3GMAA

Glutaconyl-coa decarboxylase a subunit from clostridium symbiosum co-crystallized with glutaryl-coa
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
584
structure length
558
Chain Sequence
MYSMPGYFQNMPTIGKELVNPNPENEQEIKAVESDIHESIKKALDAGITSEEKLNERGQLSAMQRINALIDPGTWCPLNSLFNPENNKFGTTNIVNGLGRVDGKWVYIVASDNKKMAGAWVPGQAENLIRCSDAAKMMHLPLIYLLNCSGVEFPNQDKVYPNRRGGGTPFFRNSELNQLGIPVIVGIYGTNPAGGGYHSISPTILIAHQDANMAVGGAAAEQIIAAQIENSKLKVPAPGSVPIHYDETGFFREVYQNDLGVIDGIKKYISYLPAYNLEFFRVDTPKAPQLPAEDLYSIIPMNQKRPYDIYEVIARLFDNSEFSEYKKGYGPEMVTGLAKVNGLLVGVIANVQGLLMNYPEYKQNSVGIGGKLYRQGLIKMNEFVTLCARDRIPLIWLQDTTGIDVGDEAEKAELLGLGQSLIYSIENSKLPSLEITIRKASAAAHYVLGGPQGNNTNVFSIGTGACEYYVMPGETAANAMYSRKQPIIGKMNDMIQMYTDKSRPKYCTEKGMVDEIVDMTEVRPYIQAFTEAAYQNPQSICPMHQMLTPRSTREFETF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase
molecule keywords Glutaconyl-CoA decarboxylase subunit A
publication title An asymmetric model for Na+-translocating glutaconyl-CoA decarboxylases
pubmed doi rcsb
source organism Clostridium symbiosum
total genus 210
structure length 558
sequence length 584
chains with identical sequence B
ec nomenclature ec 4.1.1.70: Transferred entry: 7.2.4.5.
pdb deposition date 2009-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01039 Carboxyl_trans Carboxyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.680 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Helix bin 3gmaA01
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3gmaA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3gmaA03
2J5II 4JVTA 4KPKA 4ELWA 2J5GD 4ZU2A 3LKEA 4IZCA 1NZYA 3TT6A 3FF6A 2J5IB 3TRRA 3P2LA 3QMJA 4JJTA 4JCTA 3V5EA 3TLFA 1FC6A 3STAA 4FN8A 3H0UA 5C9GA 3LAOA 1NZYB 2A7SA 3M6NA 3PE8A 4U0GA 2Q2XA 4FN7A 4HC8A 3QYRA 5FIFA 3H02A 1EF9A 4HNKA 1PIXA 2D3TA 3T3WA 4EMLA 5CTBA 4B3HA 5E0NX 3MOYA 3Q7HA 2J5GA 2BZRA 2IEXA 3HLN1 3KTGA 5DUFA 4JSBA 5DTPA 4MOUA 3IAVA 4ELSA 4JFCA 1K32A 1TYFA 2VSUA 3H0QA 5MGBA 4WCZA 4EMMA 1N6FA 2VSUC 3MT6A 2DUBA 4FJWD 4B3JA 4G2RA 2PG8A 5DKPA 1UYSA 2VREA 5E0SH 4I4ZA 1JXZA 4LK5A 3U9RB 2ZL4A 4B3IA 3Q0JA 1XNVA 4FNBA 5DTWA 3MFMA 3HP0A 4KWBA 3RRVA 5IKLB 3VIVA 2ZL3A 1N6DA 2FZSA 3BF0A 1UYRA 5CTCA 3NJDA 3PEAA 3IB9A 3K50A 3GF3A 4RYFH 4KD6A 1TG6A 4I52A 4GHNA 4JYLA 3R0OA 3T89A 3M6MA 3SLLA 5KJPA 1XNWA 3MYBA 3OC7A 2Q35A 1X0UA 4JYJA 3P85A 5C90A 4YLHA 4OMRA 4F47A 1N6EA 3K8XA 4KNPA 3T8AA 3U9TB 4U1AA 3GF7A 1VRGA 2VSUE 1HZDA 2DEOA 3ZWBA 2CE3A 3HE2A 4U19A 4RYFA 4ZDDA 3QXIA 3TZ3A 1PJHA 3R9TA 5JBWA 4K3WA 2NP9A 1EF8A 4WZ8B 3KTHA 3OT6A 3ZWAA 5DZKH 5FUSA 1UIYA 2A81A 4ZDEA 4IZDA 2VX2A 2FBMA 3HINA 3HRXA 5INFA 2VSSE 3U9SB 5JBXA 3R6HA 3H0SA 4WYOB 3RSTA 3G64A 3JU1A 4I42A 3TVWA 4U0HA 1WZ8A 2QQ3A 4MXIA 5DL1A 3GMAA 1OD2A 3R9SA 5G1SA 4JCRA 5DZKA 2CBYA 4FB8A 1WDKA 3TT7A 2VSUF 1DCIA 2PBPA 4NEKA 4IZBA 4ASIA 3I47A 3GLMA 2VSSA 4JOTA 4L8KA 3DJAA 1RJMA 3ST9A 3PGQA 4K29A 1YG6A 1WDMA 3IBBA 4JWVA 3WG5A 2FW2A 4JCQA 5DU8A 3OMEA 2WTBA 3NJBA 2PPYA 5DU6A 4JCSA 2ZQRA 3ZWCA 3KTJA 3RSIA 5G1QA 3Q1TA 1ON3A 3QREA 2F9IA 2GTRA 1FC7A 3FDUA 4ELXA 2W3PA 5KDRA 4U18A 3N6RB 3Q0GA 5INGA 3GKBA 5INIA 3QK8A 1SZOA 3ZW9A 3H0JA 4K2NA 2F9IB 2UZFA 2X24A 3BPPA 3T88A 3KTIA 4Z0MA 3V5IA 5KDRB 3T8BA 4EMPA 4ZDFA 3TVUA 2F6QA 4DI1A 2ZL2A 5DU4A 4ZDCA 1O8UA 1W2XA 3QWDA 1RJNA 4OG1A 5G1RA 4OLQA 1FC9A 3BEZA 3TV5A 1OD4A 3H81A 2ZL0A 3DORA 4QIJA 4ZDBA 2C8TA 1EY3A 3PZKA 2X58A 1FCFA 1WDLA 1Q51A 4Q0GA 4FZWA 3L3SA 4QIIA 1K39A 4FZWC 5DUCA 1UYVA 2F9YA 4RCNA 3ZW8A 3ISAA 3QXZA 1MJ3A 3TDCA 4GM2A 1HNOA 2F6IA 3QKAA 3KTKA 1SG4A 1J7XA 2HW5A 3P5MA 1DUBA 2ZQQA 2F9YB 1XO6A 2J5SA 3KQFA 4MI2A 1XX4A 1Y7OA 1ON9A 1XNYA 1Q52A 4NNQA 2A7KA 2EJ5A 4U0GH 2Q34A 4Q1IA 3R9QA 4FNDA 1UYTA 2J5IA 4QFEA 1YG8A 4L6WA 2VSSF 5E0SA 3SWXA 1HNUA
chains in the Genus database with same CATH superfamily
2J5II 3MUDC 1KFNA 2J5GD 3ZDMA 3JCUE 3JCUH 4ZU2A 4IZCA 4NPDA 3B5NB 3FF6A 3CMAP 4H44C 1QVGO 3P2LA 2YMYA 2POHA 1S9KD 1SQPG 3STAA 3QH9A 1SQXK 4C7NB 5C9GA 3WUUA 1H89A 2Q2XA 2XKMA 3RK2B 2OGUA 4HC8A 1LWUB 2WPQA 5FIFA 2IFMA 4WY4A 3E1IA 1SQXD 3TGUD 2WMMA 3K5BA 1ZXGA 4WY4C 4EMLA 3H6PA 2KI7B 3Q7HA 2FYUJ 1K04A 3KDPB 3KHUA 4PD4D 3AEGC 1AV1A 4I2LC 4K3AA 2M5AA 1MFZA 2IEXA 2NPSB 4L74A 1DEEG 1HGZA 3IAVA 1J1DB 1ZW0A 4GODA 1VQNP 4ELSA 1NTZJ 2A06G 2VSUA 3H0QA 2VSUC 1FZEA 3GHGA 2DUBA 4B3JA 4BRYB 1KYOI 4Y28J 4LC1A 1URQA 2PG8A 1SQQK 4JQ0D 3U9RB 2E5YA 4B3IA 3H1JG 2WPVB 4W7YA 1PP9G 2KK7A 3RL0C 3RRVA 1G2CB 1FBMA 1N7SD 1SQQD 1L2PA 2WT7B 1KC8Q 1P84I 1FZBA 2QVAA 1LTAC 2K3RA 2FZSA 1WT6A 4Y99C 5CMZA 3R4YA 5CTCA 3L71D 3PEAA 1LP1A 4D6TG 4UB6E 4UB6H 1SQBJ 5AW7B 5AW0B 3K50A 3CX5I 3L74D 1TG6A 2I1JA 4I52A 1W2BO 4H13C 3R0OA 1BE3D 1OVUA 3M6MA 5KJPA 1IC2A 1T2KC 3OC7A 2FYUE 2Q35A 2WSSH 5AVWB 1FJKA 2HPCB 2J59M 1SQXG 3TGUG 3K8XA 2L91A 2OYHA 4HYTB 1KYOD 2G8YA 2OYHC 1NU1K 2VSUE 3NXSA 2FYNB 1HZDA 1N7SB 3BCCD 3D71A 2C9NY 2KYVA 3CWBD 1X0TA 2AEMA 3A0HE 3A0HH 1NU1D 3CCEP 3TZ3A 1P84D 1PL5A 3MHVA 2HODA 1BGYJ 2A45I 3B8EB 2K37A 2NP9A 3L70D 2C9LY 1KMIZ 1EF8A 4TT3H 4L75A 5AVZB 3ZWAA 3HD7D 2C0XA 4IZDA 3HINA 2P7JA 1VL2A 1KZUB 2R3SA 3P32A 1SFCD 3AE4C 5INFA 2VSSE 3CX5D 3B4SA 1HJBA 1LNQA 4PV1D 5AVYB 1SQBE 4K35A 2K88A 3TVWA 4U0HA 1NTKG 3L71G 2BCCD 4MXIA 5TJHA 1LTIC 2E42A 