3GMAA

Glutaconyl-coa decarboxylase a subunit from clostridium symbiosum co-crystallized with glutaryl-coa
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
584
structure length
558
Chain Sequence
MYSMPGYFQNMPTIGKELVNPNPENEQEIKAVESDIHESIKKALDAGITSEEKLNERGQLSAMQRINALIDPGTWCPLNSLFNPENNKFGTTNIVNGLGRVDGKWVYIVASDNKKMAGAWVPGQAENLIRCSDAAKMMHLPLIYLLNCSGVEFPNQDKVYPNRRGGGTPFFRNSELNQLGIPVIVGIYGTNPAGGGYHSISPTILIAHQDANMAVGGAAAEQIIAAQIENSKLKVPAPGSVPIHYDETGFFREVYQNDLGVIDGIKKYISYLPAYNLEFFRVDTPKAPQLPAEDLYSIIPMNQKRPYDIYEVIARLFDNSEFSEYKKGYGPEMVTGLAKVNGLLVGVIANVQGLLMNYPEYKQNSVGIGGKLYRQGLIKMNEFVTLCARDRIPLIWLQDTTGIDVGDEAEKAELLGLGQSLIYSIENSKLPSLEITIRKASAAAHYVLGGPQGNNTNVFSIGTGACEYYVMPGETAANAMYSRKQPIIGKMNDMIQMYTDKSRPKYCTEKGMVDEIVDMTEVRPYIQAFTEAAYQNPQSICPMHQMLTPRSTREFETF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title An asymmetric model for Na+-translocating glutaconyl-CoA decarboxylases
pubmed doi rcsb
source organism Clostridium symbiosum
molecule tags Lyase
molecule keywords Glutaconyl-CoA decarboxylase subunit A
total genus 210
structure length 558
sequence length 584
chains with identical sequence B
ec nomenclature ec 4.1.1.70: Transferred entry: 7.2.4.5.
pdb deposition date 2009-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01039 Carboxyl_trans Carboxyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.680 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Helix bin 3gmaA01
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3gmaA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3gmaA03
1Y7OA 4JVTA 3MOYA 2ZQQA 4I4ZA 1K32A 4ZDBA 2VREA 3I47A 1XNWA 4Q0GA 5FIFA 4JCQA 2HW5A 2DEOA 4FB8A 4IZCA 4JCTA 3M6MA 3TRRA 3N6RB 2QQ3A 2IEXA 3Q0JA 5E0SA 3M6NA 5E0NX 5DUCA 1FC6A 3QWDA 1K39A 3DORA 4JFCA 2ZL4A 4GHNA 3ZWBA 4EMMA 2Q2XA 1UYRA 5DL1A 1XX4A 3HE2A 3T3WA 4FNBA 4ELWA 4U18A 3GMAA 3NJBA 3BF0A 3RSTA 2VSUA 2WTBA 3KTJA 4B3IA 3LAOA 1MJ3A 5MGBA 4OLQA 5KDRA 4K29A 4WCZA 4KD6A 2F9YB 3HINA 5G1RA 3V5EA 2PG8A 4ZDDA 2NP9A 2A81A 3Q0GA 4YLHA 1WDLA 3T89A 4GM2A 2DUBA 3GF7A 3ZW9A 2VSSE 4ASIA 4B3HA 3FDUA 5JBXA 1UYSA 4HNKA 4KNPA 3PZKA 3JU1A 3RRVA 4QFEA 4IZDA 3PGQA 3TVUA 3TZ3A 1PJHA 3R9SA 4FJWD 4JWVA 4LK5A 4RYFH 3QREA 3TV5A 2VSUE 2ZQRA 3G64A 5FUSA 2F9IA 3R6HA 5JBWA 3L3SA 4K2NA 3U9SB 3HRXA 2W3PA 1W2XA 5DU8A 4I52A 1O8UA 3Q1TA 4WYOB 1VRGA 3P2LA 2J5II 3ZWCA 1SG4A 1WDKA 1RJNA 1YG6A 3SWXA 5DTPA 4MXIA 5INGA 2FBMA 1HZDA 2J5GA 2VSSF 3K8XA 3KTKA 1Q52A 3ZWAA 3FF6A 1RJMA 2CBYA 2ZL0A 4DI1A 4FZWA 1OD4A 5DKPA 5C9GA 4KPKA 4Q1IA 4K3WA 1FCFA 5IKLB 2EJ5A 3MYBA 1WDMA 4JCSA 3HP0A 4ZDCA 2A7KA 3QXIA 5G1SA 2C8TA 4ZDFA 1N6EA 4FZWC 3R0OA 2FW2A 1UYVA 4G2RA 4OG1A 2VSUC 3MT6A 3P5MA 2CE3A 3KTGA 3NJDA 3Q7HA 2J5SA 4EMLA 1EF8A 4IZBA 3ST9A 3H02A 4HC8A 1YG8A 2X58A 3IBBA 3K50A 1N6DA 3GKBA 5INFA 1EF9A 3TT6A 1ON9A 1OD2A 1EY3A 1J7XA 3U9RB 2A7SA 4OMRA 5E0SH 5KDRB 4ELXA 3IAVA 4JYLA 5INIA 3H81A 4ZDEA 3WG5A 4KWBA 5DTWA 1DCIA 4U0GA 1FC7A 2BZRA 2J5IB 3TT7A 3U9TB 4WZ8B 5CTCA 4JCRA 1TYFA 4RYFA 4FNDA 3T88A 1PIXA 3STAA 3QMJA 5DUFA 3R9TA 2F9IB 4U0HA 4JYJA 3RSIA 3KTIA 4MI2A 5G1QA 5KJPA 4FN7A 4JOTA 4JSBA 1XNVA 4QIIA 1HNUA 3H0QA 3VIVA 2GTRA 2J5GD 2D3TA 3OC7A 3PE8A 3GF3A 4QIJA 1NZYA 4F47A 4I42A 1UIYA 4FN8A 2X24A 3DJAA 1WZ8A 3H0SA 3MFMA 4NEKA 1FC9A 3V5IA 1X0UA 2Q35A 1JXZA 1N6FA 3R9QA 1UYTA 3QXZA 4L8KA 3KTHA 3TDCA 5DZKH 2ZL3A 3T8AA 4EMPA 3QYRA 3T8BA 2Q34A 3QK8A 4NNQA 1SZOA 2F6QA 5DZKA 3GLMA 1XO6A 2FZSA 3SLLA 3LKEA 1ON3A 1XNYA 3BPPA 3KQFA 3P85A 3ISAA 2J5IA 2VX2A 3TVWA 4L6WA 4U0GH 4RCNA 4ELSA 3OT6A 4B3JA 2UZFA 4U1AA 4U19A 4JJTA 5DU6A 2ZL2A 4Z0MA 3BEZA 5C90A 1NZYB 2VSSA 1HNOA 3H0UA 2PBPA 4ZU2A 3PEAA 2PPYA 5DU4A 3TLFA 3H0JA 4MOUA 2F9YA 1Q51A 3HLN1 3OMEA 5CTBA 3ZW8A 3QKAA 3IB9A 1DUBA 2VSUF 1TG6A 2F6IA
chains in the Genus database with same CATH superfamily
3MOYA 1RF0C 3LW5H 1LTJA 1QVGO 1FU1A 1IFIA 4ZDBA 1EDIA 2YXQB 4D6TG 1VQ9P 3MD0A 4H13C 4L75A 2Q7CA 4Q0GA 1G2CB 1FJPA 4Y99C 1NTMG 2WSCJ 2QM7A 4NPEA 1S5LH 3P8CE 3M6MA 1KB9D 2B87A 2P1JA 1SFCC 1YJNP 3FWNA 5E0SA 5GTIE 3M6NA 1BGYG 1L4AA 1LTIC 1SQXJ 3V4WA 1SQQJ 2FYUD 1FC6A 3QWDA 1MZ9A 1LT9B 4JFCA 1Z56A 1NO4A 5KAIE 1NTZG 4I7ZC 1NKZB 4EMMA 3H6PA 1N73A 3CC2P 1EDLA 1UYRA 2WPQA 2JO1A 3L72D 3L74D 3RK3E 2I1KA 3CL3D 3H1JG 3B5ND 3BF0A 1LTAC 1KB9E 3S4RA 3B5NA 2R32A 1OVUA 3NTNA 1S1CX 2P58A 4H13D 1L0LK 5AW6B 1NU1J 1K05A 3HTKB 5MGBA 4OLQA 1KILA 2I1JA 4WCZA 5APYA 3RL0D 4WY4D 3V5EA 1EZVE 3TYYA 2PG8A 1VDFA 2B87B 3RL0B 2VRSA 3Q5PA 1WDLA 1J1DB 2DUBA 1Q81Q 3CPWO 5JBXA 2OYOA 1UYSA 5H2FE 4I6MC 1GTWA 1RE3C 3NMDA 2M0BA 3PZKA 3L72G 1LTBC 1DD4A 1KD1Q 1AJYA 4IZDA 3PGQA 1S3JA 3TVUA 3R9SA 4FJWD 2CPSA 3PLNA 3HD7D 2FFDA 1BE3D 3H1HJ 4LLHA 3R6HA 2W90A 1ZN5A 2NPSD 2Y0EA 3JCUE 3Q1TA 1KFNA 2QM8A 1H8AA 2Y9ZA 2J5II 1AQTA 1IK9A 1PP9E 3VOPA 5INGA 2E74B 3L72E 2FBMA 3K5BA 3PHLA 2J5GA 3KTKA 1T2KC 1MFZA 1OVVA 4TT3H 3FXEA 4GOFA 4J2UA 1N8RQ 1QEXA 2HPCB 2C0WA 2O01H 3Q1MA 2NRGA 4FZWA 5C9GA 3CXHI 3QWOC 1KQSO 5AVVB 3A0HE 4LGDE 3L73J 4K3WA 3CI9A 1H89A 