3GMAA

Glutaconyl-coa decarboxylase a subunit from clostridium symbiosum co-crystallized with glutaryl-coa
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
584
structure length
558
Chain Sequence
MYSMPGYFQNMPTIGKELVNPNPENEQEIKAVESDIHESIKKALDAGITSEEKLNERGQLSAMQRINALIDPGTWCPLNSLFNPENNKFGTTNIVNGLGRVDGKWVYIVASDNKKMAGAWVPGQAENLIRCSDAAKMMHLPLIYLLNCSGVEFPNQDKVYPNRRGGGTPFFRNSELNQLGIPVIVGIYGTNPAGGGYHSISPTILIAHQDANMAVGGAAAEQIIAAQIENSKLKVPAPGSVPIHYDETGFFREVYQNDLGVIDGIKKYISYLPAYNLEFFRVDTPKAPQLPAEDLYSIIPMNQKRPYDIYEVIARLFDNSEFSEYKKGYGPEMVTGLAKVNGLLVGVIANVQGLLMNYPEYKQNSVGIGGKLYRQGLIKMNEFVTLCARDRIPLIWLQDTTGIDVGDEAEKAELLGLGQSLIYSIENSKLPSLEITIRKASAAAHYVLGGPQGNNTNVFSIGTGACEYYVMPGETAANAMYSRKQPIIGKMNDMIQMYTDKSRPKYCTEKGMVDEIVDMTEVRPYIQAFTEAAYQNPQSICPMHQMLTPRSTREFETF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title An asymmetric model for Na+-translocating glutaconyl-CoA decarboxylases
pubmed doi rcsb
source organism Clostridium symbiosum
molecule tags Lyase
molecule keywords Glutaconyl-CoA decarboxylase subunit A
total genus 210
structure length 558
sequence length 584
chains with identical sequence B
ec nomenclature ec 4.1.1.70: Transferred entry: 7.2.4.5.
pdb deposition date 2009-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01039 Carboxyl_trans Carboxyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.680 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Helix bin 3gmaA01
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3gmaA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3gmaA03
1MJ3A 4QIIA 4B3HA 3IBBA 5DZKA 2F9IB 3FDUA 3HRXA 3P85A 4NEKA 3KTHA 3TRRA 5INGA 2VREA 3T8AA 3QK8A 3BPPA 4OLQA 3HINA 3H81A 5E0SH 2VSUA 5E0NX 5DUFA 4U0GH 1FC7A 2ZQQA 3K8XA 4DI1A 3DORA 1UYVA 3HE2A 2F9YB 2PG8A 1XNVA 3OMEA 2D3TA 2F9IA 3V5IA 4MXIA 2J5GD 3G64A 2PBPA 4JCTA 3MFMA 1FC9A 1RJNA 4JCSA 3RSTA 3H0JA 3L3SA 2X24A 3ZW9A 4ZDCA 2PPYA 1Q52A 3TLFA 4FNBA 4U18A 3QREA 4K2NA 3BF0A 1FC6A 1N6FA 2VX2A 1O8UA 3I47A 3R9SA 2F6IA 5DU6A 1XX4A 3OC7A 4Q1IA 5DZKH 3QXIA 3ZWCA 1K32A 3TT7A 3SWXA 1ON3A 4ELSA 1N6DA 1ON9A 3P5MA 1NZYB 2ZL4A 3QKAA 1XNYA 2BZRA 5JBXA 5G1SA 3R6HA 4KWBA 2VSUC 4FJWD 2Q2XA 4KD6A 5DL1A 4I52A 5G1QA 3T89A 3ST9A 1YG6A 4FN7A 4OG1A 1WDKA 4U0HA 5IKLB 4WCZA 4LK5A 1J7XA 3TV5A 4EMLA 2WTBA 4L6WA 3SLLA 3PZKA 3M6NA 4ZU2A 4F47A 4Q0GA 4JWVA 3TT6A 4MOUA 1YG8A 4I42A 4FZWC 4RCNA 4KNPA 2A7SA 5DU8A 3R0OA 5FUSA 1NZYA 1UYSA 2A7KA 2VSSF 3DJAA 5E0SA 4B3JA 4JCRA 2Q34A 3MOYA 3KTKA 3KTGA 3KTIA 2QQ3A 4B3IA 1Q51A 1PIXA 3ZWBA 2FW2A 4IZBA 5C9GA 5KJPA 4JSBA 3ZW8A 2VSSA 3T88A 1HNUA 3NJDA 3RSIA 3HLN1 3T8BA 3FF6A 3BEZA 3GLMA 1DCIA 2ZL3A 2HW5A 3T3WA 2CBYA 2CE3A 1XNWA 5INIA 3PGQA 1SZOA 3Q7HA 3GF3A 4NNQA 3LKEA 1TG6A 4QIJA 3P2LA 4GM2A 4JYLA 4JYJA 4U1AA 2J5GA 4ELWA 5DTPA 3PE8A 5MGBA 3TZ3A 3KTJA 3U9SB 5KDRA 1WZ8A 3Q1TA 2EJ5A 2UZFA 3STAA 4FB8A 1EF8A 3N6RB 4Z0MA 3U9RB 4ZDBA 2J5SA 4L8KA 5INFA 3TDCA 3IB9A 3OT6A 5G1RA 4U19A 3H02A 4EMPA 2DEOA 3MT6A 5KDRB 2GTRA 4JCQA 3Q0GA 4FNDA 3ZWAA 1W2XA 2F6QA 4HC8A 3QMJA 4IZCA 3KQFA 3PEAA 1N6EA 3RRVA 5DUCA 4K3WA 1UYTA 1EF9A 3MYBA 4OMRA 4JVTA 2FBMA 4RYFH 5DU4A 3ISAA 1HZDA 2J5IA 3VIVA 1UYRA 3U9TB 5DTWA 1OD2A 2J5II 1OD4A 3NJBA 2ZL0A 2IEXA 4RYFA 3K50A 4GHNA 3GMAA 2FZSA 1JXZA 1FCFA 2ZL2A 4G2RA 2VSUF 1TYFA 4ZDFA 4ELXA 1X0UA 1RJMA 2NP9A 2J5IB 1Y7OA 4WYOB 3M6MA 3GF7A 3JU1A 4HNKA 1EY3A 3H0UA 4QFEA 1PJHA 1SG4A 1DUBA 4JFCA 2X58A 3WG5A 3H0QA 3TVUA 1WDLA 5DKPA 5CTCA 2A81A 4WZ8B 1UIYA 1XO6A 2VSUE 3R9TA 2ZQRA 3V5EA 5FIFA 3QWDA 3H0SA 4JOTA 5CTBA 3R9QA 4MI2A 4EMMA 5JBWA 4ASIA 2C8TA 4YLHA 3TVWA 3HP0A 1K39A 2VSSE 3QYRA 4U0GA 4JJTA 2F9YA 4K29A 4IZDA 3LAOA 4FZWA 4ZDDA 3QXZA 4ZDEA 1WDMA 4I4ZA 2W3PA 5C90A 2DUBA 4KPKA 3IAVA 4FN8A 1VRGA 2Q35A 1HNOA 3GKBA 3Q0JA
chains in the Genus database with same CATH superfamily
3B5NB 2NZ2A 1NGMB 1L0LJ 3M0DC 5DZKA 4DCKA 4IL6H 1GMJA 3S1KA 3CD6P 5CHXA 1EDKA 2WSSH 2Q7CA 3CCLP 4HDTA 2IBZE 3OJAB 5INGA 2B9BA 4OGQC 2OQQA 3Q2YA 4CPGA 3KZIE 2HPCA 3H81A 3RK3E 1FC7A 5APWA 1KQLA 5DJUB 1BSHA 3G4SP 2JP3A 3OMEA 1OWAA 4N78D 2D3TA 1MV8A 1M8OB 1NTZG 4NPDA 3V5IA 1MFTA 1FZCB 2Q1KA 3GW6A 2YKQA 2PBPA 1N73A 3AECC 1NKNA 1H0TB 1S3JA 1U7MA 4BWNA 1SP4A 1SQPJ 4JCSA 4AUWA 2M8RA 3JCUH 1XTGB 2KP8A 1PV3A 3RBZA 3TLFA 2WSCJ 4K2NA 3MIWA 1KMIZ 2C9NY 1KFNA 1GW3A 1FC6A 2J58A 3RK2D 1P84H 1ZLLA 2FFDC 1FZGA 4PV1B 2FKWB 2R3SA 1NJIQ 2KSJA 3R9SA 3BASA 2KOGA 2XU6A 4WY4A 2O3JA 2D2CB 3CMEP 2YMKA 5DZKH 3WU2E 2IYPA 2W8ZA 3TT7A 1VPCA 1IFMA 1SQQJ 2Z5HA 1N6DA 1U7JA 4GOEA 4TLFA 1D7MA 3L74G 3LW5J 3CCVP 4AQRD 2B87A 4XE5B 1JEKA 2BZRA 5APXA 1PFIA 1SQPK 3P8CE 4I2LC 4KD6A 3CC7P 4I6MC 4I52A 5G1QA 5CCGA 3TGUD 3FXDA 1YG6A 1LNQA 3S4RA 1WDKA 2KUBA 2FYUK 3IN6A 1KYOE 3IF4A 4LK5A 1HGZA 3VYIA 3F89A 3PJSK 3PZKA 5B66E 3PRJA 1GDTA 2L91A 4F47A 1VF5C 4GT1A 3AE8C 4JWVA 4D6TE 2Y0CA 1SQXD 1YG8A 4U3FJ 2KNCA 1P84I 1HJBA 2P2UA 1VQPP 5CJ4A 3H1JD 3A5TA 5CMZA 1FOSF 1QVGO 3H1JG 3KDPB 2FYNB 5AVUB 4PJ0E 4JCRA 1HTLC 1NVOA 5DJTB 1S9KE 3KTGA 2QQ3A 1L2PA 2E76D 2FXMA 1M1JC 2LXCB 1UIIA 1VQLP 1USDA 1NOHA 3ZW8A 3CWBD 3HLN1 1ZRTE 3NFQA 4H44D 4WBAA 1JY3P 5APVA 2HW5A 1E5WA 3T3WA 4IFFA 3QWOC 2CBYA 1VQ4P 5INIA 2OYHC 1LTTC 5CBNA 4GODA 4U7JA 5BVZA 3GF3A 3H1IE 3MUDC 1K9MQ 4NNQA 