2QA4P 5CJ4A 5DZKA 2R3CA 2P67A 1WDKA 1L0LE 3L74G 2IBZI 3CPWO 1JCDA 1DCIA 2PBPA 4NEKA 4WVZA 1BE3G 3GLMA 1K8AQ 3I47A 1SQPJ 4JOTA 4L8KA 5AW6B 3HRNA 4I1LA 1EXJA 4K29A 1YG6A 2B89A 1WDMA 3L75J 1NJIQ 2KUBA 3AE2C 4I7ZC 1BGYE 4KJMA 1NTZK 2WPRA 1JY2O 2PPYA 1Q81Q 3Q5RA 3BCCG 5DU6A 1BDCA 1E79H 3RK3C 3CWBG 3KPEA 5APTA 1FOSF 1J1EC 3TDKA 5G1QA 2IZ0A 1NTZD 3L70G 1FC7A 3FDUA 4ELXA 2W3PA 5KDRA 3P8MC 2AXCA 4DT0A 5INGA 1XTGB 3L37A 3H1IJ 2K1AA 3ZW9A 3HUSC 3H0JA 2F9IB 1T8ZA 3VMZA 1H0TB 1VQ4P 2WSCJ 2R5DA 4GOFA 2FXMA 2YO3A 4H44B 4RKUJ 2Q3EA 1AVYA 2PGDA 2IBZD 1LJ2A 3G6EP 4EMPA 1KILE 3TVUA 1SQBK 2N9YB 2YXRB 1KV4A 3G3ZA 3CC7P 3QWDA 1SQPE 1VQ5P 4OG1A 3S4RA 1NAFA 1ZRTE 3GW6A 2YO2A 3BEZA 5AVTB 3L75E 2XZRA 1ZR4A 4QIJA 2W8ZA 1RE3A 1NKZB 1JM0A 3I5CA 1FZFA 2X58A 1RE3C 2KLUA 3VP8A 1WDLA 1GZLA 2P58A 1PZQA 1W5CE 1K39A 2H89C 1JB0J 3ZW8A 3QXZA 3CCRP 3HE5B 4GM2A 2FYUG 1GL2A 4N6JA 3KTKA 1GL2C 1SG4A 2A06E 1R5SA 1K9MQ 2J5SA 1PPJE 1DEBA 1XNYA 1NTZG 3A7OA 2E75D 2N1TA 2WSCH 3Q2YA 4NNQA 1IFJA 2N1TC 5CBOA 2Q9IA 2VRSA 3H1JE 2QJPB 2YKPA 2J5IA 4QFEA 3N7NA 1CI6B 3I56P 3BVHA 1VDFA 3V6IA 2OTLP 3T97A 5DJUB 1ZR2A 2KLVA 1HNUA 3RL0g 1S3JA 1KTMA 4KPKA 1LP1B 2B9BA 2IBZG 3S1KA 1NZYA 3TRRA 2HYNA 3QMJA 1SQQJ 1QGKB 5KTBA 4H13B 4ZMDA 1JTHB 4OGQD 1S9KE 4IFFA 5H2FE 5H2FH 1FE6A 1LTSC 3BATA 4JF7A 1SQBG 2FY8A 1GTWA 3PHLA 1R5LA 3QYRA 3CL3D 3H32A 1NOHA 1EF9A 4HNKA 1ZLLA 2OYHB 2BASA 2D3TA 1JNMA 4M3LA 1SQXE 3TGUE 4WBAA 2Y9ZA 1NH4A 3AE3C 5E0NX 2V4HA 1VQPP 1L4AC 3SWYA 1N2DC 2BZRA 1JY2N 3HLN1 5DUFA 3S9OA 2BEZF 1T3JA 4N78D 1ZOYC 1K32A 1A02J 4BXLA 5MGBA 3B5ND 2M3EA 4FJWD 2YJGA 1BDDA 5DJTB 4G2RA 1IK9A 5DKPA 4HH2A 3CC4P 4I4ZA 1BGYG 5CCHC 3VN0A 1JOCA 1N7LA 1XNVA 1NU1J 5DTWA 2JP3A 1XTCC 1YQ4C 3RK2D 1SP4A 2JWAA 3H1HD 1M90Q 3H1ID 2OYIB 1SQQE 1LGHB 3OW2O 1SLQA 3L71E 2R5BA 5AW3B 3AEDC 1OFCX 2Z5IA 4DJGA 3V4QA 2L5GB 4HB1A 4YPCA 1BCCD 3GF3A 3M9QA 4RYFH 2OQQA 2NPSD 4KD6A 5BU5A 2YMKA 3H1LJ 3L74E 4RO0A 4GHNA 4EYYQ 2HR3A 2BCCJ 1XNWA 1BE3E 3O8ZA 1KN7A 1X0UA 4YTPC 3P85A 2Y0DA 3L4FA 4QMAA 4OMRA 4F47A 1N6EA 1NHLA 2IFNA 2RKLA 4I7ZB 3AE5C 3T8AA 3U9TB 3CCLP 1CW5A 2R32A 1KYOE 1KYOH 1LTGC 4LLHA 3RK3B 1S2EA 2WSFJ 3R2PA 1J1EB 1NTMJ 3L75G 4HJGH 1HH0A 3ZWBA 3FWNA 2GUVA 3HE2A 3BCCE 4ZDDA 1NVOA 5AVXB 1GK4A 3CWBE 2QM7A 3P7KA 1N8RQ 1RF1B 1MV8A 5AVQB 1NU1E 2QJYB 2YKOA 2KP8A 1P84E 1P84H 1JEKA 5B5EE 5B5EH 1QVFO 3WU2E 3L70E 3WU2H 1ZP0C 3CCQP 3MTUE 1W2EA 3G4SP 3HUSB 2K9YA 2VX2A 4NPFX 3HRXA 3AEEC 1IFNA 2DW3A 5JBXA 2B87A 3H0SA 2K9JB 3CX5E 3CX5H 3HTKB 3RSTA 3IN6A 1FU1A 1USDA 1BSHA 3H1IG 1PPJG 4WWIA 3GHGC 3G64A 3JU1A 1URQC 1FZCB 3H1LE 2PRRA 1HF9A 4YXWH 2FFDA 1M56D 2CPSA 3WUVA 2O1KA 2BCCE 3R9SA 2FFDC 5KJ7D 1AQ5A 2QM8A 1FZGA 3Q3DA 2VSUF 3WUTA 4YXDC 3A5TA 1N73B 4IZBA 2VSSA 4HKZH 3II6A 1RJMA 2H7HA 1RQUA 3MD0A 3PGQA 1HGVA 1EDKA 1NTME 1SQVK 2YXQB 3JC22 4AYCA 2A45H 3AE6C 3L72J 5KLVK 3WG5A 3RBZA 2ZT9C 3P8CD 4KT0J 1GL2B 5DU8A 1SQVD 1J2JB 5GTHE 5GTHH 4H0LB 2HG5D 2W6AA 5KLVD 3V5BA 4JCSA 2ZQRA 4A7PA 2P10A 2M0BA 2N1TB 3CCMP 1YYCA 1M1KQ 1M1JA 1NTZE 2E74C 1M1JC 1FS0E 1VF5C 5AW2B 3T97B 4TLFA 1HTLC 1SZOA 3IAOA 5KAFE 5KAFH 2X24A 1Y9BA 2KIKA 3M9HA 4JBZA 3BPPA 2YNYA 1L0NJ 5AVRB 3KTIA 4Z0MA 3V5IA 3CD6P 2FKWB 2IBZE 1ZMEC 3VMYA 4DI1A 1M8OB 4L76A 4OH8B 3KXDA 2JWDA 3LIDA 1PGQA 2AXTE 2AXTH 1W2XA 2Y0CA 1HJ0A 1SQQG 3H32B 1FC9A 2ITAA 2ZL0A 4AQRD 3H1LD 3L72E 3DORA 4ZDBA 5CCGA 3E7KA 1AA0A 2C8TA 3PZKA 5CCGC 1LTJA 1GU5A 1EZVE 1L4AB 4IFDK 3V2PA 1IZNB 1LTJC 1KILA 1K05A 3IR9A 1NTMK 4EIJA 3U1AA 1KILC 5DUCA 3M9BA 2KB7P 2JEEA 1IK7A 2H43A 4H44D 2N9BA 1SQVG 1HNOA 3FGAD 2GA1A 2FBWC 1NTMD 2QJKB 2ZVNB 3FXDA 1LTTC 1YQ3C 3LIEA 5KLVG 1DUBA 2F9YB 5L8RJ 1H8AA 1Y7OA 1R8EA 1Q52A 3M06A 4R4LA 2ZXXA 3CCSP 1MZ9A 2EJ5A 4U0GH 1JY3P 1USEA 2Y0EA 3TK1A 1X9VA 1UYTA 1EZVI 2IPPA 2E76B 3IF4A 2D2CB 5E0SA 1NU1G 3SWXA 1LT9B 4JVTA 3AEBC 4JYCA 2WSEJ 4C7NA 3W68A 3LKEA 1MFTA 3TT6A 4JPZB 3H1HJ 3L73J 1EQ7A 1LWUA 2GM4A 3V5EA 3TLFA 1TU3F 1S4XA 3A2AA 4FN8A 2PAJA 3LAOA 2A7SA 3SFDC 4FN7A 3VMXA 2LXCB 1GK6A 3H02A 3EFFK 4IOIH 3H1LG 1BCCJ 3U59A 2IYPA 1PIXA 4U3FD 4L73A 3T3WA 2LR2A 1Z56A 2BCCG 3G71P 1NWQA 4B3HA 2BEQD 2JKVA 1T3UA 3MOYA 2J5GA 1J1DC 1RQVA 1NAYA 3D70A 5BVZA 4WY4B 3L72D 4JSBA 5DTPA 3CCJP 1JUNA 1EZVD 1FOSE 4JFCA 1TYFA 4DCKA 1NTMG 4N78E 3MT6A 3NTNA 1G2CA 2A45G 3OAKA 3CC2P 2M5AB 2WT7A 3W67A 2QIWA 4H13D 2VREA 5E0SH 1QEXA 1QL1A 4LK5A 2JR8A 1T2KD 4N3YB 3Q0JA 3MZWB 4FNBA 1VPCA 2WSEH 3MFMA 3HP0A 1L0NK 3V2RA 4KWBA 3GHGB 1RHZB 5IKLB 1URQB 3H1HE 3VIVA 4RESB 2ZL3A 3H1IE 1N6DA 3RL0B 1L0ND 1UYRA 1OX3A 2FFDB 3KZIE 3KZIH 2I1KA 2RMZA 1WMKA 3BRVB 2MKVA 4Y99B 5EFWB 5GTIE 5GTIH 3AECC 1BCCE 2E5TA 5AW4B 3AE8C 1OW6A 5BU8B 3NFQA 1CSBA 3MYBA 1G1IA 3AEAC 4JYJA 1D7MA 1N7SA 5C90A 3SWFA 5KKZC 4XE5B 2FYNC 2KXPB 3CXHD 2KS1A 2ZT9B 1N7SC 4KNPA 1GMJA 3H1KJ 5C39A 1VRGA 3O6QA 2H8PD 1QX8A 3L72G 2CE3A 2O3JA 1OXZA 3SWKA 4RYFA 1AVOA 4NPEA 2W27A 4C7RA 1AJYA 1EZVG 1PJHA 4EDFA 4K3WA 3N4XA 3M0AA 1VF5B 5AVVB 1E5WA 4R4MA 1SQVJ 3KTHA 3OT6A 1UIYA 2W83C 5KLVJ 1OZHA 2FBMA 3LW5J 2HODB 3M91A 3E1RA 2XV5A 1IFDA 4AUWA 1PGOA 1ZN5A 2KNCA 1KQSO 2ZFCA 5APQA 2P1JA 1GDTA 1KB9D 1WZ8A 1L0NG 5APUA 4ASVA 2Q6QA 3RK3D 4GDOA 2B88A 3L73D 3L35A 4JCRA 1X79B 2CBYA 3RGUA 2ZJSE 2XDJA 3SSUA 3HD7A 3TT7A 1OW8A 1Q90D 3HD7C 4ASIA 3DJAA 