 2W83C 1M8OB 5CBOA 1SG4A 2J58A 3CMEP 1VQNP 2WSEH 2A81A 3B5ND 3TVUA 3FXEA 5G1SA 1YQ4C 2ZJSE 4MI2A 2B9BA 3T8AA 3L72J 3F5HA 1L0LJ 1P84D 3L36A 1CI6B 3H81A 3L70J 1NH4A 4I42A 3LIDA 5CCHC 1BDCA 3B5NA 3PE8A 3BASA 5DJUB 2WPVB 1JEKA 3RK2C 4J2UA 2WPSA 1EZVG 2BEQD 4OGQD 1FZCB 1SQPJ 1BCCE 4MN4C 4DCKA 1L4AC 2B88A 1BCCG 4AYCA 4ZDEA 1URQA 5DUFA 1IZNB 3GHGA 5KLVJ 4OGQC 1S3JA 1ZRTD 2J5GD 4NPEA 2GA1A 1DUBA 5INGA 1LTJA 1EF9A 3QWOC 1ZXGA 3M9QA 4BXLA 2J5GA 2L91A 5TJHA 2X24A 1KYOE 4IOIH 1UIXA 2E76C 2VSUA 1W2BO 2VSSE 1N73B 1YG8A 3QWDA 3HP0A 2D2CC 1SQBD 1S9KE 3BVHA 1WMKA 2QJKC 3PZKA 1Y7OA 1FZCA 1KB9H 3P8CD 3IR9A 1A02J 3C9IA 4KNPA 1RJMA 5AW7B 5TISE 3L72G 3BPPA 1LTTC 2ZVNB 5K5GB 3L37A 2JJLA 3B4SA 3B71A 4Y28J 1WT6A 3HUSC 3BRTB 1SQBK 5G1QA 1KYOH 1NTKD 1X0TA 4ZDCA 1EDIA 2X58A 2K9YA 3OC7A 3VN0A 1T3JA 2E74C 1PPJD 1MZ9A 4XFJA 2Q6QA 4PJ0E 4B3IA 4OGQB 2Y9YA 1JY3P 1SQQJ 1OWAA 2FYUJ 1KQFB 1LTJB 3O8ZA 5KJ7C 3AEAC 3HD7A 3IF4A 5FIFA 3P5MA 2QG4A 3AEDC 1URQC 1Y47A 1SQQE 2JO1A 2WSEJ 1UYVA 4ZDFA 1N6FA 1SFCC 3GF7A 3JC22 3ZW9A 3TK1A 1SQXK 1R5SA 1QX8A 3I5CA 2KLUA 5CCHA 2HR3A 1KMIZ 2W90A 5KJ7A 3B8EB 3V4QA 3H6PA 5G1RA 4U3FJ 4YXWH 3V2PA 4U3FD 1E5WA 5AW4B 4JOTA 1ZOYC 1U57A 1M1JB 2GM4A 4L75A 1PP9D 1BGYG 3NMDA 2F9YA 3UIAA 3CXHE 3RK2D 2VSUE 2KK7A 2UWJE 5AVVB 2C9LY 2KZJA 1JM0A 3LW5J 1OD2A 2ZQRA 2AEFA 2YXQB 1EZVI 3PHLA 1HGVA 1S9KD 3ZWAA 1ON3A 2Z4EA 3Q7HA 1NU1J 1IJDB 3KQGA 2YKOA 3HE5A 3ZW8A 3RL0g 1GL2B 2R3CA 2WSFH 5CJ0A 3KTKA 3MP7B 5KJPA 3QK8A 1LP1B 2NPSB 2FFDC 2A06G 3L73J 4F47A 1MKMA 2A06D 3F89A 3E1RA 3HD7C 1P84I 3QXZA 3SWKA 3V5BA 2M3EA 2F6IA 2JWDA 3L72E 2FYUG 3M6MA 2LKMA 2WZ7A 2CPBA 2Q1KA 3HLN1 2N1TC 2PBPA 3H1JJ 3Q5SA 1M7LA 4L6WA 3FDUA 2PAJA 1DX7A 3HD7D 5AW0B 3W67A 1J1EB 3CCJP 5AW6B 2ITAA 1VQMP 3MT6A 1KZUB 1BSHA 1Z56A 4YLHA 1RY3A 3NFQA 3JCUH 1FC7A 3NJBA 5HUQA 4OWFA 3GF3A 4XA4A 1SQPD 3HTKA 3KPEA 2ZT9D 3A3YB 2D2CB 2QJYC 5AVXB 1WDMA 3H0UA 1BGYD 3BCCD 3AE4C 1HF9A 4FB8A 1JOCA 3QKAA 3H1KD 1NHLA 3ZWBA 2CPSA 3KXDA 1VQ9P 1VQPP 2Q9IA 3R9TA 2PPYA 3RSIA 3L75G 4IL6H 4D6TE 5JBXA 4WYOB 2XNXA 2WSCJ 2N1TA 1VF5C 2R32A 4HB1A 5GTHE 3HTKB 4YXDC 2C9NY 1YTZT 2BCCG 2HYNA 5BU8B 1Q86Q 1FDOA 5APYA 3T89A 1X79B 2IZ0A 4N78E 2VSUC 1YI2P 1NTZK 3RK3C 4MOUA 2F9YB 2IPPA 3M0AA
chains in the Genus database with same CATH topology
1PV3A 1OW7A 1DIPA 1HZDA 2O01J 3OT6A 4EMLA 3TZ3A 3RSTA 5KDRA 4I7ZC 3H0QA 1S5LX 2F9IB 1SZOA 5C90A 3L3SA 3R9QA 1EXJA 4FJWD 3IB9A 2CE3A 4NEKA 1JB0J 1AJYA 2GTRA 4FZWC 3Q0JA 3TT7A 1TYFA 3DORA 1Y9BA 3P85A 2MKVA 2DUBA 3OMEA 4JCRA 3AE5C 2VREA 3LAOA 2D2CD 1R8EA 3BPTA 3D6ZA 1EXIA 2HW5A 3QMJA 5L8RJ 3RK3E 1NZYB 3BF0A 3KTGA 4ZDDA 1VL2A 4H13D 5DKPA 3Q2YA 4TT3H 2UZFA 1VF5D 2D3TA 3KTIA 2FBWC 2P10A 4Q0GA 1J7XA 2ZL3A 2Q2XA 2J5II 2VSSA 3AEBC 2W3PA 3AE1C 1HNOA 4ELWA 4RCNA 3Q1TA 3MYBA 4ELSA 2YMKA 3T8BA 3H25A 1KTMA 2BZRA 1HJ0A 2E75B 5E0NX 3S9OA 4OG1A 1VF5B 3KTJA 4GHNA 4ZU2A 4H44C 1UYSA 1DCIA 3MFMA 4L8KA 2F6QA 3NJDA 3AE8C 3Q1MA 1EY3A 3STAA 2YJGA 3IAOA 3R9SA 3MOYA 3Q5RA 1FC6A 5KKZC 3WG5A 3H0JA 5MGBA 3AECC 4KD6A 1UYTA 4IZBA 3Q3DA 2OQQA 4PV1D 2WQYC 2ZT9B 2C8TA 3ISAA 1XNVA 4FN8A 1SG4A 1JXZA 4FNDA 2A81A 1S1CX 2E75D 1NYHA 4IL6X 3TVUA 4PV1C 1YQ4C 5G1SA 4MI2A 5DTPA 3U9SB 4WZ8B 3T8AA 3QYRA 3R0OA 3BEZA 3H81A 5CTBA 4I42A 2G8YA 4U1AA 3O6QA 4G2RA 2J5UA 1OMIA 4ASIA 3PE8A 5IKLB 2WPVB 4J2UA 4RYFH 1GMJA 1FC9A 4H44D 2EJ5A 4NARA 4I4ZA 4U18A 2BEQD 4OGQD 4K3WA 1O8UA 4U0GA 4H0LC 2E74B 1XNYA 2CBYA 3HRXA 4ZDEA 5DUFA 5INFA 1XNWA 4OGQC 2ZL0A 4OMRA 2J5GD 1OD4A 1DUBA 1KQGB 5INGA 1EF9A 1WDLA 4GDOA 2ZT9C 2J5GA 2E74D 2X24A 1UIXA 2E76C 2VSUA 2VSSE 3GLMA 1PL5A 4LK5A 1YG8A 3QWDA 4H44B 3GKBA 1OW8A 3HP0A 3D6YA 3PEAA 2D2CC 4PV1B 1WMKA 1K32A 2V7QJ 2QJKC 3C8VA 3PZKA 1Y7OA 3N6RB 4KNPA 3TVWA 1RQUA 