4PD4D 4QIJA 4M3LA 1NU1K 2B88A 2MKVA 2J5GA 4ELWA 2WT7B 2WPRA 2QIWA 2UWJE 3U9SB 1SQVK 1L0NJ 1CSBA 2IDBA 3A0BH 3L36A 1ZXGA 3Q1TA 2EJ5A 3H6PA 2QM8A 2UZFA 1SQBK 1LT9C 1LTBC 4FB8A 3RK3D 1SQXJ 1SFCA 1L0LD 3CXHD 2OYIC 2PP6A 2Y9ZA 2Q3EA 5AVTB 2K9JB 1ZOYC 2IFNA 1Q2NA 2XZRA 3IB9A 1OVRA 2DW3A 3H02A 4EMPA 2QEXP 3MT6A 3I56P 2P1JA 2M5AB 1EZVE 3D70A 1VQ6P 3R4YA 4EI2A 1N8RQ 1G2CB 1SQXE 1W2XA 5GTHE 3L74E 5APTA 2F6QA 3N4XA 2E74C 3H1IG 4C46A 3QMJA 5KLVE 1DD3A 1KQGB 1KB9E 3A2AA 3PEAA 5CCGD 5APUA 1HH0A 1J1EC 1UYTA 4K3WA 3MZWB 2CPSA 1DIPA 1GZLA 3H32B 3V4QA 4RYFH 3ISAA 4H0LD 3L75D 1FZCC 1RQUA 3KHUA 2ZXXA 2NRGA 1M1KQ 1NAYA 1T3UA 3L72D 3NJBA 2PGDA 1PGJA 2ZL0A 3GMAA 1YITP 2ZL2A 2VSUF 1YJ9P 4ZDFA 4KT0J 3L72E 1X0UA 2K37A 1AA0A 1NYHA 3RL0C 3PP5A 3HD7B 1NTKD 1GK6A 2J5IB 3V4WA 1Y7OA 3M6MA 3GF7A 3L73J 3JU1A 3QH9A 4GDOA 2P67A 3CCQP 1PJHA 4U3FE 1DUBA 1LGHB 2ZYGA 3B5NC 1KYOD 4UB8H 5TISH 1N73B 1NAFA 4H0LC 1FZBA 3G3ZA 2A81A 4WZ8B 3HD7A 4EIJA 1ZN5A 2SPZA 1KILD 4JBZA 3R9TA 3H1ID 1KYOI 4EDFA 1X79B 3GHGA 5E79H 1KB9H 2Q6QA 3RBXA 3CXHI 3L75E 2C8TA 2XDJA 3L75J 1ZR2A 3HP0A 1K39A 2R5BA 2WVRA 4U0GA 1LT1A 4JJTA 4K29A 1NO4A 4BRYA 3LAOA 3KXDA 5AW9B 4ZDDA 2WZ7A 1BSNA 4ZDEA 1GU5A 2QSIA 1PP9E 2A06E 5C90A 2DUBA 4PD4H 3K5BA 3HE4A 2O01J 4FN8A 1DD4A 1QEXA 1VRGA 1L0NE 1LWUC 3CX5I 5AW2B 2Q35A 1YQ3C 3GKBA 4HYTB 1X8YA 2LR2A 3CCRP 4WY4C 1BE3D 5B5EH 4QIIA 5KAIE 3SWYA 4AYCA 3IR9A 5H2FE 1IFPA 3P32A 1IO4A 1M1JB 3HRXA 4R4LA 3PTZA 3V2PA 2MJZA 2FFDB 3ZDMA 1PP9J 2AXCA 1RHZB 2GUVA 4NARA 4OGQD 3T8AA 3QK8A 1KILE 4OLQA 1VQ9P 1NTKK 1T6AA 2GA1A 3HINA 1S5LH 1RE3C 4U0GH 4A7PA 1L0NG 1FJPA 4WVZA 1PZQA 1JOCA 1UYVA 3HE2A 1PP9G 2IBZG 2CK3H 3L73E 2J5GD 1RF1C 1SQBD 2J5UA 3AE6C 2WWWA 2PAJA 4ZKUA 1LTIC 1SQQG 1FOSE 1HUCA 1NTMK 4EYYQ 3RSTA 1FZCA 3ZW9A 1PL5A 5AW7B 4YTPC 1SQVD 3ABVC 1SS1A 4U18A 1N6FA 1NTKE 1NTZE 2WMMA 2ZFCA 3M9BA 3TF5A 3I47A 2O01H 5DU6A 3EQ2A 1M1JA 4Q1IA 5KLIB 1MKMA 2WPSA 1JO5A 1IFNA 3AE4C 3SWXA 1JCCA 1W5CE 4LLHA 3P5MA 1H89A 1LT9A 3BPTA 3M06A 2V7QH 1X0TA 3L72G 2OYIB 2VRSA 3R6HA 2ZYAA 3B5NA 4JF7A 1VQNP 4KWBA 3T89A 1G1JA 3ST9A 2FYZA 4YPCA 3EWKA 1MUUA 5CBOA 2E75D 4WCZA 1J7XA 1N7LA 3CWBE 4EMLA 1JY2P 1KQFB 4L6WA 3M6NA 1X9VA 1JNMA 4ZU2A 2K9JA 1FDMA 1NTZD 2B87B 3TT6A 5AVVB 1SQPE 3H1HG 3L71D 2KZJA 4TT3H 1KQSO 2H88C 3MP7B 4RCNA 2A7SA 5DU8A 5FUSA 1NKZB 5CCHC 1LT9B 3PHLA 1URQD 2ZVOB 1S5LE 5KLVG 5E0SA 2A45I 4B3JA 1BGYJ 2Q34A 1LWUB 3MOYA 3H1KG 1BGYE 2C9LY 3KTKA 1LWUA 2FYUG 1NWQA 3KTIA 4B3IA 3SWKA 3ZWBA 3FX0A 3CX5E 4JSBA 2W83C 3T88A 1Q82Q 1HNUA 1OIPA 4DOJA 2E5YA 3NJDA 1JTHA 5KAIH 1ZP0C 3GLMA 1L0LG 2ZL3A 1GL2A 4BXLA 2CE3A 2QJKC 1KFMA 1HBWA 1XNWA 2CPBA 3C1LA 2NPSB 2I8DA 3VN0A 4JYLA 2E5TA 3LIDA 2IYOA 4WY4D 3VMYA 3PE8A 2OARA 4YXWH 2E76B 4HB1A 1WZ8A 1NTME 5AVRB 1BE3G 2Y0DA 2AXTH 4R4MA 3JSVC 1RF0A 4Z0MA 2IZ1A 1KORA 3L70D 4PD4E 2ZAEB 3L35A 1Y47A 2O1JA 3OT6A 4U19A 1GU4A 1KB9I 2DEOA 1BDDA 2W27A 3TGUJ 4W7ZA 2ZXEB 3FGAD 4UB8E 4IL6E 2BCCG 4JCQA 3TNUB 2XKMA 4I1LA 3L73D 3TNUA 3H1LJ 3RL0B 5AVWB 1SQBG 3L70J 1N7SA 3R2PA 1KILC 2Q9IA 2L5GB 3KQFA 2FYUD 3RRVA 1IZNB 5DUCA 3AE1C 3VMAA 2GM4A 1EXJA 1ZRTD 2Y9YA 2FBMA 2JKVA 4K3AA 5CCHD 2YKPA 3L70E 5AW4B 3U9TB 1FS0E 3B71A 1GK4A 1OD4A 3OW2O 2N1TB 4H13D 1CI6B 1SLQA 3OAKA 2FZSA 3TGUE 4NPEA 1N2DC 3VP8A 2E75C 1S2EA 2KK7A 4PD4I 4IOIH 3AE2C 2YXRB 2NP9A 2WSCH 3TK1A 5M1BA 4QFEA 1FJKA 2OYHB 1BCCE 2P58A 1T2KD 1R5LA 2YKOA 3W67A 2QM7A 3M0AA 2OTLP 1UIYA 3CI9A 2NPSA 1XO6A 1H88A 1SQQK 3CC4P 1PPJD 3QWDA 1DEEG 3AEAC 1PGQA 1J1DC 3H0SA 4JOTA 4EMMA 1IK7A 1PPJG 4YLHA 4ASIA 3EFGA 1OVVA 2IZ0A 3QYRA 1MFZA 3G6EP 2R3CA 4FZWA 5TISE 1NU1E 3M0DA 3QXZA 1L4AC 1YQ4C 2P10A 1L0ND 2W3PA 5E79E 3HUSB 3IAVA 3C9IA 1KZUB 2QJYB 1KV4A 2QA4P 1M56D 4ZMDA 2O01N 2JDIH 5AW3B 1HNOA 3H32A 1G1IA 3A0HE 1ZV8A 3CXHE 3Q0JA 3AEDC 1XTCC 3U1AA 1VF5D 2JJLA 3MGNA 2FXOA 3CLQA 2WT7A 2YXQB 2F9IB 3AEEC 3NXSA 3CPWO 3L4FA 2VREA 1SQVJ 1NH4A 1OX3A 1EDLA 1S1CX 3HE4B 4KHXA 1R5SA 1CI6A 1N73C 5E0NX 5DUFA 3T97B 3KQGA 3T97A 4DI1A 1NHLA 1KILA 1KC8Q 3FWLA 1BCCD 2PG8A 3I5CA 3G9RA 2W90A 4L73A 1QGKB 3C8VA 3G64A 5AW6B 3VTPC 2KXPB 1VL2A 3MFMA 1SQQD 3D71A 2ZVNB 4RO0A 3M9HA 1HWTC 4Y99B 1RJNA 1YJNP 5K5GB 2X24A 1MZ9A 4ZDCA 3TDKA 2KS1A 4FNBA 2FXPA 2VX2A 1O8UA 5AVSB 4WWIA 4JYBA 3V2QA 3L71E 3KPEA 2F6IA 1GL2B 2E75B 3TYYA 1NU1G 4ASWA 3TGUG 3O6QA 2JR8A 5KKZC 1Q7YQ 1NU1D 2I1KA 4I7ZB 4ELSA 2ZT9B 2H89C 2N1TC 2KB7P 1ON9A 5KTBA 2ZL4A 4PV1C 3P8CD 1BDCA 2HFED 3QKAA 1GL2C 5AW1B 1SQBJ 1EDIA 3L70G 4H13C 1JMBA 3H1LG 3II6A 5JBXA 1VF5B 1L4AB 1BGYD 2VSUC 4FJWD 2Q2XA 3O6QB 2A06G 5C39A 3RL0g 3HE5B 3Q3DA 5IKLB 2JWDA 1HVVA 4LC1A 1OFCX 3TV5A 5AW8B 2HG5D 1RY3A 3BCCE 3H1HJ 4IFDK 2E74B 4XFJA 1P84D 4Q0GA 4N6JA 5APSA 3Q1MA 2Q3IA 3D6ZA 4MOUA 1PGPA 2WSEJ 3KYQA 2BCCE 4FZWC 4KNPA 5EFWB 1Q81Q 3R0OA 4K35A 5H2FH 2V4HA 4JPZB 2M0BA 2IBZI 3MTUE 3P8MC 2K88A 5KLIC 1PGOA 2A7KA 2VSSF 1JCDA 2NPSD 5CJ0A 1VQOP 4GOFA 2IPPA 2XNDH 1Q51A 4DT0A 1PIXA 2FW2A 1N7SC 2E74D 3EFFK 5KJPA 3RK3B 2VSSA 2RKLA 1FZAA 3RSIA 4Y99C 2JWAA 4L75A 3I55P 1YTZI 1DX7A 1GD2E 5TJHA 2XV5A 3PGQA 1SZOA 1T2KC 2OYIA 1NTZJ 3SFEC 3LKEA 1K04A 2OTJP 3H1IJ 1PPJE 4GM2A 2G3AA 4JYJA 4U1AA 3H1KJ 1YI2P 5DTPA 4GIFA 2QJKB 3CX5H 4RESB 4H44C 2WSFH 3KTJA 2AXTE 1RH5B 2OGUA 2HR3A 4N3YB 1EC5A 4UB6E 3OA7A 3AEFC 1H0TA 1M7LA 