3TF5A 1SFCA 3ST9A 1KILB 2M3BA 1Q82Q 1SFCC 2FYZA 2QG4A 1DD4A 3IBBA 4JWVA 2CPBA 2KOGA 2RN0A 2NRGA 4PV1C 2Y9YA 1NO4A 3BASA 1PP9D 3OMEA 3P8CE 2WTBA 3NJBA 1DD3A 1SQVE 1ZV8A 3TYYA 4XFJA 1PFIA 5KLVE 3NMDA 1KQLA 3LW5H 3Q1TA 1ON3A 2F9IA 3USSA 1SS1A 1H0TA 1PV3A 3MP7B 3F89A 3JSVC 4HDTA 4GT1A 4D6TD 1OVRA 1Y47A 1U57A 4I6MC 4U18A 3N6RB 3Q0GA 1RH5B 1EDIA 1U7JA 2O1JA 4K2NA 2UZFA 3Q1MA 5KDRB 3C9IA 1AQTA 2OTJP 1IO4A 4ZNCA 4ZDFA 1FDOA 2W6BA 1HUCA 4U7JA 2CK3H 1YITP 3MGNA 1DH3A 4W80A 4ZDCA 1S72P 1O8UA 3M0DA 1GL2D 4EOTA 3M0DC 4ASWA 1RJNA 2IZ1A 5G1RA 3EFGA 3H1HG 3L73G 4H0LD 4OLQA 4GIFA 1H88A 1OW7A 2OYOA 5AVSB 4OVNF 3VOPA 3FXEA 2N1TD 1FC2C 1GD2E 5KAIE 5KAIH 3HE5A 3A0BE 3A0BH 1VQOP 1PGPA 1Q51A 1VQ7P 4FZWA 3L3SA 2WITA 4QIIA 1BCCG 5CJ0A 3SFEC 4FZWC 1UYVA 4RCNA 3H1KD 5AW9B 1YHQP 4U3FJ 1EXIA 3L36A 1MJ3A 3TDCA 4LGDE 1NTKK 2ZAEB 2WSFH 4PJ0E 4PJ0H 4BWNA 1J7XA 2HW5A 2E43A 2ZQQA 1S5LE 1S5LH 2QJPC 1CI6A 5AW1B 1XO6A 2YIUC 4MI2A 1XX4A 3AEFC 1ON9A 1NTKD 1VQMP 1FAVA 1CZQA 2A7KA 5APSA 5APVA 2WQYC 3F5HA 2KSJA 2Q34A 4Q1IA 3R9QA 1HVVA 5K5GB 4FNDA 1GU4A 1S5LX 4J2UA 1S1CX 2VSSF 4CPGA 1IFPA 4ELWA 1JTHA 1L4AD 2SPZA 3CCVP 1YTZI 2G3AA 1FJPA 2QEXP 2J5IB 3AE7C 1Q2NA 1L0LJ 4JJTA 1FDMA 4JCTA 3Q5SA 1FC6A 1VQLP 1RF0A 4DZOA 3H0UA 4MN4C 1RF0C 1DX7A 1NZYB 3M6NA 1GW3A 3PE8A 4U0GA 5KKZB 2E75C 1LT1A 5APXA 2FXPA 1YJNP 5CCHD 2KS1B 1EC5A 2JJLA 3OJAB 3V4WA 2KZJA 1X22A 1YI2P 3A3YB 4U3FE 5CTBA 3O6QB 4DOJA 2AEJA 3HE4A 2Q3IA 2Q7CA 3RBXA 2E76D 4GOEA 2D2CD 3H1KG 3KTGA 2HFED 5APWA 1NKNA 2OARA 4EI2A 4MOUA 3G9RA 5TISE 5TISH 1KD1Q 1JCCA 1JY2P 4WCZA 4EMMA 1N6FA 3PRJA 2ZYGA 4OGQC 3ABVC 5KLIC 1AFOA 1UIXA 2OYIA 1UYSA 2Q5UA 1JXZA 2OYIC 2ZL4A 3H25A 1PGJA 1VQKP 3U1CA 3BPTA 3AE1C 3KQGA 2KNCB 3VMAA 3WMM0 4C46A 2GUSA 3TNUA 3C1LA 3BF0A 3NJDA 1OIPA 5APYA 1L0NE 3IB9A 4ZKPA 3B5NA 2FYUK 4WY4D 3VP9A 1FDIA 3B5NC 3HD7B 2XNXA 1IJDB 2JO1A 1RE4A 1Y8AA 2LXBA 2PFXA 4JYLA 3T89A 1SFCB 1RE4C 2FYUD 3SLLA 2KZIA 4GKGA 4PV1B 4YLHA 1X8YA 1YBKA 2PP6A 3RK2C 1LWUC 3CXHE 3CXHH 3PH0A 3I55P 1RF1A 4U1AA 3GF7A 1RF1C 2QJYC 3OA7A 4OWFA 1URQD 2DEOA 1LTBC 3GG2A 3VYIA 5AVUB 2P2UA 4U19A 5E79E 5E79H 3HUSA 3QXIA 2HLOA 3RL0D 5HUQA 3IFMA 2NPSA 1YJ9P 3R9TA 5JBWA 2M8RA 2NZ2A 2I8DA 2NPSC 2ZYAA 3FWLA 1GW4A 3H1JJ 4WZ8B 1PP9J 2K9JA 1JY3O 1FZAA 3HTKA 2W90A 4UB8E 4UB8H 5DZKH 5FUSA 2A81A 4BRYA 1YJWP 2AEFA 4ZDEA 3PTZA 1FZCA 1Q86Q 1FZCC 3U9SB 3CXHI 3R6HA 1QL2A 1UIIA 4WYOB 1SQBD 4XA4A 1NGMB 1NYHA 4D6TJ 1JO5A 4W7ZA 2ZT9D 1YIJP 2WPSA 1N86A 4I42A 1IFIA 1L0LK 2KSEA 3EWKA 1KB9E 1KB9H 1N73A 1VQ6P 2QQ3A 2B87B 3C8VA 5DL1A 3GMAA 1N73C 1OD2A 2ZVOB 1OMIA 3KYQA 3MIWA 2WWWA 3RK3E 2ZYDA 5G1SA 1L0LD 4FB8A 3L73E 2Q1KA 2IYOA 1Q7YQ 4ZKUA 4NARA 1SQXJ 2E74D 3TGUJ 1M7LA 1T6AA 1JMBA 2Z5HA 3V2NA 3D6YA 1VF5D 2V7QJ 3V2QA 1HWTC 3CI9A 2WTYA 4WB4A 2WZ7A 1SVFA 2UWJE 4H0LC 2O01J 3AE9C 5AW5B 2HPCA 1HBWA 1BGYD 2FW2A 1MKMA 4JCQA 4IL6E 4IL6H 1KB9I 3B71A 2WVRA 1PP9E 1YTZT 3BRTB 2YIUB 3QWOC 3ZWCA 5KJ7A 3KTJA 4U3FG 3RSIA 3PP5A 5KJ7C 4B86A 3QREA 3Q5PA 2GTRA 4IL6X 3CMEP 4D6TE 1OWAA 1IFMA 5CCGD 3GKBA 5INIA 3QK8A 2QRXA 3VTPC 1VQ9P 2E74B 1M1JB 3T88A 1NTKJ 2JDIH 1SQPK 1KILD 1U7MA 3L71J 3T8BA 1EDLA 1KQGB 2F6QA 2ZL2A 3CCUP 5DU4A 1KQFB 3L74J 1SQPD 4Z1MH 2E75B 1VQ8P 1ZRTD 2Z4EA 4JYBA 2V7QH 2H88C 1BE3J 1L4AA 1L0LG 2LKMA 3L75D 2ZXEB 1K73Q 3TSIA 3TV5A 5CBNA 1M57D 5B66E 5B66H 1KFMA 4PD4H 4PD4E 2O01H 3D6ZA 1OD4A 3H81A 2OTKE 2QSIA 1EY3A 1MUUA 1FCFA 5AW8B 4Q0GA 3HE4B 4IFMA 1JMMA 3PJSK 2QJKC 1G1JA 3BCCJ 5CCHA 2F9YA 1OVVA 1A02F 2FXOA 3CWBJ 2YKQA 4KHXA 3ISAA 2C0WA 2MJZA 3H1KE 1LTJB 2IX7C 3FX0A 4OGQB 2XU6A 2A06D 2F6IA 5M1BA 3QKAA 5KLIB 1EDJA 4O9BA 5CHXA 3L70J 3EQ2A 2IDBA 3P5MA 1PPJD 3PLNA 1JY3N 3KQFA 3ITKA 2J5UA 1KORA 1WRGA 2R44A 2J58A 1LT9A 1QLED 2E76C 2D2CC 4PD4I 3H1JD 1NTKE 1LT9C 3UIAA 4RJTA 1BSNA 2W6JH 2QE7H 1YG8A 1RY3A 3CLQA 3TNUB 4L6WA 2RH0A 3MUDA 2O01N 2XNDH 1DIPA
chains in the Genus database with same CATH topology
2J5II 4JVTA 3RL0g 1KTMA 3AEBC 4KPKA 4ELWA 2WSEJ 2J5GD 4ZU2A 3LKEA 4IZCA 2G3AA 1NZYA 3TT6A 3FF6A 2J5IB 4H44C 3TRRA 3AE7C 3P2LA 3QMJA 4JJTA 4JCTA 3V5EA 3TLFA 3Q5SA 1TU3F 1FC6A 4H13B 3STAA 4FN8A 3H0UA 4OGQD 5C9GA 3LAOA 1NZYB 2A7SA 3SFDC 3M6NA 3PE8A 4U0GA 2Q2XA 4FN7A 2E75C 4HC8A 3QYRA 2FXPA 5FIFA 3H02A 1EF9A 4HNKA 1PIXA 2D3TA 3T3WA 4EMLA 5CTBA 4B3HA 2BEQD 3AE3C 5E0NX 3MOYA 3Q7HA 2J5GA 1K04A 1RQVA 3D70A 2E76D 3AEGC 2D2CD 2BZRA 2IEXA 3HLN1 3KTGA 5DUFA 4JSBA 3S9OA 5DTPA 2BEZF 4MOUA 3IAVA 3G9RA 1ZOYC 4ELSA 4JFCA 1K32A 1TYFA 2VSUA 3H0QA 5MGBA 4WCZA 4EMMA 1N6FA 2VSUC 3MT6A 4OGQC 2DUBA 2YJGA 4FJWD 3ABVC 4B3JA 4Y28J 4G2RA 5KLIC 2PG8A 5DKPA 1UIXA 2QIWA 4H13D 1UYSA 2VREA 5E0SH 4I4ZA 1JXZA 4LK5A 3U9RB 2ZL4A 4B3IA 3Q0JA 1XNVA 3H25A 2WPVB 4FNBA 5DTWA 2JP3A 3MFMA 3BPTA 3AE1C 3HP0A 1YQ4C 4KWBA 3RRVA 5IKLB 3VIVA 2ZL3A 1N6DA 2FZSA 3BF0A 1UYRA 3R4YA 5CTCA 3NJDA 3PEAA 3IB9A 3AEDC 1WMKA 1FDIA 2MKVA 3K50A 3GF3A 4RYFH 2OQQA 3AECC 4KD6A 1TG6A 2YMKA 2JO1A 4I52A 4GHNA 4JYLA 3AE8C 4H13C 3R0OA 3T89A 3M6MA 3SLLA 5KJPA 1OW6A 1XNWA 3MYBA 3OC7A 3AEAC 2Q35A 1X0UA 4YTPC 4JYJA 3P85A 4PV1B 5C90A 4YLHA 5KKZC 2FYNC 4OMRA 4F47A 1N6EA 2ZT9B 3K8XA 4I7ZB 4KNPA 1GMJA 3AE5C 3T8AA 3U9TB 2G8YA 4U1AA 3GF7A 1VRGA 3O6QA 2VSUE 2WSFJ 2QJYC 1HZDA 2DEOA 3D71A 3ZWBA 2CE3A 3HE2A 4U19A 4RYFA 4ZDDA 3QXIA 