5CHXA 2N1TD 5TJHA 3II6A 1SP4A 1PGOA 1KYOH 1Q82Q 1DIPA 3H1LE 2FY8A 2WZ7A 2C9LY 1OXZA 3D6YA 2C8TA 5DJUB 3BCCJ 1Y9BA 4ZDFA 1GU5A 2ZYAA 2QJYB 3AE4C 3R0OA 3H25A 1YTZI 4OG1A 3KHUA 4HYTB 3E1RA 3U59A 2QA4P 2CE3A 2E5YA 4H44B 3CCSP 4W7ZA 3SSUA 1QL1A 5KAIH 2FXOA 4EMLA 3V2RA 4HC8A 4U3FE 2Y0DA 2XV5A 1PP9G 2GUVA 2WPRA 5AW7B 5E79E 1PPJE 2KNCA 1N6DA 4PV1D 3GKBA 1EF9A 2YKQA 1TU3F 1BE3J 3ABVC 1EY3A 3C1LA 1NHLA 1KN7A 3U9RB 2KS1A 3S9OA 2AEFA 1ZLLA 5AVTB 1PGJA 3SWKA 3H1IG 1FZEA 2Z5IA 4WWIA 5K5GB 4ZDEA 2QJPB 4KWBA 2FFDC 2NZ2A 1M8OB 5AW9B 2Y0CA 2BZRA 4WVZA 1RQUA 2ITAA 2QEXP 2D2CD 5GTIH 1K73Q 2H43A 2WSEH 3RBXA 4JCRA 1TYFA 1M90Q 5DUFA 1IFMA 5BVZA 1ZW0A 3G9RA 1OWAA 2IPPA 4JYJA 1DEBA 1PFIA 1NTMD 2IFMA 4JYCA 1L4AD 1PGQA 1UIIA 1CI6B 5KJPA 1RF1B 4FN7A 2MJZA 1S9KD 2FYNC 1GD2E 1HNUA 5EFWB 3O6QB 1JY3N 3VMXA 1VF5D 3E1IA 2KZIA 3PE8A 1NTME 1VF5B 3GHGC 4ASVA 2W6AA 4FN8A 2E75C 3MFMA 1X0UA 3H32B 3BRTB 1CW5A 4YPCA 3WUVA 1J2JB 2W8ZA 1N6FA 4LC1A 2WVRA 3QXZA 5DZKH 2JP3A 1K8AQ 4EMPA 1YBKA 2WSCH 5E79H 3QYRA 2Q34A 3QK8A 4NNQA 2F6QA 3SFDC 2ZYGA 3D6ZA 3M0DC 2OYIB 2ZT9D 1NTZJ 3BPPA 1PV3A 3CWBG 3KQFA 2ZT9B 1LP1B 2Q3EA 2IYOA 5AVQB 2J5IA 3TVWA 3IF4A 3L70D 3OT6A 1R8EA 1PZQA 4UB8E 4U19A 1AVOA 3VMZA 1M1JB 1DEEG 3RK2D 5AVRB 4H0LC 3BEZA 3AE9C 1NZYB 3HD7A 2VSSA 1FAVA 1SQVJ 2PBPA 2E75D 3PEAA 1NU1G 2RN0A 4PJ0H 1KYOE 1GU4A 1MUUA 3LIEA 1JNMA 4GDOA 1Q2NA 1YJ9P 5AW4B 2D2CC 1SQXE 3HE5A 1Q51A 4YXDC 4H13B 3IFMA 4Y99B 5CTBA 1VQ8P 2B89A 3T97B 1ZXGA 3CCMP 3RK3B 3ZW8A 1GZLA 1FOSE 1LT1A 1DUBA 1TG6A 3Q5SA 3V6IA 1OW6A 4I4ZA 1NTKE 2N1TC 1HUCA 4U3FJ 2VREA 1LTTC 2O01J 1XNWA 5KLVE 3G71P 1KYOD 3AE8C 1JTHB 1SQQG 3OJAB 5APQA 1AQ5A 4IZCA 1IFJA 4BRYB 4IL6E 3Q0JA 3F5HA 4YXWH 1RF0A 1G1IA 4BXLA 5E0NX 3NXSA 2Z4EA 3KZIH 3AEGC 1YQ3C 4GOEA 3AE6C 1NU1D 2M3BA 1S4XA 1K39A 3DORA 2K3RA 2JDIH 2E74D 2CK3H 3CXHE 1KILC 1BGYJ 4IL6X 1LWUB 2JWDA 2PAJA 3HE2A 4ELWA 3L70J 2ZYDA 3RL0C 4OGQD 2M5AA 2M5AB 1JY2O 4B3IA 3M0DA 3KZIE 3I5CA 3MZWB 1GK6A 5GTHH 3JCUH 4K29A 3M0AA 1JEKA 1N73B 4ZDDA 2NP9A 3GW6A 2ZVNB 2FXMA 5KLIC 2A81A 4YLHA 4KT0J 3VTPC 5KJ7C 1AVYA 2OYHC 3FDUA 1PPJG 2WPVB 2L5GB 4HNKA 2PP6A 1FJKA 3JU1A 1HWTC 1KFMA 3RRVA 3PRJA 1SLQA 5L8RJ 3HTKA 3VP9A 1MFTA 4IFFA 1RE4A 4U7JA 4RYFH 4PV1B 3TV5A 2VSUE 3G64A 3KYQA 1BDCA 2F9IA 3L3SA 1SQPE 1S2EA 3HRXA 2A45I 5DU8A 2WMMA 4I52A 2XNXA 1LTSC 1NTZD 1ZRTD 1O8UA 2N1TA 1H0TA 3B71A 2WTYA 1YG6A 3A2AA 1L0NK 4MXIA 1BSHA 2IZ1A 3KXDA 3TNUA 1HZDA 4DJGA 2VSSF 3TGUD 4ZNCA 2ZL0A 4DI1A 1PP9D 2FBWC 4HDTA 2QJYC 3L71E 4TLFA 2A45G 1EXIA 2O1JA 2K9JA 1URQA 1BCCE 4H44C 1DX7A 2WWWA 3CC4P 1WDMA 1R5LA 1NU1K 3FWLA 3HP0A 4ZDCA 3BPTA 2V7QJ 2HFED 4HH2A 3L75E 3C8VA 3QXIA 5G1SA 1BE3E 1N6EA 1L0ND 2FYUG 4OGQC 2JJLA 4G2RA 1FZBA 3L4FA 1RH5B 3W67A 1VQOP 2P10A 1NTZK 2H8PD 3Q7HA 2W6BA 1EF8A 1YG8A 3RK2C 3AE3C 1NGMB 1IO4A 1P84E 1KILE 3IBBA 4DT0A 4W80A 1FZFA 2AEMA 3BVHA 4KHXA 2QIWA 5KLVK 1YJWP 1E5WA 3ZDMA 1ON9A 2RKLA 1URQB 2AEJA 1EZVG 5KKZC 1J7XA 2A7SA 2JWAA 3MIWA 1HTLC 3OAKA 4K3AA 1Y8AA 2OGUA 2AXCA 2E76B 1VQNP 5KAFE 2J5UA 2LR2A 3TDKA 4JPZB 3IN6A 2I8DA 3MHVA 5DTWA 3CWBJ 4D6TJ 4B86A 4U0GA 1JY2N 2WT7A 1SQXK 3L71G 2WT7B 2J5IB 1VQ6P 2OTLP 1U57A 2YMYA 1K9MQ 1OIPA 5CTCA 2FYUK 5C39A 2K9YA 2A06G 1RF1C 1SQBJ 2N9BA 2KOGA 2LXCB 1VQKP 4RYFA 3HUSB 3HUSA 4FNDA 2O3JA 3STAA 3R9TA 5CCHD 3CWBD 3C9IA 1M57D 1VF5C 2ZXXA 3H32A 2BCCE 2XKMA 1NTKJ 1BGYD 3L70G 2NPSC 1Q90D 2E75B 2N9YB 1L0LJ 1W5CE 3KTIA 4L76A 4UB6E 4MI2A 5APWA 1USEA 5AW8B 1JM0A 4HJGH 2OTKE 4QIIA 1FDIA 1KILD 3H0QA 1PL5A 2HG5D 1FC2C 1KB9I 2D3TA 4WY4A 1SFCA 2POHA 2XZRA 5APXA 4MN4C 2K88A 4C7NB 1SFCD 4F47A 2K37A 1T2KD 1LJ2A 1YIJP 3WU2H 4NEKA 3V5IA 5CJ4A 4EI2A 2OYIC 4Z1MH 2ZT9C 1EZVD 3PH0A 1UYTA 1JY3P 2DW3A 1NTMK 4RJTA 3H1JD 4L8KA 3HD7B 2XNDH 1T8ZA 3T8AA 4BRYA 1IJDB 4H0LB 3USSA 3LW5J 1LTJB 2H89C 2YO2A 4C46A 1ON3A 3A0HH 1XNYA 3MUDA 2KUBA 2HR3A 3H1JE 3P85A 3ISAA 1HJ0A 3T97A 2VX2A 1U7JA 4L6WA 3VMAA 4WBAA 4B3JA 1IFNA 1EXJA 4ZKUA 1U7MA 4Z0MA 3A3YB 5C90A 4M3LA 5B5EH 5DJTB 3HE4A 1L4AB 2PPYA 1N7SC 2JR8A 1RE3A 1SQQK 2XDJA 4MOUA 1NKNA 1FE6A 2OARA 1A02J 3U1AA 2FKWB 2WPSA 2ZFCA 1RF1A 1FOSF 4L74A 1OX3A 3P7KA 2LXBA 3VYIA 3W68A 3Q2YA 2VSUF 5CJ0A 3H1LJ 1M1JA 1Y7OA 1W2EA 2ZQQA 4RKUJ 3A5TA 3CCJP 4H44D 1EDJA 3H1ID 3Q5RA 3RBZA 3P32A 2DEOA 1EC5A 3R4YA 4FB8A 3BCCD 4EDFA 3L71D 2GA1A 4WB4A 3QH9A 3HRNA 1J1EB 2P67A 2YKPA 3L37A 4ZMDA 2QSIA 1SQBD 2PGDA 5DUCA 2IFNA 1JCDA 3L75G 2Y9YA 3A0BE 1BCCJ 3L73D 2OYIA 2ZL4A 2R3CA 3H1IE 1PPJD 1HGZA 1X9VA 1KQLA 5HUQA 4PJ0E 2BEQD 1NWQA 3CCLP 3T3WA 1FZCB 1FZCA 3CCQP 2JEEA 3RSTA 2VSUA 2WTBA 3KTJA 3B5NB 5KJ7A 1ZR4A 2KIKA 1SQVG 3H1IJ 5AVXB 5CCGD 3H1HG 1PGPA 4GT1A 5KDRA 2P7JA 2ZJSE 2E43A 2IBZD 4CPGA 1SQPJ 1NYHA 1SFCB 3Q0GA 3GF7A 3ZW9A 2VSSE 3H1KD 1X22A 4EIJA 1LP1A 4DOJA 1R5SA 3SFEC 2E5TA 3M9HA 4QFEA 4QMAA 4I7ZB 2ZVOB 1HH0A 1SQBK 3V2PA 4LK5A 5CCHC 2YIUB 1SQBE 1ZRTE 3QREA 3V2NA 2ZQRA 1NTKG 3F89A 5AW1B 5JBWA 3U9SB 3S1KA 2W3PA 1GMJA 1MKMA 3L74G 2QJKC 3CC7P 2LKMA 1L2PA 3CMAP 3V2QA 1VRGA 1URQD 3P2LA 3ZWCA 1WDKA 2MKVA 2R5DA 3SWXA 1RE4C 1VQ4P 