1EF8A 3CWBJ 3MUDA 2E76C 2E42A 1AVYA 3U9RB 2IX7C 4ZDBA 3CX5D 2J5SA 4L8KA 3BCCG 1L4AD 5INFA 2GUSA 3O8ZA 3TDCA 3V5BA 3VMXA 2ZT9C 1IFDA 4LGDE 2QRXA 1SQXG 2JO1A 3RK2C 4H0LB 5KDRB 3VP9A 1SFCB 2M3EA 1CW5A 1YYCA 1BE3J 2GTRA 3CC2P 3LW5H 3Q0GA 1YIJP 4FNDA 3L72J 2I1JA 1FAVA 1L4AA 1ZW0A 2ITAA 4HC8A 2H43A 1P84E 1KD1Q 4IZCA 1N86A 1BCCJ 4C7NA 3U1CA 3CXHH 3W68A 2QVAA 2M3BA 1TU3F 3V6IA 2Y0EA 3JCUE 2K1AA 1YTZT 1KN7A 2PFXA 4OMRA 4JVTA 1S5LX 2HLOA 1OW8A 2K3RA 3CMAP 5DU4A 2D2CC 1IK9A 2PRRA 5AVYB 3VIVA 2IBZD 1UYRA 3D6YA 3H1HD 5APYA 1VQ8P 1OD2A 3HUSC 5KLVK 5AW0B 1NTKJ 2QJPB 5KJ7C 2R44A 1M90Q 3GHGB 3CCEP 1VQMP 2YO3A 4C7RA 3CCMP 2IFMA 2WSFJ 3K50A 3H1JJ 4GHNA 1KTMA 5KLVJ 1JUNA 2H7HA 1NTZK 1FCFA 4ELXA 2HODA 1URQA 1SQPD 1WT6A 3B8EB 2N9BA 1FZEA 2HYNA 2H8PD 3HD7C 4WYOB 2R32A 5B66H 1L0LK 4HNKA 1EY3A 2J59M 1SG4A 3CWBG 1ZR4A 3IAOA 3SWFA 4JQ0D 1KYOH 2X58A 3WG5A 1K73Q 3H1JE 3H0QA 1GTWA 1WDLA 3TVUA 4C7NB 1NTMG 1FU1A 1LP1B 1N7SB 2ZQRA 3V5EA 3L73G 5CTBA 1KB9D 4WB4A 4IFMA 4MI2A 3R9QA 3B5ND 3UIAA 2WSEH 5JBWA 2V7QJ 3HTKB 1Q90D 3TVWA 1W2EA 2W6BA 2F9YA 4IZDA 3BRVB 5AW5B 3RL0D 4NPFX 2POHA 1YJWP 3GHGC 4U3FD 1WDMA 1VDFA 1QL2A 2KS1B 4OGQB 3NMDA 2ZT9D 4KPKA 3BCCD 2XNXA 1RE4C 3PLNA 5KAFE 1OXZA 3M9QA 1JY3N 2A06D 3Q5RA 3H1KE 1MJ3A 2K9YA 4B3HA 3IBBA 1LTJB 1HGVA 2Z4EA 2OTKE 3HRNA 4OVNF 1AQ5A 3V2RA 3FDUA 2ZYDA 3GG2A 3ITKA 3KTHA 3P85A 4NEKA 5GTIE 2BEZF 1A02J 2N1TD 2Q5UA 2N1TA 3TRRA 1QL1A 2OYOA 1USEA 3BCCJ 3H1HE 2AEJA 1LP1A 1AJYA 2YJGA 1RF1A 3BPPA 4L76A 1LTJA 5B5EE 2KIKA 5E0SH 2VSUA 2WQYC 3FWNA 3RGUA 2JEEA 2ZQQA 3A7OA 3USSA 3RK2B 3K8XA 2A45H 3DORA 3E7KA 4KJMA 1LTGC 1URQB 2HPCB 5AVZB 2F9YB 5L8RJ 1XNVA 3L71G 3CL3D 3Q5PA 2QE7H 3SFDC 2QJYC 2F9IA 1JMMA 4MXIA 2Z5IA 1VQ7P 4JCTA 1RE3A 1G2CA 3VMZA 3BVHA 1FC9A 3WMM0 1AFOA 5HUQA 2HODB 3H0JA 3L3SA 3M91A 2PPYA 1X22A 2FBWC 1QVFO 1Q52A 1WMKA 3QREA 1CZQA 3E1IA 3H1KD 2QJPC 3HUSA 3LIEA 4H44B 4ZKPA 3BF0A 3FXEA 5AVQB 2QG4A 5BU8B 3B4SA 3WU2H 1XX4A 2LKMA 3OC7A 4L74A 4DZOA 4HH2A 1FC2C 4RKUJ 3QXIA 3BATA 3ZWCA 1K32A 2YO2A 3MHVA 4ZNCA 1ON3A 1M57D 1AVOA 2WPVB 3L75G 1NZYB 1SQQE 3L74D 4HJGH 1XNYA 2KNCB 3CCJP 5G1SA 1NTMJ 1K8AQ 3E1RA 2A45G 3A3YB 4PV1D 4EOTA 1IFJA 1HF9A 5DL1A 1T3JA 2E43A 3IFMA 4FN7A 2KLUA 4OG1A 1H8AA 4U0HA 5CCHA 3BRTB 5KLVD 1SFCD 2WTBA 4U3FG 2BASA 3P7KA 4J2UA 3SLLA 1LTAC 4PJ0H 1OVUA 4GKGA 1Y9BA 3A0HH 1L0NK 2AEFA 4I42A 1BE3E 1OMIA 3KZIH 1DEBA 1NZYA 2P7JA 1NU1J 1UYSA 4D6TD 4O9BA 5KKZB 3DJAA 2FFDA 1J1EB 2YIUC 3U59A 1RE4A 1NTMD 1SVFA 3SSUA 3AE3C 1SQVG 1DH3A 1Q86Q 1L0LE 4IZBA 2WITA 3PH0A 5C9GA 4B86A 1Y8AA 1IFIA 3T8BA 3FF6A 5KJ7A 3H25A 3BEZA 3MD0A 4DJGA 1DCIA 1EDJA 5GTHH 3RK3C 1FDIA 1YBKA 1QX8A 1BCCG 2LXBA 1RF0C 1GL2D 3Q7HA 5GTIH 5KAFH 2D2CD 1TG6A 3P2LA 2WPQA 2BCCJ 3AE5C 2KLVA 1R8EA 4D6TJ 5MGBA 3TZ3A 1JTHB 5KDRA 4ASVA 2RH0A 1EZVG 3STAA 1SQPG 3S9OA 1EZVD 3N6RB 2YNYA 1FDOA 1S4XA 3F5HA 1JY2O 1URQC 1AQTA 1JM0A 1N7SD 2YIUB 1IC2A 2FYNC 4Z1MH 5G1RA 2KZIA 4Y28J 1T8ZA 2O1KA 4WY4B 5AVXB 4XA4A 4W7YA 2N9YB 4HKZH 2KSEA 3HTKA 1K05A 3CCSP 4N78E 3ZWAA 4D6TG 1LTSC 1OW7A 4BRYB 4H13B 1Z56A 1JB0J 3JC22 1SQBE 3L74J 1E79H 2YMYA 2R5DA 1WRGA 2W6JH 1EXIA 1N6EA 3L37A 1EQ7A 4I7ZC 4JYCA 1EF9A 3MYBA 2B89A 4YXDC 3WUUA 2OYHA 3AE9C 3HD7D 2BCCD 1U57A 2ZJSE 3VOPA 3HE5A 1SQXK 1HZDA 2RN0A 2J5IA 1NTKG 1HJ0A 2FYUJ 3L71J 1PP9D 3AE7C 5DTWA 3WUVA 1FZFA 2J5II 1BGYG 2C0WA 2KYVA 3A0BE 3H1LD 1RQVA 2W6AA 5KJ7D 2IEXA 5APQA 1S72P 4RYFA 4W80A 1SFCC 1AV1A 1JXZA 4G2RA 1JY3O 1TYFA 3H1LE 1LJ2A 2G8YA 2AEMA 1RJMA 2WTYA 2NPSC 1FBMA 1W2BO 3Q5SA 3H0UA 1SQVE 1OZHA 2KI7B 1VQKP 5BU5A 1VQ5P 4JFCA 1QLED 3V2NA 1LTJC 3AEGC 5DKPA 5CCGC 2FY8A 5CTCA 1UIXA 1J2JB 3AEBC 2VSUE 1A02F 5FIFA 1OW6A 1IJDB 1YHQP 2FYUE 1S9KD 2M5AA 2VSSE 3TSIA 2BEQD 3CCUP 1GW4A 1JY2N 4UB6H 4MN4C 4QMAA 3WUTA 4RJTA 4I4ZA 1J1DB 4OWFA 4OH8B 1EZVI 1RF1B 3NTNA 1KILB 1FE6A 3G71P 3N7NA 2RMZA 4IL6X 1ZMEC 2C0XA
chains in the Genus database with same CATH topology
1NGMB 2NZ2A 1VF5D 2K9YA 1MJ3A 4QIIA 4B3HA 3IBBA 5DZKA 1GMJA 2F9IB 3FDUA 3HRXA 3P85A 4NEKA 3KTHA 4R4LA 3AEEC 2BEZF 4HDTA 3TRRA 5INGA 4OGQC 2VREA 4NARA 2OQQA 4OGQD 3Q2YA 1AJYA 3T8AA 2YJGA 3QK8A 1KILE 1S1CX 3BPPA 4OLQA 3HINA 3H81A 5E0SH 2VSUA 2WQYC 3RK3E 5DUFA 4U0GH 1FC7A 5E0NX 3T97B 2ZQQA 3K8XA 4DI1A 3DORA 1UYVA 3HE2A 2F9YB 2JP3A 2PG8A 5L8RJ 1XNVA 3OMEA 3G9RA 2D3TA 3Q5PA 3SFDC 2QJYC 2F9IA 3V5IA 4MXIA 2J5GD 3C8VA 3G64A 2J5UA 2PBPA 4JCTA 1VL2A 3AECC 3AE6C 3MFMA 3D71A 1FC9A 1RJNA 4JCSA 5HUQA 3RSTA 3H0JA 3L3SA 2X24A 3ZW9A 4ZDCA 1PL5A 1PV3A 2PPYA 4YTPC 2FBWC 3ABVC 1Q52A 4FNBA 3TLFA 2WSCJ 1WMKA 4U18A 3QREA 4K2NA 1KMIZ 2QJPC 2FXPA 4H44B 3BF0A 1FC6A 1N6FA 2VX2A 1O8UA 4PV1B 3I47A 3R9SA 2F6IA 5DU6A 1XX4A 3OC7A 2D2CB 2E75B 2YMKA 4Q1IA 5DZKH 4RKUJ 1MKMA 3QXIA 3ZWCA 3O6QA 1K32A 5KKZC 3TT7A 3AE4C 3SWXA 1ON3A 4I7ZB 4ELSA 2ZT9B 1N6DA 2H89C 1ON9A 2WPVB 3P5MA 1NZYB 2ZL4A 4PV1C 3BPTA 3LW5J 3QKAA 1XNYA 2BZRA 4H13C 5JBXA 5G1SA 3R6HA 1VF5B 4KWBA 2VSUC 4FJWD 2Q2XA 4PV1D 1HF9A 4KD6A 5DL1A 4I52A 5G1QA 3T89A 3ST9A 1YG6A 3EWKA 4FN7A 3RL0g 3Q3DA 1WDKA 4OG1A 4U0HA 5IKLB 3IN6A 2E75D 4WCZA 4LK5A 1J7XA 3TV5A 4EMLA 2WTBA 4J2UA 1KQFB 4L6WA 3SLLA 3PZKA 3M6NA 2E74B 4XFJA 4ZU2A 4F47A 4Q0GA 1VF5C 3AE8C 1Y9BA 3Q1MA 4JWVA 3TT6A 3D6ZA 4MOUA 2WSEJ 4TT3H 1YG8A 4I42A 4FZWC 2H88C 4RCNA 4KNPA 