5HUQA 1AJYA 3TZ3A 1PJHA 3R9TA 5JBWA 1PL5A 4K3WA 2NZ2A 2NP9A 1KMIZ 1VF5B 1EF8A 4TT3H 4WZ8B 4R4MA 1ZP0C 3KTHA 3OT6A 3ZWAA 5DZKH 5FUSA 1UIYA 2A81A 4ZDEA 2K9YA 4IZDA 2VX2A 2FBMA 3HINA 3LW5J 1VL2A 3HRXA 3AEEC 3AE4C 5INFA 2VSSE 3U9SB 5JBXA 3R6HA 3H0SA 4WYOB 1NGMB 3RSTA 1NYHA 3IN6A 4PV1D 2ZT9D 3G64A 3JU1A 4I42A 3TVWA 4U0HA 1WZ8A 3EWKA 1HF9A 2QQ3A 4MXIA 3C8VA 5DL1A 3GMAA 4GDOA 1OD2A 3R9SA 1OMIA 3RK3E 5G1SA 4JCRA 5DZKA 2CBYA 4FB8A 1WDKA 3Q3DA 3TT7A 1OW8A 2VSUF 1Q90D 1DCIA 2PBPA 4NARA 4YXDC 4NEKA 2E74D 4IZBA 4ASIA 3I47A 3GLMA 3D6YA 1VF5D 2VSSA 4JOTA 2V7QJ 4L8KA 3DJAA 1RJMA 1EXJA 1RQUA 3ST9A 3PGQA 4K29A 1YG6A 1WDMA 1DD4A 3IBBA 4JWVA 4H0LC 2O01J 3AE9C 3AE6C 4PV1C 3WG5A 2ZT9C 2FW2A 3AE2C 4KT0J 1MKMA 4I7ZC 4JCQA 5DU8A 3OMEA 2WTBA 3B71A 3NJBA 4H0LB 1DD3A 2PPYA 3Q5RA 5DU6A 4XFJA 4JCSA 2ZQRA 3ZWCA 3KTJA 3RSIA 5G1QA 2P10A 3Q1TA 1ON3A 3QREA 2F9IA 3Q5PA 1PV3A 2GTRA 4IL6X 1FC7A 4HDTA 2E74C 3FDUA 4ELXA 2W3PA 5KDRA 1U57A 1VF5C 4U18A 3N6RB 3Q0GA 5INGA 3T97B 3GKBA 5INIA 3QK8A 1SZOA 3ZW9A 3IAOA 3H0JA 4K2NA 2F9IB 2UZFA 2X24A 1Y9BA 2E74B 2WSCJ 3Q1MA 3BPPA 3T88A 4H44B 4RKUJ 3KTIA 4Z0MA 3V5IA 5KDRB 3T8BA 4EMPA 4ZDFA 1FDOA 1KILE 1ZMEC 1KQGB 3TVUA 2F6QA 4DI1A 4U7JA 2ZL2A 5DU4A 4ZDCA 1KQFB 1O8UA 1W2XA 4Z1MH 3QWDA 2E75B 1RJNA 4OG1A 5G1RA 2H88C 4H0LD 1ZRTE 4OLQA 1HJ0A 1OW7A 1FC9A 3BEZA 3TV5A 1OD4A 3H81A 2ZL0A 3D6ZA 3DORA 4QIJA 2QSIA 4ZDBA 2C8TA 1EY3A 3PZKA 2X58A 1FCFA 1WDLA 1Q51A 4Q0GA 4FZWA 3L3SA 4QIIA 1K05A 2QJKC 1K39A 3SFEC 4FZWC 5DUCA 1UYVA 2F9YA 4RCNA 2H89C 1JB0J 3ZW8A 3ISAA 3QXZA 1IK7A 1EXIA 1MJ3A 4H44D 3TDCA 4GM2A 4OGQB 1HNOA 3FGAD 2FBWC 2F6IA 5M1BA 3QKAA 3KTKA 1SG4A 1YQ3C 2IDBA 1J7XA 2HW5A 3P5MA 1DUBA 2ZQQA 2F9YB 5L8RJ 2QJPC 1XO6A 2J5SA 2YIUC 3KQFA 4MI2A 1XX4A 2J5UA 1Y7OA 1KORA 3AEFC 1R8EA 1ON9A 1XNYA 2E76C 1Q52A 2E75D 4R4LA 2D2CC 3Q2YA 4NNQA 2A7KA 2WQYC 2EJ5A 4U0GH 2Q34A 4Q1IA 3R9QA 4FNDA 1UYTA 2J5IA 4QFEA 1YG8A 1S5LX 4J2UA 1S1CX 4L6WA 2E76B 2VSSF 2D2CB 5E0SA 3SWXA 1HNUA 1DIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J5I I;  4JVT A;  4KPK A;  4ELW A;  2J5G D;  4ZU2 A;  3LKE A;  4IZC A;  1NZY A;  3TT6 A;  3FF6 A;  2J5I B;  3TRR A;  3P2L A;  3QMJ A;  4JJT A;  4JCT A;  3V5E A;  3TLF A;  1FC6 A;  3STA A;  4FN8 A;  3H0U A;  5C9G A;  3LAO A;  1NZY B;  2A7S A;  3M6N A;  3PE8 A;  4U0G A;  2Q2X A;  4FN7 A;  4HC8 A;  3QYR A;  5FIF A;  3H02 A;  1EF9 A;  4HNK A;  1PIX A;  2D3T A;  3T3W A;  4EML A;  5CTB A;  4B3H A;  5E0N X;  3MOY A;  3Q7H A;  2J5G A;  2BZR A;  2IEX A;  3HLN 1;  3KTG A;  5DUF A;  4JSB A;  5DTP A;  4MOU A;  3IAV A;  4ELS A;  4JFC A;  1K32 A;  1TYF A;  2VSU A;  3H0Q A;  5MGB A;  4WCZ A;  4EMM A;  1N6F A;  2VSU C;  3MT6 A;  2DUB A;  4FJW D;  4B3J A;  4G2R A;  2PG8 A;  5DKP A;  1UYS A;  2VRE A;  5E0S H;  4I4Z A;  1JXZ A;  4LK5 A;  3U9R B;  2ZL4 A;  4B3I A;  3Q0J A;  1XNV A;  4FNB A;  5DTW A;  3MFM A;  3HP0 A;  4KWB A;  3RRV A;  5IKL B;  3VIV A;  2ZL3 A;  1N6D A;  2FZS A;  3BF0 A;  1UYR A;  5CTC A;  3NJD A;  3PEA A;  3IB9 A;  3K50 A;  3GF3 A;  4RYF H;  4KD6 A;  1TG6 A;  4I52 A;  4GHN A;  4JYL A;  3R0O A;  3T89 A;  3M6M A;  3SLL A;  5KJP A;  1XNW A;  3MYB A;  3OC7 A;  2Q35 A;  1X0U A;  4JYJ A;  3P85 A;  5C90 A;  4YLH A;  4OMR A;  4F47 A;  1N6E A;  3K8X A;  4KNP A;  3T8A A;  3U9T B;  4U1A A;  3GF7 A;  1VRG A;  2VSU E;  1HZD A;  2DEO A;  3ZWB A;  2CE3 A;  3HE2 A;  4U19 A;  4RYF A;  4ZDD A;  3QXI A;  3TZ3 A;  1PJH A;  3R9T A;  5JBW A;  4K3W A;  2NP9 A;  1EF8 A;  4WZ8 B;  3KTH A;  3OT6 A;  3ZWA A;  5DZK H;  5FUS A;  1UIY A;  2A81 A;  4ZDE A;  4IZD A;  2VX2 A;  2FBM A;  3HIN A;  3HRX A;  5INF A;  2VSS E;  3U9S B;  5JBX A;  3R6H A;  3H0S A;  4WYO B;  3RST A;  3G64 A;  3JU1 A;  4I42 A;  3TVW A;  4U0H A;  1WZ8 A;  2QQ3 A;  4MXI A;  5DL1 A;  3GMA A;  1OD2 A;  3R9S A;  5G1S A;  4JCR A;  5DZK A;  2CBY A;  4FB8 A;  1WDK A;  3TT7 A;  2VSU F;  1DCI A;  2PBP A;  4NEK A;  4IZB A;  4ASI A;  3I47 A;  3GLM A;  2VSS A;  4JOT A;  4L8K A;  3DJA A;  1RJM A;  3ST9 A;  3PGQ A;  4K29 A;  1YG6 A;  1WDM A;  3IBB A;  4JWV A;  3WG5 A;  2FW2 A;  4JCQ A;  5DU8 A;  3OME A;  2WTB A;  3NJB A;  2PPY A;  5DU6 A;  4JCS A;  2ZQR A;  3ZWC A;  3KTJ A;  3RSI A;  5G1Q A;  3Q1T A;  1ON3 A;  3QRE A;  2F9I A;  2GTR A;  1FC7 A;  3FDU A;  4ELX A;  2W3P A;  5KDR A;  4U18 A;  3N6R B;  3Q0G A;  5ING A;  3GKB A;  5INI A;  3QK8 A;  1SZO A;  3ZW9 A;  3H0J A;  4K2N A;  2F9I B;  2UZF A;  2X24 A;  3BPP A;  3T88 A;  3KTI A;  4Z0M A;  3V5I A;  5KDR B;  3T8B A;  4EMP A;  4ZDF A;  3TVU A;  2F6Q A;  4DI1 A;  2ZL2 A;  5DU4 A;  4ZDC A;  1O8U A;  1W2X A;  3QWD A;  1RJN A;  4OG1 A;  5G1R A;  4OLQ A;  1FC9 A;  3BEZ A;  3TV5 A;  1OD4 A;  3H81 A;  2ZL0 A;  3DOR A;  4QIJ A;  4ZDB A;  2C8T A;  1EY3 A;  3PZK A;  2X58 A;  1FCF A;  1WDL A;  1Q51 A;  4Q0G A;  4FZW A;  3L3S A;  4QII A;  1K39 A;  4FZW C;  5DUC A;  1UYV A;  2F9Y A;  4RCN A;  3ZW8 A;  3ISA A;  3QXZ A;  1MJ3 A;  3TDC A;  4GM2 A;  1HNO A;  2F6I A;  3QKA A;  3KTK A;  1SG4 A;  1J7X A;  2HW5 A;  3P5M A;  1DUB A;  2ZQQ A;  2F9Y B;  1XO6 A;  2J5S A;  3KQF A;  4MI2 A;  1XX4 A;  1Y7O A;  1ON9 A;  1XNY A;  1Q52 A;  4NNQ A;  2A7K A;  2EJ5 A;  4U0G H;  2Q34 A;  4Q1I A;  3R9Q A;  4FND A;  1UYT A;  2J5I A;  4QFE A;  1YG8 A;  4L6W A;  2VSS F;  5E0S A;  3SWX A;  1HNU A; 