3MTUE 3L72J 3N4XA 2HODB 4HB1A 3FF6A 1RJMA 1SQVD 2GUSA 3CCEP 1JY2P 3CMEP 1M7LA 1L0LE 3LIDA 3M06A 4KPKA 1JCCA 1N86A 1FCFA 5CBNA 5IKLB 2GM4A 2KSJA 4NARA 3JC22 3L36A 2A7KA 3M91A 2Q6QA 5BU5A 3Q3DA 1W2BO 1NTMJ 3TSIA 3BCCE 1UYVA 4PD4D 1VPCA 2VSUC 3MT6A 2BCCG 3P5MA 3KTGA 3NJDA 1URQC 1SS1A 1YYCA 2PFXA 2B9BA 2J5SA 3H02A 3KDPB 1NTKD 3L75J 2IBZG 2AXTE 4N6JA 1BCCG 4C7RA 2E74C 2X58A 2E76C 1FDOA 3K50A 3H1LD 2R3SA 5INFA 1NOHA 4O9BA 3IR9A 4W7YA 3BCCG 1QL2A 1JTHA 3H1JJ 3IAOA 5AW5B 2KS1B 1X79B 2KI7B 5E0SH 4IFDK 1KC8Q 1SVFA 1XTGB 3OA7A 4ELXA 3H1LG 4JYLA 3HUSC 3WG5A 3O8ZA 3VP8A 4H0LD 1YQ4C 5CCHA 2Q3IA 1DCIA 1FC7A 1M1KQ 3TT7A 1VQ7P 4WZ8B 3WMM0 3OW2O 2M8RA 3B4SA 2IYPA 5AVZB 1LWUA 1JMBA 4EOTA 3I55P 3AE2C 1YHQP 3VN0A 1NAYA 3AE5C 4D6TE 3QMJA 3H1HD 2F9IB 3EQ2A 5B5EE 3CXHH 1FS0E 2BEZF 2RH0A 3RSIA 3H1KJ 4ASWA 4N78D 1FDMA 5G1QA 4U3FD 4NPFX 4JOTA 4JSBA 1XTCC 2GTRA 1SQXD 3O6QA 2A06E 3GF3A 1L0NG 1NZYA 1FZAA 2WSFJ 4I42A 4DZOA 1SQPG 2NPSA 3CCUP 2X24A 2KLVA 3L75D 2PRRA 4EYYQ 1M56D 2RMZA 2Q35A 4GKGA 5CCGC 2YXRB 1JXZA 4NPDA 1IFDA 4WY4C 3R9QA 1KQGB 1SQQE 2YNYA 2V7QH 3KTHA 1Y47A 1Q86Q 1OFCX 2ZL3A 1JO5A 4RO0A 2KK7A 3T8BA 3KQGA 2AXTH 1NAFA 1GDTA 1XO6A 1N7SA 3LKEA 1G1JA 4BWNA 1CI6A 2WSSH 4R4LA 4AQRD 3M9QA 3RGUA 4U0GH 3TF5A 2FYNB 4JQ0D 4RCNA 4ELSA 1YI2P 3BASA 2QRXA 4GIFA 3AE1C 4JJTA 5DU6A 1P84I 4IL6H 3BRVB 3H0UA 3B8EB 3V5BA 4RESB 3SWFA 2OYHA 4ZU2A 5DU4A 3GG2A 1AFOA 3G4SP 2QE7H 2FYUE 3MUDC 4AYCA 2IBZI 1G2CA 2FXPA 2JKVA 3PTZA 1YTZT 1LTGC 4I2LC 2KB7P 4JYBA 1KILB 1LWUC 2C9NY 1P84D 1HJBA 2SPZA 3L70E 3IB9A 2HODA 2F6IA 4PD4I 2ZXEB 4JVTA 2M3EA 2H7HA 2UWJE 3WUTA 3AE7C 1S5LE 1K32A 3I47A 1KORA 5FIFA 4JCQA 2V4HA 3H1HE 2HW5A 1VQMP 3A7OA 4JCTA 1GL2D 1N73C 1RHZB 3G6EP 3TRRA 5CBOA 3N6RB 2J58A 1M1JC 2QQ3A 2IEXA 1GL2B 3MGNA 5KLIB 2OQQA 4AUWA 1SQPD 2W83C 5APSA 5KTBA 1FZCC 2WSEJ 1A02F 1SQVE 1H88A 5KJ7D 3B5NC 1L0LD 4GHNA 1D7MA 1NH4A 2D2CB 3ZWBA 2E76D 2Q2XA 1YITP 5DL1A 1XX4A 4PV1C 3RK3C 2O1KA 1VQ5P 4HKZH 4R4MA 4FNBA 4U18A 2IDBA 1NU1E 3GMAA 1ZOYC 3NJBA 1LGHB 1T6AA 3LAOA 1JY3O 1LT9C 1SQQD 2FYUJ 2QG4A 2N1TB 1ZP0C 1MJ3A 1Q7YQ 1KV4A 3CCVP 1OW7A 4GODA 3M9BA 4Y28J 2P2UA 1P84H 4KD6A 2F9YB 2KZJA 3HINA 2W6JH 5G1RA 3L71J 1MV8A 1USDA 2YIUC 4XA4A 3T89A 4GM2A 1S9KE 4ASIA 1VL2A 4B3HA 3PJSK 4N78E 3SWYA 4KNPA 2K9JB 2QJKB 4OH8B 2FYZA 2KYVA 1NTZE 3I56P 3TZ3A 2KLUA 1PJHA 1HGVA 3RL0g 4JWVA 4N3YB 4PD4H 1J1DC 5FUSA 1L0LG 5TISE 4K2NA 3AEBC 3H1KG 2G3AA 1NJIQ 1W2XA 2B88A 4ZKPA 1JUNA 2QVAA 1ZV8A 1BCCD 4IFMA 4WYOB 3P8MC 1DD3A 1QGKB 1SG4A 4D6TD 1RJNA 2BCCJ 3CLQA 5DTPA 1KYOI 3L73G 1IFPA 3K8XA 1Q52A 2WSFH 3ZWAA 2KP8A 1JOCA 3TGUG 3CX5E 5B66H 2CBYA 1HF9A 1EQ7A 3EFGA 1OD4A 5DKPA 4IOIH 5KLVJ 1GW4A 3H1KE 3ITKA 4Q1IA 4XE5B 2OYHB 3E7KA 1BDDA 2L91A 3BATA 2XU6A 1L0NE 4I1LA 2YO3A 2EJ5A 1BE3G 3MYBA 3A0BH 5APVA 5GTHE 3AECC 1KQFB 1S72P 4A7PA 2Q1KA 4JCSA 5KLVD 4DCKA 1KTMA 3HE4B 2HYNA 1JMMA 2CPBA 3EFFK 1N7LA 5BU8B 1SQPK 4FZWC 1KMIZ 3FGAD 5AVYB 1PP9J 3MP7B 3TK1A 2FW2A 2O01N 5APUA 3L74E 1K04A 1OVRA 3TGUJ 1KZUB 1X0TA 1BGYE 1AA0A 1LT9A 2BCCD 5AW3B 1L0NJ 1CZQA 2Q5UA 4IZBA 3ST9A 1QX8A 2IZ0A 3D70A 1JB0J 1LNQA 3UIAA 2K1AA 3G3ZA 4OWFA 2R44A 4YTPC 2HLOA 3TT6A 3P8CD 1GW3A 3PP5A 2NPSB 3D71A 1OZHA 1OD2A 1NTKK 2ZAEB 5H2FH 4OMRA 3AEEC 5KDRB 2R5BA 4KJMA 3CX5D 1QLED 3WU2E 1DH3A 3IAVA 3FXDA 5INIA 5AVSB 3H81A 1OMIA 2G8YA 2A45H 3CX5I 2HPCA 4L73A 2YMKA 4OGQB 1GK4A 3U9TB 1WT6A 2WQYC 5AVUB 1HVVA 2J59M 2OTJP 2W27A 3N7NA 1EDKA 3RK2B 1UIXA 2QJPC 3T88A 3KPEA 2FFDB 1GL2A 1PIXA 1SQVK 2E42A 5B66E 5KLVG 3CX5H 3FX0A 1E79H 1T3JA 1LTJC 4U0HA 1IC2A 1HBWA 4JBZA 4JF7A 3VMYA 4UB8H 1QVFO 5KKZB 3TGUE 1XNVA 3HE5B 5CCGA 3VIVA 3RK3D 2J5GD 1IK7A 3OC7A 4WY4B 1RQVA 4QIJA 1X8YA 2Z5HA 2KNCB 4C7NA 2IX7C 5TISH 1L4AC 1UIYA 3AEAC 4PD4E 1N7SB 1WRGA 3L35A 3CWBE 3DJAA 1WZ8A 3H0SA 3U1CA 1FZGA 1N7SD 1FC9A 1NVOA 1CSBA 4UB6H 3CCRP 2H88C 1OW8A 1T3UA 1KB9H 5APTA 4XFJA 1H0TB 3TDCA 3GHGB 3GHGA 1EZVI 1FBMA 3CD6P 2C0XA 2Q9IA 1IZNB 3NFQA 1SZOA 5DZKA 3GLMA 2FZSA 3SLLA 1N2DC 5AW2B 2YKOA 2BASA 3L73E 5M1BA 5AW0B 2UZFA 4U1AA 2A06D 3JSVC 2ZL2A 1RY3A 4OVNF 3WUUA 1AV1A 1J1EC 3L74J 3V4QA 1ZR2A 3AEFC 2KSEA 1HNOA 3EWKA 5KAFH 3AEDC 3TLFA 2KXPB 3H0JA 1SQBG 5AVWB 1VQPP 2F9YA 2WITA 2YJGA 3HLN1 3R2PA 3OMEA 3CXHD 1BSNA 4K35A 4U3FG 1ZMEC 3TNUB 2IBZE 1WMKA 3QKAA 1SQXG 5CMZA 3HD7C 1VQLP 1S5LX 1GL2C
chains in the Genus database with same CATH topology
