3GMAA

Glutaconyl-coa decarboxylase a subunit from clostridium symbiosum co-crystallized with glutaryl-coa
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
584
structure length
558
Chain Sequence
MYSMPGYFQNMPTIGKELVNPNPENEQEIKAVESDIHESIKKALDAGITSEEKLNERGQLSAMQRINALIDPGTWCPLNSLFNPENNKFGTTNIVNGLGRVDGKWVYIVASDNKKMAGAWVPGQAENLIRCSDAAKMMHLPLIYLLNCSGVEFPNQDKVYPNRRGGGTPFFRNSELNQLGIPVIVGIYGTNPAGGGYHSISPTILIAHQDANMAVGGAAAEQIIAAQIENSKLKVPAPGSVPIHYDETGFFREVYQNDLGVIDGIKKYISYLPAYNLEFFRVDTPKAPQLPAEDLYSIIPMNQKRPYDIYEVIARLFDNSEFSEYKKGYGPEMVTGLAKVNGLLVGVIANVQGLLMNYPEYKQNSVGIGGKLYRQGLIKMNEFVTLCARDRIPLIWLQDTTGIDVGDEAEKAELLGLGQSLIYSIENSKLPSLEITIRKASAAAHYVLGGPQGNNTNVFSIGTGACEYYVMPGETAANAMYSRKQPIIGKMNDMIQMYTDKSRPKYCTEKGMVDEIVDMTEVRPYIQAFTEAAYQNPQSICPMHQMLTPRSTREFETF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutaconyl-CoA decarboxylase subunit A
publication title An asymmetric model for Na+-translocating glutaconyl-CoA decarboxylases
pubmed doi rcsb
source organism Clostridium symbiosum
molecule tags Lyase
total genus 210
structure length 558
sequence length 584
chains with identical sequence B
ec nomenclature ec 4.1.1.70: Transferred entry: 7.2.4.5.
pdb deposition date 2009-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01039 Carboxyl_trans Carboxyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.680 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Helix bin 3gmaA01
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3gmaA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3gmaA03
3ZW8A 3BPPA 3H0UA 5FIFA 2VSSA 1SZOA 5DTPA 3NJBA 3PZKA 2VSUA 3QWDA 2VX2A 3KQFA 4KNPA 3TVWA 1FC6A 4JYJA 4JCSA 3GF7A 4B3JA 1WDMA 4K29A 3R6HA 1TYFA 5DUFA 3R0OA 4IZBA 3RSIA 3K50A 1N6EA 4I4ZA 2A7SA 2CE3A 1W2XA 4MXIA 3KTHA 4JYLA 3TVUA 3DJAA 2ZL2A 5G1RA 2HW5A 1UYSA 2A7KA 1Q52A 2BZRA 4DI1A 1K32A 3QYRA 1WDLA 2IEXA 1SG4A 3BF0A 4L6WA 4FB8A 1FC9A 4IZCA 2F9YA 4FN7A 4K2NA 4LK5A 3LKEA 3U9TB 2C8TA 1EY3A 2DEOA 3QREA 4I52A 4WYOB 5DZKH 5DTWA 3MT6A 4HC8A 2A81A 4RYFA 3P2LA 3T8BA 2ZL3A 3HLN1 4ELXA 4FJWD 2Q34A 1PIXA 1JXZA 5JBXA 5E0SA 4MI2A 3DORA 4ZDCA 4EMMA 2DUBA 2X24A 5C9GA 4JJTA 1RJNA 1WZ8A 4ASIA 2J5IB 3L3SA 1DCIA 4QIJA 3V5EA 4B3HA 3IAVA 2UZFA 4RCNA 2FBMA 4JSBA 2J5GA 1HNOA 2PPYA 3KTJA 1Y7OA 2D3TA 4U19A 3GMAA 3M6NA 3R9SA 3RRVA 3Q0JA 4U0GH 4FZWA 3FF6A 2WTBA 5IKLB 3H81A 4Q1IA 4U1AA 4WCZA 5CTCA 2PG8A 3OC7A 3T88A 3MOYA 3HINA 1N6DA 3HP0A 3FDUA 4ZDFA 1UYTA 3GKBA 1EF9A 4ZDBA 5JBWA 3QK8A 4NNQA 4FNBA 3TV5A 3QMJA 2F6QA 1PJHA 4L8KA 4EMPA 3TZ3A 1K39A 5FUSA 3OT6A 1XNVA 3KTIA 4U0HA 3R9TA 5KDRB 2ZL4A 2VSSF 3V5IA 3PE8A 5DU6A 2VSUF 3H02A 4I42A 4U18A 3MFMA 1Q51A 3BEZA 3G64A 4ELSA 4QIIA 5C90A 4JFCA 4KPKA 5MGBA 2QQ3A 3ISAA 2J5SA 3QKAA 4JCQA 1N6FA 3IB9A 2VSUC 3SWXA 3ZWCA 3M6MA 5INFA 1YG8A 1MJ3A 3KTGA 4HNKA 3TT6A 4OLQA 2Q35A 5KJPA 5DUCA 2EJ5A 1NZYB 2F9YB 3RSTA 3WG5A 4G2RA 3QXIA 4Q0GA 2F9IB 3HRXA 3P85A 3Q7HA 4NEKA 4JOTA 3R9QA 3STAA 3Q1TA 1XNYA 2J5GD 4JCRA 4WZ8B 1UYRA 5INIA 4JVTA 1J7XA 2FZSA 4OG1A 1OD2A 4FNDA 1WDKA 2W3PA 1ON9A 3ZW9A 5DZKA 1YG6A 4GM2A 3TLFA 5E0NX 1UIYA 4KD6A 3SLLA 3TDCA 2J5II 5DL1A 3T89A 2Q2XA 3H0QA 3U9RB 2F6IA 1DUBA 3T3WA 3IBBA 3Q0GA 5DKPA 2PBPA 3H0SA 5CTBA 1OD4A 1VRGA 1XNWA 4ZDEA 3OMEA 4RYFH 3VIVA 5KDRA 3N6RB 1EF8A 3QXZA 3NJDA 1FC7A 3T8AA 5E0SH 2VREA 4ELWA 4GHNA 3GLMA 3PGQA 2X58A 4K3WA 3TT7A 1TG6A 1O8UA 1HZDA 2FW2A 3GF3A 4FZWC 4JWVA 4U0GA 3ZWAA 1FCFA 3ST9A 3KTKA 5DU8A 2GTRA 2CBYA 1NZYA 3ZWBA 4JCTA 2F9IA 4QFEA 3P5MA 3MYBA 3PEAA 2ZL0A 2J5IA 3K8XA 1RJMA 5G1QA 4OMRA 5G1SA 4ZDDA 3I47A 2VSSE 4ZU2A 4B3IA 1XO6A 1ON3A 2VSUE 4YLHA 3U9SB 1XX4A 3LAOA 3JU1A 3HE2A 4EMLA 4FN8A 4Z0MA 2ZQQA 1UYVA 5DU4A 4KWBA 3H0JA 4MOUA 2NP9A 1X0UA 3TRRA 4IZDA 1HNUA 2ZQRA 5INGA 4F47A
chains in the Genus database with same CATH superfamily
3ZW8A 2ZT9D 3BPPA 3BCCD 3IF4A 5FIFA 1NGMB 2C9NY 1WRGA 4OH8B 3HRNA 1SQXJ 4TLFA 5CCHD 5DTPA 3NJBA 2E76B 2R3SA 1S9KD 1RF1A 1JY3P 1SFCA 3A7OA 2W6AA 2VX2A 2KS1B 3WUTA 3M9QA 3H1LG 4U7JA 1FC6A 2AEJA 2WPRA 3KYQA 4B3JA 2ZXXA 3B8EB 1TYFA 1YJNP 4ZMDA 2OTJP 2Z5HA 3R0OA 1MFTA 3RSIA 1Y47A 4I4ZA 1R5LA 5AVUB 1FZBA 1PPJG 1S5LE 1W2XA 1AA0A 3BATA 3FGAD 2BCCD 4JYLA 1MFZA 2E75D 1L4AB 3CWBD 1X8YA 2P1JA 1EZVI 1XTCC 4YXWH 2Y0DA 1FBMA 3Q5SA 3QYRA 2IEXA 4L6WA 4IZCA 4LK5A 1BGYD 2OQQA 4PD4E 3V4WA 4K3AA 3QREA 2WZ7A 5DZKH 3Q3DA 1LTTC 4HC8A 1NU1D 5AW0B 2JDIH 3G6EP 2HFED 4ELXA 2Q1KA 5APTA 3V2NA 3TDKA 1SQPD 5JBXA 1URQB 1VF5B 2Y9YA 3AE5C 1VQMP 5E0SA 1QGKB 2IPPA 4EMMA 1H8AA 1T2KC 2CPSA 4JJTA 1RJNA 1E79H 3TF5A 3L3SA 1J1DC 3NMDA 1AVYA 5KTBA 3M0DC 2P2UA 4K35A 1JMBA 1UIIA 2PRRA 3HE4A 2O3JA 2N1TA 1EDKA 1CI6A 3B5NB 1Y9BA 2JJLA 4RCNA 1FU1A 2FBMA 1BDDA 4ASWA 4AUWA 1RE3C 1IJDB 2HODB 5KLVJ 3H1LD 2KS1A 3L75G 4FZWA 1LTAC 3FF6A 3CX5H 1FZFA 3H1JJ 3H1KJ 3HUSB 3RK2C 5KJ7C 1NTMD 2OYHB 5CTCA 3G71P 1T2KD 2QA4P 2RN0A 3T88A 4ZNCA 3HINA 3CC7P 1N6DA 4N6JA 4HB1A 1EF9A 1PPJD 1NU1K 4JYCA 5KLVG 2WMMA 5AW1B 3PLNA 1VDFA 3QMJA 2K1AA 4OGQB 3L71G 1SQBE 1GL2C 5B5EE 4L8KA 1SQPK 5FUSA 3OT6A 3KTIA 5KDRB 3R9TA 1L4AA 4DT0A 2JWAA 5TISE 4W7ZA 1VPCA 3V5IA 1LWUC 4I42A 3H02A 4RESB 1Q51A 3G64A 4ELSA 1GU5A 3H1ID 1L0LE 1LJ2A 1BCCG 1MV8A 2J5SA 5AVVB 3WUUA 3QKAA 3RK2D 3H32A 3TNUA 4B86A 1FOSE 4L74A 