#chains in the Genus database with same CATH topology
 2J5I I;  3MUD C;  1KFN A;  2J5G D;  3ZDM A;  3JCU E;  3JCU H;  4ZU2 A;  4IZC A;  4NPD A;  3B5N B;  3FF6 A;  3CMA P;  4H44 C;  1QVG O;  3P2L A;  2YMY A;  2POH A;  1S9K D;  1SQP G;  3STA A;  3QH9 A;  1SQX K;  4C7N B;  5C9G A;  3WUU A;  1H89 A;  2Q2X A;  2XKM A;  3RK2 B;  2OGU A;  4HC8 A;  1LWU B;  2WPQ A;  5FIF A;  2IFM A;  4WY4 A;  3E1I A;  1SQX D;  3TGU D;  2WMM A;  3K5B A;  1ZXG A;  4WY4 C;  4EML A;  3H6P A;  2KI7 B;  3Q7H A;  2FYU J;  1K04 A;  3KDP B;  3KHU A;  4PD4 D;  3AEG C;  1AV1 A;  4I2L C;  4K3A A;  2M5A A;  1MFZ A;  2IEX A;  2NPS B;  4L74 A;  1DEE G;  1HGZ A;  3IAV A;  1J1D B;  1ZW0 A;  4GOD A;  1VQN P;  4ELS A;  1NTZ J;  2A06 G;  2VSU A;  3H0Q A;  2VSU C;  1FZE A;  3GHG A;  2DUB A;  4B3J A;  4BRY B;  1KYO I;  4Y28 J;  4LC1 A;  1URQ A;  2PG8 A;  1SQQ K;  4JQ0 D;  3U9R B;  2E5Y A;  4B3I A;  3H1J G;  2WPV B;  4W7Y A;  1PP9 G;  2KK7 A;  3RL0 C;  3RRV A;  1G2C B;  1FBM A;  1N7S D;  1SQQ D;  1L2P A;  2WT7 B;  1KC8 Q;  1P84 I;  1FZB A;  2QVA A;  1LTA C;  2K3R A;  2FZS A;  1WT6 A;  4Y99 C;  5CMZ A;  3R4Y A;  5CTC A;  3L71 D;  3PEA A;  1LP1 A;  4D6T G;  4UB6 E;  4UB6 H;  1SQB J;  5AW7 B;  5AW0 B;  3K50 A;  3CX5 I;  3L74 D;  1TG6 A;  2I1J A;  4I52 A;  1W2B O;  4H13 C;  3R0O A;  1BE3 D;  1OVU A;  3M6M A;  5KJP A;  1IC2 A;  1T2K C;  3OC7 A;  2FYU E;  2Q35 A;  2WSS H;  5AVW B;  1FJK A;  2HPC B;  2J59 M;  1SQX G;  3TGU G;  3K8X A;  2L91 A;  2OYH A;  4HYT B;  1KYO D;  2G8Y A;  2OYH C;  1NU1 K;  2VSU E;  3NXS A;  2FYN B;  1HZD A;  1N7S B;  3BCC D;  3D71 A;  2C9N Y;  2KYV A;  3CWB D;  1X0T A;  2AEM A;  3A0H E;  3A0H H;  1NU1 D;  3CCE P;  3TZ3 A;  1P84 D;  1PL5 A;  3MHV A;  2HOD A;  1BGY J;  2A45 I;  3B8E B;  2K37 A;  2NP9 A;  3L70 D;  2C9L Y;  1KMI Z;  1EF8 A;  4TT3 H;  4L75 A;  5AVZ B;  3ZWA A;  3HD7 D;  2C0X A;  4IZD A;  3HIN A;  2P7J A;  1VL2 A;  1KZU B;  2R3S A;  3P32 A;  1SFC D;  3AE4 C;  5INF A;  2VSS E;  3CX5 D;  3B4S A;  1HJB A;  1LNQ A;  4PV1 D;  5AVY B;  1SQB E;  4K35 A;  2K88 A;  3TVW A;  4U0H A;  1NTK G;  3L71 G;  2BCC D;  4MXI A;  5TJH A;  1LTI C;  2E42 A;  2QA4 P;  5CJ4 A;  5DZK A;  2R3C A;  2P67 A;  1WDK A;  1L0L E;  3L74 G;  2IBZ I;  3CPW O;  1JCD A;  1DCI A;  2PBP A;  4NEK A;  4WVZ A;  1BE3 G;  3GLM A;  1K8A Q;  3I47 A;  1SQP J;  4JOT A;  4L8K A;  5AW6 B;  3HRN A;  4I1L A;  1EXJ A;  4K29 A;  1YG6 A;  2B89 A;  1WDM A;  3L75 J;  1NJI Q;  2KUB A;  3AE2 C;  4I7Z C;  1BGY E;  4KJM A;  1NTZ K;  2WPR A;  1JY2 O;  2PPY A;  1Q81 Q;  3Q5R A;  3BCC G;  5DU6 A;  1BDC A;  1E79 H;  3RK3 C;  3CWB G;  3KPE A;  5APT A;  1FOS F;  1J1E C;  3TDK A;  5G1Q A;  2IZ0 A;  1NTZ D;  3L70 G;  1FC7 A;  3FDU A;  4ELX A;  2W3P A;  5KDR A;  3P8M C;  2AXC A;  4DT0 A;  5ING A;  1XTG B;  3L37 A;  3H1I J;  2K1A A;  3ZW9 A;  3HUS C;  3H0J A;  2F9I B;  1T8Z A;  3VMZ A;  1H0T B;  1VQ4 P;  2WSC J;  2R5D A;  4GOF A;  2FXM A;  2YO3 A;  4H44 B;  4RKU J;  2Q3E A;  1AVY A;  2PGD A;  2IBZ D;  1LJ2 A;  3G6E P;  4EMP A;  1KIL E;  3TVU A;  1SQB K;  2N9Y B;  2YXR B;  1KV4 A;  3G3Z A;  3CC7 P;  3QWD A;  1SQP E;  1VQ5 P;  4OG1 A;  3S4R A;  1NAF A;  1ZRT E;  3GW6 A;  2YO2 A;  3BEZ A;  5AVT B;  3L75 E;  2XZR A;  1ZR4 A;  4QIJ A;  2W8Z A;  1RE3 A;  1NKZ B;  1JM0 A;  3I5C A;  1FZF A;  2X58 A;  1RE3 C;  2KLU A;  3VP8 A;  1WDL A;  1GZL A;  2P58 A;  1PZQ A;  1W5C E;  1K39 A;  2H89 C;  1JB0 J;  3ZW8 A;  3QXZ A;  3CCR P;  3HE5 B;  4GM2 A;  2FYU G;  1GL2 A;  4N6J A;  3KTK A;  1GL2 C;  1SG4 A;  2A06 E;  1R5S A;  1K9M Q;  2J5S A;  1PPJ E;  1DEB A;  1XNY A;  1NTZ G;  3A7O A;  2E75 D;  2N1T A;  2WSC H;  3Q2Y A;  4NNQ A;  1IFJ A;  2N1T C;  5CBO A;  2Q9I A;  2VRS A;  3H1J E;  2QJP B;  2YKP A;  2J5I A;  4QFE A;  3N7N A;  1CI6 B;  3I56 P;  3BVH A;  1VDF A;  3V6I A;  2OTL P;  3T97 A;  5DJU B;  1ZR2 A;  2KLV A;  1HNU A;  3RL0 g;  1S3J A;  1KTM A;  4KPK A;  1LP1 B;  2B9B A;  2IBZ G;  3S1K A;  1NZY A;  3TRR A;  2HYN A;  3QMJ A;  1SQQ J;  1QGK B;  5KTB A;  4H13 B;  4ZMD A;  1JTH B;  4OGQ D;  1S9K E;  4IFF A;  5H2F E;  5H2F H;  1FE6 A;  1LTS C;  3BAT A;  4JF7 A;  1SQB G;  2FY8 A;  1GTW A;  3PHL A;  1R5L A;  3QYR A;  3CL3 D;  3H32 A;  1NOH A;  1EF9 A;  4HNK A;  1ZLL A;  2OYH B;  2BAS A;  2D3T A;  1JNM A;  4M3L A;  1SQX E;  3TGU E;  4WBA A;  2Y9Z A;  1NH4 A;  3AE3 C;  5E0N X;  2V4H A;  1VQP P;  1L4A C;  3SWY A;  1N2D C;  2BZR A;  1JY2 N;  3HLN 1;  5DUF A;  3S9O A;  2BEZ F;  1T3J A;  4N78 D;  1ZOY C;  1K32 A;  1A02 J;  4BXL A;  5MGB A;  3B5N D;  2M3E A;  4FJW D;  2YJG A;  1BDD A;  5DJT B;  4G2R A;  1IK9 A;  5DKP A;  4HH2 A;  3CC4 P;  4I4Z A;  1BGY G;  5CCH C;  3VN0 A;  1JOC A;  1N7L A;  1XNV A;  1NU1 J;  5DTW A;  2JP3 A;  1XTC C;  1YQ4 C;  3RK2 D;  1SP4 A;  2JWA A;  3H1H D;  1M90 Q;  3H1I D;  2OYI B;  1SQQ E;  1LGH B;  3OW2 O;  1SLQ A;  3L71 E;  2R5B A;  5AW3 B;  3AED C;  1OFC X;  2Z5I A;  4DJG A;  3V4Q A;  2L5G B;  4HB1 A;  4YPC A;  1BCC D;  3GF3 A;  3M9Q A;  4RYF H;  2OQQ A;  2NPS D;  4KD6 A;  5BU5 A;  2YMK A;  3H1L J;  3L74 E;  4RO0 A;  4GHN A;  4EYY Q;  2HR3 A;  2BCC J;  1XNW A;  1BE3 E;  3O8Z A;  1KN7 A;  1X0U A;  4YTP C;  