1OW6A 1Y7OA 4JVTA 3MOYA 2ZQQA 4RKUJ 3AE7C 4I4ZA 1K32A 4ZDBA 2VREA 4H44D 3I47A 1KORA 2O01J 4H13C 1XNWA 3Q5RA 4Q0GA 5FIFA 4JCQA 3AE8C 2HW5A 2DEOA 2WSCJ 3R4YA 4FB8A 4IZCA 4JCTA 3M6MA 3TRRA 3N6RB 2QQ3A 2IEXA 2OQQA 3Q0JA 5E0SA 2WSEJ 3M6NA 5E0NX 2QSIA 5DUCA 1FC6A 3AEGC 3QWDA 1YQ3C 3AE6C 1K39A 3DORA 4JFCA 2ZL4A 4GHNA 3ZWBA 2D2CB 2E74D 4I7ZC 4EMMA 2E76D 2Q2XA 1UYRA 5DL1A 5HUQA 4IL6X 1XX4A 4PV1C 2JO1A 2BEQD 3HE2A 4R4MA 3T3WA 3RK3E 4FNBA 4ELWA 4U18A 2IDBA 3GMAA 1ZOYC 3BF0A 3NJBA 3RSTA 2VSUA 2WTBA 3KTJA 4OGQD 4B3IA 3LAOA 1S1CX 4H13D 1ZP0C 1MJ3A 1K05A 5MGBA 4OLQA 1OW7A 4Y28J 4K29A 5KDRA 4WCZA 4KD6A 2F9YB 3HINA 5G1RA 3V5EA 2PG8A 4ZDDA 2NP9A 1NYHA 2YIUC 5KLIC 2A81A 3Q5PA 3Q0GA 4YLHA 1WDLA 4KT0J 3T89A 4GM2A 2DUBA 3GF7A 3ZW9A 2VSSE 4ASIA 1VL2A 3FDUA 4B3HA 5JBXA 2WPVB 1UYSA 4HNKA 4KNPA 3PZKA 3SFEC 3JU1A 1DD4A 3RRVA 1AJYA 4QFEA 4IZDA 3PGQA 3TVUA 3TZ3A 1PJHA 3R9SA 4FJWD 4I7ZB 5L8RJ 3RL0g 4JWVA 4LK5A 4U7JA 1ZRTE 4PV1B 3QREA 4RYFH 3TV5A 2VSUE 2ZQRA 3G64A 5FUSA 2F9IA 3R6HA 5JBWA 3L3SA 4K2NA 3AEBC 3U9SB 2G3AA 3HRXA 2W3PA 1W2XA 5DU8A 1GMJA 4I52A 1MKMA 2QJKC 1O8UA 3Q1TA 4WYOB 1VRGA 3P2LA 2J5II 1DD3A 3ZWCA 1SG4A 3B71A 1WDKA 1RJNA 2MKVA 1YG6A 3SWXA 5DTPA 4MXIA 5INGA 2E74B 2FBMA 1HZDA 2J5GA 2VSSF 3K8XA 3KTKA 1Q52A 3ZWAA 4TT3H 3FF6A 1RJMA 2CBYA 2ZL0A 4J2UA 1HF9A 4DI1A 2FBWC 3Q1MA 4FZWA 1OD4A 4HDTA 2QJYC 5DKPA 5C9GA 4KPKA 4Q1IA 4K3WA 1FCFA 1EXIA 5IKLB 2EJ5A 3MYBA 4H44C 3AECC 1WDMA 4NARA 1KQFB 1DIPA 4JCSA 3HP0A 4ZDCA 3BPTA 2V7QJ 2A7KA 3C8VA 1KTMA 3Q3DA 3D6YA 3QXIA 2C8TA 5G1SA 1Y9BA 4ZDFA 1N6EA 4FZWC 1KMIZ 3AE4C 3FGAD 3R0OA 2FW2A 3H25A 4OGQC 1UYVA 4G2RA 4OG1A 2VSUC 3MT6A 1K04A 3P5MA 2CE3A 3KTGA 3NJDA 4H44B 2P10A 3Q7HA 2J5SA 4EMLA 1EF8A 4IZBA 3ST9A 3H02A 4HC8A 1YG8A 3AE3C 1NGMB 3D70A 1JB0J 2E74C 2X58A 2E76C 1KILE 1FDOA 3IBBA 3K50A 1N6DA 4PV1D 4YTPC 3GKBA 5INFA 1EF9A 3TT6A 2QIWA 3D71A 1TU3F 1ON9A 1OD2A 3ABVC 1EY3A 5KKZC 1J7XA 3IAOA 3U9RB 2A7SA 3S9OA 4OMRA 3AEEC 5E0SH 5KDRB 2E76B 4ELXA 2J5UA 3IAVA 4JYLA 5INIA 3H81A 1OMIA 3IN6A 4ZDEA 3WG5A 2G8YA 4H0LD 1YQ4C 4KWBA 5DTWA 2NZ2A 1DCIA 4U0GA 1FC7A 2BZRA 2YMKA 2J5IB 4OGQB 1U57A 1RQUA 3TT7A 3U9TB 4WZ8B 5CTCA 2WQYC 2D2CD 2K9YA 4JCRA 1TYFA 3AE2C 4RYFA 4FNDA 1UIXA 2QJPC 3T88A 3AE5C 1PIXA 3STAA 3QMJA 5DUFA 3R9TA 2F9IB 3G9RA 1VF5C 4U0HA 2BEZF 4JYJA 3RSIA 1Q90D 2E75B 3KTIA 4MI2A 5G1QA 5KJPA 4FN7A 4JOTA 4JSBA 1XNVA 2FYNC 4QIIA 1HNUA 1FDIA 3H0QA 1PL5A 3VIVA 2GTRA 2J5GD 1IK7A 3O6QA 2D3TA 3OC7A 1VF5D 1RQVA 3PE8A 3GF3A 4QIJA 1VF5B 1NZYA 4F47A 2WSFJ 4I42A 1UIYA 3AEAC 4FN8A 2X24A 3DJAA 2E75C 1WZ8A 3H0SA 3MFMA 4NEKA 1FC9A 3V5IA 1X0UA 2Q35A 1JXZA 4Z1MH 2ZT9C 2H88C 1OW8A 1N6FA 3R9QA 4XFJA 1UYTA 3QXZA 1KQGB 4L8KA 3KTHA 3TDCA 5DZKH 2ZL3A 3T8AA 2JP3A 4EMPA 4H0LB 3QYRA 3T8BA 3LW5J 2Q34A 3QK8A 4NNQA 1SZOA 2F6QA 3SFDC 3D6ZA 5DZKA 2ZT9D 3GLMA 1XO6A 2FZSA 3SLLA 2H89C 3LKEA 1ON3A 1XNYA 3BPPA 1PV3A 3KQFA 2ZT9B 3P85A 3ISAA 1HJ0A 4R4LA 2J5IA 2VX2A 3TVWA 4L6WA 4U0GH 4RCNA 4ELSA 3OT6A 5M1BA 3AE1C 1R8EA 4B3JA 1EXJA 2UZFA 4U1AA 4U19A 4JJTA 5DU6A 2ZL2A 4Z0MA 4H0LC 3BEZA 5C90A 3AE9C 1NZYB 3AEFC 2VSSA 1HNOA 3H0UA 2PBPA 2E75D 4ZU2A 3EWKA 3PEAA 2PPYA 5DU4A 3AEDC 3TLFA 2FXPA 4GDOA 3H0JA 4MOUA 2D2CC 2F9YA 1Q51A 2YJGA 4YXDC 3HLN1 4H13B 3OMEA 5CTBA 3T97B 1ZMEC 3ZW8A 1WMKA 3QKAA 1S5LX 3IB9A 3Q2YA 1DUBA 2VSUF 1TG6A 2F6IA 3Q5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y7O A;  4JVT A;  3MOY A;  2ZQQ A;  4I4Z A;  1K32 A;  4ZDB A;  2VRE A;  3I47 A;  1XNW A;  4Q0G A;  5FIF A;  4JCQ A;  2HW5 A;  2DEO A;  4FB8 A;  4IZC A;  4JCT A;  3M6M A;  3TRR A;  3N6R B;  2QQ3 A;  2IEX A;  3Q0J A;  5E0S A;  3M6N A;  5E0N X;  5DUC A;  1FC6 A;  3QWD A;  1K39 A;  3DOR A;  4JFC A;  2ZL4 A;  4GHN A;  3ZWB A;  4EMM A;  2Q2X A;  1UYR A;  5DL1 A;  1XX4 A;  3HE2 A;  3T3W A;  4FNB A;  4ELW A;  4U18 A;  3GMA A;  3NJB A;  3BF0 A;  3RST A;  2VSU A;  2WTB A;  3KTJ A;  4B3I A;  3LAO A;  1MJ3 A;  5MGB A;  4OLQ A;  5KDR A;  4K29 A;  4WCZ A;  4KD6 A;  2F9Y B;  3HIN A;  5G1R A;  3V5E A;  2PG8 A;  4ZDD A;  2NP9 A;  2A81 A;  3Q0G A;  4YLH A;  1WDL A;  3T89 A;  4GM2 A;  2DUB A;  3GF7 A;  3ZW9 A;  2VSS E;  4ASI A;  4B3H A;  3FDU A;  5JBX A;  1UYS A;  4HNK A;  4KNP A;  3PZK A;  3JU1 A;  3RRV A;  4QFE A;  4IZD A;  3PGQ A;  3TVU A;  3TZ3 A;  1PJH A;  3R9S A;  4FJW D;  4JWV A;  4LK5 A;  4RYF H;  3QRE A;  3TV5 A;  2VSU E;  2ZQR A;  3G64 A;  5FUS A;  2F9I A;  3R6H A;  5JBW A;  3L3S A;  4K2N A;  3U9S B;  3HRX A;  2W3P A;  1W2X A;  5DU8 A;  4I52 A;  1O8U A;  3Q1T A;  4WYO B;  1VRG A;  3P2L A;  2J5I I;  3ZWC A;  1SG4 A;  1WDK A;  1RJN A;  1YG6 A;  3SWX A;  5DTP A;  4MXI A;  5ING A;  2FBM A;  1HZD A;  2J5G A;  2VSS F;  3K8X A;  3KTK A;  1Q52 A;  3ZWA A;  3FF6 A;  1RJM A;  2CBY A;  2ZL0 A;  4DI1 A;  4FZW A;  1OD4 A;  5DKP A;  5C9G A;  4KPK A;  4Q1I A;  4K3W A;  1FCF A;  5IKL B;  2EJ5 A;  3MYB A;  1WDM A;  4JCS A;  3HP0 A;  4ZDC A;  2A7K A;  3QXI A;  5G1S A;  2C8T A;  4ZDF A;  1N6E A;  4FZW C;  3R0O A;  2FW2 A;  1UYV A;  4G2R A;  4OG1 A;  2VSU C;  3MT6 A;  3P5M A;  2CE3 A;  3KTG A;  3NJD A;  3Q7H A;  2J5S A;  4EML A;  1EF8 A;  4IZB A;  3ST9 A;  3H02 A;  4HC8 A;  1YG8 A;  2X58 A;  3IBB A;  3K50 A;  1N6D A;  3GKB A;  5INF A;  1EF9 A;  3TT6 A;  1ON9 A;  1OD2 A;  1EY3 A;  1J7X A;  3U9R B;  2A7S A;  4OMR A;  5E0S H;  5KDR B;  4ELX A;  3IAV A;  4JYL A;  5INI A;  3H81 A;  4ZDE A;  3WG5 A;  4KWB A;  5DTW A;  1DCI A;  4U0G A;  1FC7 A;  2BZR A;  2J5I B;  3TT7 A;  3U9T B;  4WZ8 B;  5CTC A;  4JCR A;  1TYF A;  4RYF A;  4FND A;  3T88 A;  1PIX A;  3STA A;  3QMJ A;  5DUF A;  3R9T A;  2F9I B;  4U0H A;  4JYJ A;  3RSI A;  3KTI A;  4MI2 A;  5G1Q A;  5KJP A;  