3PGQA 1RJMA 1OW6A 3BPPA 3RRVA 3U9RB 3D71A 2ZQQA 2FBMA 3AE6C 4RKUJ 3TV5A 3B71A 4Y28J 2YIUC 1YG6A 3V5IA 1VRGA 3HINA 5G1QA 4KPKA 4I7ZB 1K39A 4JCQA 4ZDCA 5DTWA 2H89C 2X58A 2K9YA 3OC7A 4B3HA 4JSBA 5KDRB 4GM2A 3SLLA 2E74C 2Q34A 3K8XA 4XFJA 3KTHA 3H0SA 5KLIC 4H13C 1WZ8A 2WTBA 4B3IA 4OGQB 3T3WA 3AE9C 3G64A 1UIYA 4R4MA 3ST9A 1KQFB 5DUCA 1HNUA 3H02A 3AEAC 5FIFA 3P5MA 2QQ3A 4KT0J 3AEDC 3ABVC 1TU3F 2E76B 3AE7C 2JO1A 2WSEJ 2J5SA 1UYVA 1NZYA 4JCTA 4ZDFA 1N6FA 4H0LB 3GF7A 4NNQA 2FZSA 2A7KA 3ZW9A 4Z1MH 2J5IA 3V5EA 4HDTA 4ZDBA 3TT6A 2BEZF 4K29A 1KMIZ 1IK7A 2NP9A 4JYLA 3LKEA 2VSSF 1MJ3A 1Q52A 4QIIA 3TLFA 1XO6A 4FZWA 5G1RA 2E75C 1NGMB 1RQVA 3SFEC 3P2LA 4EMPA 5CTCA 1PIXA 3M6NA 5DZKH 2QJPC 5E0SA 5E0SH 5JBWA 4IZCA 4JOTA 3K50A 1ZOYC 4U7JA 1U57A 1N6DA 4H13B 3IBBA 3IN6A 4JCSA 2ZL4A 1FDIA 2F9YA 2IDBA 3D70A 4U0GH 3JU1A 4MXIA 3U9TB 5DU8A 3FGAD 4U19A 2VSUE 4JYJA 4RYFA 1K04A 1ZP0C 3LW5J 1OD2A 2ZQRA 3SWXA 4EMMA 3ZWAA 5M1BA 3T97B 1ON3A 3AE2C 2JP3A 2A7SA 3Q7HA 3SFDC 3QXIA 3FF6A 3DJAA 3TDCA 5FUSA 1X0UA 3ZW8A 1UYRA 3GMAA 3RL0g 3T88A 1W2XA 3Q0GA 3AEGC 1PJHA 3KTKA 5KJPA 3QK8A 3QREA 4IZDA 2FYNC 1YQ3C 2PG8A 1ZMEC 4F47A 1MKMA 1RJNA 4FN7A 4QFEA 2F9IA 1EF8A 3HE2A 4JJTA 3QXZA 3I47A 1FCFA 2F6IA 2VSUF 4Z0MA 1ZRTE 3M6MA 3HLN1 3TRRA 2Q35A 2PBPA 3Q5PA 3Q5SA 4L6WA 3FDUA 2FXPA 4I52A 4YTPC 2QSIA 3G9RA 4WCZA 4U0HA 3MT6A 4YLHA 3AE3C 3ZWCA 2VX2A 4K2NA 1Q90D 4OLQA 1FC7A 2DEOA 3NJBA 5HUQA 5INIA 3GF3A 3R4YA 2ZT9D 2D2CB 4JVTA 2QJYC 5DZKA 1WDMA 3R6HA 4B3JA 3H0UA 4JWVA 4R4LA 3AE4C 5DU6A 2G3AA 1HF9A 3AEEC 4FB8A 1ON9A 1TG6A 3QKAA 4ELXA 2WSFJ 5C9GA 1KORA 1DD4A 2QIWA 4HC8A 3ZWBA 2E76D 3R9TA 2NZ2A 2PPYA 2J5IB 4KWBA 1Q51A 3RSIA 2ZL2A 5DL1A 4DI1A 5JBXA 1XX4A 4WYOB 2WSCJ 1VF5C 4Q1IA 3VIVA 1N6EA 1DD3A 3IAVA 4YXDC 4HNKA 4JFCA 1FDOA 3T89A 4FNBA 2FW2A 3AEFC 4QIJA 2VSUC 1K05A 1KILE 2H88C 4H0LD 4MOUA 2F9YB 1WDKA 2IEXA 3KQFA 5DU4A 3EWKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HZD A;  3OT6 A;  4EML A;  3TZ3 A;  3RST A;  5KDR A;  3H0Q A;  2F9I B;  1SZO A;  5C90 A;  3L3S A;  3R9Q A;  4FJW D;  3IB9 A;  2CE3 A;  4NEK A;  2GTR A;  4FZW C;  3TT7 A;  3Q0J A;  1TYF A;  3DOR A;  3P85 A;  2DUB A;  3OME A;  4JCR A;  2VRE A;  3LAO A;  2HW5 A;  3QMJ A;  1NZY B;  3BF0 A;  3KTG A;  4ZDD A;  5DKP A;  2UZF A;  2D3T A;  3KTI A;  4Q0G A;  1J7X A;  2Q2X A;  2J5I I;  2ZL3 A;  2VSS A;  2W3P A;  1HNO A;  4ELW A;  4RCN A;  3Q1T A;  3MYB A;  4ELS A;  3T8B A;  2BZR A;  5E0N X;  4OG1 A;  3KTJ A;  4GHN A;  4ZU2 A;  1UYS A;  1DCI A;  3MFM A;  4L8K A;  2F6Q A;  3NJD A;  3STA A;  1EY3 A;  3R9S A;  3MOY A;  1FC6 A;  3WG5 A;  3H0J A;  5MGB A;  4KD6 A;  1UYT A;  4IZB A;  2C8T A;  3ISA A;  1XNV A;  4FN8 A;  1SG4 A;  1JXZ A;  4FND A;  2A81 A;  3TVU A;  5G1S A;  4MI2 A;  5DTP A;  3U9S B;  4WZ8 B;  3T8A A;  3QYR A;  3R0O A;  3BEZ A;  3H81 A;  5CTB A;  4I42 A;  4U1A A;  4G2R A;  4ASI A;  3PE8 A;  5IKL B;  4RYF H;  1FC9 A;  2EJ5 A;  4I4Z A;  4U18 A;  4K3W A;  1O8U A;  4U0G A;  1XNY A;  2CBY A;  3HRX A;  4ZDE A;  5DUF A;  5INF A;  1XNW A;  2ZL0 A;  4OMR A;  2J5G D;  1OD4 A;  1DUB A;  5ING A;  1EF9 A;  1WDL A;  2J5G A;  2X24 A;  2VSU A;  2VSS E;  3GLM A;  4LK5 A;  1YG8 A;  3QWD A;  3GKB A;  3HP0 A;  3PEA A;  1K32 A;  3PZK A;  1Y7O A;  3N6R B;  3TVW A;  4KNP A;  3PGQ A;  1RJM A;  3BPP A;  3RRV A;  3U9R B;  2ZQQ A;  2FBM A;  3TV5 A;  1YG6 A;  3V5I A;  1VRG A;  3HIN A;  5G1Q A;  4KPK A;  1K39 A;  4JCQ A;  4ZDC A;  5DTW A;  2X58 A;  3OC7 A;  4B3H A;  4JSB A;  5KDR B;  4GM2 A;  3SLL A;  2Q34 A;  3K8X A;  3KTH A;  3H0S A;  1WZ8 A;  2WTB A;  4B3I A;  3T3W A;  3G64 A;  1UIY A;  3ST9 A;  5DUC A;  1HNU A;  3H02 A;  5FIF A;  3P5M A;  2QQ3 A;  2J5S A;  1UYV A;  1NZY A;  4JCT A;  4ZDF