1OMIA 2A7SA 5DU8A 3R0OA 5FUSA 1NZYA 5KLIC 1UYSA 2A7KA 2VSSF 3DJAA 5E0SA 4B3JA 4JCRA 2YIUC 2Q34A 3MOYA 3KTKA 3AE3C 3KTGA 3KTIA 2QQ3A 4B3IA 1Q51A 2E76D 1PIXA 3ZWBA 2FW2A 4IZBA 2E74D 5C9GA 5KJPA 4JSBA 3ZW8A 2VSSA 3T88A 1HNUA 3NJDA 3RSIA 3HLN1 3T8BA 3FF6A 1ZRTE 3H25A 4H44D 1ZP0C 3BEZA 3GLMA 1DCIA 2ZL3A 2HW5A 3T3WA 1FDIA 2CBYA 2CE3A 2QJKC 1XNWA 5INIA 3PGQA 1SZOA 3Q7HA 4U7JA 3GF3A 4NNQA 2D2CD 3SFEC 3LKEA 1K04A 1TG6A 4QIJA 3P2LA 4GM2A 4JYLA 2G3AA 4JYJA 4U1AA 2MKVA 2J5GA 4ELWA 5DTPA 3AE5C 3PE8A 4H44C 1R8EA 5MGBA 3TZ3A 2QIWA 3KTJA 3U9SB 5KDRA 2E76B 2IDBA 1WZ8A 3Q1TA 2EJ5A 2UZFA 3STAA 4R4MA 3AEFC 4FB8A 3S9OA 1EF8A 3N6RB 4Z0MA 2E76C 1KORA 3U9RB 4ZDBA 1FDOA 2J5SA 4L8KA 1ZOYC 5INFA 3TDCA 3IB9A 2ZT9C 2FYNC 3OT6A 4Z1MH 5G1RA 4U19A 3H02A 4Y28J 4EMPA 2DEOA 3MT6A 2JO1A 5KDRB 4H0LB 3FGAD 3D70A 3R4YA 2GTRA 1K05A 4JCQA 3Q0GA 4FNDA 3ZWAA 1W2XA 1OW7A 2F6QA 4H13B 4HC8A 2E74C 1JB0J 3QMJA 4IZCA 3KQFA 1DD3A 1KQGB 1EXIA 3PEAA 1N6EA 3RRVA 5DUCA 3AE1C 1TU3F 4I7ZC 4K3WA 1EXJA 1UYTA 1EF9A 3MYBA 1DIPA 4YXDC 4OMRA 4JVTA 1S5LX 3AE9C 1OW8A 2FBMA 4RYFH 1U57A 5DU4A 3ISAA 4H0LD 2D2CC 1RQUA 1HZDA 2J5IA 3VIVA 1UYRA 1HJ0A 3D6YA 3AE7C 3U9TB 5DTWA 1OD2A 3B71A 2J5II 1OD4A 3NJBA 4H13D 1RQVA 2ZL0A 2IEXA 4RYFA 2WSFJ 3K50A 4GHNA 3GMAA 1KTMA 2FZSA 1JXZA 1FCFA 2ZL2A 4G2RA 2VSUF 1TYFA 4ZDFA 4ELXA 4KT0J 2E75C 2G8YA 3AE2C 1X0UA 1RJMA 2NP9A 1NYHA 2J5IB 1Y7OA 4WYOB 3M6MA 3GF7A 3JU1A 5M1BA 3Q5SA 1EY3A 4GDOA 3H0UA 4HNKA 4QFEA 1PJHA 1SG4A 1DUBA 3IAOA 4JFCA 2X58A 3WG5A 3H0QA 3TVUA 3AEGC 1WDLA 5DKPA 4H0LC 5CTCA 2A81A 4WZ8B 1UIXA 1UIYA 3AEBC 1XO6A 2VSUE 3R9TA 2ZQRA 3V5EA 5FIFA 1OW6A 3QWDA 3AEAC 3H0SA 4JOTA 5CTBA 3R9QA 4MI2A 4EMMA 1IK7A 5JBWA 2C8TA 2V7QJ 4YLHA 4ASIA 1Q90D 3TVWA 3HP0A 1K39A 2VSSE 3QYRA 4U0GA 2BEQD 4JJTA 2F9YA 4IZDA 4K29A 3LAOA 4FZWA 4ZDDA 3QXZA 1YQ4C 2P10A 4ZDEA 2QSIA 1WDMA 4I4ZA 2W3PA 4OGQB 5C90A 2DUBA 2ZT9D 4KPKA 3IAVA 2O01J 4FN8A 1DD4A 1VRGA 2Q35A 1YQ3C 1HNOA 3GKBA 1ZMEC 4IL6X 3Q5RA 3Q0JA 3AEDC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MJ3 A;  4QII A;  4B3H A;  3IBB A;  5DZK A;  2F9I B;  3FDU A;  3HRX A;  3P85 A;  4NEK A;  3KTH A;  3TRR A;  5ING A;  2VRE A;  3T8A A;  3QK8 A;  3BPP A;  4OLQ A;  3HIN A;  3H81 A;  5E0S H;  2VSU A;  5E0N X;  5DUF A;  4U0G H;  1FC7 A;  2ZQQ A;  3K8X A;  4DI1 A;  3DOR A;  1UYV A;  3HE2 A;  2F9Y B;  2PG8 A;  1XNV A;  3OME A;  2D3T A;  2F9I A;  3V5I A;  4MXI A;  2J5G D;  3G64 A;  2PBP A;  4JCT A;  3MFM A;  1FC9 A;  1RJN A;  4JCS A;  3RST A;  3H0J A;  3L3S A;  2X24 A;  3ZW9 A;  4ZDC A;  2PPY A;  1Q52 A;  3TLF A;  4FNB A;  4U18 A;  3QRE A;  4K2N A;  3BF0 A;  1FC6 A;  1N6F A;  2VX2 A;  1O8U A;  3I47 A;  3R9S A;  2F6I A;  5DU6 A;  1XX4 A;  3OC7 A;  4Q1I A;  5DZK H;  3QXI A;  3ZWC A;  1K32 A;  3TT7 A;  3SWX A;  1ON3 A;  4ELS A;  1N6D A;  1ON9 A;  3P5M A;  1NZY B;  2ZL4 A;  3QKA A;  1XNY A;  2BZR A;  5JBX A;  5G1S A;  3R6H A;  4KWB A;  2VSU C;  4FJW D;  2Q2X A;  4KD6 A;  5DL1 A;  4I52 A;  5G1Q A;  3T89 A;  3ST9 A;  1YG6 A;  4FN7 A;  4OG1 A;  1WDK A;  4U0H A;  5IKL B;  4WCZ A;  4LK5 A;  1J7X A;  3TV5 A;  4EML A;  2WTB A;  4L6W A;  3SLL A;  3PZK A;  3M6N A;  4ZU2 A;  4F47 A;  4Q0G A;  4JWV A;  3TT6 A;  4MOU A;  1YG8 A;  4I42 A;  4FZW C;  4RCN A;  4KNP A;  2A7S A;  5DU8 A;  3R0O A;  5FUS A;  1NZY A;  1UYS A;  2A7K A;  2VSS F;  3DJA A;  5E0S A;  4B3J A;  4JCR A;  2Q34 A;  3MOY A;  3KTK A;  3KTG A;  3KTI A;  2QQ3 A;  4B3I A;  1Q51 A;  1PIX A;  3ZWB A;  2FW2 A;  4IZB A;  5C9G A;  5KJP A;  4JSB A;  3ZW8 A;  2VSS A;  3T88 A;  1HNU A;  3NJD A;  3RSI A;  3HLN 1;  3T8B A;  3FF6 A;  3BEZ A;  3GLM A;  1DCI A;  2ZL3 A;  2HW5 A;  3T3W A;  2CBY A;  2CE3 A;  1XNW A;  5INI A;  3PGQ A;  1SZO A;  3Q7H A;  3GF3 A;  4NNQ A;  3LKE A;  1TG6 A;  4QIJ A;  3P2L A;  4GM2 A;  4JYL A;  4JYJ A;  4U1A A;  2J5G A;  4ELW A;  5DTP A;  3PE8 A;  5MGB A;  3TZ3 A;  3KTJ A;  3U9S B;  5KDR A;  1WZ8 A;  3Q1T A;  2EJ5 A;  2UZF A;  3STA A;  4FB8 A;  1EF8 A;  3N6R B;  4Z0M A;  3U9R B;  4ZDB A;  2J5S A;  4L8K A;  5INF A;  3TDC A;  3IB9 A;  3OT6 A;  5G1R A;  4U19 A;  3H02 A;  4EMP A;  2DEO A;  3MT6 A;  5KDR B;  2GTR A;  4JCQ A;  3Q0G A;  4FND A;  3ZWA A;  1W2X A;  2F6Q A;  4HC8 A;  3QMJ A;  4IZC A;  3KQF A;  3PEA A;  1N6E A;  3RRV A;  5DUC A;  4K3W A;  1UYT A;  1EF9 A;  3MYB A;  4OMR A;  4JVT A;  2FBM A;  4RYF H;  5DU4 A;  3ISA A;  1HZD A;  2J5I A;  3VIV A;  1UYR A;  3U9T B;  5DTW A;  1OD2 A;  2J5I I;  1OD4 A;  3NJB A;  2ZL0 A;  2IEX A;  4RYF A;  3K50 A;  4GHN A;  3GMA A;  2FZS A;  1JXZ A;  1FCF A;  2ZL2 A;  4G2R A;  2VSU F;  1TYF A;  4ZDF A;  4ELX A;  1X0U A;  1RJM A;  2NP9 A;  2J5I B;  1Y7O A;  4WYO B;  3M6M A;  3GF7 A;  3JU1 A;  4HNK A;  1EY3 A;  3H0U A;  4QFE A;  1PJH A;  1SG4 A;  1DUB A;  4JFC A;  2X58 A;  3WG5 A;  3H0Q A;  3TVU A;  1WDL A;  5DKP A;  5CTC A;  2A81 A;  4WZ8 B;  1UIY A;  1XO6 A;  2VSU E;  3R9T A;  2ZQR A;  3V5E A;  5FIF A;  3QWD A;  3H0S A;  4JOT A;  5CTB A;  3R9Q A;  4MI2 A;  4EMM A;  5JBW A;  4ASI A;  2C8T A;  4YLH A;  3TVW A;  3HP0 A;  1K39 A;  2VSS E;  3QYR A;  4U0G A;  4JJT A;  2F9Y A;  4K29 A;  4IZD A;  3LAO A;  4FZW A;  4ZDD A;  3QXZ A;  4ZDE A;  1WDM A;  4I4Z A;  2W3P A;  5C90 A;  2DUB A;  4KPK A;  3IAV A;  4FN8 A;  1VRG A;  2Q35 A;  1HNO A;  3GKB A;  3Q0J A; 