4FN7 A;  4JOT A;  4JSB A;  1XNV A;  4QII A;  1HNU A;  3H0Q A;  3VIV A;  2GTR A;  2J5G D;  2D3T A;  3OC7 A;  3PE8 A;  3GF3 A;  4QIJ A;  1NZY A;  4F47 A;  4I42 A;  1UIY A;  4FN8 A;  2X24 A;  3DJA A;  1WZ8 A;  3H0S A;  3MFM A;  4NEK A;  1FC9 A;  3V5I A;  1X0U A;  2Q35 A;  1JXZ A;  1N6F A;  3R9Q A;  1UYT A;  3QXZ A;  4L8K A;  3KTH A;  3TDC A;  5DZK H;  2ZL3 A;  3T8A A;  4EMP A;  3QYR A;  3T8B A;  2Q34 A;  3QK8 A;  4NNQ A;  1SZO A;  2F6Q A;  5DZK A;  3GLM A;  1XO6 A;  2FZS A;  3SLL A;  3LKE A;  1ON3 A;  1XNY A;  3BPP A;  3KQF A;  3P85 A;  3ISA A;  2J5I A;  2VX2 A;  3TVW A;  4L6W A;  4U0G H;  4RCN A;  4ELS A;  3OT6 A;  4B3J A;  2UZF A;  4U1A A;  4U19 A;  4JJT A;  5DU6 A;  2ZL2 A;  4Z0M A;  3BEZ A;  5C90 A;  1NZY B;  2VSS A;  1HNO A;  3H0U A;  2PBP A;  4ZU2 A;  3PEA A;  2PPY A;  5DU4 A;  3TLF A;  3H0J A;  4MOU A;  2F9Y A;  1Q51 A;  3HLN 1;  3OME A;  5CTB A;  3ZW8 A;  3QKA A;  3IB9 A;  1DUB A;  2VSU F;  1TG6 A;  2F6I A; 
#chains in the Genus database with same CATH topology
 3MOY A;  1RF0 C;  3LW5 H;  1LTJ A;  1QVG O;  1FU1 A;  1IFI A;  4ZDB A;  1EDI A;  2YXQ B;  4D6T G;  1VQ9 P;  3MD0 A;  4H13 C;  4L75 A;  2Q7C A;  4Q0G A;  1G2C B;  1FJP A;  4Y99 C;  1NTM G;  2WSC J;  2QM7 A;  4NPE A;  1S5L H;  3P8C E;  3M6M A;  1KB9 D;  2B87 A;  2P1J A;  1SFC C;  1YJN P;  3FWN A;  5E0S A;  5GTI E;  3M6N A;  1BGY G;  1L4A A;  1LTI C;  1SQX J;  3V4W A;  1SQQ J;  2FYU D;  1FC6 A;  3QWD A;  1MZ9 A;  1LT9 B;  4JFC A;  1Z56 A;  1NO4 A;  5KAI E;  1NTZ G;  4I7Z C;  1NKZ B;  4EMM A;  3H6P A;  1N73 A;  3CC2 P;  1EDL A;  1UYR A;  2WPQ A;  2JO1 A;  3L72 D;  3L74 D;  3RK3 E;  2I1K A;  3CL3 D;  3H1J G;  3B5N D;  3BF0 A;  1LTA C;  1KB9 E;  3S4R A;  3B5N A;  2R32 A;  1OVU A;  3NTN A;  1S1C X;  2P58 A;  4H13 D;  1L0L K;  5AW6 B;  1NU1 J;  1K05 A;  3HTK B;  5MGB A;  4OLQ A;  1KIL A;  2I1J A;  4WCZ A;  5APY A;  3RL0 D;  4WY4 D;  3V5E A;  1EZV E;  3TYY A;  2PG8 A;  1VDF A;  2B87 B;  3RL0 B;  2VRS A;  3Q5P A;  1WDL A;  1J1D B;  2DUB A;  1Q81 Q;  3CPW O;  5JBX A;  2OYO A;  1UYS A;  5H2F E;  4I6M C;  1GTW A;  1RE3 C;  3NMD A;  2M0B A;  3PZK A;  3L72 G;  1LTB C;  1DD4 A;  1KD1 Q;  1AJY A;  4IZD A;  3PGQ A;  1S3J A;  3TVU A;  3R9S A;  4FJW D;  2CPS A;  3PLN A;  3HD7 D;  2FFD A;  1BE3 D;  3H1H J;  4LLH A;  3R6H A;  2W90 A;  1ZN5 A;  2NPS D;  2Y0E A;  3JCU E;  3Q1T A;  1KFN A;  2QM8 A;  1H8A A;  2Y9Z A;  2J5I I;  1AQT A;  1IK9 A;  1PP9 E;  3VOP A;  5ING A;  2E74 B;  3L72 E;  2FBM A;  3K5B A;  3PHL A;  2J5G A;  3KTK A;  1T2K C;  1MFZ A;  1OVV A;  4TT3 H;  3FXE A;  4GOF A;  4J2U A;  1N8R Q;  1QEX A;  2HPC B;  2C0W A;  2O01 H;  3Q1M A;  2NRG A;  4FZW A;  5C9G A;  3CXH I;  3QWO C;  1KQS O;  5AVV B;  3A0H E;  4LGD E;  3L73 J;  4K3W A;  3CI9 A;  1H89 A;  5CHX A;  2N1T D;  5TJH A;  3II6 A;  1SP4 A;  1PGO A;  1KYO H;  1Q82 Q;  1DIP A;  3H1L E;  2FY8 A;  2WZ7 A;  2C9L Y;  1OXZ A;  3D6Y A;  2C8T A;  5DJU B;  3BCC J;  1Y9B A;  4ZDF A;  1GU5 A;  2ZYA A;  2QJY B;  3AE4 C;  3R0O A;  3H25 A;  1YTZ I;  4OG1 A;  3KHU A;  4HYT B;  3E1R A;  3U59 A;  2QA4 P;  2CE3 A;  2E5Y A;  4H44 B;  3CCS P;  4W7Z A;  3SSU A;  1QL1 A;  5KAI H;  2FXO A;  4EML A;  3V2R A;  4HC8 A;  4U3F E;  2Y0D A;  2XV5 A;  1PP9 G;  2GUV A;  2WPR A;  5AW7 B;  5E79 E;  1PPJ E;  2KNC A;  1N6D A;  4PV1 D;  3GKB A;  1EF9 A;  2YKQ A;  1TU3 F;  1BE3 J;  3ABV C;  1EY3 A;  3C1L A;  1NHL A;  1KN7 A;  3U9R B;  2KS1 A;  3S9O A;  2AEF A;  1ZLL A;  5AVT B;  1PGJ A;  3SWK A;  3H1I G;  1FZE A;  2Z5I A;  4WWI A;  5K5G B;  4ZDE A;  2QJP B;  4KWB A;  2FFD C;  2NZ2 A;  1M8O B;  5AW9 B;  2Y0C A;  2BZR A;  4WVZ A;  1RQU A;  2ITA A;  2QEX P;  2D2C D;  5GTI H;  1K73 Q;  2H43 A;  2WSE H;  3RBX A;  4JCR A;  1TYF A;  1M90 Q;  5DUF A;  1IFM A;  5BVZ A;  1ZW0 A;  3G9R A;  1OWA A;  2IPP A;  4JYJ A;  1DEB A;  1PFI A;  1NTM D;  2IFM A;  4JYC A;  1L4A D;  1PGQ A;  1UII A;  1CI6 B;  5KJP A;  1RF1 B;  4FN7 A;  2MJZ A;  1S9K D;  2FYN C;  1GD2 E;  1HNU A;  5EFW B;  3O6Q B;  1JY3 N;  3VMX A;  1VF5 D;  3E1I A;  2KZI A;  3PE8 A;  1NTM E;  1VF5 B;  3GHG C;  4ASV A;  2W6A A;  4FN8 A;  2E75 C;  3MFM A;  1X0U A;  3H32 B;  3BRT B;  1CW5 A;  4YPC A;  3WUV A;  1J2J B;  2W8Z A;  1N6F A;  4LC1 A;  2WVR A;  3QXZ A;  5DZK H;  2JP3 A;  1K8A Q;  4EMP A;  1YBK A;  2WSC H;  5E79 H;  3QYR A;  2Q34 A;  3QK8 A;  4NNQ A;  2F6Q A;  3SFD C;  2ZYG A;  3D6Z A;  3M0D C;  2OYI B;  2ZT9 D;  1NTZ J;  3BPP A;  1PV3 A;  3CWB G;  3KQF A;  2ZT9 B;  1LP1 B;  2Q3E A;  2IYO A;  5AVQ B;  2J5I A;  3TVW A;  3IF4 A;  3L70 D;  3OT6 A;  1R8E A;  1PZQ A;  4UB8 E;  4U19 A;  1AVO A;  3VMZ A;  1M1J B;  1DEE G;  3RK2 D;  5AVR B;  4H0L C;  3BEZ A;  3AE9 C;  1NZY B;  3HD7 A;  2VSS A;  1FAV A;  1SQV J;  2PBP A;  2E75 D;  3PEA A;  1NU1 G;  2RN0 A;  4PJ0 H;  1KYO E;  1GU4 A;  1MUU A;  3LIE A;  1JNM A;  4GDO A;  1Q2N A;  1YJ9 P;  5AW4 B;  2D2C C;  1SQX E;  3HE5 A;  1Q51 A;  4YXD C;  4H13 B;  3IFM A;  4Y99 B;  5CTB A;  1VQ8 P;  2B89 A;  3T97 B;  1ZXG