5KJ7D 1SFCC 3ZWCA 5KAFE 5INFA 2SPZA 1HGVA 4PV1B 4HNKA 1LTIC 2H43A 3L73E 5KJPA 2BASA 3GHGB 2D2CC 2F9YB 1GL2D 2OARA 1JUNA 3QXIA 1ZRTD 2ZFCA 2KUBA 3Q7HA 4NEKA 2WT7B 2V7QJ 3STAA 3ABVC 3EFGA 1NTMK 3Q1TA 1KC8Q 3JCUE 4JCRA 2Q9IA 1UYRA 1K05A 2QJKB 1X22A 2I1KA 5KAIH 4JVTA 3BCCE 1GK4A 1OD2A 3FWNA 1SFCD 4JF7A 5AW3B 3VMYA 2RKLA 3H6PA 5AVTB 3ZW9A 4U3FG 4GM2A 1X9VA 4HYTB 2GUVA 2MKVA 2D2CD 4I2LC 3HUSA 4LLHA 3O6QA 2W6JH 2M0BA 1Z56A 1DUBA 3T3WA 3LW5H 3IBBA 3NXSA 1VQPP 5CTBA 1NTKG 1KORA 2B89A 2K9YA 4DZOA 3G9RA 5KDRA 1N73A 1NVOA 2I1JA 1NTZJ 3JSVC 1YTZT 1SVFA 1VQ6P 1LTJA 2WSCH 3VOPA 5CCHA 1J1EB 3CXHE 3AEEC 1FC7A 3T8AA 2YMYA 2VREA 4ELWA 1KB9E 1VQKP 1XTGB 1JY3O 5B66H 1PP9J 2QSIA 2LR2A 3AE8C 2E76C 1YHQP 2FW2A 3GF3A 1AFOA 2YKPA 3M0AA 4FZWC 2Q6QA 1Q82Q 1JCDA 1GDTA 2Y0EA 3KTKA 1KYOI 2FY8A 1N7SB 2K9JA 2CBYA 3GHGA 2POHA 5TJHA 1SQQJ 4R4LA 1G2CB 5AVRB 1H0TA 3AE1C 1BSHA 4UB8H 1FDMA 1OVVA 1FDOA 2WT7A 3PEAA 4EDFA 4HH2A 3K8XA 2WPQA 1L4AC 5APXA 1YIJP 2VSUE 1SQQG 3B4SA 2FYUJ 2E76D 2YKOA 1FZAA 4U3FD 1D7MA 3GW6A 1HF9A 3H1LE 3RK3E 5M1BA 4FN8A 1U7JA 3L72G 2YNYA 2B87A 1RQVA 4PJ0E 2YMKA 1UYVA 1L0NG 3UIAA 1BE3J 4KWBA 2R5BA 1NTME 2ITAA 4OWFA 4UB6E 2NP9A 2QE7H 2FYUG 3TRRA 2L91A 1H89A 1HBWA 5KLIB 2ZXEB 1RH5B 3MTUE 1HNUA 1PPJE 2IZ1A 1VF5C 4GIFA 2DW3A 3TGUG 2QM8A 3H0UA 1L4AD 2WSFJ 1SZOA 3EFFK 1KV4A 3P8MC 1X0TA 3PZKA 1JTHB 3CMAP 1VQ4P 2VSUA 3L70D 1LP1B 2HPCA 1U57A 4BRYB 2OYIB 4ZKPA 2WQYC 3HTKB 4NPFX 1M8OB 4K29A 2E43A 3HD7A 3QWOC 5CMZA 3II6A 3KQGA 1N86A 3VMAA 5GTHE 1N6EA 1SP4A 2W83C 2CE3A 2FXPA 3L4FA 4MXIA 3KTHA 5C39A 1VF5D 5AW5B 3CCVP 4C46A 3DJAA 1SQBD 1SS1A 3HUSC 2XNXA 2BCCJ 3FWLA 1YI2P 1MZ9A 3CWBJ 2WSCJ 1ZRTE 2Z4EA 1Q90D 2M5AB 1FC9A 4K2NA 4D6TG 4FN7A 3CCMP 4IOIH 2A06G 3U9TB 1CSBA 2C8TA 4OGQC 1KFMA 1JCCA 1L0LD 2KP8A 1BGYJ 4Y28J 1N73C 3B5ND 3MD0A 4FJWD 1LTJC 1NU1J 1ZR4A 1AVOA 1JXZA 2KI7B 1G1JA 1IZNB 4XA4A 3L75E 3H1HG 3L72D 2IBZG 3DORA 2YXRB 1SQPJ 1OMIA 4N3YB 1L0ND 3W68A 2GA1A 2GUSA 4I1LA 1OVRA 1KYOH 2J5IB 5E79H 3CPWO 5DJUB 4TT3H 3PTZA 1GL2A 2WSEJ 4RKUJ 4PV1C 3V5EA 1QEXA 3L71E 3IAVA 1YYCA 1PFIA 2WPVB 4OGQD 3GHGC 2WWWA 2PP6A 2AEFA 4JSBA 3V2PA 1Y7OA 1SQBK 2D3TA 4U19A 5BU5A 3CCJP 4ZKUA 2HYNA 4IL6X 4HKZH 3RRVA 3Q0JA 2ZYAA 1KD1Q 4GT1A 4H44B 1N7LA 3ZDMA 1BCCE 5IKLB 4BRYA 2QRXA 1HTLC 1FC2C 2QJKC 3MHVA 2CPBA 4U1AA 1GD2E 1IK9A 4JYBA 3A0BE 3MUDC 1L0LK 3MOYA 1UYTA 4M3LA 1RF0A 5JBWA 3AEGC 3QK8A 4NNQA 1SQXG 3KPEA 4PV1D 1EQ7A 2XNDH 3CCRP 1KILB 4W80A 1NO4A 1S3JA 3P8CD 2K37A 3VP8A 1K39A 1XNVA 2A45I 2GM4A 2VSSF 1JO5A 2IYPA 2YO3A 2OGUA 4YPCA 1ZN5A 4D6TD 1L0NK 4U18A 2PAJA 3K5BA 2M5AA 1R5SA 4W7YA 1ZXGA 3U1AA 3CXHD 2QQ3A 2HR3A 3H1IJ 2V7QH 3VP9A 1KQSO 1KB9D 1L2PA 2VSUC 3SWXA 1GW4A 2M8RA 3KTGA 4PD4H 3TT6A 3AE6C 4U3FE 3RK3C 5CCGA 3ITKA 3HD7C 1RQUA 1HUCA 4I6MC 4H13B 3RSTA 4G2RA 4C7NA 3L74J 1S2EA 3AE7C 3R2PA 3VTPC 2KOGA 2FXOA 2QG4A 1T3UA 2AXTH 1P84D 1PGOA 2J5GD 1KILE 1IFDA 1SLQA 4WZ8B 3L37A 2OTKE 5AVXB 3C8VA 3G3ZA 1N7SC 1NTKE 3LIEA 2KSJA 1J7XA 2P7JA 2KNCB 3L74G 4FNDA 3OJAB 4A7PA 3L70E 1SQVJ 1LTGC 5DZKA 1YG6A 4Y99C 3S1KA 3RK3D 3N7NA 4KD6A 3HD7D 4LGDE 4CPGA 3P32A 2Q2XA 3CXHI 4HDTA 3MIWA 3SFDC 1SQXD 1KB9I 3CX5E 3Q0GA 5AVSB 2PBPA 1OD4A 1KILA 3RL0B 1VRGA 1ZOYC 3AE9C 1N7SD 4RYFH 3VIVA 4NARA 3H1JG 3H1KG 5CJ0A 4EYYQ 1HJ0A 4OVNF 4WB4A 5KLIC 2E74C 2W8ZA 4C7RA 4J2UA 3QXZA 1KN7A 2IYOA 2IDBA 3E7KA 1P84I 2FYZA 1ZLLA 3T97B 3TT7A 2O1KA 5K5GB 4WWIA 1O8UA 3Q2YA 2KB7P 1BDCA 3V5BA 5APWA 3BPTA 1Q7YQ 3PHLA 1OVUA 2QIWA 1QVGO 3F5HA 2QJYB 2G3AA 2P58A 3L72E 5DU8A 1DD3A 5CBOA 3IN6A 3H25A 1URQA 1L0NE 5KAFH 3L35A 3ZWBA 5AVZB 1YITP 1RF0C 3CC2P 4JCTA 4NPEA 1ZV8A 3A0HH 3OW2O 2ZVOB 3P5MA 2VRSA 1PGQA 4GOFA 3MYBA 1WT6A 3KZIH 2E74D 5G1QA 4OMRA 4DJGA 3TGUE 3RBZA 1SQXK 5G1SA 4ZDDA 1GU4A 4B3IA 1XO6A 1WMKA 1PZQA 2JKVA 3B71A 3FXDA 1VQLP 3E1IA 3CI9A 3D6ZA 3U9SB 3NFQA 5AVYB 2KNCA 3B5NA 2ZYDA 1YQ3C 3I56P 1NOHA 5CJ4A 2WSFH 5KAIE 2AEMA 4Z0MA 1LT9B 3L75D 3BVHA 2HODA 2ZQQA 1VQ9P 2Y0CA 4MOUA 3I5CA 4WY4B 1QL2A 1LTSC 3SSUA 2YXQB 2E5TA 2OYHA 1M1JB 2O1JA 5KLVD 5CCGC 2W27A 3SWKA 1YJWP 2P67A 3L71D 3P8CE 3H1JD 4N78E 2FFDB 5H2FH 3VYIA 5AW6B 4D6TE 1R8EA 4KNPA 1HGZA 2A06E 3TVWA 1FJPA 1IO4A 4JCSA 2OTLP 1BCCD 1OW8A 3R6HA 1TU3F 2N9BA 1NH4A 1S4XA 4QMAA 3WU2H 5DUFA 4IZBA 3K50A 2OYOA 1AQ5A 3KHUA 1NTZG 5B66E 3H1HE 1Q81Q 4H44C 3TVUA 2IZ0A 4EOTA 2IBZE 5CCGD 1JNMA 2ZL2A 1J2JB 1OFCX 2HW5A 1UYSA 3FX0A 1Q52A 3HE5B 1NKNA 1SQBJ 4DI1A 1A02J 1PP9G 1EDLA 3AEFC 1SG4A 4FB8A 2F9YA 1EDIA 3LKEA 5AW2B 2QJPB 2BEZF 4H0LB 1KILC 1P84E 4I52A 1OW6A 5KLVK 4UB8E 2WSEH 1L0LJ 3HLN1 2Q34A 1FZEA 2H8PD 2KYVA 3IR9A 4MN4C 1KFNA 1PIXA 1AJYA 2K3RA 3MUDA 4H44D 1OIPA 1VQ5P 4ZDCA 2YJGA 2DUBA 5C9GA 2MJZA 3AE3C 2KXPB 1WZ8A 1RE4A 3Q1MA 2WTYA 4ASIA 3L73J 3V2RA 1DCIA 1KZUB 1LNQA 1E5WA 4EI2A 2Q5UA 4WY4A 5HUQA 1SQXE 4BWNA 4B3HA 5KKZB 3V4QA 2E5YA 3AECC 1M1JA 1KILD 1URQC 2UZFA 1OX3A 2FYNB 2J5GA 2LKMA 3KXDA 1NTKD 1W5CE 2PPYA 3KTJA 1OZHA 1EZVG 2O01J 3SFEC 1LGHB 2KIKA 1BE3G 3GMAA 3M6NA 4U0GH 1KQFB 3U1CA 3BCCJ 2W90A 4IFMA 2WTBA 4Q1IA 4WCZA 3O8ZA 2PG8A 3M06A 3B5NC 4ZDFA 3GKBA 1AV1A 4ZDBA 1GK6A 1PL5A 1NTZD 1Y8AA 4FNBA 2IX7C 3TV5A 1HWTC 1GZLA 2JWDA 1RF1B 3CX5D 2F6QA 3TZ3A 2YO2A 3D6YA 2ZL4A 2YKQA 1URQD 3PE8A 1H88A 3D70A 2ZAEB 3HE5A 4DOJA 1QVFO 3BEZA 2RH0A 2OYHC 