#chains in the Genus database with same CATH topology
 3B5N B;  2NZ2 A;  1NGM B;  1L0L J;  3M0D C;  5DZK A;  4DCK A;  4IL6 H;  1GMJ A;  3S1K A;  3CD6 P;  5CHX A;  1EDK A;  2WSS H;  2Q7C A;  3CCL P;  4HDT A;  2IBZ E;  3OJA B;  5ING A;  2B9B A;  4OGQ C;  2OQQ A;  3Q2Y A;  4CPG A;  3KZI E;  2HPC A;  3H81 A;  3RK3 E;  1FC7 A;  5APW A;  1KQL A;  5DJU B;  1BSH A;  3G4S P;  2JP3 A;  3OME A;  1OWA A;  4N78 D;  2D3T A;  1MV8 A;  1M8O B;  1NTZ G;  4NPD A;  3V5I A;  1MFT A;  1FZC B;  2Q1K A;  3GW6 A;  2YKQ A;  2PBP A;  1N73 A;  3AEC C;  1NKN A;  1H0T B;  1S3J A;  1U7M A;  4BWN A;  1SP4 A;  1SQP J;  4JCS A;  4AUW A;  2M8R A;  3JCU H;  1XTG B;  2KP8 A;  1PV3 A;  3RBZ A;  3TLF A;  2WSC J;  4K2N A;  3MIW A;  1KMI Z;  2C9N Y;  1KFN A;  1GW3 A;  1FC6 A;  2J58 A;  3RK2 D;  1P84 H;  1ZLL A;  2FFD C;  1FZG A;  4PV1 B;  2FKW B;  2R3S A;  1NJI Q;  2KSJ A;  3R9S A;  3BAS A;  2KOG A;  2XU6 A;  4WY4 A;  2O3J A;  2D2C B;  3CME P;  2YMK A;  5DZK H;  3WU2 E;  2IYP A;  2W8Z A;  3TT7 A;  1VPC A;  1IFM A;  1SQQ J;  2Z5H A;  1N6D A;  1U7J A;  4GOE A;  4TLF A;  1D7M A;  3L74 G;  3LW5 J;  3CCV P;  4AQR D;  2B87 A;  4XE5 B;  1JEK A;  2BZR A;  5APX A;  1PFI A;  1SQP K;  3P8C E;  4I2L C;  4KD6 A;  3CC7 P;  4I6M C;  4I52 A;  5G1Q A;  5CCG A;  3TGU D;  3FXD A;  1YG6 A;  1LNQ A;  3S4R A;  1WDK A;  2KUB A;  2FYU K;  3IN6 A;  1KYO E;  3IF4 A;  4LK5 A;  1HGZ A;  3VYI A;  3F89 A;  3PJS K;  3PZK A;  5B66 E;  3PRJ A;  1GDT A;  2L91 A;  4F47 A;  1VF5 C;  4GT1 A;  3AE8 C;  4JWV A;  4D6T E;  2Y0C A;  1SQX D;  1YG8 A;  4U3F J;  2KNC A;  1P84 I;  1HJB A;  2P2U A;  1VQP P;  5CJ4 A;  3H1J D;  3A5T A;  5CMZ A;  1FOS F;  1QVG O;  3H1J G;  3KDP B;  2FYN B;  5AVU B;  4PJ0 E;  4JCR A;  1HTL C;  1NVO A;  5DJT B;  1S9K E;  3KTG A;  2QQ3 A;  1L2P A;  2E76 D;  2FXM A;  1M1J C;  2LXC B;  1UII A;  1VQL P;  1USD A;  1NOH A;  3ZW8 A;  3CWB D;  3HLN 1;  1ZRT E;  3NFQ A;  4H44 D;  4WBA A;  1JY3 P;  5APV A;  2HW5 A;  1E5W A;  3T3W A;  4IFF A;  3QWO C;  2CBY A;  1VQ4 P;  5INI A;  2OYH C;  1LTT C;  5CBN A;  4GOD A;  4U7J A;  5BVZ A;  3GF3 A;  3H1I E;  3MUD C;  1K9M Q;  4NNQ A;  4PD4 D;  4QIJ A;  4M3L A;  1NU1 K;  2B88 A;  2MKV A;  2J5G A;  4ELW A;  2WT7 B;  2WPR A;  2QIW A;  2UWJ E;  3U9S B;  1SQV K;  1L0N J;  1CSB A;  2IDB A;  3A0B H;  3L36 A;  1ZXG A;  3Q1T A;  2EJ5 A;  3H6P A;  2QM8 A;  2UZF A;  1SQB K;  1LT9 C;  1LTB C;  4FB8 A;  3RK3 D;  1SQX J;  1SFC A;  1L0L D;  3CXH D;  2OYI C;  2PP6 A;  2Y9Z A;  2Q3E A;  5AVT B;  2K9J B;  1ZOY C;  2IFN A;  1Q2N A;  2XZR A;  3IB9 A;  1OVR A;  2DW3 A;  3H02 A;  4EMP A;  2QEX P;  3MT6 A;  3I56 P;  2P1J A;  2M5A B;  1EZV E;  3D70 A;  1VQ6 P;  3R4Y A;  4EI2 A;  1N8R Q;  1G2C B;  1SQX E;  1W2X A;  5GTH E;  3L74 E;  5APT A;  2F6Q A;  3N4X A;  2E74 C;  3H1I G;  4C46 A;  3QMJ A;  5KLV E;  1DD3 A;  1KQG B;  1KB9 E;  3A2A A;  3PEA A;  5CCG D;  5APU A;  1HH0 A;  1J1E C;  1UYT A;  4K3W A;  3MZW B;  2CPS A;  1DIP A;  1GZL A;  3H32 B;  3V4Q A;  4RYF H;  3ISA A;  4H0L D;  3L75 D;  1FZC C;  1RQU A;  3KHU A;  2ZXX A;  2NRG A;  1M1K Q;  1NAY A;  1T3U A;  3L72 D;  3NJB A;  2PGD A;  1PGJ A;  2ZL0 A;  3GMA A;  1YIT P;  2ZL2 A;  2VSU F;  1YJ9 P;  4ZDF A;  4KT0 J;  3L72 E;  1X0U A;  2K37 A;  1AA0 A;  1NYH A;  3RL0 C;  3PP5 A;  3HD7 B;  1NTK D;  1GK6 A;  2J5I B;  3V4W A;  1Y7O A;  3M6M A;  3GF7 A;  3L73 J;  3JU1 A;  3QH9 A;  4GDO A;  2P67 A;  3CCQ P;  1PJH A;  4U3F E;  1DUB A;  1LGH B;  2ZYG A;  3B5N C;  1KYO D;  4UB8 H;  5TIS H;  1N73 B;  1NAF A;  4H0L C;  1FZB A;  3G3Z A;  2A81 A;  4WZ8 B;  3HD7 A;  4EIJ A;  1ZN5 A;  2SPZ A;  1KIL D;  4JBZ A;  3R9T A;  3H1I D;  1KYO I;  4EDF A;  1X79 B;  3GHG A;  5E79 H;  1KB9 H;  2Q6Q A;  3RBX A;  3CXH I;  3L75 E;  2C8T A;  2XDJ A;  3L75 J;  1ZR2 A;  3HP0 A;  1K39 A;  2R5B A;  2WVR A;  4U0G A;  1LT1 A;  4JJT A;  4K29 A;  1NO4 A;  4BRY A;  3LAO A;  3KXD A;  5AW9 B;  4ZDD A;  2WZ7 A;  1BSN A;  4ZDE A;  1GU5 A;  2QSI A;  1PP9 E;  2A06 E;  5C90 A;  2DUB A;  4PD4 H;  3K5B A;  3HE4 A;  2O01 J;  4FN8 A;  1DD4 A;  1QEX A;  1VRG A;  1L0N E;  1LWU C;  3CX5 I;  5AW2 B;  2Q35 A;  1YQ3 C;  3GKB A;  4HYT B;  1X8Y A;  2LR2 A;  3CCR P;  4WY4 C;  1BE3 D;  5B5E H;  4QII A;  5KAI E;  3SWY A;  4AYC A;  3IR9 A;  5H2F E;  1IFP A;  3P32 A;  1IO4 A;  1M1J B;  3HRX A;  4R4L A;  3PTZ A;  3V2P A;  2MJZ A;  2FFD B;  3ZDM A;  1PP9 J;  2AXC A;  1RHZ B;  2GUV A;  4NAR A;  4OGQ D;  3T8A A;  3QK8 A;  1KIL E;  4OLQ A;  1VQ9 P;  1NTK K;  1T6A A;  2GA1 A;  3HIN A;  1S5L H;  1RE3 C;  4U0G H;  4A7P A;  1L0N G;  1FJP A;  4WVZ A;  1PZQ A;  1JOC A;  1UYV A;  3HE2 A;  1PP9 G;  2IBZ G;  2CK3 H;  3L73 E;  2J5G D;  1RF1 C;  1SQB D;  2J5U A;  3AE6 C;  2WWW A;  2PAJ A;  4ZKU A;  1LTI C;  1SQQ G;  1FOS E;  1HUC A;  1NTM K;  4EYY Q;  3RST A;  1FZC A;  3ZW9 A;  1PL5 A;  5AW7 B;  4YTP C;  1SQV D;  3ABV C;  1SS1 A;  4U18 A;  1N6F A;  1NTK E;  1NTZ E;  2WMM A;  2ZFC A;  3M9B A;  3TF5 A;  3I47 A;  2O01 H;  5DU6 A;  3EQ2 A;  1M1J A;  4Q1I A;  5KLI B;  1MKM A;  2WPS A;  1JO5 A;  1IFN A;  3AE4 C;  3SWX A;  1JCC A;  1W5C E;  4LLH A;  3P5M A;  1H89 A;  1LT9 A;  3BPT A;  3M06 A;  2V7Q H;  