A;  1N6F A;  3GF7 A;  4NNQ A;  2FZS A;  2A7K A;  3ZW9 A;  2J5I A;  3V5E A;  4ZDB A;  3TT6 A;  4K29 A;  2NP9 A;  4JYL A;  3LKE A;  2VSS F;  1MJ3 A;  1Q52 A;  4QII A;  3TLF A;  1XO6 A;  4FZW A;  5G1R A;  3P2L A;  4EMP A;  5CTC A;  1PIX A;  3M6N A;  5DZK H;  5JBW A;  5E0S A;  5E0S H;  4IZC A;  4JOT A;  3K50 A;  1N6D A;  3IBB A;  4JCS A;  2ZL4 A;  2F9Y A;  4U0G H;  3U9T B;  3JU1 A;  4MXI A;  5DU8 A;  4U19 A;  2VSU E;  4JYJ A;  4RYF A;  1OD2 A;  2ZQR A;  3SWX A;  4EMM A;  3ZWA A;  1ON3 A;  2A7S A;  3Q7H A;  3QXI A;  3FF6 A;  3DJA A;  3TDC A;  5FUS A;  1X0U A;  3ZW8 A;  1UYR A;  3GMA A;  3T88 A;  1W2X A;  3Q0G A;  1PJH A;  3KTK A;  5KJP A;  3QK8 A;  3QRE A;  4IZD A;  2PG8 A;  4F47 A;  1RJN A;  4FN7 A;  4QFE A;  2F9I A;  1EF8 A;  3HE2 A;  4JJT A;  3QXZ A;  3I47 A;  1FCF A;  2F6I A;  2VSU F;  4Z0M A;  3M6M A;  3HLN 1;  3TRR A;  2Q35 A;  2PBP A;  4L6W A;  3FDU A;  4I52 A;  4WCZ A;  4U0H A;  3MT6 A;  4YLH A;  3ZWC A;  2VX2 A;  4K2N A;  4OLQ A;  1FC7 A;  2DEO A;  3NJB A;  5INI A;  3GF3 A;  4JVT A;  5DZK A;  1WDM A;  3R6H A;  4B3J A;  3H0U A;  4JWV A;  5DU6 A;  4FB8 A;  1ON9 A;  1TG6 A;  3QKA A;  4ELX A;  5C9G A;  4HC8 A;  3ZWB A;  3R9T A;  2PPY A;  2J5I B;  4KWB A;  1Q51 A;  3RSI A;  2ZL2 A;  5DL1 A;  4DI1 A;  5JBX A;  1XX4 A;  4WYO B;  4Q1I A;  3VIV A;  1N6E A;  3IAV A;  4HNK A;  4JFC A;  3T89 A;  4FNB A;  2FW2 A;  4QIJ A;  2VSU C;  4MOU A;  2F9Y B;  1WDK A;  2IEX A;  3KQF A;  5DU4 A; 
#chains in the Genus database with same CATH topology
 1OW7 A;  1G1I A;  1HZD A;  4EDF A;  2O01 J;  2AXC A;  3OT6 A;  4EML A;  3WU2 H;  3JSV C;  3TZ3 A;  3RST A;  5KDR A;  3H0Q A;  1S5L X;  2F9I B;  2ZVO B;  1SZO A;  1SFC B;  4FJW D;  3CPW O;  4EI2 A;  2CE3 A;  4NEK A;  1JB0 J;  1AJY A;  2K9J A;  1SQQ D;  3P85 A;  3P7K A;  1PFI A;  3A0H E;  2KB7 P;  2GUV A;  3E7K A;  1FU1 A;  1R8E A;  5L8R J;  2P58 A;  1L4A A;  1QL1 A;  4W7Z A;  2ZYG A;  3BF0 A;  4OH8 B;  5DKP A;  1M90 Q;  3KTI A;  2FBW C;  4LC1 A;  4Q0G A;  2ZL3 A;  2R5D A;  3AE1 C;  1JCC A;  4JBZ A;  1URQ D;  4ELS A;  2YMK A;  3A0B E;  5E0N X;  1M1K Q;  2WPR A;  4L74 A;  4GHN A;  4NPF X;  1BSN A;  1LJ2 A;  4YPC A;  4H44 C;  2VRS A;  2W8Z A;  2IYP A;  1DCI A;  1UYS A;  4ZMD A;  2YJG A;  1FDM A;  1AFO A;  1FZB A;  3CWB D;  1FC6 A;  3CCM P;  4C7N A;  2P7J A;  2I1J A;  1MV8 A;  3FX0 A;  1CI6 A;  3ISA A;  1EZV D;  1XNV A;  1LTA C;  2K1A A;  1FOS E;  1HUC A;  2JEE A;  1K8A Q;  2M3B A;  4IL6 X;  4GIF A;  4Y99 B;  5APT A;  1OX3 A;  5TIS H;  5AW2 B;  1G2C A;  1M57 D;  3BEZ A;  3CI9 A;  1JCD A;  2G8Y A;  1L0L G;  5CCG C;  4ASI A;  3W68 A;  4BRY A;  1GMJ A;  1NAY A;  3L71 G;  4H44 D;  4NAR A;  2HOD A;  3TNU B;  4U0G A;  1GU4 A;  3RK3 D;  2O1K A;  3CCV P;  3G6E P;  2ZFC A;  2CBY A;  1BCC J;  3RL0 B;  1NAF A;  2RN0 A;  2OYH B;  1KQG B;  1VQL P;  5CCG D;  1SQP G;  2E74 D;  1OVU A;  2QRX A;  3PH0 A;  1PL5 A;  4LK5 A;  3H1J E;  1L4A B;  3L75 J;  1LTG C;  1KB9 E;  3V2N A;  3D6Y A;  3C8V A;  1VQK P;  3N6R B;  1AQ5 A;  5KKZ B;  3VMA A;  4IFF A;  2FYU D;  3PGQ A;  3H1H E;  3RRV A;  3D71 A;  2OTK E;  2FBM A;  4RKU J;  3MD0 A;  1H0T B;  1OVR A;  1VRG A;  1JY2 N;  3L35 A;  4I7Z B;  5DTW A;  4JSB A;  3SLL A;  1PPJ E;  3KZI E;  3MUD A;  2KNC B;  3M9H A;  3U59 A;  1ZV8 A;  1PP9 E;  3K8X A;  1RF1 C;  2WIT A;  4H13 C;  3GG2 A;  1SQX J;  3AE9 C;  3CXH H;  5GTI E;  1UIY A;  2OYH C;  5DUC A;  3CC4 P;  1HNU A;  4KT0 J;  1JMB A;  3ABV C;  2B87 B;  2E43 A;  4JCT A;  1LWU B;  3KZI H;  3M06 A;  4NNQ A;  3V4W A;  2XDJ A;  1NTK G;  2J5I A;  1AVO A;  4HDT A;  1PP9 J;  1KC8 Q;  4K29 A;  2LXB A;  3LKE A;  1MJ3 A;  3CX5 E;  4U3F G;  3CD6 P;  1XO6 A;  1SQB J;  1GTW A;  3SWY A;  1IFD A;  