A;  3CCM P;  3RK3 B;  3ZW8 A;  1GZL A;  1FOS E;  1LT1 A;  1DUB A;  1TG6 A;  3Q5S A;  3V6I A;  1OW6 A;  4I4Z A;  1NTK E;  2N1T C;  1HUC A;  4U3F J;  2VRE A;  1LTT C;  2O01 J;  1XNW A;  5KLV E;  3G71 P;  1KYO D;  3AE8 C;  1JTH B;  1SQQ G;  3OJA B;  5APQ A;  1AQ5 A;  4IZC A;  1IFJ A;  4BRY B;  4IL6 E;  3Q0J A;  3F5H A;  4YXW H;  1RF0 A;  1G1I A;  4BXL A;  5E0N X;  3NXS A;  2Z4E A;  3KZI H;  3AEG C;  1YQ3 C;  4GOE A;  3AE6 C;  1NU1 D;  2M3B A;  1S4X A;  1K39 A;  3DOR A;  2K3R A;  2JDI H;  2E74 D;  2CK3 H;  3CXH E;  1KIL C;  1BGY J;  4IL6 X;  1LWU B;  2JWD A;  2PAJ A;  3HE2 A;  4ELW A;  3L70 J;  2ZYD A;  3RL0 C;  4OGQ D;  2M5A A;  2M5A B;  1JY2 O;  4B3I A;  3M0D A;  3KZI E;  3I5C A;  3MZW B;  1GK6 A;  5GTH H;  3JCU H;  4K29 A;  3M0A A;  1JEK A;  1N73 B;  4ZDD A;  2NP9 A;  3GW6 A;  2ZVN B;  2FXM A;  5KLI C;  2A81 A;  4YLH A;  4KT0 J;  3VTP C;  5KJ7 C;  1AVY A;  2OYH C;  3FDU A;  1PPJ G;  2WPV B;  2L5G B;  4HNK A;  2PP6 A;  1FJK A;  3JU1 A;  1HWT C;  1KFM A;  3RRV A;  3PRJ A;  1SLQ A;  5L8R J;  3HTK A;  3VP9 A;  1MFT A;  4IFF A;  1RE4 A;  4U7J A;  4RYF H;  4PV1 B;  3TV5 A;  2VSU E;  3G64 A;  3KYQ A;  1BDC A;  2F9I A;  3L3S A;  1SQP E;  1S2E A;  3HRX A;  2A45 I;  5DU8 A;  2WMM A;  4I52 A;  2XNX A;  1LTS C;  1NTZ D;  1ZRT D;  1O8U A;  2N1T A;  1H0T A;  3B71 A;  2WTY A;  1YG6 A;  3A2A A;  1L0N K;  4MXI A;  1BSH A;  2IZ1 A;  3KXD A;  3TNU A;  1HZD A;  4DJG A;  2VSS F;  3TGU D;  4ZNC A;  2ZL0 A;  4DI1 A;  1PP9 D;  2FBW C;  4HDT A;  2QJY C;  3L71 E;  4TLF A;  2A45 G;  1EXI A;  2O1J A;  2K9J A;  1URQ A;  1BCC E;  4H44 C;  1DX7 A;  2WWW A;  3CC4 P;  1WDM A;  1R5L A;  1NU1 K;  3FWL A;  3HP0 A;  4ZDC A;  3BPT A;  2V7Q J;  2HFE D;  4HH2 A;  3L75 E;  3C8V A;  3QXI A;  5G1S A;  1BE3 E;  1N6E A;  1L0N D;  2FYU G;  4OGQ C;  2JJL A;  4G2R A;  1FZB A;  3L4F A;  1RH5 B;  3W67 A;  1VQO P;  2P10 A;  1NTZ K;  2H8P D;  3Q7H A;  2W6B A;  1EF8 A;  1YG8 A;  3RK2 C;  3AE3 C;  1NGM B;  1IO4 A;  1P84 E;  1KIL E;  3IBB A;  4DT0 A;  4W80 A;  1FZF A;  2AEM A;  3BVH A;  4KHX A;  2QIW A;  5KLV K;  1YJW P;  1E5W A;  3ZDM A;  1ON9 A;  2RKL A;  1URQ B;  2AEJ A;  1EZV G;  5KKZ C;  1J7X A;  2A7S A;  2JWA A;  3MIW A;  1HTL C;  3OAK A;  4K3A A;  1Y8A A;  2OGU A;  2AXC A;  2E76 B;  1VQN P;  5KAF E;  2J5U A;  2LR2 A;  3TDK A;  4JPZ B;  3IN6 A;  2I8D A;  3MHV A;  5DTW A;  3CWB J;  4D6T J;  4B86 A;  4U0G A;  1JY2 N;  2WT7 A;  1SQX K;  3L71 G;  2WT7 B;  2J5I B;  1VQ6 P;  2OTL P;  1U57 A;  2YMY A;  1K9M Q;  1OIP A;  5CTC A;  2FYU K;  5C39 A;  2K9Y A;  2A06 G;  1RF1 C;  1SQB J;  2N9B A;  2KOG A;  2LXC B;  1VQK P;  4RYF A;  3HUS B;  3HUS A;  4FND A;  2O3J A;  3STA A;  3R9T A;  5CCH D;  3CWB D;  3C9I A;  1M57 D;  1VF5 C;  2ZXX A;  3H32 A;  2BCC E;  2XKM A;  1NTK J;  1BGY D;  3L70 G;  2NPS C;  1Q90 D;  2E75 B;  2N9Y B;  1L0L J;  1W5C E;  3KTI A;  4L76 A;  4UB6 E;  4MI2 A;  5APW A;  1USE A;  5AW8 B;  1JM0 A;  4HJG H;  2OTK E;  4QII A;  1FDI A;  1KIL D;  3H0Q A;  1PL5 A;  2HG5 D;  1FC2 C;  1KB9 I;  2D3T A;  4WY4 A;  1SFC A;  2POH A;  2XZR A;  5APX A;  4MN4 C;  2K88 A;  4C7N B;  1SFC D;  4F47 A;  2K37 A;  1T2K D;  1LJ2 A;  1YIJ P;  3WU2 H;  4NEK A;  3V5I A;  5CJ4 A;  4EI2 A;  2OYI C;  4Z1M H;  2ZT9 C;  1EZV D;  3PH0 A;  1UYT A;  1JY3 P;  2DW3 A;  1NTM K;  4RJT A;  3H1J D;  4L8K A;  3HD7 B;  2XND H;  1T8Z A;  3T8A A;  4BRY A;  1IJD B;  4H0L B;  3USS A;  3LW5 J;  1LTJ B;  2H89 C;  2YO2 A;  4C46 A;  1ON3 A;  3A0H H;  1XNY A;  3MUD A;  2KUB A;  2HR3 A;  3H1J E;  3P85 A;  3ISA A;  1HJ0 A;  3T97 A;  2VX2 A;  1U7J A;  4L6W A;  3VMA A;  4WBA A;  4B3J A;  1IFN A;  1EXJ A;  4ZKU A;  1U7M A;  4Z0M A;  3A3Y B;  5C90 A;  4M3L A;  5B5E H;  5DJT B;  3HE4 A;  1L4A B;  2PPY A;  1N7S C;  2JR8 A;  1RE3 A;  1SQQ K;  2XDJ A;  4MOU A;  1NKN A;  1FE6 A;  2OAR A;  1A02 J;  3U1A A;  2FKW B;  2WPS A;  2ZFC A;  1RF1 A;  1FOS F;  4L74 A;  1OX3 A;  3P7K A;  2LXB A;  3VYI A;  3W68 A;  3Q2Y A;  2VSU F;  5CJ0 A;  3H1L J;  1M1J A;  1Y7O A;  1W2E A;  2ZQQ A;  4RKU J;  3A5T A;  3CCJ P;  4H44 D;  1EDJ A;  3H1I D;  3Q5R A;  3RBZ A;  3P32 A;  2DEO A;  1EC5 A;  3R4Y A;  4FB8 A;  3BCC D;  4EDF A;  3L71 D;  2GA1 A;  4WB4 A;  3QH9 A;  3HRN A;  1J1E B;  2P67 A;  2YKP A;  3L37 A;  4ZMD A;  2QSI A;  1SQB D;  2PGD A;  5DUC A;  2IFN A;  1JCD A;  3L75 G;  2Y9Y A;  3A0B E;  1BCC J;  3L73 D;  2OYI A;  2ZL4 A;  2R3C A;  3H1I E;  1PPJ D;  1HGZ A;  1X9V A;  1KQL A;  5HUQ A;  4PJ0 E;  2BEQ D;  1NWQ A;  3CCL P;  3T3W A;  1FZC B;  1FZC A;  3CCQ P;  2JEE A;  3RST A;  2VSU A;  2WTB A;  3KTJ A;  3B5N B;  5KJ7 A;  1ZR4 A;  2KIK A;  1SQV G;  3H1I J;  5AVX B;  5CCG D;  3H1H G;  1PGP A;  4GT1 A;  5KDR A;  2P7J A;  2ZJS E;  2E43 A;  2IBZ D;  4CPG A;  1SQP J;  1NYH A;  1SFC B;  3Q0G A;  3GF7 A;  3ZW9 A;  2VSS E;  3H1K D;  1X22 A;  4EIJ A;  1LP1 A;  4DOJ A;  1R5S A;  3SFE C;  2E5T A;  3M9H A;  4QFE A;  4QMA A;  4I7Z B;  2ZVO B;  1HH0 A;  1SQB K;  3V2P A;  4LK5 A;  5CCH C;  2YIU B;  1SQB