1X0T A;  3L72 G;  2OYI B;  2VRS A;  3R6H A;  2ZYA A;  3B5N A;  4JF7 A;  1VQN P;  4KWB A;  3T89 A;  1G1J A;  3ST9 A;  2FYZ A;  4YPC A;  3EWK A;  1MUU A;  5CBO A;  2E75 D;  4WCZ A;  1J7X A;  1N7L A;  3CWB E;  4EML A;  1JY2 P;  1KQF B;  4L6W A;  3M6N A;  1X9V A;  1JNM A;  4ZU2 A;  2K9J A;  1FDM A;  1NTZ D;  2B87 B;  3TT6 A;  5AVV B;  1SQP E;  3H1H G;  3L71 D;  2KZJ A;  4TT3 H;  1KQS O;  2H88 C;  3MP7 B;  4RCN A;  2A7S A;  5DU8 A;  5FUS A;  1NKZ B;  5CCH C;  1LT9 B;  3PHL A;  1URQ D;  2ZVO B;  1S5L E;  5KLV G;  5E0S A;  2A45 I;  4B3J A;  1BGY J;  2Q34 A;  1LWU B;  3MOY A;  3H1K G;  1BGY E;  2C9L Y;  3KTK A;  1LWU A;  2FYU G;  1NWQ A;  3KTI A;  4B3I A;  3SWK A;  3ZWB A;  3FX0 A;  3CX5 E;  4JSB A;  2W83 C;  3T88 A;  1Q82 Q;  1HNU A;  1OIP A;  4DOJ A;  2E5Y A;  3NJD A;  1JTH A;  5KAI H;  1ZP0 C;  3GLM A;  1L0L G;  2ZL3 A;  1GL2 A;  4BXL A;  2CE3 A;  2QJK C;  1KFM A;  1HBW A;  1XNW A;  2CPB A;  3C1L A;  2NPS B;  2I8D A;  3VN0 A;  4JYL A;  2E5T A;  3LID A;  2IYO A;  4WY4 D;  3VMY A;  3PE8 A;  2OAR A;  4YXW H;  2E76 B;  4HB1 A;  1WZ8 A;  1NTM E;  5AVR B;  1BE3 G;  2Y0D A;  2AXT H;  4R4M A;  3JSV C;  1RF0 A;  4Z0M A;  2IZ1 A;  1KOR A;  3L70 D;  4PD4 E;  2ZAE B;  3L35 A;  1Y47 A;  2O1J A;  3OT6 A;  4U19 A;  1GU4 A;  1KB9 I;  2DEO A;  1BDD A;  2W27 A;  3TGU J;  4W7Z A;  2ZXE B;  3FGA D;  4UB8 E;  4IL6 E;  2BCC G;  4JCQ A;  3TNU B;  2XKM A;  4I1L A;  3L73 D;  3TNU A;  3H1L J;  3RL0 B;  5AVW B;  1SQB G;  3L70 J;  1N7S A;  3R2P A;  1KIL C;  2Q9I A;  2L5G B;  3KQF A;  2FYU D;  3RRV A;  1IZN B;  5DUC A;  3AE1 C;  3VMA A;  2GM4 A;  1EXJ A;  1ZRT D;  2Y9Y A;  2FBM A;  2JKV A;  4K3A A;  5CCH D;  2YKP A;  3L70 E;  5AW4 B;  3U9T B;  1FS0 E;  3B71 A;  1GK4 A;  1OD4 A;  3OW2 O;  2N1T B;  4H13 D;  1CI6 B;  1SLQ A;  3OAK A;  2FZS A;  3TGU E;  4NPE A;  1N2D C;  3VP8 A;  2E75 C;  1S2E A;  2KK7 A;  4PD4 I;  4IOI H;  3AE2 C;  2YXR B;  2NP9 A;  2WSC H;  3TK1 A;  5M1B A;  4QFE A;  1FJK A;  2OYH B;  1BCC E;  2P58 A;  1T2K D;  1R5L A;  2YKO A;  3W67 A;  2QM7 A;  3M0A A;  2OTL P;  1UIY A;  3CI9 A;  2NPS A;  1XO6 A;  1H88 A;  1SQQ K;  3CC4 P;  1PPJ D;  3QWD A;  1DEE G;  3AEA C;  1PGQ A;  1J1D C;  3H0S A;  4JOT A;  4EMM A;  1IK7 A;  1PPJ G;  4YLH A;  4ASI A;  3EFG A;  1OVV A;  2IZ0 A;  3QYR A;  1MFZ A;  3G6E P;  2R3C A;  4FZW A;  5TIS E;  1NU1 E;  3M0D A;  3QXZ A;  1L4A C;  1YQ4 C;  2P10 A;  1L0N D;  2W3P A;  5E79 E;  3HUS B;  3IAV A;  3C9I A;  1KZU B;  2QJY B;  1KV4 A;  2QA4 P;  1M56 D;  4ZMD A;  2O01 N;  2JDI H;  5AW3 B;  1HNO A;  3H32 A;  1G1I A;  3A0H E;  1ZV8 A;  3CXH E;  3Q0J A;  3AED C;  1XTC C;  3U1A A;  1VF5 D;  2JJL A;  3MGN A;  2FXO A;  3CLQ A;  2WT7 A;  2YXQ B;  2F9I B;  3AEE C;  3NXS A;  3CPW O;  3L4F A;  2VRE A;  1SQV J;  1NH4 A;  1OX3 A;  1EDL A;  1S1C X;  3HE4 B;  4KHX A;  1R5S A;  1CI6 A;  1N73 C;  5E0N X;  5DUF A;  3T97 B;  3KQG A;  3T97 A;  4DI1 A;  1NHL A;  1KIL A;  1KC8 Q;  3FWL A;  1BCC D;  2PG8 A;  3I5C A;  3G9R A;  2W90 A;  4L73 A;  1QGK B;  3C8V A;  3G64 A;  5AW6 B;  3VTP C;  2KXP B;  1VL2 A;  3MFM A;  1SQQ D;  3D71 A;  2ZVN B;  4RO0 A;  3M9H A;  1HWT C;  4Y99 B;  1RJN A;  1YJN P;  5K5G B;  2X24 A;  1MZ9 A;  4ZDC A;  3TDK A;  2KS1 A;  4FNB A;  2FXP A;  2VX2 A;  1O8U A;  5AVS B;  4WWI A;  4JYB A;  3V2Q A;  3L71 E;  3KPE A;  2F6I A;  1GL2 B;  2E75 B;  3TYY A;  1NU1 G;  4ASW A;  3TGU G;  3O6Q A;  2JR8 A;  5KKZ C;  1Q7Y Q;  1NU1 D;  2I1K A;  4I7Z B;  4ELS A;  2ZT9 B;  2H89 C;  2N1T C;  2KB7 P;  1ON9 A;  5KTB A;  2ZL4 A;  4PV1 C;  3P8C D;  1BDC A;  2HFE D;  3QKA A;  1GL2 C;  5AW1 B;  1SQB J;  1EDI A;  3L70 G;  4H13 C;  1JMB A;  3H1L G;  3II6 A;  5JBX A;  1VF5 B;  1L4A B;  1BGY D;  2VSU C;  4FJW D;  2Q2X A;  3O6Q B;  2A06 G;  5C39 A;  3RL0 g;  3HE5 B;  3Q3D A;  5IKL B;  2JWD A;  1HVV A;  4LC1 A;  1OFC X;  3TV5 A;  5AW8 B;  2HG5 D;  1RY3 A;  3BCC E;  3H1H J;  4IFD K;  2E74 B;  4XFJ A;  1P84 D;  4Q0G A;  4N6J A;  5APS A;  3Q1M A;  2Q3I A;  3D6Z A;  4MOU A;  1PGP A;  2WSE J;  3KYQ A;  2BCC E;  4FZW C;  4KNP A;  5EFW B;  1Q81 Q;  3R0O A;  4K35 A;  5H2F H;  2V4H A;  4JPZ B;  2M0B A;  2IBZ I;  3MTU E;  3P8M C;  2K88 A;  5KLI C;  1PGO A;  2A7K A;  2VSS F;  1JCD A;  2NPS D;  5CJ0 A;  1VQO P;  4GOF A;  2IPP A;  2XND H;  1Q51 A;  4DT0 A;  1PIX A;  2FW2 A;  1N7S C;  2E74 D;  3EFF K;  5KJP A;  3RK3 B;  2VSS A;  2RKL A;  1FZA A;  3RSI A;  4Y99 C;  2JWA A;  4L75 A;  3I55 P;  1YTZ I;  1DX7 A;  1GD2 E;  5TJH A;  2XV5 A;  3PGQ A;  1SZO A;  1T2K C;  2OYI A;  1NTZ J;  3SFE C;  3LKE A;  1K04 A;  2OTJ P;  3H1I J;  1PPJ E;  4GM2 A;  2G3A A;  4JYJ A;  4U1A A;  3H1K J;  1YI2 P;  5DTP A;  4GIF A;  2QJK B;  3CX5 H;  4RES B;  4H44 C;  2WSF H;  3KTJ A;  2AXT E;  1RH5 B;  2OGU A;  2HR3 A;  4N3Y B;  1EC5 A;  4UB6 E;  3OA7 A;  3AEF C;  1H0T A;  1M7L A;  1EF8 A;  3CWB J;  3MUD A;  2E76 C;  2E42 A;  1AVY A;  3U9R B;  2IX7 C;  4ZDB A;  3CX5 D;  2J5S A;  4L8K A;  3BCC G;  1L4A D;  5INF A;  2GUS A;  3O8Z A;  3TDC A;  3V5B A;  3VMX A;  2ZT9 C;  1IFD A;  4LGD E;  2QRX A;  1SQX G;  2JO1 A;  3RK2 C;  4H0L B;  5KDR B;  3VP9 A;  1SFC B;  2M3E A;  1CW5 A;  1YYC A;  1BE3 J;  2GTR A;  3CC2 P;  3LW5 H;  3Q0G A;  1YIJ P;  4FND A;  3L72 