3P2L A;  2R5B A;  2WT7 A;  3M6N A;  5E0S H;  5B66 H;  4U7J A;  5H2F H;  2QJK B;  4H13 B;  2OTJ P;  3BCC E;  3IN6 A;  3H32 B;  2ZL4 A;  1T2K D;  3NXS A;  1FDI A;  3TSI A;  5CCG A;  1U7J A;  3D70 A;  4I6M C;  3M0D A;  2Y0D A;  3JU1 A;  4MXI A;  5DU8 A;  4U19 A;  1AVY A;  1RF1 A;  2FYU E;  1YBK A;  3L74 G;  1YTZ I;  1NTZ D;  4EMM A;  3T97 B;  5B66 E;  3AE2 C;  5KAF E;  1SFC D;  3TDK A;  1NTM G;  3IFM A;  1JY2 P;  2Z5H A;  3KHU A;  1X0U A;  4W80 A;  3T88 A;  1W2X A;  3Q0G A;  3A7O A;  2OGU A;  3CC2 P;  3AEG C;  1PJH A;  4N78 D;  4IZD A;  2WSS H;  2PG8 A;  1DH3 A;  1SQV E;  1RJN A;  4M3L A;  3H1L J;  1EF8 A;  3TF5 A;  2OAR A;  3I56 P;  2K37 A;  2QJY B;  1FCF A;  3VMX A;  3QH9 A;  1L0L K;  5KAF H;  3TRR A;  2QM8 A;  2FXP A;  1SQX E;  3G9R A;  4WCZ A;  2H8P D;  2N9B A;  2WWW A;  2FY8 A;  3H32 A;  4U0H A;  2KUB A;  5AVT B;  2VX2 A;  4GOF A;  3RK2 B;  4ASV A;  1HVV A;  4EIJ A;  1D7M A;  1EQ7 A;  1IFN A;  5DZK A;  1E79 H;  1LNQ A;  4HJG H;  2O01 N;  1FOS F;  5DU6 A;  1GW3 A;  3AEE C;  1TG6 A;  2AEJ A;  3HE5 B;  1EC5 A;  2E76 D;  3R2P A;  1NKN A;  2NZ2 A;  5APX A;  1XX4 A;  3P8C E;  1OFC X;  1GZL A;  3L73 E;  1T8Z A;  1SQB E;  1A02 F;  4JYB A;  4HNK A;  4JFC A;  2IBZ E;  4FNB A;  2YXR B;  1OZH A;  3CC7 P;  1S4X A;  1FZE A;  4H0L D;  1IK9 A;  3USS A;  5CHX A;  5DU4 A;  3PRJ A;  2KYV A;  1M1J A;  4RJT A;  2Y0C A;  2FYZ A;  1KB9 D;  5AW1 B;  5AW9 B;  3H1L D;  2ZXE B;  3T97 A;  1EXJ A;  1NTM J;  3L74 D;  2P67 A;  3IB9 A;  3RL0 D;  1U7M A;  2M5A B;  4FZW C;  3TT7 A;  2Z5I A;  1TYF A;  5APQ A;  4C7R A;  1NJI Q;  1Y9B A;  3DOR A;  1K9M Q;  4XE5 B;  2MKV A;  2DUB A;  1EDK A;  3OME A;  5AVU B;  3TYY A;  4DOJ A;  3AE5 C;  4UB6 H;  2PFX A;  2HOD B;  2HW5 A;  4L73 A;  4L76 A;  1NZY B;  1M56 D;  3PTZ A;  2WT7 B;  1L4A D;  1S5L E;  2BCC D;  3KTG A;  4ZDD A;  1JMM A;  4H13 D;  3L73 G;  3KDP B;  3HE4 A;  1VF5 D;  2D3T A;  3CCU P;  2J5I I;  2AXT E;  1VQ6 P;  4HKZ H;  1GL2 A;  3S4R A;  2I8D A;  4ELW A;  3Q1T A;  1KTM A;  1HJ0 A;  1SQV K;  3S9O A;  3U1A A;  4OG1 A;  3KTJ A;  1OIP A;  3CLQ A;  2QM7 A;  2SPZ A;  1JY3 O;  1EZV E;  1S5L H;  3AE8 C;  1EY3 A;  3R9S A;  3MOY A;  4RO0 A;  4O9B A;  1LT9 C;  1FC2 C;  3H0J A;  2FFD A;  5MGB A;  2M0B A;  3AEC C;  1VQ8 P;  4KD6 A;  3C1L A;  1NTK K;  3MHV A;  2N9Y B;  3Q3D A;  1N8R Q;  5KAI H;  1VDF A;  1KD1 Q;  4FND A;  1IFM A;  1NU1 G;  1S1C X;  2E75 D;  1NYH A;  3M0D C;  3O6Q B;  3HUS A;  2JWA A;  4WZ8 B;  4K35 A;  3R0O A;  2OYH A;  1MFT A;  1HBW A;  5C39 A;  2J5U A;  1N7S D;  2KIK A;  3H1H J;  1OMI A;  3L71 J;  3VMY A;  1VQ4 P;  1BDD A;  4JPZ B;  4RYF H;  2OYI B;  1FC9 A;  1USD A;  1NWQ A;  4I4Z A;  4U18 A;  4DJG A;  3L75 D;  1O8U A;  2KP8 A;  3H1J G;  4H0L C;  3RGU A;  2E74 B;  1KYO D;  4BRY B;  3HRX A;  1FJP A;  5GTI H;  5INF A;  2KZI A;  1XNW A;  1YIJ P;  2ZL0 A;  4HYT B;  4C7N B;  2XKM A;  3BCC G;  1OD4 A;  2KOG A;  1WDL A;  4GDO A;  4LLH A;  2RMZ A;  1BGY J;  1NU1 E;  2Q3I A;  2QEX P;  2Q7C A;  1SP4 A;  4H44 B;  3GKB A;  1OW8 A;  3PEA A;  3PP5 A;  2YKQ A;  1K32 A;  3B5N C;  4DZO A;  1EDL A;  3TVW A;  1RQU A;  3H1H D;  1BGY E;  1OW6 A;  3CXH D;  1NTZ E;  2ZQQ A;  3AE6 C;  1L0L D;  2NPS D;  3GHG B;  4ZKP A;  2HPC B;  1YG6 A;  3V5I A;  1Q2N A;  2BCC E;  1GL2 D;  2ZAE B;  3HIN A;  4KPK A;  1IFJ A;  1YJN P;  2H89 C;  1NU1 K;  1QLE D;  1NVO A;  1BE3 D;  4GM2 A;  1USE A;  5APU A;  4R4M A;  3ST9 A;  2Q3E A;  3VYI A;  2QQ3 A;  4NPD A;  1VQ7 P;  1TU3 F;  2E76 B;  1ZLL A;  3BRV B;  2IYO A;  5BVZ A;  2J5S A;  3U1C A;  2K3R A;  1NZY A;  1J1D C;  1DEE G;  1PPJ G;  2IZ1 A;  1JNM A;  3S1K A;  2FZS A;  2DW3 A;  2A7K A;  1KFM A;  4Z1M H;  2C0W A;  3BAT A;  3V5E A;  3RL0 