3P85 A;  2Y0D A;  3L4F A;  4QMA A;  4OMR A;  4F47 A;  1N6E A;  1NHL A;  2IFN A;  2RKL A;  4I7Z B;  3AE5 C;  3T8A A;  3U9T B;  3CCL P;  1CW5 A;  2R32 A;  1KYO E;  1KYO H;  1LTG C;  4LLH A;  3RK3 B;  1S2E A;  2WSF J;  3R2P A;  1J1E B;  1NTM J;  3L75 G;  4HJG H;  1HH0 A;  3ZWB A;  3FWN A;  2GUV A;  3HE2 A;  3BCC E;  4ZDD A;  1NVO A;  5AVX B;  1GK4 A;  3CWB E;  2QM7 A;  3P7K A;  1N8R Q;  1RF1 B;  1MV8 A;  5AVQ B;  1NU1 E;  2QJY B;  2YKO A;  2KP8 A;  1P84 E;  1P84 H;  1JEK A;  5B5E E;  5B5E H;  1QVF O;  3WU2 E;  3L70 E;  3WU2 H;  1ZP0 C;  3CCQ P;  3MTU E;  1W2E A;  3G4S P;  3HUS B;  2K9Y A;  2VX2 A;  4NPF X;  3HRX A;  3AEE C;  1IFN A;  2DW3 A;  5JBX A;  2B87 A;  3H0S A;  2K9J B;  3CX5 E;  3CX5 H;  3HTK B;  3RST A;  3IN6 A;  1FU1 A;  1USD A;  1BSH A;  3H1I G;  1PPJ G;  4WWI A;  3GHG C;  3G64 A;  3JU1 A;  1URQ C;  1FZC B;  3H1L E;  2PRR A;  1HF9 A;  4YXW H;  2FFD A;  1M56 D;  2CPS A;  3WUV A;  2O1K A;  2BCC E;  3R9S A;  2FFD C;  5KJ7 D;  1AQ5 A;  2QM8 A;  1FZG A;  3Q3D A;  2VSU F;  3WUT A;  4YXD C;  3A5T A;  1N73 B;  4IZB A;  2VSS A;  4HKZ H;  3II6 A;  1RJM A;  2H7H A;  1RQU A;  3MD0 A;  3PGQ A;  1HGV A;  1EDK A;  1NTM E;  1SQV K;  2YXQ B;  3JC2 2;  4AYC A;  2A45 H;  3AE6 C;  3L72 J;  5KLV K;  3WG5 A;  3RBZ A;  2ZT9 C;  3P8C D;  4KT0 J;  1GL2 B;  5DU8 A;  1SQV D;  1J2J B;  5GTH E;  5GTH H;  4H0L B;  2HG5 D;  2W6A A;  5KLV D;  3V5B A;  4JCS A;  2ZQR A;  4A7P A;  2P10 A;  2M0B A;  2N1T B;  3CCM P;  1YYC A;  1M1K Q;  1M1J A;  1NTZ E;  2E74 C;  1M1J C;  1FS0 E;  1VF5 C;  5AW2 B;  3T97 B;  4TLF A;  1HTL C;  1SZO A;  3IAO A;  5KAF E;  5KAF H;  2X24 A;  1Y9B A;  2KIK A;  3M9H A;  4JBZ A;  3BPP A;  2YNY A;  1L0N J;  5AVR B;  3KTI A;  4Z0M A;  3V5I A;  3CD6 P;  2FKW B;  2IBZ E;  1ZME C;  3VMY A;  4DI1 A;  1M8O B;  4L76 A;  4OH8 B;  3KXD A;  2JWD A;  3LID A;  1PGQ A;  2AXT E;  2AXT H;  1W2X A;  2Y0C A;  1HJ0 A;  1SQQ G;  3H32 B;  1FC9 A;  2ITA A;  2ZL0 A;  4AQR D;  3H1L D;  3L72 E;  3DOR A;  4ZDB A;  5CCG A;  3E7K A;  1AA0 A;  2C8T A;  3PZK A;  5CCG C;  1LTJ A;  1GU5 A;  1EZV E;  1L4A B;  4IFD K;  3V2P A;  1IZN B;  1LTJ C;  1KIL A;  1K05 A;  3IR9 A;  1NTM K;  4EIJ A;  3U1A A;  1KIL C;  5DUC A;  3M9B A;  2KB7 P;  2JEE A;  1IK7 A;  2H43 A;  4H44 D;  2N9B A;  1SQV G;  1HNO A;  3FGA D;  2GA1 A;  2FBW C;  1NTM D;  2QJK B;  2ZVN B;  3FXD A;  1LTT C;  1YQ3 C;  3LIE A;  5KLV G;  1DUB A;  2F9Y B;  5L8R J;  1H8A A;  1Y7O A;  1R8E A;  1Q52 A;  3M06 A;  4R4L A;  2ZXX A;  3CCS P;  1MZ9 A;  2EJ5 A;  4U0G H;  1JY3 P;  1USE A;  2Y0E A;  3TK1 A;  1X9V A;  1UYT A;  1EZV I;  2IPP A;  2E76 B;  3IF4 A;  2D2C B;  5E0S A;  1NU1 G;  3SWX A;  1LT9 B;  4JVT A;  3AEB C;  4JYC A;  2WSE J;  4C7N A;  3W68 A;  3LKE A;  1MFT A;  3TT6 A;  4JPZ B;  3H1H J;  3L73 J;  1EQ7 A;  1LWU A;  2GM4 A;  3V5E A;  3TLF A;  1TU3 F;  1S4X A;  3A2A A;  4FN8 A;  2PAJ A;  3LAO A;  2A7S A;  3SFD C;  4FN7 A;  3VMX A;  2LXC B;  1GK6 A;  3H02 A;  3EFF K;  4IOI H;  3H1L G;  1BCC J;  3U59 A;  2IYP A;  1PIX A;  4U3F D;  4L73 A;  3T3W A;  2LR2 A;  1Z56 A;  2BCC G;  3G71 P;  1NWQ A;  4B3H A;  2BEQ D;  2JKV A;  1T3U A;  3MOY A;  2J5G A;  1J1D C;  1RQV A;  1NAY A;  3D70 A;  5BVZ A;  4WY4 B;  3L72 D;  4JSB A;  5DTP A;  3CCJ P;  1JUN A;  1EZV D;  1FOS E;  4JFC A;  1TYF A;  4DCK A;  1NTM G;  4N78 E;  3MT6 A;  3NTN A;  1G2C A;  2A45 G;  3OAK A;  3CC2 P;  2M5A B;  2WT7 A;  3W67 A;  2QIW A;  4H13 D;  2VRE A;  5E0S H;  1QEX A;  1QL1 A;  4LK5 A;  2JR8 A;  1T2K D;  4N3Y B;  3Q0J A;  3MZW B;  4FNB A;  1VPC A;  2WSE H;  3MFM A;  3HP0 A;  1L0N K;  3V2R A;  4KWB A;  3GHG B;  1RHZ B;  5IKL B;  1URQ B;  3H1H E;  3VIV A;  4RES B;  2ZL3 A;  3H1I E;  1N6D A;  3RL0 B;  1L0N D;  1UYR A;  1OX3 A;  2FFD B;  3KZI E;  3KZI H;  2I1K A;  2RMZ A;  1WMK A;  3BRV B;  2MKV A;  4Y99 B;  5EFW B;  5GTI E;  5GTI H;  3AEC C;  1BCC E;  2E5T A;  5AW4 B;  3AE8 C;  1OW6 A;  5BU8 B;  3NFQ A;  1CSB A;  3MYB A;  1G1I A;  3AEA C;  4JYJ A;  1D7M A;  1N7S A;  5C90 A;  3SWF A;  5KKZ C;  4XE5 B;  2FYN C;  2KXP B;  3CXH D;  2KS1 A;  2ZT9 B;  1N7S C;  4KNP A;  1GMJ A;  3H1K J;  5C39 A;  1VRG A;  3O6Q A;  2H8P D;  1QX8 A;  3L72 G;  2CE3 A;  2O3J A;  1OXZ A;  3SWK A;  4RYF A;  1AVO A;  4NPE A;  2W27 A;  4C7R A;  1AJY A;  1EZV G;  1PJH A;  4EDF A;  4K3W A;  3N4X A;  3M0A A;  1VF5 B;  5AVV B;  1E5W A;  4R4M A;  1SQV J;  3KTH A;  3OT6 A;  1UIY A;  2W83 C;  5KLV J;  1OZH A;  2FBM A;  3LW5 J;  2HOD B;  3M91 A;  3E1R A;  2XV5 A;  1IFD A;  4AUW A;  1PGO A;  1ZN5 A;  2KNC A;  1KQS O;  2ZFC A;  5APQ A;  2P1J A;  1GDT A;  1KB9 D;  1WZ8 A;  1L0N G;  5APU A;  4ASV A;  2Q6Q A;  3RK3 D;  4GDO A;  2B88 A;  3L73 D;  3L35 A;  4JCR A;  1X79 B;  2CBY A;  3RGU A;  2ZJS E;  2XDJ A;  3SSU A;  3HD7 A;  3TT7 A;  1OW8 A;  1Q90 D;  3HD7 C;  4ASI A;  3DJA A;  3TF5 A;  1SFC A;  3ST9 A;  1KIL B;  2M3B A;  1Q82 Q;  1SFC C;  2FYZ A;  2QG4 A;  1DD4 A;  3IBB A;  4JWV A;  2CPB A;  2KOG A;  2RN0 A;  2NRG A;  4PV1 C;  2Y9Y A;  1NO4 A;  3BAS A;  1PP9 D;  3OME A;  3P8C E;  2WTB A;  3NJB A;  1DD3 A;  1SQV E;  1ZV8 A;  3TYY A;  4XFJ A;  1PFI A;  5KLV E;  3NMD A;  1KQL A;  3LW5 H;  3Q1T A;  1ON3 A;  2F9I A;  3USS A;  1SS1 A;  1H0T A;  1PV3 