E;  1ZRT E;  3QRE A;  3V2N A;  2ZQR A;  1NTK G;  3F89 A;  5AW1 B;  5JBW A;  3U9S B;  3S1K A;  2W3P A;  1GMJ A;  1MKM A;  3L74 G;  2QJK C;  3CC7 P;  2LKM A;  1L2P A;  3CMA P;  3V2Q A;  1VRG A;  1URQ D;  3P2L A;  3ZWC A;  1WDK A;  2MKV A;  2R5D A;  3SWX A;  1RE4 C;  1VQ4 P;  3MTU E;  3L72 J;  3N4X A;  2HOD B;  4HB1 A;  3FF6 A;  1RJM A;  1SQV D;  2GUS A;  3CCE P;  1JY2 P;  3CME P;  1M7L A;  1L0L E;  3LID A;  3M06 A;  4KPK A;  1JCC A;  1N86 A;  1FCF A;  5CBN A;  5IKL B;  2GM4 A;  2KSJ A;  4NAR A;  3JC2 2;  3L36 A;  2A7K A;  3M91 A;  2Q6Q A;  5BU5 A;  3Q3D A;  1W2B O;  1NTM J;  3TSI A;  3BCC E;  1UYV A;  4PD4 D;  1VPC A;  2VSU C;  3MT6 A;  2BCC G;  3P5M A;  3KTG A;  3NJD A;  1URQ C;  1SS1 A;  1YYC A;  2PFX A;  2B9B A;  2J5S A;  3H02 A;  3KDP B;  1NTK D;  3L75 J;  2IBZ G;  2AXT E;  4N6J A;  1BCC G;  4C7R A;  2E74 C;  2X58 A;  2E76 C;  1FDO A;  3K50 A;  3H1L D;  2R3S A;  5INF A;  1NOH A;  4O9B A;  3IR9 A;  4W7Y A;  3BCC G;  1QL2 A;  1JTH A;  3H1J J;  3IAO A;  5AW5 B;  2KS1 B;  1X79 B;  2KI7 B;  5E0S H;  4IFD K;  1KC8 Q;  1SVF A;  1XTG B;  3OA7 A;  4ELX A;  3H1L G;  4JYL A;  3HUS C;  3WG5 A;  3O8Z A;  3VP8 A;  4H0L D;  1YQ4 C;  5CCH A;  2Q3I A;  1DCI A;  1FC7 A;  1M1K Q;  3TT7 A;  1VQ7 P;  4WZ8 B;  3WMM 0;  3OW2 O;  2M8R A;  3B4S A;  2IYP A;  5AVZ B;  1LWU A;  1JMB A;  4EOT A;  3I55 P;  3AE2 C;  1YHQ P;  3VN0 A;  1NAY A;  3AE5 C;  4D6T E;  3QMJ A;  3H1H D;  2F9I B;  3EQ2 A;  5B5E E;  3CXH H;  1FS0 E;  2BEZ F;  2RH0 A;  3RSI A;  3H1K J;  4ASW A;  4N78 D;  1FDM A;  5G1Q A;  4U3F D;  4NPF X;  4JOT A;  4JSB A;  1XTC C;  2GTR A;  1SQX D;  3O6Q A;  2A06 E;  3GF3 A;  1L0N G;  1NZY A;  1FZA A;  2WSF J;  4I42 A;  4DZO A;  1SQP G;  2NPS A;  3CCU P;  2X24 A;  2KLV A;  3L75 D;  2PRR A;  4EYY Q;  1M56 D;  2RMZ A;  2Q35 A;  4GKG A;  5CCG C;  2YXR B;  1JXZ A;  4NPD A;  1IFD A;  4WY4 C;  3R9Q A;  1KQG B;  1SQQ E;  2YNY A;  2V7Q H;  3KTH A;  1Y47 A;  1Q86 Q;  1OFC X;  2ZL3 A;  1JO5 A;  4RO0 A;  2KK7 A;  3T8B A;  3KQG A;  2AXT H;  1NAF A;  1GDT A;  1XO6 A;  1N7S A;  3LKE A;  1G1J A;  4BWN A;  1CI6 A;  2WSS H;  4R4L A;  4AQR D;  3M9Q A;  3RGU A;  4U0G H;  3TF5 A;  2FYN B;  4JQ0 D;  4RCN A;  4ELS A;  1YI2 P;  3BAS A;  2QRX A;  4GIF A;  3AE1 C;  4JJT A;  5DU6 A;  1P84 I;  4IL6 H;  3BRV B;  3H0U A;  3B8E B;  3V5B A;  4RES B;  3SWF A;  2OYH A;  4ZU2 A;  5DU4 A;  3GG2 A;  1AFO A;  3G4S P;  2QE7 H;  2FYU E;  3MUD C;  4AYC A;  2IBZ I;  1G2C A;  2FXP A;  2JKV A;  3PTZ A;  1YTZ T;  1LTG C;  4I2L C;  2KB7 P;  4JYB A;  1KIL B;  1LWU C;  2C9N Y;  1P84 D;  1HJB A;  2SPZ A;  3L70 E;  3IB9 A;  2HOD A;  2F6I A;  4PD4 I;  2ZXE B;  4JVT A;  2M3E A;  2H7H A;  2UWJ E;  3WUT A;  3AE7 C;  1S5L E;  1K32 A;  3I47 A;  1KOR A;  5FIF A;  4JCQ A;  2V4H A;  3H1H E;  2HW5 A;  1VQM P;  3A7O A;  4JCT A;  1GL2 D;  1N73 C;  1RHZ B;  3G6E P;  3TRR A;  5CBO A;  3N6R B;  2J58 A;  1M1J C;  2QQ3 A;  2IEX A;  1GL2 B;  3MGN A;  5KLI B;  2OQQ A;  4AUW A;  1SQP D;  2W83 C;  5APS A;  5KTB A;  1FZC C;  2WSE J;  1A02 F;  1SQV E;  1H88 A;  5KJ7 D;  3B5N C;  1L0L D;  4GHN A;  1D7M A;  1NH4 A;  2D2C B;  3ZWB A;  2E76 D;  2Q2X A;  1YIT P;  5DL1 A;  1XX4 A;  4PV1 C;  3RK3 C;  2O1K A;  1VQ5 P;  4HKZ H;  4R4M A;  4FNB A;  4U18 A;  2IDB A;  1NU1 E;  3GMA A;  1ZOY C;  3NJB A;  1LGH B;  1T6A A;  3LAO A;  1JY3 O;  1LT9 C;  1SQQ D;  2FYU J;  2QG4 A;  2N1T B;  1ZP0 C;  1MJ3 A;  1Q7Y Q;  1KV4 A;  3CCV P;  1OW7 A;  4GOD A;  3M9B A;  4Y28 J;  2P2U A;  1P84 H;  4KD6 A;  2F9Y B;  2KZJ A;  3HIN A;  2W6J H;  5G1R A;  3L71 J;  1MV8 A;  1USD A;  2YIU C;  4XA4 A;  3T89 A;  4GM2 A;  1S9K E;  4ASI A;  1VL2 A;  4B3H A;  3PJS K;  4N78 E;  3SWY A;  4KNP A;  2K9J B;  2QJK B;  4OH8 B;  2FYZ A;  2KYV A;  1NTZ E;  3I56 P;  3TZ3 A;  2KLU A;  1PJH A;  1HGV A;  3RL0 g;  4JWV A;  4N3Y B;  4PD4 H;  1J1D C;  5FUS A;  1L0L G;  5TIS E;  4K2N A;  3AEB C;  3H1K G;  2G3A A;  1NJI Q;  1W2X A;  2B88 A;  4ZKP A;  1JUN A;  2QVA A;  1ZV8 A;  1BCC D;  4IFM A;  4WYO B;  3P8M C;  1DD3 A;  1QGK B;  1SG4 A;  4D6T D;  1RJN A;  2BCC J;  3CLQ A;  5DTP A;  1KYO I;  3L73 G;  1IFP A;  3K8X A;  1Q52 A;  2WSF H;  3ZWA A;  2KP8 A;  1JOC A;  3TGU G;  3CX5 E;  5B66 H;  2CBY A;  1HF9 A;  1EQ7 A;  3EFG A;  1OD4 A;  5DKP A;  4IOI H;  5KLV J;  1GW4 A;  3H1K E;  3ITK A;  4Q1I A;  4XE5 B;  2OYH B;  3E7K A;  1BDD A;  2L91 A;  3BAT A;  2XU6 A;  1L0N E;  4I1L A;  2YO3 A;  2EJ5 A;  1BE3 G;  3MYB A;  3A0B H;  5APV A;  5GTH E;  3AEC C;  1KQF B;  1S72 P;  4A7P A;  2Q1K A;  4JCS A;  5KLV D;  4DCK A;  1KTM A;  3HE4 B;  2HYN A;  1JMM A;  2CPB A;  3EFF K;  1N7L A;  5BU8 B;  1SQP K;  4FZW C;  1KMI Z;  3FGA D;  5AVY B;  1PP9 J;  3MP7 B;  3TK1 A;  2FW2 A;  2O01 N;  5APU A;  3L74 E;  1K04 A;  1OVR A;  3TGU J;  1KZU B;  1X0T A;  1BGY E;  1AA0 A;  1LT9 A;  2BCC D;  5AW3 B;  1L0N J;  1CZQ A;  2Q5U A;  4IZB A;  3ST9 A;  1QX8 A;  2IZ0 A;  3D70 A;  1JB0 J;  1LNQ A;  3UIA A;  2K1A A;  3G3Z A;  4OWF A;  2R44 A;  4YTP C;  