C;  3TT6 A;  3MZW B;  2C0X A;  4JYL A;  2VSS F;  3L72 D;  1Q52 A;  4QII A;  2J59 M;  2W6A A;  1NTZ J;  2FYN B;  4WY4 D;  4FZW A;  1IFP A;  1VQO P;  1NGM B;  1BE3 J;  1CW5 A;  2A06 E;  4D6T J;  5CTC A;  1PIX A;  5E0S A;  3K50 A;  3H1I E;  1K73 Q;  3L4F A;  1N7S B;  4I2L C;  1N6D A;  1EDJ A;  2XZR A;  1LTJ C;  2IDB A;  4WY4 A;  3A2A A;  3FGA D;  2FYU K;  3G71 P;  3P32 A;  4RYF A;  3L74 J;  1RF0 A;  4WB4 A;  1ZP0 C;  1KQS O;  1LTI C;  5KLV E;  3SWX A;  4EOT A;  1L0N D;  3ZDM A;  4B86 A;  5M1B A;  2GUS A;  3H1L G;  2A7S A;  5KLI B;  1XTC C;  3WU2 E;  3SFD C;  3QXI A;  3TDC A;  5FUS A;  1UYR A;  3GMA A;  1H89 A;  2FYN C;  1YQ3 C;  4AUW A;  2I1K A;  3GW6 A;  4FN7 A;  4QFE A;  3A5T A;  4KJM A;  3L70 E;  3I47 A;  4WBA A;  3PLN A;  4WY4 C;  2VSU F;  3L75 E;  4D6T G;  2Q35 A;  3Q5P A;  1SLQ A;  1T3U A;  2AEM A;  4I52 A;  2QSI A;  1HJB A;  1YYC A;  1NTZ G;  2ZXX A;  1LWU A;  3AE3 C;  3VP8 A;  3II6 A;  1Q90 D;  4OLQ A;  2KI7 B;  1WRG A;  3KYQ A;  4JYC A;  2DEO A;  5INI A;  2JR8 A;  1JTH A;  1KYO I;  2XND H;  1AQT A;  4GOD A;  3VMZ A;  3VTP C;  1N73 C;  3V2R A;  3G3Z A;  4JVT A;  1SFC A;  3R6H A;  4B3J A;  4JWV A;  1FE6 A;  2G3A A;  1SQV G;  3VP9 A;  4ELX A;  5C9G A;  1KOR A;  4UB6 E;  1ZR2 A;  2O01 H;  3WUT A;  2J5I B;  3H1I J;  3GHG C;  3L74 E;  4KWB A;  1ZR4 A;  1N2D C;  5DL1 A;  1AV1 A;  3BCC J;  3VIV A;  1BE3 E;  5AW3 B;  4ZNC A;  1N6E A;  1DD3 A;  4GT1 A;  4EYY Q;  2H43 A;  3I55 P;  1IFI A;  4WY4 B;  2FW2 A;  2AXT H;  3AEF C;  1RF0 C;  2N1T B;  4WWI A;  1L0N E;  3MTU E;  3KQF A;  3FWN A;  1DIP A;  3K5B A;  4JF7 A;  4C46 A;  1NTM D;  2BAS A;  4I7Z C;  1LT1 A;  5C90 A;  3R9Q A;  1HTL C;  1LP1 A;  2NPS A;  1KB9 I;  4AQR D;  3E1I A;  3Q0J A;  3CCS P;  1L0L E;  4ASW A;  5KAI E;  1SQQ K;  2QA4 P;  3N4X A;  3BPT A;  1FAV A;  1EXI A;  1N7L A;  2KS1 A;  1QL2 A;  1FJK A;  3Q2Y A;  3JCU E;  1KN7 A;  3RK3 B;  3CCL P;  2Q2X A;  1PGP A;  2VSS A;  1HNO A;  5CJ4 A;  1J2J B;  1L2P A;  4RCN A;  2PRR A;  2WPQ A;  2WMM A;  1YIT P;  2BCC J;  2O3J A;  2E75 B;  2R3S A;  1KIL D;  1DEB A;  1SQV D;  3FXD A;  4ZU2 A;  4ZKU A;  5AW8 B;  3LW5 H;  2F6Q A;  1GK4 A;  3FWL A;  2QJP B;  4GOE A;  1QVF O;  3STA A;  2QE7 H;  2Y9Z A;  2ZYA A;  3CCQ P;  3WG5 A;  2B87 A;  3CL3 D;  2R44 A;  5APW A;  1S2E A;  3N7N A;  2E5T A;  5AVW B;  2PGD A;  5E79 H;  2OQQ A;  4PV1 D;  2WQY C;  2ZT9 B;  2C8T A;  2NPS C;  4FN8 A;  5KLV K;  2OYI C;  1L0N J;  1FZG A;  1JXZ A;  4D6T D;  1N73 A;  4PV1 C;  1SQP K;  5DTP A;  3U9S B;  4IFM A;  1LT9 B;  3QYR A;  4N3Y B;  2A45 G;  2YNY A;  3NTN A;  5CTB A;  2NRG A;  4U1A A;  3O6Q A;  2B89 A;  3M9B A;  3CCE P;  4G2R A;  1W5C E;  3SSU A;  5E79 E;  2E42 A;  1ZN5 A;  1YJW P;  2WSC H;  1NU1 D;  1URQ B;  2YIU B;  5IKL B;  3LIE A;  2EJ5 A;  2IBZ G;  4UB8 E;  4LGD E;  2MJZ A;  3L71 E;  4K3W A;  3TNU A;  3A0H H;  1Y8A A;  1SQB G;  4GKG A;  3M91 A;  1XNY A;  2RH0 A;  1HH0 A;  4CPG A;  5KJ7 D;  1Q82 Q;  4U3F E;  2HPC A;  1H0T A;  3B5N B;  2XV5 A;  1KQL A;  1VPC A;  4PD4 E;  4OMR A;  1PGO A;  5CBN A;  3MGN A;  2ZT9 C;  3P8M C;  3HUS B;  1HWT C;  1GD2 E;  5CCH D;  3GLM A;  1IO4 A;  4KHX A;  4A7P A;  1YJ9 P;  5AVR B;  1LWU C;  2HG5 D;  4PV1 B;  2V7Q J;  1JY3 N;  3A0B H;  4HH2 A;  4PD4 H;  5KTB A;  3L71 D;  2YO2 A;  1W2E A;  3U9R B;  4W7Y A;  2V4H A;  2POH A;  3TV5 A;  2IX7 C;  5KLV D;  3H1K E;  2YIU C;  3MIW A;  1GU5 A;  1RE4 A;  1NO4 A;  3WMM 0;  2YKP A;  1K39 A;  4JCQ A;  3PJS K;  4B3H A;  5KDR B;  2Q34 A;  3TGU E;  1ZW0 A;  2OYI A;  3KTH A;  1SQQ G;  3H0S A;  5KLI C;  3VOP A;  4PD4 I;  1WZ8 A;  2WTB A;  2K9J B;  3T3W A;  2FXO A;  2WTY A;  4PJ0 H;  3G64 A;  1H88 A;  2JKV A;  2L5G B;  1L0N G;  3V6I A;  