1N7SA 4QIIA 5BVZA 1DH3A 1N8RQ 4KPKA 5MGBA 1G2CA 1K04A 3RL0C 3AE2C 1JY2N 5GTIH 1N6FA 1DEBA 1IFNA 3CC4P 4BXLA 1YG8A 3JC22 1MJ3A 1GW3A 1SQQD 2BCCG 2ZJSE 1NTKK 3CWBG 1IC2A 3PRJA 3VMZA 5DUCA 2NPSB 2EJ5A 1X79B 2J59M 5CBNA 3RBXA 3HRXA 4IL6H 1RY3A 1BGYG 5APQA 3E1RA 4O9BA 1VQ7P 5BU8B 1XNYA 2FYUD 4I7ZB 2NZ2A 3I55P 1NU1G 5KLVE 2QJYC 4IFDK 5E79E 2FXMA 1NTZK 2XV5A 3TGUD 3RL0D 3BRVB 3CX5I 1T3JA 1EZVD 3MP7B 2FZSA 4OG1A 2K88A 1SQPG 3H1JE 3H1KE 1WDKA 1OXZA 3S4RA 2W3PA 3CCQP 1ON9A 2H7HA 3A5TA 1JTHA 2RMZA 1LP1A 3SLLA 3TDCA 2LXCB 3P7KA 1JM0A 5DL1A 4GOEA 2OYIA 3U9RB 2N1TB 3H1LJ 1CI6B 1W2EA 2F6IA 3HTKA 3LIDA 4KHXA 3AEBC 1NTMJ 1SQQK 3CMEP 1LT9C 3H0SA 1RE4C 3A0BH 4ZDEA 1YJ9P 4JBZA 4N78D 4WY4C 1JOCA 3RGUA 1EXJA 1M1JC 2BEQD 3NJDA 1NAYA 1MKMA 1PGJA 5E0SH 1T8ZA 1NTMG 1S5LH 2A06D 4GHNA 1FJKA 2FYUK 4AQRD 4Z1MH 2JO1A 4L75A 3PGQA 2P10A 4K3WA 2FFDC 2Y9ZA 3AEDC 4JWVA 2G8YA 1FCFA 4JQ0D 1IFJA 3L36A 1EC5A 3H1HD 3W67A 3KDPB 2XKMA 2NPSA 2IBZD 1J1EC 5EFWB 1K9MQ 1JY2P 2JP3A 1U7MA 3H1IG 2M3BA 1S5LX 4KJMA 3H32B 4WY4D 3TNUB 2J5IA 2KK7A 2O01N 4WBAA 3I47A 2VSSE 3AE4C 4ZU2A 4GKGA 1YBKA 2QVAA 2AXTE 1XX4A 3M9HA 3HE2A 2QJPC 4ASVA 4EMLA 2AXCA 4H0LC 1ZW0A 1A02F 5CHXA 5DU4A 5APYA 3IFMA 3L75J 3G4SP 1X0UA 4L76A 1FZCB 4IZDA 1VQ8P 1NTZE 4RO0A 5INGA 3OA7A 3SWFA 1SQVG 2L5GB 3TYYA 2VSSA 2HG5D 1M56D 3L71J 3EQ2A 1FOSF 1USEA 1PP9E 3QWDA 1G1IA 2IBZI 3CD6P 3KQFA 2PGDA 5L8RJ 3O6QB 1KMIZ 5KKZC 4KT0J 4EIJA 4JYJA 3GF7A 1HVVA 1NJIQ 1WDMA 4H0LD 2YIUB 2C0XA 2FYNC 1IFIA 5B5EH 2XZRA 2R5DA 1FDIA 2CK3H 2Z5IA 5TISH 1EDJA 1BCCJ 2A7SA 1ZP0C 1SQQE 1N73B 2ZT9B 1OW7A 1LTJB 3NTNA 2XU6A 5G1RA 2ZVNB 2OYIC 1YTZI 2A7KA 4AYCA 1JB0J 3IAOA 1CZQA 4GDOA 2BZRA 2W6BA 1K32A 1WDLA 3EWKA 1K73Q 3BF0A 3V2QA 4XE5B 3SWYA 2A45H 1EY3A 2FKWB 2DEOA 1RF1C 2FYUE 2KZJA 4WYOB 3AEAC 5DTWA 3MT6A 2A81A 4RYFA 3P2LA 3T8BA 3D71A 3A0HE 2ZL3A 3PH0A 1EZVE 3KZIE 2K9JB 3L74D 1BE3E 3BASA 2E75B 1RHZB 3TSIA 2QM7A 1H0TB 3CLQA 4MI2A 2FBWC 1K8AQ 3CCSP 2X24A 3JCUH 1FE6A 2PFXA 2WVRA 3USSA 2O01H 3QH9A 1EXIA 4U3FJ 1NAFA 3C9IA 4DCKA 4QIJA 4IFFA 1FZCA 4R4MA 2NPSC 1SQVD 1S1CX 5AW4B 1S72P 4LC1A 1KYOD 1S9KE 1HNOA 1W2BO 2WITA 4YTPC 3A2AA 3M91A 1KQLA 2B87B 2R3CA 2ZYGA 1NTKJ 3H1KD 1CW5A 3R9SA 4I7ZC 1HJBA 5AW7B 3U59A 1GMJA 1FAVA 1MUUA 3V6IA 3H81A 3N4XA 3L70J 5H2FE 3OC7A 3RL0g 3HP0A 3FDUA 2WPSA 3S9OA 2BCCE 3MZWB 4JPZB 2WSSH 3T97A 3CWBE 4RJTA 1FZGA 1NHLA 1PJHA 1IFPA 4EMPA 3CXHH 3WU2E 4U0HA 2NPSD 2HPCB 2C9LY 2M3EA 3L70G 1KB9H 1UIXA 5DU6A 2N1TC 3WUVA 1JMMA 1Q86Q 2VSUF 1BGYE 3MFMA 3RK3B 3HD7B 1YQ4C 3CCEP 5C90A 2V4HA 4WVZA 5AW9B 4JFCA 3VMXA 1NU1E 4GODA 3ISAA 2H88C 1VQOP 4JCQA 2KZIA 2J58A 5AW8B 3IB9A 1SQVK 3M6MA 1J1DB 1SQPE 1T6AA 2UWJE 4OLQA 3C1LA 1P84H 1SQBG 2Q35A 3F89A 2C0WA 1NZYB 1KTMA 3CL3D 3WG5A 4Q0GA 2F9IB 1ZR2A 3P85A 1NKZB 1M7LA 4JOTA 3R9QA 1LT9A 4Y99B 4PD4D 2N1TD 3L72J 3WMM0 1L0LG 1QLED 2IFNA 1L0NJ 1JY2O 3RK2B 3PP5A 5INIA 1M1KQ 1DIPA 2JR8A 1VQNP 1AQTA 4PJ0H 3CCUP 3TGUJ 2A45G 5AVQB 4H13C 3OAKA 3FXEA 4HJGH 3L73G 4UB6H 3VN0A 1GL2B 5APSA 3TLFA 2FFDA 2JEEA 5AVWB 5E0NX 1UIYA 2J5II 2E74B 1LWUB 1LTBC 3T89A 3H0QA 1QX8A 3CCLP 1JY3N 4YXDC 3M9BA 1N2DC 1HH0A 1DEEG 1QL1A 5DKPA 2B88A 1NYHA 1XNWA 4NPDA 3OMEA 2N9YB 3BCCG 1SFCB 3N6RB 1PV3A 1NWQA 1EF8A 2E42A 1LT1A 3H1IE 2B9BA 1FZCC 5GTHH 4H13D 1PP9D 1IK7A 2KSEA 3LW5J 4PD4I 2D2CB 1USDA 2R44A 3GLMA 4D6TJ 1M57D 2X58A 1KQGB 1TG6A 2QEXP 1HZDA 3PJSK 1DX7A 1GTWA 1PGPA 4U0GA 3ZWAA 3M0DA 2Q3IA 3MGNA 3Q5PA 2IFMA 3L74E 2NRGA 5APVA 3A3YB 3ST9A 5GTIE 1ZMEC 1JEKA 2YIUC 2GTRA 3GG2A 1NZYA 2KLVA 5APUA 1VL2A 3H1HJ 1FS0E 2F9IA 1RE3A 4QFEA 2R32A 2XDJA 2ZL0A 1RJMA 3R4YA 2ZT9C 1M90Q 4L73A 2HLOA 4IL6E 4XFJA 1ON3A 1SQVE 5CCHC 5DJTB 5KJ7A 4YLHA 1KYOE 2KLUA 2LXBA 3L73D 2Q3EA 3LAOA 3Q5RA 1DD4A 3JU1A 4C7NB 2Q7CA 1OWAA 1BE3D 3BRTB 1IFMA 2J5UA 3H0JA 2I8DA 1LWUA 3HE4B 3TK1A 2ZQRA 2E75C 1Q2NA 2H89C 1BSNA 4F47A
chains in the Genus database with same CATH topology
3ZW8A 2ZT9D 3BPPA 3H0UA 5FIFA 1NGMB 2WSFJ 2VSSA 1SZOA 5DTPA 3NJBA 3PZKA 2E76B 2VSUA 3QWDA 2VX2A 1R8EA 3KQFA 5L8RJ 4KNPA 1U57A 3TVWA 1KMIZ 5KKZC 4KT0J 4U7JA 1FC6A 4JYJA 4JCSA 2WQYC 3GF7A 4B3JA 1WDMA 4H0LD 4K29A 1OW8A 3R6HA 1TU3F 2FYNC 1TYFA 1FDIA 5DUFA 3R0OA 4IZBA 3RSIA 3K50A 1N6EA 4I4ZA 2A7SA 2CE3A 1ZP0C 2FXPA 1W2XA 4MXIA 3FGAD 3KTHA 4JYLA 2ZT9B 4H44C 3TVUA 1VF5D 2E75D 3DJAA 1OW7A 2ZL2A 5G1RA 2HW5A 1UYSA 2A7KA 1Q52A 1JB0J 3IAOA 2WSCJ 4GDOA 3Q5SA 1ZRTE 2BZRA 4DI1A 1K32A 3QYRA 1WDLA 1Q90D 3EWKA 1SG4A 3AEFC 2IEXA 3BF0A 1FC9A 4L6WA 4FB8A 4IZCA 2F9YA 4FN7A 4K2NA 4LK5A 3LKEA 2OQQA 3U9TB 2C8TA 4OGQC 1EY3A 2BEZF 4H0LB 2DEOA 3QREA 4I52A 4WYOB 5DZKH 3AEAC 1OW6A 3Q3DA 5DTWA 3MT6A 4Y28J 4HC8A 2A81A 4RYFA 3P2LA 3T8BA 3D71A 2ZL3A 3HLN1 4ELXA 4FJWD 2Q34A 1PIXA 1AJYA 1JXZA 5JBXA 1VF5B 2E75B 3AE5C 5E0SA 4MI2A 3DORA 2FBWC 4H44D 4ZDCA 4EMMA 1OMIA 2DUBA 2X24A 2YJGA 5C9GA 3AE3C 4JJTA 1WZ8A 1RJNA 3Q1MA 4ASIA 2J5IB 1EXIA 4TT3H 3L3SA 1DCIA 2WSEJ 4RKUJ 4PV1C 4QIJA 3V5EA 5HUQA 4B3HA 3IAVA 3AECC 4R4MA 2WPVB 1S1CX 4OGQD 1Y9BA 2UZFA 4RCNA 2FBMA 4JSBA 2J5GA 1HNOA 2PPYA 3KTJA 4YTPC 1Y7OA 2D3TA 4U19A 2O01J 3SFEC 4IL6X 3GMAA 3M6NA 3R9SA 3RRVA 4I7ZC 3Q0JA 4U0GH 4FZWA 4H44B 3FF6A 1KQFB 1GMJA 2WTBA 5IKLB 2QJKC 3H81A 4Q1IA 4U1AA 4WCZA 5CTCA 2PG8A 3OC7A 3T88A 3MOYA 3HINA 1N6DA 3RL0g 