A;  3MP7 B;  3F89 A;  3JSV C;  4HDT A;  4GT1 A;  4D6T D;  1OVR A;  1Y47 A;  1U57 A;  4I6M C;  4U18 A;  3N6R B;  3Q0G A;  1RH5 B;  1EDI A;  1U7J A;  2O1J A;  4K2N A;  2UZF A;  3Q1M A;  5KDR B;  3C9I A;  1AQT A;  2OTJ P;  1IO4 A;  4ZNC A;  4ZDF A;  1FDO A;  2W6B A;  1HUC A;  4U7J A;  2CK3 H;  1YIT P;  3MGN A;  1DH3 A;  4W80 A;  4ZDC A;  1S72 P;  1O8U A;  3M0D A;  1GL2 D;  4EOT A;  3M0D C;  4ASW A;  1RJN A;  2IZ1 A;  5G1R A;  3EFG A;  3H1H G;  3L73 G;  4H0L D;  4OLQ A;  4GIF A;  1H88 A;  1OW7 A;  2OYO A;  5AVS B;  4OVN F;  3VOP A;  3FXE A;  2N1T D;  1FC2 C;  1GD2 E;  5KAI E;  5KAI H;  3HE5 A;  3A0B E;  3A0B H;  1VQO P;  1PGP A;  1Q51 A;  1VQ7 P;  4FZW A;  3L3S A;  2WIT A;  4QII A;  1BCC G;  5CJ0 A;  3SFE C;  4FZW C;  1UYV A;  4RCN A;  3H1K D;  5AW9 B;  1YHQ P;  4U3F J;  1EXI A;  3L36 A;  1MJ3 A;  3TDC A;  4LGD E;  1NTK K;  2ZAE B;  2WSF H;  4PJ0 E;  4PJ0 H;  4BWN A;  1J7X A;  2HW5 A;  2E43 A;  2ZQQ A;  1S5L E;  1S5L H;  2QJP C;  1CI6 A;  5AW1 B;  1XO6 A;  2YIU C;  4MI2 A;  1XX4 A;  3AEF C;  1ON9 A;  1NTK D;  1VQM P;  1FAV A;  1CZQ A;  2A7K A;  5APS A;  5APV A;  2WQY C;  3F5H A;  2KSJ A;  2Q34 A;  4Q1I A;  3R9Q A;  1HVV A;  5K5G B;  4FND A;  1GU4 A;  1S5L X;  4J2U A;  1S1C X;  2VSS F;  4CPG A;  1IFP A;  4ELW A;  1JTH A;  1L4A D;  2SPZ A;  3CCV P;  1YTZ I;  2G3A A;  1FJP A;  2QEX P;  2J5I B;  3AE7 C;  1Q2N A;  1L0L J;  4JJT A;  1FDM A;  4JCT A;  3Q5S A;  1FC6 A;  1VQL P;  1RF0 A;  4DZO A;  3H0U A;  4MN4 C;  1RF0 C;  1DX7 A;  1NZY B;  3M6N A;  1GW3 A;  3PE8 A;  4U0G A;  5KKZ B;  2E75 C;  1LT1 A;  5APX A;  2FXP A;  1YJN P;  5CCH D;  2KS1 B;  1EC5 A;  2JJL A;  3OJA B;  3V4W A;  2KZJ A;  1X22 A;  1YI2 P;  3A3Y B;  4U3F E;  5CTB A;  3O6Q B;  4DOJ A;  2AEJ A;  3HE4 A;  2Q3I A;  2Q7C A;  3RBX A;  2E76 D;  4GOE A;  2D2C D;  3H1K G;  3KTG A;  2HFE D;  5APW A;  1NKN A;  2OAR A;  4EI2 A;  4MOU A;  3G9R A;  5TIS E;  5TIS H;  1KD1 Q;  1JCC A;  1JY2 P;  4WCZ A;  4EMM A;  1N6F A;  3PRJ A;  2ZYG A;  4OGQ C;  3ABV C;  5KLI C;  1AFO A;  1UIX A;  2OYI A;  1UYS A;  2Q5U A;  1JXZ A;  2OYI C;  2ZL4 A;  3H25 A;  1PGJ A;  1VQK P;  3U1C A;  3BPT A;  3AE1 C;  3KQG A;  2KNC B;  3VMA A;  3WMM 0;  4C46 A;  2GUS A;  3TNU A;  3C1L A;  3BF0 A;  3NJD A;  1OIP A;  5APY A;  1L0N E;  3IB9 A;  4ZKP A;  3B5N A;  2FYU K;  4WY4 D;  3VP9 A;  1FDI A;  3B5N C;  3HD7 B;  2XNX A;  1IJD B;  2JO1 A;  1RE4 A;  1Y8A A;  2LXB A;  2PFX A;  4JYL A;  3T89 A;  1SFC B;  1RE4 C;  2FYU D;  3SLL A;  2KZI A;  4GKG A;  4PV1 B;  4YLH A;  1X8Y A;  1YBK A;  2PP6 A;  3RK2 C;  1LWU C;  3CXH E;  3CXH H;  3PH0 A;  3I55 P;  1RF1 A;  4U1A A;  3GF7 A;  1RF1 C;  2QJY C;  3OA7 A;  4OWF A;  1URQ D;  2DEO A;  1LTB C;  3GG2 A;  3VYI A;  5AVU B;  2P2U A;  4U19 A;  5E79 E;  5E79 H;  3HUS A;  3QXI A;  2HLO A;  3RL0 D;  5HUQ A;  3IFM A;  2NPS A;  1YJ9 P;  3R9T A;  5JBW A;  2M8R A;  2NZ2 A;  2I8D A;  2NPS C;  2ZYA A;  3FWL A;  1GW4 A;  3H1J J;  4WZ8 B;  1PP9 J;  2K9J A;  1JY3 O;  1FZA A;  3HTK A;  2W90 A;  4UB8 E;  4UB8 H;  5DZK H;  5FUS A;  2A81 A;  4BRY A;  1YJW P;  2AEF A;  4ZDE A;  3PTZ A;  1FZC A;  1Q86 Q;  1FZC C;  3U9S B;  3CXH I;  3R6H A;  1QL2 A;  1UII A;  4WYO B;  1SQB D;  4XA4 A;  1NGM B;  1NYH A;  4D6T J;  1JO5 A;  4W7Z A;  2ZT9 D;  1YIJ P;  2WPS A;  1N86 A;  4I42 A;  1IFI A;  1L0L K;  2KSE A;  3EWK A;  1KB9 E;  1KB9 H;  1N73 A;  1VQ6 P;  2QQ3 A;  2B87 B;  3C8V A;  5DL1 A;  3GMA A;  1N73 C;  1OD2 A;  2ZVO B;  1OMI A;  3KYQ A;  3MIW A;  2WWW A;  3RK3 E;  2ZYD A;  5G1S A;  1L0L D;  4FB8 A;  3L73 E;  2Q1K A;  2IYO A;  1Q7Y Q;  4ZKU A;  4NAR A;  1SQX J;  2E74 D;  3TGU J;  1M7L A;  1T6A A;  1JMB A;  2Z5H A;  3V2N A;  3D6Y A;  1VF5 D;  2V7Q J;  3V2Q A;  1HWT C;  3CI9 A;  2WTY A;  4WB4 A;  2WZ7 A;  1SVF A;  2UWJ E;  4H0L C;  2O01 J;  3AE9 C;  5AW5 B;  2HPC A;  1HBW A;  1BGY D;  2FW2 A;  1MKM A;  4JCQ A;  4IL6 E;  4IL6 H;  1KB9 I;  3B71 A;  2WVR A;  1PP9 E;  1YTZ T;  3BRT B;  2YIU B;  3QWO C;  3ZWC A;  5KJ7 A;  3KTJ A;  4U3F G;  3RSI A;  3PP5 A;  5KJ7 C;  4B86 A;  3QRE A;  3Q5P A;  2GTR A;  4IL6 X;  3CME P;  4D6T E;  1OWA A;  1IFM A;  5CCG D;  3GKB A;  5INI A;  3QK8 A;  2QRX A;  3VTP C;  1VQ9 P;  2E74 B;  1M1J B;  3T88 A;  1NTK J;  2JDI H;  1SQP K;  1KIL D;  1U7M A;  3L71 J;  3T8B A;  1EDL A;  1KQG B;  2F6Q A;  2ZL2 A;  3CCU P;  5DU4 A;  1KQF B;  3L74 J;  1SQP D;  4Z1M H;  2E75 B;  1VQ8 P;  1ZRT D;  2Z4E A;  4JYB A;  2V7Q H;  2H88 C;  1BE3 J;  1L4A A;  1L0L G;  2LKM A;  3L75 D;  2ZXE B;  1K73 Q;  3TSI A;  3TV5 A;  5CBN A;  1M57 D;  5B66 E;  5B66 H;  1KFM A;  4PD4 H;  4PD4 E;  2O01 H;  3D6Z A;  1OD4 A;  3H81 A;  2OTK E;  2QSI A;  1EY3 A;  1MUU A;  1FCF A;  5AW8 B;  4Q0G A;  3HE4 B;  4IFM A;  1JMM A;  3PJS K;  2QJK C;  1G1J A;  3BCC J;  5CCH A;  2F9Y A;  1OVV A;  1A02 F;  2FXO A;  3CWB J;  2YKQ A;  4KHX A;  3ISA A;  2C0W A;  2MJZ A;  3H1K E;  1LTJ B;  2IX7 C;  3FX0 A;  4OGQ B;  2XU6 A;  2A06 D;  2F6I A;  5M1B A;  3QKA A;  5KLI B;  1EDJ A;  4O9B A;  5CHX A;  3L70 J;  3EQ2 A;  2IDB A;  3P5M A;  1PPJ D;  3PLN A;  1JY3 N;  3KQF A;  3ITK A;  2J5U A;  1KOR A;  1WRG A;  2R44 A;  2J58 A;  1LT9 A;  1QLE D;  2E76 C;  2D2C C;  4PD4 I;  3H1J D;  1NTK E;  1LT9 C;  3UIA A;  4RJT A;  1BSN A;  2W6J H;  2QE7 H;  1YG8 A;  1RY3 A;  3CLQ A;  3TNU B;  4L6W A;  2RH0 A;  3MUD A;  2O01 N;  2XND H;  1DIP A; 