J;  2I1J A;  1FAV A;  1L4A A;  1ZW0 A;  2ITA A;  4HC8 A;  2H43 A;  1P84 E;  1KD1 Q;  4IZC A;  1N86 A;  1BCC J;  4C7N A;  3U1C A;  3CXH H;  3W68 A;  2QVA A;  2M3B A;  1TU3 F;  3V6I A;  2Y0E A;  3JCU E;  2K1A A;  1YTZ T;  1KN7 A;  2PFX A;  4OMR A;  4JVT A;  1S5L X;  2HLO A;  1OW8 A;  2K3R A;  3CMA P;  5DU4 A;  2D2C C;  1IK9 A;  2PRR A;  5AVY B;  3VIV A;  2IBZ D;  1UYR A;  3D6Y A;  3H1H D;  5APY A;  1VQ8 P;  1OD2 A;  3HUS C;  5KLV K;  5AW0 B;  1NTK J;  2QJP B;  5KJ7 C;  2R44 A;  1M90 Q;  3GHG B;  3CCE P;  1VQM P;  2YO3 A;  4C7R A;  3CCM P;  2IFM A;  2WSF J;  3K50 A;  3H1J J;  4GHN A;  1KTM A;  5KLV J;  1JUN A;  2H7H A;  1NTZ K;  1FCF A;  4ELX A;  2HOD A;  1URQ A;  1SQP D;  1WT6 A;  3B8E B;  2N9B A;  1FZE A;  2HYN A;  2H8P D;  3HD7 C;  4WYO B;  2R32 A;  5B66 H;  1L0L K;  4HNK A;  1EY3 A;  2J59 M;  1SG4 A;  3CWB G;  1ZR4 A;  3IAO A;  3SWF A;  4JQ0 D;  1KYO H;  2X58 A;  3WG5 A;  1K73 Q;  3H1J E;  3H0Q A;  1GTW A;  1WDL A;  3TVU A;  4C7N B;  1NTM G;  1FU1 A;  1LP1 B;  1N7S B;  2ZQR A;  3V5E A;  3L73 G;  5CTB A;  1KB9 D;  4WB4 A;  4IFM A;  4MI2 A;  3R9Q A;  3B5N D;  3UIA A;  2WSE H;  5JBW A;  2V7Q J;  3HTK B;  1Q90 D;  3TVW A;  1W2E A;  2W6B A;  2F9Y A;  4IZD A;  3BRV B;  5AW5 B;  3RL0 D;  4NPF X;  2POH A;  1YJW P;  3GHG C;  4U3F D;  1WDM A;  1VDF A;  1QL2 A;  2KS1 B;  4OGQ B;  3NMD A;  2ZT9 D;  4KPK A;  3BCC D;  2XNX A;  1RE4 C;  3PLN A;  5KAF E;  1OXZ A;  3M9Q A;  1JY3 N;  2A06 D;  3Q5R A;  3H1K E;  1MJ3 A;  2K9Y A;  4B3H A;  3IBB A;  1LTJ B;  1HGV A;  2Z4E A;  2OTK E;  3HRN A;  4OVN F;  1AQ5 A;  3V2R A;  3FDU A;  2ZYD A;  3GG2 A;  3ITK A;  3KTH A;  3P85 A;  4NEK A;  5GTI E;  2BEZ F;  1A02 J;  2N1T D;  2Q5U A;  2N1T A;  3TRR A;  1QL1 A;  2OYO A;  1USE A;  3BCC J;  3H1H E;  2AEJ A;  1LP1 A;  1AJY A;  2YJG A;  1RF1 A;  3BPP A;  4L76 A;  1LTJ A;  5B5E E;  2KIK A;  5E0S H;  2VSU A;  2WQY C;  3FWN A;  3RGU A;  2JEE A;  2ZQQ A;  3A7O A;  3USS A;  3RK2 B;  3K8X A;  2A45 H;  3DOR A;  3E7K A;  4KJM A;  1LTG C;  1URQ B;  2HPC B;  5AVZ B;  2F9Y B;  5L8R J;  1XNV A;  3L71 G;  3CL3 D;  3Q5P A;  2QE7 H;  3SFD C;  2QJY C;  2F9I A;  1JMM A;  4MXI A;  2Z5I A;  1VQ7 P;  4JCT A;  1RE3 A;  1G2C A;  3VMZ A;  3BVH A;  1FC9 A;  3WMM 0;  1AFO A;  5HUQ A;  2HOD B;  3H0J A;  3L3S A;  3M91 A;  2PPY A;  1X22 A;  2FBW C;  1QVF O;  1Q52 A;  1WMK A;  3QRE A;  1CZQ A;  3E1I A;  3H1K D;  2QJP C;  3HUS A;  3LIE A;  4H44 B;  4ZKP A;  3BF0 A;  3FXE A;  5AVQ B;  2QG4 A;  5BU8 B;  3B4S A;  3WU2 H;  1XX4 A;  2LKM A;  3OC7 A;  4L74 A;  4DZO A;  4HH2 A;  1FC2 C;  4RKU J;  3QXI A;  3BAT A;  3ZWC A;  1K32 A;  2YO2 A;  3MHV A;  4ZNC A;  1ON3 A;  1M57 D;  1AVO A;  2WPV B;  3L75 G;  1NZY B;  1SQQ E;  3L74 D;  4HJG H;  1XNY A;  2KNC B;  3CCJ P;  5G1S A;  1NTM J;  1K8A Q;  3E1R A;  2A45 G;  3A3Y B;  4PV1 D;  4EOT A;  1IFJ A;  1HF9 A;  5DL1 A;  1T3J A;  2E43 A;  3IFM A;  4FN7 A;  2KLU A;  4OG1 A;  1H8A A;  4U0H A;  5CCH A;  3BRT B;  5KLV D;  1SFC D;  2WTB A;  4U3F G;  2BAS A;  3P7K A;  4J2U A;  3SLL A;  1LTA C;  4PJ0 H;  1OVU A;  4GKG A;  1Y9B A;  3A0H H;  1L0N K;  2AEF A;  4I42 A;  1BE3 E;  1OMI A;  3KZI H;  1DEB A;  1NZY A;  2P7J A;  1NU1 J;  1UYS A;  4D6T D;  4O9B A;  5KKZ B;  3DJA A;  2FFD A;  1J1E B;  2YIU C;  3U59 A;  1RE4 A;  1NTM D;  1SVF A;  3SSU A;  3AE3 C;  1SQV G;  1DH3 A;  1Q86 Q;  1L0L E;  4IZB A;  2WIT A;  3PH0 A;  5C9G A;  4B86 A;  1Y8A A;  1IFI A;  3T8B A;  3FF6 A;  5KJ7 A;  3H25 A;  3BEZ A;  3MD0 A;  4DJG A;  1DCI A;  1EDJ A;  5GTH H;  3RK3 C;  1FDI A;  1YBK A;  1QX8 A;  1BCC G;  2LXB A;  1RF0 C;  1GL2 D;  3Q7H A;  5GTI H;  5KAF H;  2D2C D;  1TG6 A;  3P2L A;  2WPQ A;  2BCC J;  3AE5 C;  2KLV A;  1R8E A;  4D6T J;  5MGB A;  3TZ3 A;  1JTH B;  5KDR A;  4ASV A;  2RH0 A;  1EZV G;  3STA A;  1SQP G;  3S9O A;  1EZV D;  3N6R B;  2YNY A;  1FDO A;  1S4X A;  3F5H A;  1JY2 O;  1URQ C;  1AQT A;  1JM0 A;  1N7S D;  2YIU B;  1IC2 A;  2FYN C;  4Z1M H;  5G1R A;  2KZI A;  4Y28 J;  1T8Z A;  2O1K A;  4WY4 B;  5AVX B;  4XA4 A;  4W7Y A;  2N9Y B;  4HKZ H;  2KSE A;  3HTK A;  1K05 A;  3CCS P;  4N78 E;  3ZWA A;  4D6T G;  1LTS C;  1OW7 A;  4BRY B;  4H13 B;  1Z56 A;  1JB0 J;  3JC2 2;  1SQB E;  3L74 J;  1E79 H;  2YMY A;  2R5D A;  1WRG A;  2W6J H;  1EXI A;  1N6E A;  3L37 A;  1EQ7 A;  4I7Z C;  4JYC A;  1EF9 A;  3MYB A;  2B89 A;  4YXD C;  3WUU A;  2OYH A;  3AE9 C;  3HD7 D;  2BCC D;  1U57 A;  2ZJS E;  3VOP A;  3HE5 A;  1SQX K;  1HZD A;  2RN0 A;  2J5I A;  1NTK G;  1HJ0 A;  2FYU J;  3L71 J;  1PP9 D;  3AE7 C;  5DTW A;  3WUV A;  1FZF A;  2J5I I;  1BGY G;  2C0W A;  2KYV A;  3A0B E;  3H1L D;  1RQV A;  2W6A A;  5KJ7 D;  2IEX A;  5APQ A;  1S72 P;  4RYF A;  4W80 A;  1SFC C;  1AV1 A;  1JXZ A;  4G2R A;  1JY3 O;  1TYF A;  3H1L E;  1LJ2 A;  2G8Y A;  2AEM A;  1RJM A;  2WTY A;  2NPS C;  1FBM A;  1W2B O;  3Q5S A;  3H0U A;  1SQV E;  1OZH A;  2KI7 B;  1VQK P;  5BU5 A;  1VQ5 P;  4JFC A;  1QLE D;  3V2N A;  1LTJ C;  3AEG C;  5DKP A;  5CCG C;  2FY8 A;  5CTC A;  1UIX A;  1J2J B;  3AEB C;  2VSU E;  1A02 F;  5FIF A;  1OW6 A;  1IJD B;  1YHQ P;  2FYU E;  1S9K D;  2M5A A;  2VSS E;  3TSI A;  2BEQ D;  3CCU P;  1GW4 A;  1JY2 N;  4UB6 H;  4MN4 C;  4QMA A;  3WUT A;  4RJT A;  4I4Z A;  1J1D B;  4OWF A;  4OH8 B;  1EZV I;  1RF1 B;  3NTN A;  1KIL B;  1FE6 A;  3G71 P;  3N7N A;  2RMZ A;  4IL6 X;  1ZME C;  2C0X A; 