3HP0A 3FDUA 4ZDFA 1UYTA 3GKBA 1EF9A 4ZDBA 5JBWA 3S9OA 3AEGC 1PL5A 3QK8A 4NNQA 4FNBA 3TV5A 4PV1D 3QMJA 4OGQB 2F6QA 1PJHA 4L8KA 4EMPA 3TZ3A 3D6YA 1K39A 5FUSA 3OT6A 1XNVA 3KTIA 4U0HA 3R9TA 5KDRB 2ZL4A 2VSSF 3V5IA 1UIXA 3PE8A 5DU6A 3D70A 2VSUF 3H02A 4I42A 4U18A 3MFMA 1Q51A 3BEZA 3G64A 4ELSA 1YQ4C 4QIIA 5C90A 4JFCA 4KPKA 5MGBA 1K04A 2QQ3A 3ISAA 2J5SA 3AE2C 3QKAA 2H88C 4JCQA 1N6FA 3IB9A 2VSUC 3SWXA 3ZWCA 3M6MA 5INFA 1YG8A 1MJ3A 3KTGA 4PV1B 4HNKA 3TT6A 4OLQA 3AE6C 2Q35A 5KJPA 5DUCA 2EJ5A 1NZYB 1RQUA 2D2CC 2F9YB 1KTMA 4H13B 3RSTA 3WG5A 4G2RA 3QXIA 4Q0GA 2F9IB 3HRXA 3P85A 3Q7HA 4NEKA 4JOTA 2V7QJ 3AE7C 3R9QA 3STAA 3ABVC 3Q1TA 1XNYA 4I7ZB 2J5GD 1KILE 4JCRA 4WZ8B 2NZ2A 1UYRA 1K05A 2QJYC 3C8VA 5INIA 4JVTA 1DIPA 1J7XA 2FZSA 4OG1A 1OD2A 4FNDA 4H13C 1WDKA 2W3PA 1ON9A 3ZW9A 5DZKA 1YG6A 4GM2A 3TLFA 5E0NX 1UIYA 4KD6A 2MKVA 3SLLA 2D2CD 3TDCA 2J5II 2E74B 5DL1A 3T89A 3O6QA 2Q2XA 3H0QA 3U9RB 4HDTA 4YXDC 2F6IA 3SFDC 1DUBA 3T3WA 3IBBA 3Q0GA 3AEBC 5DKPA 2PBPA 3H0SA 5CTBA 1OD4A 1VRGA 1KORA 1ZOYC 1NYHA 2K9YA 3AE9C 1XNWA 4ZDEA 3G9RA 3OMEA 4RYFH 3VIVA 5KDRA 3N6RB 1PV3A 4NARA 1EF8A 1HJ0A 5KLIC 2E74C 4H13D 1IK7A 1EXJA 4J2UA 3QXZA 2BEQD 3AEEC 3NJDA 1FC7A 3T8AA 5E0SH 1MKMA 2VREA 3LW5J 4ELWA 2D2CB 4GHNA 2IDBA 2QSIA 4Z1MH 2JO1A 3GLMA 3AE8C 3T97B 3PGQA 2X58A 2P10A 4K3WA 1KQGB 3TT7A 2E76C 1TG6A 1O8UA 1HZDA 3Q2YA 3GF3A 2FW2A 3AEDC 4FZWC 4JWVA 3BPTA 4U0GA 3ZWAA 3Q5PA 2G8YA 1FCFA 2QIWA 3ST9A 3KTKA 2G3AA 1ZMEC 5DU8A 2YIUC 1DD3A 2GTRA 2CBYA 3IN6A 1NZYA 3H25A 2JP3A 3ZWBA 4R4LA 1VL2A 4JCTA 3AE1C 2F9IA 4QFEA 3P5MA 1S5LX 1FDOA 3MYBA 3PEAA 2ZL0A 2E74D 2J5IA 3K8XA 1RJMA 3R4YA 4OMRA 5G1QA 2ZT9C 5G1SA 4ZDDA 3I47A 2VSSE 3AE4C 4ZU2A 4B3IA 4XFJA 1XO6A 1WMKA 1ON3A 3B71A 2VSUE 4YLHA 3D6ZA 3U9SB 1XX4A 2E76D 3LAOA 3Q5RA 1DD4A 1YQ3C 3JU1A 3HE2A 1HF9A 2QJPC 4EMLA 3RK3E 5M1BA 4H0LC 4FN8A 4Z0MA 2J5UA 2ZQQA 1RQVA 2YMKA 1UYVA 5DU4A 4KWBA 3H0JA 4MOUA 2NP9A 1X0UA 3TRRA 4IZDA 1HNUA 2ZQRA 1VF5C 2E75C 2H89C 5INGA 4F47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZW8 A;  3BPP A;  3H0U A;  5FIF A;  2VSS A;  1SZO A;  5DTP A;  3NJB A;  3PZK A;  2VSU A;  3QWD A;  2VX2 A;  3KQF A;  4KNP A;  3TVW A;  1FC6 A;  4JYJ A;  4JCS A;  3GF7 A;  4B3J A;  1WDM A;  4K29 A;  3R6H A;  1TYF A;  5DUF A;  3R0O A;  4IZB A;  3RSI A;  3K50 A;  1N6E A;  4I4Z A;  2A7S A;  2CE3 A;  1W2X A;  4MXI A;  3KTH A;  4JYL A;  3TVU A;  3DJA A;  2ZL2 A;  5G1R A;  2HW5 A;  1UYS A;  2A7K A;  1Q52 A;  2BZR A;  4DI1 A;  1K32 A;  3QYR A;  1WDL A;  2IEX A;  1SG4 A;  3BF0 A;  4L6W A;  4FB8 A;  1FC9 A;  4IZC A;  2F9Y A;  4FN7 A;  4K2N A;  4LK5 A;  3LKE A;  3U9T B;  2C8T A;  1EY3 A;  2DEO A;  3QRE A;  4I52 A;  4WYO B;  5DZK H;  5DTW A;  3MT6 A;  4HC8 A;  2A81 A;  4RYF A;  3P2L A;  3T8B A;  2ZL3 A;  3HLN 1;  4ELX A;  4FJW D;  2Q34 A;  1PIX A;  1JXZ A;  5JBX A;  5E0S A;  4MI2 A;  3DOR A;  4ZDC A;  4EMM A;  2DUB A;  2X24 A;  5C9G A;  4JJT A;  1RJN A;  1WZ8 A;  4ASI A;  2J5I B;  3L3S A;  1DCI A;  4QIJ A;  3V5E A;  4B3H A;  3IAV A;  2UZF A;  4RCN A;  2FBM A;  4JSB A;  2J5G A;  1HNO A;  2PPY A;  3KTJ A;  1Y7O A;  2D3T A;  4U19 A;  3GMA A;  3M6N A;  3R9S A;  3RRV A;  3Q0J A;  4U0G H;  4FZW A;  3FF6 A;  2WTB A;  5IKL B;  3H81 A;  4Q1I A;  4U1A A;  4WCZ A;  5CTC A;  2PG8 A;  3OC7 A;  3T88 A;  3MOY A;  3HIN A;  1N6D A;  3HP0 A;  3FDU A;  4ZDF A;  1UYT A;  3GKB A;  1EF9 A;  4ZDB A;  5JBW A;  3QK8 A;  4NNQ A;  4FNB A;  3TV5 A;  3QMJ A;  2F6Q A;  1PJH A;  4L8K A;  4EMP A;  3TZ3 A;  1K39 A;  5FUS A;  3OT6 A;  1XNV A;  3KTI A;  4U0H A;  3R9T A;  5KDR B;  2ZL4 A;  2VSS F;  3V5I A;  3PE8 A;  5DU6 A;  2VSU F;  3H02 A;  4I42 A;  4U18 A;  3MFM A;  1Q51 A;  3BEZ A;  3G64 A;  4ELS A;  4QII A;  5C90 A;  4JFC A;  4KPK A;  5MGB A;  2QQ3 A;  3ISA A;  2J5S A;  3QKA A;  4JCQ A;  1N6F A;  3IB9 A;  2VSU C;  3SWX A;  3ZWC A;  3M6M A;  5INF A;  1YG8 A;  1MJ3 A;  3KTG A;  4HNK A;  3TT6 A;  4OLQ A;  2Q35 A;  5KJP A;  5DUC A;  2EJ5 A;  1NZY B;  2F9Y B;  3RST A;  3WG5 A;  4G2R A;  3QXI A;  4Q0G A;  2F9I B;  3HRX A;  3P85 A;  3Q7H A;  4NEK A;  4JOT A;  3R9Q A;  3STA A;  3Q1T A;  1XNY A;  2J5G D;  4JCR A;  4WZ8 B;  1UYR A;  5INI A;  4JVT A;  1J7X A;  2FZS A;  4OG1 A;  1OD2 A;  4FND A;  1WDK A;  2W3P A;  1ON9 A;  3ZW9 A;  5DZK A;  1YG6 A;  4GM2 A;  3TLF A;  5E0N X;  1UIY A;  4KD6 A;  3SLL A;  3TDC A;  2J5I I;  5DL1 A;  3T89 A;  2Q2X A;  3H0Q A;  3U9R B;  2F6I A;  1DUB A;  3T3W A;  3IBB A;  3Q0G A;  5DKP A;  2PBP A;  3H0S A;  5CTB A;  1OD4 A;  1VRG A;  1XNW A;  4ZDE A;  3OME A;  4RYF H;  3VIV A;  5KDR A;  3N6R B;  1EF8 A;  3QXZ A;  3NJD A;  1FC7 A;  3T8A A;  5E0S H;  2VRE A;  4ELW A;  4GHN A;  3GLM A;  3PGQ A;  2X58 A;  4K3W A;  3TT7 A;  1TG6 A;  1O8U A;  1HZD A;  2FW2 A;  3GF3 A;  4FZW C;  4JWV A;  4U0G A;  3ZWA A;  1FCF A;  3ST9 A;  3KTK A;  5DU8 A;  2GTR A;  2CBY A;  1NZY A;  3ZWB A;  4JCT A;  2F9I A;  4QFE A;  3P5M A;  3MYB A;  3PEA A;  2ZL0 A;  2J5I A;  3K8X A;  1RJM A;  5G1Q A;  4OMR A;  5G1S A;  4ZDD A;  3I47 A;  2VSS E;  4ZU2 A;  4B3I A;  1XO6 A;  1ON3 A;  2VSU E;  4YLH A;  3U9S B;  1XX4 A;  3LAO A;  3JU1 A;  3HE2 A;  4EML A;  4FN8 A;  4Z0M A;  2ZQQ A;  1UYV A;  5DU4 A;  4KWB A;  3H0J A;  4MOU A;  2NP9 A;  1X0U A;  3TRR A;  4IZD A;  1HNU A;  2ZQR A;  5ING A;  4F47 A; 