3H02 A;  2E5Y A;  1SS1 A;  1NTM E;  3HE4 B;  5BU5 A;  3AE7 C;  1FBM A;  1N86 A;  1SQV J;  3CWB G;  2KS1 B;  4H0L B;  3CWB E;  1BE3 G;  1PZQ A;  2JDI H;  3ITK A;  1N7S C;  3EFG A;  4ZDB A;  1T6A A;  2BEZ F;  2OTL P;  2YMY A;  1KFN A;  1IK7 A;  2NP9 A;  2ZYD A;  1J1E C;  1P84 E;  3MUD C;  4WVZ A;  1UII A;  2CK3 H;  3TLF A;  1GK6 A;  2E75 C;  2YO3 A;  1S72 P;  2QVA A;  1LTS C;  1J1D B;  1RQV A;  3SFE C;  3WUU A;  1FZF A;  2IBZ I;  4EMP A;  5JBW A;  5DZK H;  2QJP C;  2O1J A;  2KSJ A;  4IZC A;  2W27 A;  1QEX A;  2KLV A;  3H1K G;  3IBB A;  4JCS A;  1FS0 E;  1SVF A;  2N1T D;  2A45 I;  1NOH A;  1P84 H;  1SQX D;  4U0G H;  1NTM K;  3U9T B;  1IC2 A;  1NTK E;  4JYJ A;  2FFD B;  1KIL C;  2M5A A;  2OYO A;  3V2Q A;  1K04 A;  3CX5 D;  3CXH I;  4Y99 C;  1RE4 C;  1G1J A;  2HLO A;  1RE3 C;  2JP3 A;  1M1J C;  2IBZ D;  1XTG B;  2H7H A;  3FF6 A;  3DJA A;  3L70 D;  1LTB C;  3HRN A;  1JO5 A;  2IFN A;  1T2K C;  3CWB J;  3QRE A;  3H1L E;  1ZME C;  2F9I A;  3OA7 A;  3HE2 A;  5KLV G;  4JJT A;  1YHQ P;  1PGQ A;  4N6J A;  4Z0M A;  3H1H G;  1ZRT E;  2LR2 A;  4I1L A;  4YTP C;  1RHZ B;  3TGU D;  1GL2 C;  2K88 A;  2Q5U A;  3ZWC A;  1RE3 A;  4K2N A;  1H8A A;  1KIL B;  3H1I G;  2M8R A;  4DT0 A;  4OVN F;  3R4Y A;  4IFD K;  4BWN A;  1NTK J;  1AA0 A;  4TLF A;  2V7Q H;  1Q81 Q;  3CX5 H;  4R4L A;  1JTH B;  5AVY B;  1ON9 A;  3H1I D;  1KIL A;  1SQP E;  1R5L A;  2WSF J;  1DD4 A;  2QIW A;  5AVQ B;  4HC8 A;  1CZQ A;  1KV4 A;  5AVZ B;  3RBZ A;  5H2F E;  1JY2 O;  3TGU G;  3H1J D;  1Q51 A;  2ZL2 A;  4DI1 A;  1OXZ A;  2IFM A;  4Q1I A;  3G4S P;  1X22 A;  4JQ0 D;  1PGJ A;  3IAV A;  1MUU A;  2A45 H;  2LXC B;  3L73 D;  1FZA A;  3CCR P;  1RF1 B;  5AW5 B;  4QIJ A;  1OVV A;  1K05 A;  1KIL E;  2H88 C;  1L0N K;  1WDK A;  2IEX A;  3CX5 I;  3EWK A;  1QGK B;  1PV3 A;  1HGZ A;  1GDT A;  2W6B A;  2W6J H;  3L70 G;  2PP6 A;  3OAK A;  1CSB A;  3HD7 B;  1X8Y A;  3L3S A;  1Q7Y Q;  1JUN A;  1MFZ A;  1QVG O;  2FKW B;  5APV A;  1RH5 B;  2KXP B;  2GTR A;  5EFW B;  3OW2 O;  2Y0E A;  1SQX G;  3EQ2 A;  4JCR A;  5B5E E;  4RES B;  2VRE A;  1PP9 G;  3LAO A;  1VQ5 P;  2D2C D;  4QMA A;  1NKZ B;  3D6Z A;  3QMJ A;  3RK3 E;  3EFF K;  1X9V A;  4IL6 E;  2P2U A;  5GTH H;  1VL2 A;  2XU6 A;  2HFE D;  4TT3 H;  2UZF A;  1G2C B;  2P10 A;  1J7X A;  1LT9 A;  2RKL A;  1GW4 A;  3TGU J;  3AEB C;  2W3P A;  5B5E H;  4UB8 H;  2FXM A;  4K3A A;  3SWF A;  3MYB A;  3T8B A;  1N7S A;  3H25 A;  3OJA B;  2BZR A;  4PD4 D;  3RBX A;  2KNC A;  5DJT B;  1VF5 B;  1FZC C;  3MFM A;  4L8K A;  2KSE A;  3Q1M A;  3NJD A;  3WUV A;  3IAO A;  5AVS B;  2P1J A;  3Q5R A;  5KKZ C;  5CMZ A;  2WVR A;  5APS A;  1BCC D;  1UYT A;  4IZB A;  3H1K J;  1LGH B;  3CMA P;  2W83 C;  1M8O B;  5CBO A;  1SG4 A;  2J58 A;  3CME P;  1VQN P;  2WSE H;  2A81 A;  3B5N D;  3TVU A;  3FXE A;  5G1S A;  1YQ4 C;  2ZJS E;  4MI2 A;  2B9B A;  3T8A A;  3L72 J;  3F5H A;  1L0L J;  1P84 D;  3L36 A;  1CI6 B;  3H81 A;  3L70 J;  1NH4 A;  4I42 A;  3LID A;  5CCH C;  1BDC A;  3B5N A;  3PE8 A;  3BAS A;  5DJU B;  2WPV B;  1JEK A;  3RK2 C;  4J2U A;  2WPS A;  1EZV G;  2BEQ D;  4OGQ D;  1FZC B;  1SQP J;  1BCC E;  4MN4 C;  4DCK A;  1L4A C;  2B88 A;  1BCC G;  4AYC A;  4ZDE A;  1URQ A;  5DUF A;  1IZN B;  3GHG A;  5KLV J;  4OGQ C;  1S3J A;  1ZRT D;  2J5G D;  4NPE A;  2GA1 A;  1DUB A;  5ING A;  1LTJ A;  1EF9 A;  3QWO C;  1ZXG A;  3M9Q A;  4BXL A;  2J5G A;  2L91 A;  5TJH A;  2X24 A;  1KYO E;  4IOI H;  1UIX A;  2E76 C;  2VSU A;  1W2B O;  2VSS E;  1N73 B;  1YG8 A;  3QWD A;  3HP0 A;  2D2C C;  1SQB D;  1S9K E;  3BVH A;  1WMK A;  2QJK C;  3PZK A;  1Y7O A;  1FZC A;  1KB9 H;  3P8C D;  3IR9 A;  1A02 J;  3C9I A;  4KNP A;  1RJM A;  5AW7 B;  5TIS E;  3L72 