#chains in the Genus database with same CATH homology
 2J5I I;  4JVT A;  3RL0 g;  1KTM A;  3AEB C;  4KPK A;  4ELW A;  2WSE J;  2J5G D;  4ZU2 A;  3LKE A;  4IZC A;  2G3A A;  1NZY A;  3TT6 A;  3FF6 A;  2J5I B;  4H44 C;  3TRR A;  3AE7 C;  3P2L A;  3QMJ A;  4JJT A;  4JCT A;  3V5E A;  3TLF A;  3Q5S A;  1TU3 F;  1FC6 A;  4H13 B;  3STA A;  4FN8 A;  3H0U A;  4OGQ D;  5C9G A;  3LAO A;  1NZY B;  2A7S A;  3SFD C;  3M6N A;  3PE8 A;  4U0G A;  2Q2X A;  4FN7 A;  2E75 C;  4HC8 A;  3QYR A;  2FXP A;  5FIF A;  3H02 A;  1EF9 A;  4HNK A;  1PIX A;  2D3T A;  3T3W A;  4EML A;  5CTB A;  4B3H A;  2BEQ D;  3AE3 C;  5E0N X;  3MOY A;  3Q7H A;  2J5G A;  1K04 A;  1RQV A;  3D70 A;  2E76 D;  3AEG C;  2D2C D;  2BZR A;  2IEX A;  3HLN 1;  3KTG A;  5DUF A;  4JSB A;  3S9O A;  5DTP A;  2BEZ F;  4MOU A;  3IAV A;  3G9R A;  1ZOY C;  4ELS A;  4JFC A;  1K32 A;  1TYF A;  2VSU A;  3H0Q A;  5MGB A;  4WCZ A;  4EMM A;  1N6F A;  2VSU C;  3MT6 A;  4OGQ C;  2DUB A;  2YJG A;  4FJW D;  3ABV C;  4B3J A;  4Y28 J;  4G2R A;  5KLI C;  2PG8 A;  5DKP A;  1UIX A;  2QIW A;  4H13 D;  1UYS A;  2VRE A;  5E0S H;  4I4Z A;  1JXZ A;  4LK5 A;  3U9R B;  2ZL4 A;  4B3I A;  3Q0J A;  1XNV A;  3H25 A;  2WPV B;  4FNB A;  5DTW A;  2JP3 A;  3MFM A;  3BPT A;  3AE1 C;  3HP0 A;  1YQ4 C;  4KWB A;  3RRV A;  5IKL B;  3VIV A;  2ZL3 A;  1N6D A;  2FZS A;  3BF0 A;  1UYR A;  3R4Y A;  5CTC A;  3NJD A;  3PEA A;  3IB9 A;  3AED C;  1WMK A;  1FDI A;  2MKV A;  3K50 A;  3GF3 A;  4RYF H;  2OQQ A;  3AEC C;  4KD6 A;  1TG6 A;  2YMK A;  2JO1 A;  4I52 A;  4GHN A;  4JYL A;  3AE8 C;  4H13 C;  3R0O A;  3T89 A;  3M6M A;  3SLL A;  5KJP A;  1OW6 A;  1XNW A;  3MYB A;  3OC7 A;  3AEA C;  2Q35 A;  1X0U A;  4YTP C;  4JYJ A;  3P85 A;  4PV1 B;  5C90 A;  4YLH A;  5KKZ C;  2FYN C;  4OMR A;  4F47 A;  1N6E A;  2ZT9 B;  3K8X A;  4I7Z B;  4KNP A;  1GMJ A;  3AE5 C;  3T8A A;  3U9T B;  2G8Y A;  4U1A A;  3GF7 A;  1VRG A;  3O6Q A;  2VSU E;  2WSF J;  2QJY C;  1HZD A;  2DEO A;  3D71 A;  3ZWB A;  2CE3 A;  3HE2 A;  4U19 A;  4RYF A;  4ZDD A;  3QXI A;  5HUQ A;  1AJY A;  3TZ3 A;  1PJH A;  3R9T A;  5JBW A;  1PL5 A;  4K3W A;  2NZ2 A;  2NP9 A;  1KMI Z;  1VF5 B;  1EF8 A;  4TT3 H;  4WZ8 B;  4R4M A;  1ZP0 C;  3KTH A;  3OT6 A;  3ZWA A;  5DZK H;  5FUS A;  1UIY A;  2A81 A;  4ZDE A;  2K9Y A;  4IZD A;  2VX2 A;  2FBM A;  3HIN A;  3LW5 J;  1VL2 A;  3HRX A;  3AEE C;  3AE4 C;  5INF A;  2VSS E;  3U9S B;  5JBX A;  3R6H A;  3H0S A;  4WYO B;  1NGM B;  3RST A;  1NYH A;  3IN6 A;  4PV1 D;  2ZT9 D;  3G64 A;  3JU1 A;  4I42 A;  3TVW A;  4U0H A;  1WZ8 A;  3EWK A;  1HF9 A;  2QQ3 A;  4MXI A;  3C8V A;  5DL1 A;  3GMA A;  4GDO A;  1OD2 A;  3R9S A;  1OMI A;  3RK3 E;  5G1S A;  4JCR A;  5DZK A;  2CBY A;  4FB8 A;  1WDK A;  3Q3D A;  3TT7 A;  1OW8 A;  2VSU F;  1Q90 D;  1DCI A;  2PBP A;  4NAR A;  4YXD C;  4NEK A;  2E74 D;  4IZB A;  4ASI A;  3I47 A;  3GLM A;  3D6Y A;  1VF5 D;  2VSS A;  4JOT A;  2V7Q J;  4L8K A;  3DJA A;  1RJM A;  1EXJ A;  1RQU A;  3ST9 A;  3PGQ A;  4K29 A;  1YG6 A;  1WDM A;  1DD4 A;  3IBB A;  4JWV A;  4H0L C;  2O01 J;  3AE9 C;  3AE6 C;  4PV1 C;  3WG5 A;  2ZT9 C;  2FW2 A;  3AE2 C;  4KT0 J;  1MKM A;  4I7Z C;  4JCQ A;  5DU8 A;  3OME A;  2WTB A;  3B71 A;  3NJB A;  4H0L B;  1DD3 A;  2PPY A;  3Q5R A;  5DU6 A;  4XFJ A;  4JCS A;  2ZQR A;  3ZWC A;  3KTJ A;  3RSI A;  5G1Q A;  2P10 A;  3Q1T A;  1ON3 A;  3QRE A;  2F9I A;  3Q5P A;  1PV3 A;  2GTR A;  4IL6 X;  1FC7 A;  4HDT A;  2E74 C;  3FDU A;  4ELX A;  2W3P A;  5KDR A;  1U57 A;  1VF5 C;  4U18 A;  3N6R B;  3Q0G A;  5ING A;  3T97 B;  3GKB A;  5INI A;  3QK8 A;  1SZO A;  3ZW9 A;  3IAO A;  3H0J A;  4K2N A;  2F9I B;  2UZF A;  2X24 A;  1Y9B A;  2E74 B;  2WSC J;  3Q1M A;  3BPP A;  3T88 A;  4H44 B;  4RKU J;  3KTI A;  4Z0M A;  3V5I A;  5KDR B;  3T8B A;  4EMP A;  4ZDF A;  1FDO A;  1KIL E;  1ZME C;  1KQG B;  3TVU A;  2F6Q A;  4DI1 A;  4U7J A;  2ZL2 A;  5DU4 A;  4ZDC A;  1KQF B;  1O8U A;  1W2X A;  4Z1M H;  3QWD A;  2E75 B;  1RJN A;  4OG1 A;  5G1R A;  2H88 C;  4H0L D;  1ZRT E;  4OLQ A;  1HJ0 A;  1OW7 A;  1FC9 A;  3BEZ A;  3TV5 A;  1OD4 A;  3H81 A;  2ZL0 A;  3D6Z A;  3DOR A;  4QIJ A;  2QSI A;  4ZDB A;  2C8T A;  1EY3 A;  3PZK A;  2X58 A;  1FCF A;  1WDL A;  1Q51 A;  4Q0G A;  4FZW A;  3L3S A;  4QII A;  1K05 A;  2QJK C;  1K39 A;  3SFE C;  4FZW C;  5DUC A;  1UYV A;  2F9Y A;  4RCN A;  2H89 C;  1JB0 J;  3ZW8 A;  3ISA A;  3QXZ A;  1IK7 A;  1EXI A;  1MJ3 A;  4H44 D;  3TDC A;  4GM2 A;  4OGQ B;  1HNO A;  3FGA D;  2FBW C;  2F6I A;  5M1B A;  3QKA A;  3KTK A;  1SG4 A;  1YQ3 C;  2IDB A;  1J7X A;  2HW5 A;  3P5M A;  1DUB A;  2ZQQ A;  2F9Y B;  5L8R J;  2QJP C;  1XO6 A;  2J5S A;  2YIU C;  3KQF A;  4MI2 A;  1XX4 A;  2J5U A;  1Y7O A;  1KOR A;  3AEF C;  1R8E A;  1ON9 A;  1XNY A;  2E76 C;  1Q52 A;  2E75 D;  4R4L A;  2D2C C;  3Q2Y A;  4NNQ A;  2A7K A;  2WQY C;  2EJ5 A;  4U0G H;  2Q34 A;  4Q1I A;  3R9Q A;  4FND A;  1UYT A;  2J5I A;  4QFE A;  1YG8 A;  1S5L X;  4J2U A;  1S1C X;  4L6W A;  2E76 B;  2VSS F;  2D2C B;  5E0S A;  3SWX A;  1HNU A;  1DIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...