#chains in the Genus database with same CATH topology
 3ZW8 A;  2ZT9 D;  3BPP A;  3BCC D;  3IF4 A;  5FIF A;  1NGM B;  2C9N Y;  1WRG A;  4OH8 B;  3HRN A;  1SQX J;  4TLF A;  5CCH D;  5DTP A;  3NJB A;  2E76 B;  2R3S A;  1S9K D;  1RF1 A;  1JY3 P;  1SFC A;  3A7O A;  2W6A A;  2VX2 A;  2KS1 B;  3WUT A;  3M9Q A;  3H1L G;  4U7J A;  1FC6 A;  2AEJ A;  2WPR A;  3KYQ A;  4B3J A;  2ZXX A;  3B8E B;  1TYF A;  1YJN P;  4ZMD A;  2OTJ P;  2Z5H A;  3R0O A;  1MFT A;  3RSI A;  1Y47 A;  4I4Z A;  1R5L A;  5AVU B;  1FZB A;  1PPJ G;  1S5L E;  1W2X A;  1AA0 A;  3BAT A;  3FGA D;  2BCC D;  4JYL A;  1MFZ A;  2E75 D;  1L4A B;  3CWB D;  1X8Y A;  2P1J A;  1EZV I;  1XTC C;  4YXW H;  2Y0D A;  1FBM A;  3Q5S A;  3QYR A;  2IEX A;  4L6W A;  4IZC A;  4LK5 A;  1BGY D;  2OQQ A;  4PD4 E;  3V4W A;  4K3A A;  3QRE A;  2WZ7 A;  5DZK H;  3Q3D A;  1LTT C;  4HC8 A;  1NU1 D;  5AW0 B;  2JDI H;  3G6E P;  2HFE D;  4ELX A;  2Q1K A;  5APT A;  3V2N A;  3TDK A;  1SQP D;  5JBX A;  1URQ B;  1VF5 B;  2Y9Y A;  3AE5 C;  1VQM P;  5E0S A;  1QGK B;  2IPP A;  4EMM A;  1H8A A;  1T2K C;  2CPS A;  4JJT A;  1RJN A;  1E79 H;  3TF5 A;  3L3S A;  1J1D C;  3NMD A;  1AVY A;  5KTB A;  3M0D C;  2P2U A;  4K35 A;  1JMB A;  1UII A;  2PRR A;  3HE4 A;  2O3J A;  2N1T A;  1EDK A;  1CI6 A;  3B5N B;  1Y9B A;  2JJL A;  4RCN A;  1FU1 A;  2FBM A;  1BDD A;  4ASW A;  4AUW A;  1RE3 C;  1IJD B;  2HOD B;  5KLV J;  3H1L D;  2KS1 A;  3L75 G;  4FZW A;  1LTA C;  3FF6 A;  3CX5 H;  1FZF A;  3H1J J;  3H1K J;  3HUS B;  3RK2 C;  5KJ7 C;  1NTM D;  2OYH B;  5CTC A;  3G71 P;  1T2K D;  2QA4 P;  2RN0 A;  3T88 A;  4ZNC A;  3HIN A;  3CC7 P;  1N6D A;  4N6J A;  4HB1 A;  1EF9 A;  1PPJ D;  1NU1 K;  4JYC A;  5KLV G;  2WMM A;  5AW1 B;  3PLN A;  1VDF A;  3QMJ A;  2K1A A;  4OGQ B;  3L71 G;  1SQB E;  1GL2 C;  5B5E E;  4L8K A;  1SQP K;  5FUS A;  3OT6 A;  3KTI A;  5KDR B;  3R9T A;  1L4A A;  4DT0 A;  2JWA A;  5TIS E;  4W7Z A;  1VPC A;  3V5I A;  1LWU C;  4I42 A;  3H02 A;  4RES B;  1Q51 A;  3G64 A;  4ELS A;  1GU5 A;  3H1I D;  1L0L E;  1LJ2 A;  1BCC G;  1MV8 A;  2J5S A;  5AVV B;  3WUU A;  3QKA A;  3RK2 D;  3H32 A;  3TNU A;  4B86 A;  1FOS E;  4L74 A;  5KJ7 D;  1SFC C;  3ZWC A;  5KAF E;  5INF A;  2SPZ A;  1HGV A;  4PV1 B;  4HNK A;  1LTI C;  2H43 A;  3L73 E;  5KJP A;  2BAS A;  3GHG B;  2D2C C;  2F9Y B;  1GL2 D;  2OAR A;  1JUN A;  3QXI A;  1ZRT D;  2ZFC A;  2KUB A;  3Q7H A;  4NEK A;  2WT7 B;  2V7Q J;  3STA A;  3ABV C;  3EFG A;  1NTM K;  3Q1T A;  1KC8 Q;  3JCU E;  4JCR A;  2Q9I A;  1UYR A;  1K05 A;  2QJK B;  1X22 A;  2I1K A;  5KAI H;  4JVT A;  3BCC E;  1GK4 A;  1OD2 A;  3FWN A;  1SFC D;  4JF7 A;  5AW3 B;  3VMY A;  2RKL A;  3H6P A;  5AVT B;  3ZW9 A;  4U3F G;  4GM2 A;  1X9V A;  4HYT B;  2GUV A;  2MKV A;  2D2C D;  4I2L C;  3HUS A;  4LLH A;  3O6Q A;  2W6J H;  2M0B A;  1Z56 A;  1DUB A;  3T3W A;  3LW5 H;  3IBB A;  3NXS A;  1VQP P;  5CTB A;  1NTK G;  1KOR A;  2B89 A;  2K9Y A;  4DZO A;  3G9R A;  5KDR A;  1N73 A;  1NVO A;  2I1J A;  1NTZ J;  3JSV C;  1YTZ T;  1SVF A;  1VQ6 P;  1LTJ A;  2WSC H;  3VOP A;  5CCH A;  1J1E B;  3CXH E;  3AEE C;  1FC7 A;  3T8A A;  2YMY A;  2VRE A;  4ELW A;  1KB9 E;  1VQK P;  1XTG B;  1JY3 O;  5B66 H;  1PP9 J;  2QSI A;  2LR2 A;  3AE8 C;  2E76 C;  1YHQ P;  2FW2 A;  3GF3 A;  1AFO A;  2YKP A;  3M0A A;  4FZW C;  2Q6Q A;  1Q82 Q;  1JCD A;  1GDT A;  2Y0E A;  3KTK A;  1KYO I;  2FY8 A;  1N7S B;  2K9J A;  2CBY A;  3GHG A;  2POH A;  5TJH A;  1SQQ J;  4R4L A;  1G2C B;  5AVR B;  1H0T A;  3AE1 C;  1BSH A;  4UB8 H;  1FDM A;  1OVV A;  1FDO A;  2WT7 A;  3PEA A;  4EDF A;  4HH2 A;  3K8X A;  2WPQ A;  1L4A C;  5APX A;  1YIJ P;  2VSU E;  1SQQ G;  3B4S A;  2FYU J;  2E76 D;  2YKO A;  1FZA A;  4U3F D;  1D7M A;  3GW6 A;  1HF9 A;  3H1L E;  3RK3 E;  5M1B A;  4FN8 A;  1U7J A;  3L72 G;  2YNY A;  2B87 A;  1RQV A;  4PJ0 E;  2YMK A;  1UYV A;  1L0N G;  3UIA A;  1BE3 J;  4KWB A;  2R5B A;  1NTM E;  2ITA A;  4OWF A;  4UB6 E;  2NP9 A;  2QE7 H;  2FYU G;  3TRR A;  2L91 A;  1H89 A;  1HBW A;  5KLI B;  2ZXE B;  1RH5 B;  3MTU E;  1HNU A;  1PPJ E;  2IZ1 A;  1VF5 C;  4GIF A;  2DW3 A;  3TGU G;  2QM8 A;  3H0U A;  1L4A D;  2WSF J;  1SZO A;  3EFF K;  1KV4 A;  3P8M C;  1X0T A;  3PZK A;  1JTH B;  3CMA P;  1VQ4 P;  2VSU A;  3L70 D;  1LP1 B;  2HPC A;  1U57 A;  4BRY B;  2OYI B;  4ZKP A;  2WQY C;  3HTK B;  4NPF X;  1M8O B;  4K29 A;  2E43 A;  3HD7 A;  3QWO C;  5CMZ A;  3II6 A;  3KQG A;  1N86 A;  3VMA A;  5GTH E;  1N6E A;  1SP4 A;  2W83 C;  2CE3 A;  2FXP A;  3L4F A;  4MXI A;  3KTH A;  5C39 A;  1VF5 D;  5AW5 B;  3CCV P;  4C46 A;  3DJA A;  1SQB D;  1SS1 A;  3HUS C;  2XNX A;  2BCC J;  3FWL A;  1YI2 P;  1MZ9 A;  3CWB J;  2WSC J;  1ZRT E;  2Z4E A;  1Q90 D;  2M5A B;  1FC9 A;  4K2N A;  4D6T G;  4FN7 A;  3CCM P;  4IOI H;  2A06 G;  3U9T B;  1CSB A;  2C8T A;  4OGQ C;  1KFM A;  1JCC A;  1L0L D;  2KP8 A;  1BGY J;  4Y28 J;  1N73 C;  3B5N D;  3MD0 A;  4FJW D;  1LTJ C;  1NU1 J;  1ZR4 A;  1AVO A;  1JXZ A;  2KI7 B;  1G1J A;  1IZN B;  4XA4 A;  3L75 E;  3H1H G;  3L72 D;  2IBZ G;  3DOR A;  2YXR B;  1SQP J;  1OMI A;  4N3Y B;  1L0N D;  3W68 A;  2GA1 A;  2GUS A;  4I1L A;  1OVR A;  1KYO H;  2J5I B;  5E79 H;  