#chains in the Genus database with same CATH homology
 1NGM B;  2NZ2 A;  1VF5 D;  2K9Y A;  1MJ3 A;  4QII A;  4B3H A;  3IBB A;  5DZK A;  1GMJ A;  2F9I B;  3FDU A;  3HRX A;  3P85 A;  4NEK A;  3KTH A;  4R4L A;  3AEE C;  2BEZ F;  4HDT A;  3TRR A;  5ING A;  4OGQ C;  2VRE A;  4NAR A;  2OQQ A;  4OGQ D;  3Q2Y A;  1AJY A;  3T8A A;  2YJG A;  3QK8 A;  1KIL E;  1S1C X;  3BPP A;  4OLQ A;  3HIN A;  3H81 A;  5E0S H;  2VSU A;  2WQY C;  3RK3 E;  5DUF A;  4U0G H;  1FC7 A;  5E0N X;  3T97 B;  2ZQQ A;  3K8X A;  4DI1 A;  3DOR A;  1UYV A;  3HE2 A;  2F9Y B;  2JP3 A;  2PG8 A;  5L8R J;  1XNV A;  3OME A;  3G9R A;  2D3T A;  3Q5P A;  3SFD C;  2QJY C;  2F9I A;  3V5I A;  4MXI A;  2J5G D;  3C8V A;  3G64 A;  2J5U A;  2PBP A;  4JCT A;  1VL2 A;  3AEC C;  3AE6 C;  3MFM A;  3D71 A;  1FC9 A;  1RJN A;  4JCS A;  5HUQ A;  3RST A;  3H0J A;  3L3S A;  2X24 A;  3ZW9 A;  4ZDC A;  1PL5 A;  1PV3 A;  2PPY A;  4YTP C;  2FBW C;  3ABV C;  1Q52 A;  4FNB A;  3TLF A;  2WSC J;  1WMK A;  4U18 A;  3QRE A;  4K2N A;  1KMI Z;  2QJP C;  2FXP A;  4H44 B;  3BF0 A;  1FC6 A;  1N6F A;  2VX2 A;  1O8U A;  4PV1 B;  3I47 A;  3R9S A;  2F6I A;  5DU6 A;  1XX4 A;  3OC7 A;  2D2C B;  2E75 B;  2YMK A;  4Q1I A;  5DZK H;  4RKU J;  1MKM A;  3QXI A;  3ZWC A;  3O6Q A;  1K32 A;  5KKZ C;  3TT7 A;  3AE4 C;  3SWX A;  1ON3 A;  4I7Z B;  4ELS A;  2ZT9 B;  1N6D A;  2H89 C;  1ON9 A;  2WPV B;  3P5M A;  1NZY B;  2ZL4 A;  4PV1 C;  3BPT A;  3LW5 J;  3QKA A;  1XNY A;  2BZR A;  4H13 C;  5JBX A;  5G1S A;  3R6H A;  1VF5 B;  4KWB A;  2VSU C;  4FJW D;  2Q2X A;  4PV1 D;  1HF9 A;  4KD6 A;  5DL1 A;  4I52 A;  5G1Q A;  3T89 A;  3ST9 A;  1YG6 A;  3EWK A;  4FN7 A;  3RL0 g;  3Q3D A;  1WDK A;  4OG1 A;  4U0H A;  5IKL B;  3IN6 A;  2E75 D;  4WCZ A;  4LK5 A;  1J7X A;  3TV5 A;  4EML A;  2WTB A;  4J2U A;  1KQF B;  4L6W A;  3SLL A;  3PZK A;  3M6N A;  2E74 B;  4XFJ A;  4ZU2 A;  4F47 A;  4Q0G A;  1VF5 C;  3AE8 C;  1Y9B A;  3Q1M A;  4JWV A;  3TT6 A;  3D6Z A;  4MOU A;  2WSE J;  4TT3 H;  1YG8 A;  4I42 A;  4FZW C;  2H88 C;  4RCN A;  4KNP A;  1OMI A;  2A7S A;  5DU8 A;  3R0O A;  5FUS A;  1NZY A;  5KLI C;  1UYS A;  2A7K A;  2VSS F;  3DJA A;  5E0S A;  4B3J A;  4JCR A;  2YIU C;  2Q34 A;  3MOY A;  3KTK A;  3AE3 C;  3KTG A;  3KTI A;  2QQ3 A;  4B3I A;  1Q51 A;  2E76 D;  1PIX A;  3ZWB A;  2FW2 A;  4IZB A;  2E74 D;  5C9G A;  5KJP A;  4JSB A;  3ZW8 A;  2VSS A;  3T88 A;  1HNU A;  3NJD A;  3RSI A;  3HLN 1;  3T8B A;  3FF6 A;  1ZRT E;  3H25 A;  4H44 D;  1ZP0 C;  3BEZ A;  3GLM A;  1DCI A;  2ZL3 A;  2HW5 A;  3T3W A;  1FDI A;  2CBY A;  2CE3 A;  2QJK C;  1XNW A;  5INI A;  3PGQ A;  1SZO A;  3Q7H A;  4U7J A;  3GF3 A;  4NNQ A;  2D2C D;  3SFE C;  3LKE A;  1K04 A;  1TG6 A;  4QIJ A;  3P2L A;  4GM2 A;  4JYL A;  2G3A A;  4JYJ A;  4U1A A;  2MKV A;  2J5G A;  4ELW A;  5DTP A;  3AE5 C;  3PE8 A;  4H44 C;  1R8E A;  5MGB A;  3TZ3 A;  2QIW A;  3KTJ A;  3U9S B;  5KDR A;  2E76 B;  2IDB A;  1WZ8 A;  3Q1T A;  2EJ5 A;  2UZF A;  3STA A;  4R4M A;  3AEF C;  4FB8 A;  3S9O A;  1EF8 A;  3N6R B;  4Z0M A;  2E76 C;  1KOR A;  3U9R B;  4ZDB A;  1FDO A;  2J5S A;  4L8K A;  1ZOY C;  5INF A;  3TDC A;  3IB9 A;  2ZT9 C;  2FYN C;  3OT6 A;  4Z1M H;  5G1R A;  4U19 A;  3H02 A;  4Y28 J;  4EMP A;  2DEO A;  3MT6 A;  2JO1 A;  5KDR B;  4H0L B;  3FGA D;  3D70 A;  3R4Y A;  2GTR A;  1K05 A;  4JCQ A;  3Q0G A;  4FND A;  3ZWA A;  1W2X A;  1OW7 A;  2F6Q A;  4H13 B;  4HC8 A;  2E74 C;  1JB0 J;  3QMJ A;  4IZC A;  3KQF A;  1DD3 A;  1KQG B;  1EXI A;  3PEA A;  1N6E A;  3RRV A;  5DUC A;  3AE1 C;  1TU3 F;  4I7Z C;  4K3W A;  1EXJ A;  1UYT A;  1EF9 A;  3MYB A;  1DIP A;  4YXD C;  4OMR A;  4JVT A;  1S5L X;  3AE9 C;  1OW8 A;  2FBM A;  4RYF H;  1U57 A;  5DU4 A;  3ISA A;  4H0L D;  2D2C C;  1RQU A;  1HZD A;  2J5I A;  3VIV A;  1UYR A;  1HJ0 A;  3D6Y A;  3AE7 C;  3U9T B;  5DTW A;  1OD2 A;  3B71 A;  2J5I I;  1OD4 A;  3NJB A;  4H13 D;  1RQV A;  2ZL0 A;  2IEX A;  4RYF A;  2WSF J;  3K50 A;  4GHN A;  3GMA A;  1KTM A;  2FZS A;  1JXZ A;  1FCF A;  2ZL2 A;  4G2R A;  2VSU F;  1TYF A;  4ZDF A;  4ELX A;  4KT0 J;  2E75 C;  2G8Y A;  3AE2 C;  1X0U A;  1RJM A;  2NP9 A;  1NYH A;  2J5I B;  1Y7O A;  4WYO B;  3M6M A;  3GF7 A;  3JU1 A;  5M1B A;  3Q5S A;  1EY3 A;  4GDO A;  3H0U A;  4HNK A;  4QFE A;  1PJH A;  1SG4 A;  1DUB A;  3IAO A;  4JFC A;  2X58 A;  3WG5 A;  3H0Q A;  3TVU A;  3AEG C;  1WDL A;  5DKP A;  4H0L C;  5CTC A;  2A81 A;  4WZ8 B;  1UIX A;  1UIY A;  3AEB C;  1XO6 A;  2VSU E;  3R9T A;  2ZQR A;  3V5E A;  5FIF A;  1OW6 A;  3QWD A;  3AEA C;  3H0S A;  4JOT A;  5CTB A;  3R9Q A;  4MI2 A;  4EMM A;  1IK7 A;  5JBW A;  2C8T A;  2V7Q J;  4YLH A;  4ASI A;  1Q90 D;  3TVW A;  3HP0 A;  1K39 A;  2VSS E;  3QYR A;  4U0G A;  2BEQ D;  4JJT A;  2F9Y A;  4IZD A;  4K29 A;  3LAO A;  4FZW A;  4ZDD A;  3QXZ A;  1YQ4 C;  2P10 A;  4ZDE A;  2QSI A;  1WDM A;  4I4Z A;  2W3P A;  4OGQ B;  5C90 A;  2DUB A;  2ZT9 D;  4KPK A;  3IAV A;  2O01 J;  4FN8 A;  1DD4 A;  1VRG A;  2Q35 A;  1YQ3 C;  1HNO A;  3GKB A;  1ZME C;  4IL6 X;  3Q5R A;  3Q0J A;  3AED C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...