G;  3BPP A;  1LTT C;  2ZVN B;  5K5G B;  3L37 A;  2JJL A;  3B4S A;  3B71 A;  4Y28 J;  1WT6 A;  3HUS C;  3BRT B;  1SQB K;  5G1Q A;  1KYO H;  1NTK D;  1X0T A;  4ZDC A;  1EDI A;  2X58 A;  2K9Y A;  3OC7 A;  3VN0 A;  1T3J A;  2E74 C;  1PPJ D;  1MZ9 A;  4XFJ A;  2Q6Q A;  4PJ0 E;  4B3I A;  4OGQ B;  2Y9Y A;  1JY3 P;  1SQQ J;  1OWA A;  2FYU J;  1KQF B;  1LTJ B;  3O8Z A;  5KJ7 C;  3AEA C;  3HD7 A;  3IF4 A;  5FIF A;  3P5M A;  2QG4 A;  3AED C;  1URQ C;  1Y47 A;  1SQQ E;  2JO1 A;  2WSE J;  1UYV A;  4ZDF A;  1N6F A;  1SFC C;  3GF7 A;  3JC2 2;  3ZW9 A;  3TK1 A;  1SQX K;  1R5S A;  1QX8 A;  3I5C A;  2KLU A;  5CCH A;  2HR3 A;  1KMI Z;  2W90 A;  5KJ7 A;  3B8E B;  3V4Q A;  3H6P A;  5G1R A;  4U3F J;  4YXW H;  3V2P A;  4U3F D;  1E5W A;  5AW4 B;  4JOT A;  1ZOY C;  1U57 A;  1M1J B;  2GM4 A;  4L75 A;  1PP9 D;  1BGY G;  3NMD A;  2F9Y A;  3UIA A;  3CXH E;  3RK2 D;  2VSU E;  2KK7 A;  2UWJ E;  5AVV B;  2C9L Y;  2KZJ A;  1JM0 A;  3LW5 J;  1OD2 A;  2ZQR A;  2AEF A;  2YXQ B;  1EZV I;  3PHL A;  1HGV A;  1S9K D;  3ZWA A;  1ON3 A;  2Z4E A;  3Q7H A;  1NU1 J;  1IJD B;  3KQG A;  2YKO A;  3HE5 A;  3ZW8 A;  3RL0 g;  1GL2 B;  2R3C A;  2WSF H;  5CJ0 A;  3KTK A;  3MP7 B;  5KJP A;  3QK8 A;  1LP1 B;  2NPS B;  2FFD C;  2A06 G;  3L73 J;  4F47 A;  1MKM A;  2A06 D;  3F89 A;  3E1R A;  3HD7 C;  1P84 I;  3QXZ A;  3SWK A;  3V5B A;  2M3E A;  2F6I A;  2JWD A;  3L72 E;  2FYU G;  3M6M A;  2LKM A;  2WZ7 A;  2CPB A;  2Q1K A;  3HLN 1;  2N1T C;  2PBP A;  3H1J J;  3Q5S A;  1M7L A;  4L6W A;  3FDU A;  2PAJ A;  1DX7 A;  3HD7 D;  5AW0 B;  3W67 A;  1J1E B;  3CCJ P;  5AW6 B;  2ITA A;  1VQM P;  3MT6 A;  1KZU B;  1BSH A;  1Z56 A;  4YLH A;  1RY3 A;  3NFQ A;  3JCU H;  1FC7 A;  3NJB A;  5HUQ A;  4OWF A;  3GF3 A;  4XA4 A;  1SQP D;  3HTK A;  3KPE A;  2ZT9 D;  3A3Y B;  2D2C B;  2QJY C;  5AVX B;  1WDM A;  3H0U A;  1BGY D;  3BCC D;  3AE4 C;  1HF9 A;  4FB8 A;  1JOC A;  3QKA A;  3H1K D;  1NHL A;  3ZWB A;  2CPS A;  3KXD A;  1VQ9 P;  1VQP P;  2Q9I A;  3R9T A;  2PPY A;  3RSI A;  3L75 G;  4IL6 H;  4D6T E;  5JBX A;  4WYO B;  2XNX A;  2WSC J;  2N1T A;  1VF5 C;  2R32 A;  4HB1 A;  5GTH E;  3HTK B;  4YXD C;  2C9N Y;  1YTZ T;  2BCC G;  2HYN A;  5BU8 B;  1Q86 Q;  1FDO A;  5APY A;  3T89 A;  1X79 B;  2IZ0 A;  4N78 E;  2VSU C;  1YI2 P;  1NTZ K;  3RK3 C;  4MOU A;  2F9Y B;  2IPP A;  3M0A A; 
#chains in the Genus database with same CATH homology
 1PV3 A;  1OW7 A;  1DIP A;  1HZD A;  2O01 J;  3OT6 A;  4EML A;  3TZ3 A;  3RST A;  5KDR A;  4I7Z C;  3H0Q A;  1S5L X;  2F9I B;  1SZO A;  5C90 A;  3L3S A;  3R9Q A;  1EXJ A;  4FJW D;  3IB9 A;  2CE3 A;  4NEK A;  1JB0 J;  1AJY A;  2GTR A;  4FZW C;  3Q0J A;  3TT7 A;  1TYF A;  3DOR A;  1Y9B A;  3P85 A;  2MKV A;  2DUB A;  3OME A;  4JCR A;  3AE5 C;  2VRE A;  3LAO A;  2D2C D;  1R8E A;  3BPT A;  3D6Z A;  1EXI A;  2HW5 A;  3QMJ A;  5L8R J;  3RK3 E;  1NZY B;  3BF0 A;  3KTG A;  4ZDD A;  1VL2 A;  4H13 D;  5DKP A;  3Q2Y A;  4TT3 H;  2UZF A;  1VF5 D;  2D3T A;  3KTI A;  2FBW C;  2P10 A;  4Q0G A;  1J7X A;  2ZL3 A;  2Q2X A;  2J5I I;  2VSS A;  3AEB C;  2W3P A;  3AE1 C;  1HNO A;  4ELW A;  4RCN A;  3Q1T A;  3MYB A;  4ELS A;  2YMK A;  3T8B A;  3H25 A;  1KTM A;  2BZR A;  1HJ0 A;  2E75 B;  5E0N X;  3S9O A;  4OG1 A;  1VF5 B;  3KTJ A;  4GHN A;  4ZU2 A;  4H44 C;  1UYS A;  1DCI A;  3MFM A;  4L8K A;  2F6Q A;  3NJD A;  3AE8 C;  3Q1M A;  1EY3 A;  3STA A;  2YJG A;  3IAO A;  3R9S A;  3MOY A;  3Q5R A;  1FC6 A;  5KKZ C;  3WG5 A;  3H0J A;  5MGB A;  3AEC C;  4KD6 A;  1UYT A;  4IZB A;  3Q3D A;  2OQQ A;  4PV1 D;  2WQY C;  2ZT9 B;  2C8T A;  3ISA A;  1XNV A;  4FN8 A;  1SG4 A;  1JXZ A;  4FND A;  2A81 A;  1S1C X;  2E75 D;  1NYH A;  4IL6 X;  3TVU A;  4PV1 C;  1YQ4 C;  