3CPW O;  5DJU B;  4TT3 H;  3PTZ A;  1GL2 A;  2WSE J;  4RKU J;  4PV1 C;  3V5E A;  1QEX A;  3L71 E;  3IAV A;  1YYC A;  1PFI A;  2WPV B;  4OGQ D;  3GHG C;  2WWW A;  2PP6 A;  2AEF A;  4JSB A;  3V2P A;  1Y7O A;  1SQB K;  2D3T A;  4U19 A;  5BU5 A;  3CCJ P;  4ZKU A;  2HYN A;  4IL6 X;  4HKZ H;  3RRV A;  3Q0J A;  2ZYA A;  1KD1 Q;  4GT1 A;  4H44 B;  1N7L A;  3ZDM A;  1BCC E;  5IKL B;  4BRY A;  2QRX A;  1HTL C;  1FC2 C;  2QJK C;  3MHV A;  2CPB A;  4U1A A;  1GD2 E;  1IK9 A;  4JYB A;  3A0B E;  3MUD C;  1L0L K;  3MOY A;  1UYT A;  4M3L A;  1RF0 A;  5JBW A;  3AEG C;  3QK8 A;  4NNQ A;  1SQX G;  3KPE A;  4PV1 D;  1EQ7 A;  2XND H;  3CCR P;  1KIL B;  4W80 A;  1NO4 A;  1S3J A;  3P8C D;  2K37 A;  3VP8 A;  1K39 A;  1XNV A;  2A45 I;  2GM4 A;  2VSS F;  1JO5 A;  2IYP A;  2YO3 A;  2OGU A;  4YPC A;  1ZN5 A;  4D6T D;  1L0N K;  4U18 A;  2PAJ A;  3K5B A;  2M5A A;  1R5S A;  4W7Y A;  1ZXG A;  3U1A A;  3CXH D;  2QQ3 A;  2HR3 A;  3H1I J;  2V7Q H;  3VP9 A;  1KQS O;  1KB9 D;  1L2P A;  2VSU C;  3SWX A;  1GW4 A;  2M8R A;  3KTG A;  4PD4 H;  3TT6 A;  3AE6 C;  4U3F E;  3RK3 C;  5CCG A;  3ITK A;  3HD7 C;  1RQU A;  1HUC A;  4I6M C;  4H13 B;  3RST A;  4G2R A;  4C7N A;  3L74 J;  1S2E A;  3AE7 C;  3R2P A;  3VTP C;  2KOG A;  2FXO A;  2QG4 A;  1T3U A;  2AXT H;  1P84 D;  1PGO A;  2J5G D;  1KIL E;  1IFD A;  1SLQ A;  4WZ8 B;  3L37 A;  2OTK E;  5AVX B;  3C8V A;  3G3Z A;  1N7S C;  1NTK E;  3LIE A;  2KSJ A;  1J7X A;  2P7J A;  2KNC B;  3L74 G;  4FND A;  3OJA B;  4A7P A;  3L70 E;  1SQV J;  1LTG C;  5DZK A;  1YG6 A;  4Y99 C;  3S1K A;  3RK3 D;  3N7N A;  4KD6 A;  3HD7 D;  4LGD E;  4CPG A;  3P32 A;  2Q2X A;  3CXH I;  4HDT A;  3MIW A;  3SFD C;  1SQX D;  1KB9 I;  3CX5 E;  3Q0G A;  5AVS B;  2PBP A;  1OD4 A;  1KIL A;  3RL0 B;  1VRG A;  1ZOY C;  3AE9 C;  1N7S D;  4RYF H;  3VIV A;  4NAR A;  3H1J G;  3H1K G;  5CJ0 A;  4EYY Q;  1HJ0 A;  4OVN F;  4WB4 A;  5KLI C;  2E74 C;  2W8Z A;  4C7R A;  4J2U A;  3QXZ A;  1KN7 A;  2IYO A;  2IDB A;  3E7K A;  1P84 I;  2FYZ A;  1ZLL A;  3T97 B;  3TT7 A;  2O1K A;  5K5G B;  4WWI A;  1O8U A;  3Q2Y A;  2KB7 P;  1BDC A;  3V5B A;  5APW A;  3BPT A;  1Q7Y Q;  3PHL A;  1OVU A;  2QIW A;  1QVG O;  3F5H A;  2QJY B;  2G3A A;  2P58 A;  3L72 E;  5DU8 A;  1DD3 A;  5CBO A;  3IN6 A;  3H25 A;  1URQ A;  1L0N E;  5KAF H;  3L35 A;  3ZWB A;  5AVZ B;  1YIT P;  1RF0 C;  3CC2 P;  4JCT A;  4NPE A;  1ZV8 A;  3A0H H;  3OW2 O;  2ZVO B;  3P5M A;  2VRS A;  1PGQ A;  4GOF A;  3MYB A;  1WT6 A;  3KZI H;  2E74 D;  5G1Q A;  4OMR A;  4DJG A;  3TGU E;  3RBZ A;  1SQX K;  5G1S A;  4ZDD A;  1GU4 A;  4B3I A;  1XO6 A;  1WMK A;  1PZQ A;  2JKV A;  3B71 A;  3FXD A;  1VQL P;  3E1I A;  3CI9 A;  3D6Z A;  3U9S B;  3NFQ A;  5AVY B;  2KNC A;  3B5N A;  2ZYD A;  1YQ3 C;  3I56 P;  1NOH A;  5CJ4 A;  2WSF H;  5KAI E;  2AEM A;  4Z0M A;  1LT9 B;  3L75 D;  3BVH A;  2HOD A;  2ZQQ A;  1VQ9 P;  2Y0C A;  4MOU A;  3I5C A;  4WY4 B;  1QL2 A;  1LTS C;  3SSU A;  2YXQ B;  2E5T A;  2OYH A;  1M1J B;  2O1J A;  5KLV D;  5CCG C;  2W27 A;  3SWK A;  1YJW P;  2P67 A;  3L71 D;  3P8C E;  3H1J D;  4N78 E;  2FFD B;  5H2F H;  3VYI A;  5AW6 B;  4D6T E;  1R8E A;  4KNP A;  1HGZ A;  2A06 E;  3TVW A;  1FJP A;  1IO4 A;  4JCS A;  2OTL P;  1BCC D;  1OW8 A;  3R6H A;  1TU3 F;  2N9B A;  1NH4 A;  1S4X A;  4QMA A;  3WU2 H;  5DUF A;  4IZB A;  3K50 A;  2OYO A;  1AQ5 A;  3KHU A;  1NTZ G;  5B66 E;  3H1H E;  1Q81 Q;  4H44 C;  3TVU A;  2IZ0 A;  4EOT A;  2IBZ E;  5CCG D;  1JNM A;  2ZL2 A;  1J2J B;  1OFC X;  2HW5 A;  1UYS A;  3FX0 A;  1Q52 A;  3HE5 B;  1NKN A;  1SQB J;  4DI1 A;  1A02 J;  1PP9 G;  1EDL A;  3AEF C;  1SG4 A;  4FB8 A;  2F9Y A;  1EDI A;  3LKE A;  5AW2 B;  2QJP B;  2BEZ F;  4H0L B;  1KIL C;  1P84 E;  4I52 A;  1OW6 A;  5KLV K;  4UB8 E;  2WSE H;  1L0L J;  3HLN 1;  2Q34 A;  1FZE A;  2H8P D;  2KYV A;  3IR9 A;  4MN4 C;  1KFN A;  1PIX A;  1AJY A;  2K3R A;  3MUD A;  4H44 D;  1OIP A;  1VQ5 P;  4ZDC A;  2YJG A;  2DUB A;  5C9G A;  2MJZ A;  3AE3 C;  2KXP B;  1WZ8 A;  1RE4 A;  3Q1M A;  2WTY A;  4ASI A;  3L73 J;  3V2R A;  1DCI A;  1KZU B;  1LNQ A;  1E5W A;  4EI2 A;  2Q5U A;  4WY4 A;  5HUQ A;  1SQX E;  4BWN A;  4B3H A;  5KKZ B;  3V4Q A;  2E5Y A;  3AEC C;  1M1J A;  1KIL D;  1URQ C;  2UZF A;  1OX3 A;  2FYN B;  2J5G A;  2LKM A;  3KXD A;  1NTK D;  1W5C E;  2PPY A;  3KTJ A;  1OZH A;  1EZV G;  2O01 J;  3SFE C;  1LGH B;  2KIK A;  1BE3 G;  3GMA A;  3M6N A;  4U0G H;  1KQF B;  3U1C A;  3BCC J;  2W90 A;  4IFM A;  2WTB A;  4Q1I A;  4WCZ A;  3O8Z A;  2PG8 A;  3M06 A;  3B5N C;  4ZDF A;  3GKB A;  1AV1 A;  4ZDB A;  1GK6 A;  1PL5 A;  1NTZ D;  1Y8A A;  4FNB A;  2IX7 C;  3TV5 A;  1HWT C;  1GZL A;  2JWD A;  1RF1 B;  3CX5 D;  2F6Q A;  3TZ3 A;  2YO2 A;  3D6Y A;  2ZL4 A;  2YKQ A;  1URQ D;  3PE8 A;  1H88 A;  3D70 A;  2ZAE B;  3HE5 A;  4DOJ A;  1QVF O;  3BEZ A;  2RH0 A;  2OYH C;  1N7S A;  4QII A;  5BVZ A;  1DH3 A;  1N8R Q;  4KPK A;  5MGB A;  1G2C A;  1K04 A;  3RL0 C;  3AE2 C;  1JY2 N;  5GTI H;  1N6F A;  1DEB A;  1IFN A;  3CC4 P;  4BXL A;  1YG8 A;  3JC2 2;  1MJ3 A;  1GW3 A;  1SQQ D;  2BCC G;  2ZJS E;  1NTK K;  3CWB G;  1IC2 A;  3PRJ A;  3VMZ A;  5DUC A;  2NPS B;  2EJ5 A;  1X79 B;  2J59 M;  5CBN A;  3RBX A;  3HRX A;  4IL6 H;  1RY3 A;  1BGY G;  5APQ A;  3E1R A;  4O9B A;  1VQ7 P;  5BU8 B;  1XNY A;  2FYU D;  4I7Z B;  2NZ2 A;  3I55 P;  1NU1 G;  5KLV E;  2QJY C;  4IFD K;  5E79 E;  2FXM A;  1NTZ K;  2XV5 A;  3TGU D;  3RL0 D;  3BRV B;  3CX5 I;  1T3J A;  1EZV D;  3MP7 B;  2FZS A;  4OG1 A;  2K88 A;  1SQP G;  3H1J E;  3H1K E;  1WDK A;  1OXZ A;  3S4R A;  2W3P A;  3CCQ P;  1ON9 A;  2H7H A;  3A5T A;  1JTH A;  2RMZ A;  1LP1 A;  3SLL A;  3TDC A;  2LXC B;  3P7K A;  1JM0 A;  5DL1 A;  4GOE A;  2OYI A;  3U9R B;  2N1T B;  3H1L J;  1CI6 B;  1W2E A;  2F6I A;  3HTK A;  3LID A;  4KHX A;  3AEB C;  1NTM J;  1SQQ K;  3CME P;  1LT9 C;  3H0S A;  1RE4 C;  3A0B H;  4ZDE A;  1YJ9 P;  4JBZ A;  4N78 D;  4WY4 C;  1JOC A;  3RGU A;  1EXJ A;  1M1J C;  2BEQ D;  3NJD A;  1NAY A;  1MKM A;  1PGJ A;  5E0S H;  1T8Z A;  1NTM G;  1S5L H;  2A06 D;  4GHN A;  1FJK A;  2FYU K;  4AQR D;  4Z1M H;  2JO1 A;  4L75 A;  3PGQ A;  2P10 A;  4K3W A;  2FFD C;  2Y9Z A;  3AED C;  4JWV A;  2G8Y A;  1FCF A;  4JQ0 D;  1IFJ A;  3L36 A;  1EC5 A;  3H1H D;  3W67 A;  3KDP B;  2XKM A;  2NPS A;  2IBZ D;  1J1E C;  5EFW B;  1K9M Q;  1JY2 P;  2JP3 A;  1U7M A;  3H1I G;  2M3B A;  1S5L X;  4KJM A;  3H32 B;  4WY4 D;  3TNU B;  2J5I A;  2KK7 A;  2O01 N;  4WBA A;  3I47 A;  2VSS E;  3AE4 C;  4ZU2 A;  4GKG A;  1YBK A;  2QVA A;  2AXT E;  1XX4 A;  3M9H A;  3HE2 A;  2QJP C;  4ASV A;  4EML A;  2AXC A;  4H0L C;  1ZW0 A;  1A02 F;  5CHX A;  5DU4 A;  5APY A;  3IFM A;  3L75 J;  3G4S P;  1X0U A;  4L76 A;  1FZC B;  4IZD A;  1VQ8 P;  1NTZ E;  4RO0 A;  5ING A;  3OA7 A;  3SWF A;  1SQV G;  2L5G B;  3TYY A;  2VSS A;  2HG5 D;  1M56 D;  3L71 J;  3EQ2 A;  1FOS F;  1USE A;  1PP9 E;  3QWD A;  1G1I A;  2IBZ I;  3CD6 P;  3KQF A;  2PGD A;  5L8R J;  3O6Q B;  1KMI Z;  5KKZ C;  4KT0 J;  4EIJ A;  4JYJ A;  3GF7 A;  1HVV A;  1NJI Q;  1WDM A;  4H0L D;  2YIU B;  2C0X A;  2FYN C;  1IFI A;  5B5E H;  2XZR A;  2R5D A;  1FDI A;  2CK3 H;  2Z5I A;  5TIS H;  1EDJ A;  1BCC J;  2A7S A;  1ZP0 C;  1SQQ E;  1N73 B;  2ZT9 B;  1OW7 A;  1LTJ B;  3NTN A;  2XU6 A;  5G1R A;  2ZVN B;  2OYI C;  1YTZ I;  2A7K A;  4AYC A;  1JB0 J;  3IAO A;  1CZQ A;  4GDO A;  2BZR A;  2W6B A;  1K32 A;  1WDL A;  3EWK A;  1K73 Q;  3BF0 A;  3V2Q A;  4XE5 B;  3SWY A;  2A45 H;  1EY3 A;  2FKW B;  2DEO A;  1RF1 C;  2FYU E;  2KZJ A;  4WYO B;  3AEA C;  5DTW A;  3MT6 A;  2A81 A;  4RYF A;  3P2L A;  3T8B A;  3D71 A;  3A0H E;  2ZL3 A;  3PH0 A;  1EZV E;  3KZI E;  2K9J B;  3L74 D;  1BE3 E;  3BAS A;  2E75 B;  1RHZ B;  3TSI A;  2QM7 A;  1H0T B;  3CLQ A;  4MI2 A;  2FBW C;  1K8A Q;  3CCS P;  2X24 A;  3JCU H;  1FE6 A;  2PFX A;  2WVR A;  3USS A;  2O01 H;  3QH9 A;  1EXI A;  4U3F J;  1NAF A;  3C9I A;  4DCK A;  4QIJ A;  4IFF A;  1FZC A;  4R4M A;  2NPS C;  1SQV D;  1S1C X;  5AW4 B;  1S72 P;  4LC1 A;  1KYO D;  1S9K E;  1HNO A;  1W2B O;  2WIT A;  4YTP C;  3A2A A;  3M91 A;  1KQL A;  2B87 B;  2R3C A;  2ZYG A;  1NTK J;  3H1K D;  1CW5 A;  3R9S A;  4I7Z C;  1HJB A;  5AW7 B;  3U59 A;  1GMJ A;  1FAV A;  1MUU A;  3V6I A;  3H81 A;  3N4X A;  3L70 J;  5H2F E;  3OC7 A;  3RL0 g;  3HP0 A;  3FDU A;  2WPS A;  3S9O A;  2BCC E;  3MZW B;  4JPZ B;  2WSS H;  3T97 A;  3CWB E;  4RJT A;  1FZG A;  1NHL A;  1PJH A;  1IFP A;  4EMP A;  3CXH H;  3WU2 E;  4U0H A;  2NPS D;  2HPC B;  2C9L Y;  2M3E A;  3L70 G;  1KB9 H;  1UIX A;  5DU6 A;  2N1T C;  3WUV A;  1JMM A;  1Q86 Q;  2VSU F;  1BGY E;  3MFM A;  3RK3 B;  3HD7 B;  1YQ4 C;  3CCE P;  5C90 A;  2V4H A;  4WVZ A;  5AW9 B;  4JFC A;  3VMX A;  1NU1 E;  4GOD A;  3ISA A;  2H88 C;  1VQO P;  4JCQ A;  2KZI A;  2J58 A;  5AW8 B;  3IB9 A;  1SQV K;  3M6M A;  1J1D B;  1SQP E;  1T6A A;  2UWJ E;  4OLQ A;  3C1L A;  1P84 H;  1SQB G;  2Q35 A;  3F89 A;  2C0W A;  1NZY B;  1KTM A;  3CL3 D;  3WG5 A;  4Q0G A;  2F9I B;  1ZR2 A;  3P85 A;  1NKZ B;  1M7L A;  4JOT A;  3R9Q A;  1LT9 A;  4Y99 B;  4PD4 D;  2N1T D;  3L72 J;  3WMM 0;  1L0L G;  1QLE D;  2IFN A;  1L0N J;  1JY2 O;  3RK2 B;  3PP5 A;  5INI A;  1M1K Q;  1DIP A;  2JR8 A;  1VQN P;  1AQT A;  4PJ0 H;  3CCU P;  3TGU J;  2A45 G;  5AVQ B;  4H13 C;  3OAK A;  3FXE A;  4HJG H;  3L73 G;  4UB6 H;  3VN0 A;  1GL2 B;  5APS A;  3TLF A;  2FFD A;  2JEE A;  5AVW B;  5E0N X;  1UIY A;  2J5I I;  2E74 B;  1LWU B;  1LTB C;  3T89 A;  3H0Q A;  1QX8 A;  3CCL P;  1JY3 N;  4YXD C;  3M9B A;  1N2D C;  1HH0 A;  1DEE G;  1QL1 A;  5DKP A;  2B88 A;  1NYH A;  1XNW A;  4NPD A;  3OME A;  2N9Y B;  3BCC G;  1SFC B;  3N6R B;  1PV3 A;  1NWQ A;  1EF8 A;  2E42 A;  1LT1 A;  3H1I E;  2B9B A;  1FZC C;  5GTH H;  4H13 D;  1PP9 D;  1IK7 A;  2KSE A;  3LW5 J;  4PD4 I;  2D2C B;  1USD A;  2R44 A;  3GLM A;  4D6T J;  1M57 D;  2X58 A;  1KQG B;  1TG6 A;  2QEX P;  1HZD A;  3PJS K;  1DX7 A;  1GTW A;  1PGP A;  4U0G A;  3ZWA A;  3M0D A;  2Q3I A;  3MGN A;  3Q5P A;  2IFM A;  3L74 E;  2NRG A;  5APV A;  3A3Y B;  3ST9 A;  5GTI E;  1ZME C;  1JEK A;  2YIU C;  2GTR A;  3GG2 A;  1NZY A;  2KLV A;  5APU A;  1VL2 A;  3H1H J;  1FS0 E;  2F9I A;  1RE3 A;  4QFE A;  2R32 A;  2XDJ A;  2ZL0 A;  1RJM A;  3R4Y A;  2ZT9 C;  1M90 Q;  4L73 A;  2HLO A;  4IL6 E;  4XFJ A;  1ON3 A;  1SQV E;  5CCH C;  5DJT B;  5KJ7 A;  4YLH A;  1KYO E;  2KLU A;  2LXB A;  3L73 D;  2Q3E A;  3LAO A;  3Q5R A;  1DD4 A;  3JU1 A;  4C7N B;  2Q7C A;  1OWA A;  1BE3 D;  3BRT B;  1IFM A;  2J5U A;  3H0J A;  2I8D A;  1LWU A;  3HE4 B;  3TK1 A;  2ZQR A;  2E75 C;  1Q2N A;  2H89 C;  1BSN A;  4F47 A; 