5G1S A;  4MI2 A;  5DTP A;  3U9S B;  4WZ8 B;  3T8A A;  3QYR A;  3R0O A;  3BEZ A;  3H81 A;  5CTB A;  4I42 A;  2G8Y A;  4U1A A;  3O6Q A;  4G2R A;  2J5U A;  1OMI A;  4ASI A;  3PE8 A;  5IKL B;  2WPV B;  4J2U A;  4RYF H;  1GMJ A;  1FC9 A;  4H44 D;  2EJ5 A;  4NAR A;  4I4Z A;  4U18 A;  2BEQ D;  4OGQ D;  4K3W A;  1O8U A;  4U0G A;  4H0L C;  2E74 B;  1XNY A;  2CBY A;  3HRX A;  4ZDE A;  5DUF A;  5INF A;  1XNW A;  4OGQ C;  2ZL0 A;  4OMR A;  2J5G D;  1OD4 A;  1DUB A;  1KQG B;  5ING A;  1EF9 A;  1WDL A;  4GDO A;  2ZT9 C;  2J5G A;  2E74 D;  2X24 A;  1UIX A;  2E76 C;  2VSU A;  2VSS E;  3GLM A;  1PL5 A;  4LK5 A;  1YG8 A;  3QWD A;  4H44 B;  3GKB A;  1OW8 A;  3HP0 A;  3D6Y A;  3PEA A;  2D2C C;  4PV1 B;  1WMK A;  1K32 A;  2V7Q J;  2QJK C;  3C8V A;  3PZK A;  1Y7O A;  3N6R B;  4KNP A;  3TVW A;  1RQU A;  3PGQ A;  1RJM A;  1OW6 A;  3BPP A;  3RRV A;  3U9R B;  3D71 A;  2ZQQ A;  2FBM A;  3AE6 C;  4RKU J;  3TV5 A;  3B71 A;  4Y28 J;  2YIU C;  1YG6 A;  3V5I A;  1VRG A;  3HIN A;  5G1Q A;  4KPK A;  4I7Z B;  1K39 A;  4JCQ A;  4ZDC A;  5DTW A;  2H89 C;  2X58 A;  2K9Y A;  3OC7 A;  4B3H A;  4JSB A;  5KDR B;  4GM2 A;  3SLL A;  2E74 C;  2Q34 A;  3K8X A;  4XFJ A;  3KTH A;  3H0S A;  5KLI C;  4H13 C;  1WZ8 A;  2WTB A;  4B3I A;  4OGQ B;  3T3W A;  3AE9 C;  3G64 A;  1UIY A;  4R4M A;  3ST9 A;  1KQF B;  5DUC A;  1HNU A;  3H02 A;  3AEA C;  5FIF A;  3P5M A;  2QQ3 A;  4KT0 J;  3AED C;  3ABV C;  1TU3 F;  2E76 B;  3AE7 C;  2JO1 A;  2WSE J;  2J5S A;  1UYV A;  1NZY A;  4JCT A;  4ZDF A;  1N6F A;  4H0L B;  3GF7 A;  4NNQ A;  2FZS A;  2A7K A;  3ZW9 A;  4Z1M H;  2J5I A;  3V5E A;  4HDT A;  4ZDB A;  3TT6 A;  2BEZ F;  4K29 A;  1KMI Z;  1IK7 A;  2NP9 A;  4JYL A;  3LKE A;  2VSS F;  1MJ3 A;  1Q52 A;  4QII A;  3TLF A;  1XO6 A;  4FZW A;  5G1R A;  2E75 C;  1NGM B;  1RQV A;  3SFE C;  3P2L A;  4EMP A;  5CTC A;  1PIX A;  3M6N A;  5DZK H;  2QJP C;  5E0S A;  5E0S H;  5JBW A;  4IZC A;  4JOT A;  3K50 A;  1ZOY C;  4U7J A;  1U57 A;  1N6D A;  4H13 B;  3IBB A;  3IN6 A;  4JCS A;  2ZL4 A;  1FDI A;  2F9Y A;  2IDB A;  3D70 A;  4U0G H;  3JU1 A;  4MXI A;  3U9T B;  5DU8 A;  3FGA D;  4U19 A;  2VSU E;  4JYJ A;  4RYF A;  1K04 A;  1ZP0 C;  3LW5 J;  1OD2 A;  2ZQR A;  3SWX A;  4EMM A;  3ZWA A;  5M1B A;  3T97 B;  1ON3 A;  3AE2 C;  2JP3 A;  2A7S A;  3Q7H A;  3SFD C;  3QXI A;  3FF6 A;  3DJA A;  3TDC A;  5FUS A;  1X0U A;  3ZW8 A;  1UYR A;  3GMA A;  3RL0 g;  3T88 A;  1W2X A;  3Q0G A;  3AEG C;  1PJH A;  3KTK A;  5KJP A;  3QK8 A;  3QRE A;  4IZD A;  2FYN C;  1YQ3 C;  2PG8 A;  1ZME C;  4F47 A;  1MKM A;  1RJN A;  4FN7 A;  4QFE A;  2F9I A;  1EF8 A;  3HE2 A;  4JJT A;  3QXZ A;  3I47 A;  1FCF A;  2F6I A;  2VSU F;  4Z0M A;  1ZRT E;  3M6M A;  3HLN 1;  3TRR A;  2Q35 A;  2PBP A;  3Q5P A;  3Q5S A;  4L6W A;  3FDU A;  2FXP A;  4I52 A;  4YTP C;  2QSI A;  3G9R A;  4WCZ A;  4U0H A;  3MT6 A;  4YLH A;  3AE3 C;  3ZWC A;  2VX2 A;  4K2N A;  1Q90 D;  4OLQ A;  1FC7 A;  2DEO A;  3NJB A;  5HUQ A;  5INI A;  3GF3 A;  3R4Y A;  2ZT9 D;  2D2C B;  4JVT A;  2QJY C;  5DZK A;  1WDM A;  3R6H A;  4B3J A;  3H0U A;  4JWV A;  4R4L A;  3AE4 C;  5DU6 A;  2G3A A;  1HF9 A;  3AEE C;  4FB8 A;  1ON9 A;  1TG6 A;  3QKA A;  4ELX A;  2WSF J;  5C9G A;  1KOR A;  1DD4 A;  2QIW A;  4HC8 A;  3ZWB A;  2E76 D;  3R9T A;  2NZ2 A;  2PPY A;  2J5I B;  4KWB A;  1Q51 A;  3RSI A;  2ZL2 A;  5DL1 A;  4DI1 A;  5JBX A;  1XX4 A;  4WYO B;  2WSC J;  1VF5 C;  4Q1I A;  3VIV A;  1N6E A;  1DD3 A;  3IAV A;  4YXD C;  4HNK A;  4JFC A;  1FDO A;  3T89 A;  4FNB A;  2FW2 A;  3AEF C;  4QIJ A;  2VSU C;  1K05 A;  1KIL E;  2H88 C;  4H0L D;  4MOU A;  2F9Y B;  1WDK A;  2IEX A;  3KQF A;  5DU4 A;  3EWK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...