#chains in the Genus database with same CATH homology
 3ZW8 A;  2ZT9 D;  3BPP A;  3H0U A;  5FIF A;  1NGM B;  2WSF J;  2VSS A;  1SZO A;  5DTP A;  3NJB A;  3PZK A;  2E76 B;  2VSU A;  3QWD A;  2VX2 A;  1R8E A;  3KQF A;  5L8R J;  4KNP A;  1U57 A;  3TVW A;  1KMI Z;  5KKZ C;  4KT0 J;  4U7J A;  1FC6 A;  4JYJ A;  4JCS A;  2WQY C;  3GF7 A;  4B3J A;  1WDM A;  4H0L D;  4K29 A;  1OW8 A;  3R6H A;  1TU3 F;  2FYN C;  1TYF A;  1FDI A;  5DUF A;  3R0O A;  4IZB A;  3RSI A;  3K50 A;  1N6E A;  4I4Z A;  2A7S A;  2CE3 A;  1ZP0 C;  2FXP A;  1W2X A;  4MXI A;  3FGA D;  3KTH A;  4JYL A;  2ZT9 B;  4H44 C;  3TVU A;  1VF5 D;  2E75 D;  3DJA A;  1OW7 A;  2ZL2 A;  5G1R A;  2HW5 A;  1UYS A;  2A7K A;  1Q52 A;  1JB0 J;  3IAO A;  2WSC J;  4GDO A;  3Q5S A;  1ZRT E;  2BZR A;  4DI1 A;  1K32 A;  3QYR A;  1WDL A;  1Q90 D;  3EWK A;  1SG4 A;  3AEF C;  2IEX A;  3BF0 A;  1FC9 A;  4L6W A;  4FB8 A;  4IZC A;  2F9Y A;  4FN7 A;  4K2N A;  4LK5 A;  3LKE A;  2OQQ A;  3U9T B;  2C8T A;  4OGQ C;  1EY3 A;  2BEZ F;  4H0L B;  2DEO A;  3QRE A;  4I52 A;  4WYO B;  5DZK H;  3AEA C;  1OW6 A;  3Q3D A;  5DTW A;  3MT6 A;  4Y28 J;  4HC8 A;  2A81 A;  4RYF A;  3P2L A;  3T8B A;  3D71 A;  2ZL3 A;  3HLN 1;  4ELX A;  4FJW D;  2Q34 A;  1PIX A;  1AJY A;  1JXZ A;  5JBX A;  1VF5 B;  2E75 B;  3AE5 C;  5E0S A;  4MI2 A;  3DOR A;  2FBW C;  4H44 D;  4ZDC A;  4EMM A;  1OMI A;  2DUB A;  2X24 A;  2YJG A;  5C9G A;  3AE3 C;  4JJT A;  1WZ8 A;  1RJN A;  3Q1M A;  4ASI A;  2J5I B;  1EXI A;  4TT3 H;  3L3S A;  1DCI A;  2WSE J;  4RKU J;  4PV1 C;  4QIJ A;  3V5E A;  5HUQ A;  4B3H A;  3IAV A;  3AEC C;  4R4M A;  2WPV B;  1S1C X;  4OGQ D;  1Y9B A;  2UZF A;  4RCN A;  2FBM A;  4JSB A;  2J5G A;  1HNO A;  2PPY A;  3KTJ A;  4YTP C;  1Y7O A;  2D3T A;  4U19 A;  2O01 J;  3SFE C;  4IL6 X;  3GMA A;  3M6N A;  3R9S A;  3RRV A;  4I7Z C;  3Q0J A;  4U0G H;  4FZW A;  4H44 B;  3FF6 A;  1KQF B;  1GMJ A;  2WTB A;  5IKL B;  2QJK C;  3H81 A;  4Q1I A;  4U1A A;  4WCZ A;  5CTC A;  2PG8 A;  3OC7 A;  3T88 A;  3MOY A;  3HIN A;  1N6D A;  3RL0 g;  3HP0 A;  3FDU A;  4ZDF A;  1UYT A;  3GKB A;  1EF9 A;  4ZDB A;  5JBW A;  3S9O A;  3AEG C;  1PL5 A;  3QK8 A;  4NNQ A;  4FNB A;  3TV5 A;  4PV1 D;  3QMJ A;  4OGQ B;  2F6Q A;  1PJH A;  4L8K A;  4EMP A;  3TZ3 A;  3D6Y A;  1K39 A;  5FUS A;  3OT6 A;  1XNV A;  3KTI A;  4U0H A;  3R9T A;  5KDR B;  2ZL4 A;  2VSS F;  3V5I A;  1UIX A;  3PE8 A;  5DU6 A;  3D70 A;  2VSU F;  3H02 A;  4I42 A;  4U18 A;  3MFM A;  1Q51 A;  3BEZ A;  3G64 A;  4ELS A;  1YQ4 C;  4QII A;  5C90 A;  4JFC A;  4KPK A;  5MGB A;  1K04 A;  2QQ3 A;  3ISA A;  2J5S A;  3AE2 C;  3QKA A;  2H88 C;  4JCQ A;  1N6F A;  3IB9 A;  2VSU C;  3SWX A;  3ZWC A;  3M6M A;  5INF A;  1YG8 A;  1MJ3 A;  3KTG A;  4PV1 B;  4HNK A;  3TT6 A;  4OLQ A;  3AE6 C;  2Q35 A;  5KJP A;  5DUC A;  2EJ5 A;  1NZY B;  1RQU A;  2D2C C;  2F9Y B;  1KTM A;  4H13 B;  3RST A;  3WG5 A;  4G2R A;  3QXI A;  4Q0G A;  2F9I B;  3HRX A;  3P85 A;  3Q7H A;  4NEK A;  4JOT A;  2V7Q J;  3AE7 C;  3R9Q A;  3STA A;  3ABV C;  3Q1T A;  1XNY A;  4I7Z B;  2J5G D;  1KIL E;  4JCR A;  4WZ8 B;  2NZ2 A;  1UYR A;  1K05 A;  2QJY C;  3C8V A;  5INI A;  4JVT A;  1DIP A;  1J7X A;  2FZS A;  4OG1 A;  1OD2 A;  4FND A;  4H13 C;  1WDK A;  2W3P A;  1ON9 A;  3ZW9 A;  5DZK A;  1YG6 A;  4GM2 A;  3TLF A;  5E0N X;  1UIY A;  4KD6 A;  2MKV A;  3SLL A;  2D2C D;  3TDC A;  2J5I I;  2E74 B;  5DL1 A;  3T89 A;  3O6Q A;  2Q2X A;  3H0Q A;  3U9R B;  4HDT A;  4YXD C;  2F6I A;  3SFD C;  1DUB A;  3T3W A;  3IBB A;  3Q0G A;  3AEB C;  5DKP A;  2PBP A;  3H0S A;  5CTB A;  1OD4 A;  1VRG A;  1KOR A;  1ZOY C;  1NYH A;  2K9Y A;  3AE9 C;  1XNW A;  4ZDE A;  3G9R A;  3OME A;  4RYF H;  3VIV A;  5KDR A;  3N6R B;  1PV3 A;  4NAR A;  1EF8 A;  1HJ0 A;  5KLI C;  2E74 C;  4H13 D;  1IK7 A;  1EXJ A;  4J2U A;  3QXZ A;  2BEQ D;  3AEE C;  3NJD A;  1FC7 A;  3T8A A;  5E0S H;  1MKM A;  2VRE A;  3LW5 J;  4ELW A;  2D2C B;  4GHN A;  2IDB A;  2QSI A;  4Z1M H;  2JO1 A;  3GLM A;  3AE8 C;  3T97 B;  3PGQ A;  2X58 A;  2P10 A;  4K3W A;  1KQG B;  3TT7 A;  2E76 C;  1TG6 A;  1O8U A;  1HZD A;  3Q2Y A;  3GF3 A;  2FW2 A;  3AED C;  4FZW C;  4JWV A;  3BPT A;  4U0G A;  3ZWA A;  3Q5P A;  2G8Y A;  1FCF A;  2QIW A;  3ST9 A;  3KTK A;  2G3A A;  1ZME C;  5DU8 A;  2YIU C;  1DD3 A;  2GTR A;  2CBY A;  3IN6 A;  1NZY A;  3H25 A;  2JP3 A;  3ZWB A;  4R4L A;  1VL2 A;  4JCT A;  3AE1 C;  2F9I A;  4QFE A;  3P5M A;  1S5L X;  1FDO A;  3MYB A;  3PEA A;  2ZL0 A;  2E74 D;  2J5I A;  3K8X A;  1RJM A;  3R4Y A;  4OMR A;  5G1Q A;  2ZT9 C;  5G1S A;  4ZDD A;  3I47 A;  2VSS E;  3AE4 C;  4ZU2 A;  4B3I A;  4XFJ A;  1XO6 A;  1WMK A;  1ON3 A;  3B71 A;  2VSU E;  4YLH A;  3D6Z A;  3U9S B;  1XX4 A;  2E76 D;  3LAO A;  3Q5R A;  1DD4 A;  1YQ3 C;  3JU1 A;  3HE2 A;  1HF9 A;  2QJP C;  4EML A;  3RK3 E;  5M1B A;  4H0L C;  4FN8 A;  4Z0M A;  2J5U A;  2ZQQ A;  1RQV A;  2YMK A;  1UYV A;  5DU4 A;  4KWB A;  3H0J A;  4MOU A;  2NP9 A;  1X0U A;  3TRR A;  4IZD A;  1HNU A;  2ZQR A;  1VF5 C;  2E75 C;  2H89 C;  5ING A;  4F47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...