2HLO A;  3TT6 A;  3P8C D;  1GW3 A;  3PP5 A;  2NPS B;  3D71 A;  1OZH A;  1OD2 A;  1NTK K;  2ZAE B;  5H2F H;  4OMR A;  3AEE C;  5KDR B;  2R5B A;  4KJM A;  3CX5 D;  1QLE D;  3WU2 E;  1DH3 A;  3IAV A;  3FXD A;  5INI A;  5AVS B;  3H81 A;  1OMI A;  2G8Y A;  2A45 H;  3CX5 I;  2HPC A;  4L73 A;  2YMK A;  4OGQ B;  1GK4 A;  3U9T B;  1WT6 A;  2WQY C;  5AVU B;  1HVV A;  2J59 M;  2OTJ P;  2W27 A;  3N7N A;  1EDK A;  3RK2 B;  1UIX A;  2QJP C;  3T88 A;  3KPE A;  2FFD B;  1GL2 A;  1PIX A;  1SQV K;  2E42 A;  5B66 E;  5KLV G;  3CX5 H;  3FX0 A;  1E79 H;  1T3J A;  1LTJ C;  4U0H A;  1IC2 A;  1HBW A;  4JBZ A;  4JF7 A;  3VMY A;  4UB8 H;  1QVF O;  5KKZ B;  3TGU E;  1XNV A;  3HE5 B;  5CCG A;  3VIV A;  3RK3 D;  2J5G D;  1IK7 A;  3OC7 A;  4WY4 B;  1RQV A;  4QIJ A;  1X8Y A;  2Z5H A;  2KNC B;  4C7N A;  2IX7 C;  5TIS H;  1L4A C;  1UIY A;  3AEA C;  4PD4 E;  1N7S B;  1WRG A;  3L35 A;  3CWB E;  3DJA A;  1WZ8 A;  3H0S A;  3U1C A;  1FZG A;  1N7S D;  1FC9 A;  1NVO A;  1CSB A;  4UB6 H;  3CCR P;  2H88 C;  1OW8 A;  1T3U A;  1KB9 H;  5APT A;  4XFJ A;  1H0T B;  3TDC A;  3GHG B;  3GHG A;  1EZV I;  1FBM A;  3CD6 P;  2C0X A;  2Q9I A;  1IZN B;  3NFQ A;  1SZO A;  5DZK A;  3GLM A;  2FZS A;  3SLL A;  1N2D C;  5AW2 B;  2YKO A;  2BAS A;  3L73 E;  5M1B A;  5AW0 B;  2UZF A;  4U1A A;  2A06 D;  3JSV C;  2ZL2 A;  1RY3 A;  4OVN F;  3WUU A;  1AV1 A;  1J1E C;  3L74 J;  3V4Q A;  1ZR2 A;  3AEF C;  2KSE A;  1HNO A;  3EWK A;  5KAF H;  3AED C;  3TLF A;  2KXP B;  3H0J A;  1SQB G;  5AVW B;  1VQP P;  2F9Y A;  2WIT A;  2YJG A;  3HLN 1;  3R2P A;  3OME A;  3CXH D;  1BSN A;  4K35 A;  4U3F G;  1ZME C;  3TNU B;  2IBZ E;  1WMK A;  3QKA A;  1SQX G;  5CMZ A;  3HD7 C;  1VQL P;  1S5L X;  1GL2 C; 
#chains in the Genus database with same CATH homology
 1OW6 A;  1Y7O A;  4JVT A;  3MOY A;  2ZQQ A;  4RKU J;  3AE7 C;  4I4Z A;  1K32 A;  4ZDB A;  2VRE A;  4H44 D;  3I47 A;  1KOR A;  2O01 J;  4H13 C;  1XNW A;  3Q5R A;  4Q0G A;  5FIF A;  4JCQ A;  3AE8 C;  2HW5 A;  2DEO A;  2WSC J;  3R4Y A;  4FB8 A;  4IZC A;  4JCT A;  3M6M A;  3TRR A;  3N6R B;  2QQ3 A;  2IEX A;  2OQQ A;  3Q0J A;  5E0S A;  2WSE J;  3M6N A;  5E0N X;  2QSI A;  5DUC A;  1FC6 A;  3AEG C;  3QWD A;  1YQ3 C;  3AE6 C;  1K39 A;  3DOR A;  4JFC A;  2ZL4 A;  4GHN A;  3ZWB A;  2D2C B;  2E74 D;  4I7Z C;  4EMM A;  2E76 D;  2Q2X A;  1UYR A;  5DL1 A;  5HUQ A;  4IL6 X;  1XX4 A;  4PV1 C;  2JO1 A;  2BEQ D;  3HE2 A;  4R4M A;  3T3W A;  3RK3 E;  4FNB A;  4ELW A;  4U18 A;  2IDB A;  3GMA A;  1ZOY C;  3BF0 A;  3NJB A;  3RST A;  2VSU A;  2WTB A;  3KTJ A;  4OGQ D;  4B3I A;  3LAO A;  1S1C X;  4H13 D;  1ZP0 C;  1MJ3 A;  1K05 A;  5MGB A;  4OLQ A;  1OW7 A;  4Y28 J;  4K29 A;  5KDR A;  4WCZ A;  4KD6 A;  2F9Y B;  3HIN A;  5G1R A;  3V5E A;  2PG8 A;  4ZDD A;  2NP9 A;  1NYH A;  2YIU C;  5KLI C;  2A81 A;  3Q5P A;  3Q0G A;  4YLH A;  1WDL A;  4KT0 J;  3T89 A;  4GM2 A;  2DUB A;  3GF7 A;  3ZW9 A;  2VSS E;  4ASI A;  1VL2 A;  3FDU A;  4B3H A;  5JBX A;  2WPV B;  1UYS A;  4HNK A;  4KNP A;  3PZK A;  3SFE C;  3JU1 A;  1DD4 A;  3RRV A;  1AJY A;  4QFE A;  4IZD A;  3PGQ A;  3TVU A;  3TZ3 A;  1PJH A;  3R9S A;  4FJW D;  4I7Z B;  5L8R J;  3RL0 g;  4JWV A;  4LK5 A;  4U7J A;  1ZRT E;  4PV1 B;  3QRE A;  4RYF H;  3TV5 A;  2VSU E;  2ZQR A;  3G64 A;  5FUS A;  2F9I A;  3R6H A;  5JBW A;  3L3S A;  4K2N A;  3AEB C;  3U9S B;  2G3A A;  3HRX A;  2W3P A;  1W2X A;  5DU8 A;  1GMJ A;  4I52 A;  1MKM A;  2QJK C;  1O8U A;  3Q1T A;  4WYO B;  1VRG A;  3P2L A;  2J5I I;  1DD3 A;  3ZWC A;  1SG4 A;  3B71 A;  1WDK A;  1RJN A;  2MKV A;  1YG6 A;  3SWX A;  5DTP A;  4MXI A;  5ING A;  2E74 B;  2FBM A;  1HZD A;  2J5G A;  2VSS F;  3K8X A;  3KTK A;  1Q52 A;  3ZWA A;  4TT3 H;  3FF6 A;  1RJM A;  2CBY A;  2ZL0 A;  4J2U A;  1HF9 A;  4DI1 A;  2FBW C;  3Q1M A;  4FZW A;  1OD4 A;  4HDT A;  2QJY C;  5DKP A;  5C9G A;  4KPK A;  4Q1I A;  4K3W A;  1FCF A;  1EXI A;  5IKL B;  2EJ5 A;  3MYB A;  4H44 C;  3AEC C;  1WDM A;  4NAR A;  1KQF B;  1DIP A;  4JCS A;  3HP0 A;  4ZDC A;  3BPT A;  2V7Q J;  2A7K A;  3C8V A;  1KTM A;  3Q3D A;  3D6Y A;  3QXI A;  2C8T A;  5G1S A;  1Y9B A;  4ZDF A;  1N6E A;  4FZW C;  1KMI Z;  3AE4 C;  3FGA D;  3R0O A;  2FW2 A;  3H25 A;  4OGQ C;  1UYV A;  4G2R A;  4OG1 A;  2VSU C;  3MT6 A;  1K04 A;  3P5M A;  2CE3 A;  3KTG A;  3NJD A;  4H44 B;  2P10 A;  3Q7H A;  2J5S A;  4EML A;  1EF8 A;  4IZB A;  3ST9 A;  3H02 A;  4HC8 A;  1YG8 A;  3AE3 C;  1NGM B;  3D70 A;  1JB0 J;  2E74 C;  2X58 A;  2E76 C;  1KIL E;  1FDO A;  3IBB A;  3K50 A;  1N6D A;  4PV1 D;  4YTP C;  3GKB A;  5INF A;  1EF9 A;  3TT6 A;  2QIW A;  3D71 A;  1TU3 F;  1ON9 A;  1OD2 A;  3ABV C;  1EY3 A;  5KKZ C;  1J7X A;  3IAO A;  3U9R B;  2A7S A;  3S9O A;  4OMR A;  3AEE C;  5E0S H;  5KDR B;  2E76 B;  4ELX A;  2J5U A;  3IAV A;  4JYL A;  5INI A;  3H81 A;  1OMI A;  3IN6 A;  4ZDE A;  3WG5 A;  2G8Y A;  4H0L D;  1YQ4 C;  4KWB A;  5DTW A;  2NZ2 A;  1DCI A;  4U0G A;  1FC7 A;  2BZR A;  2YMK A;  2J5I B;  4OGQ B;  1U57 A;  1RQU A;  3TT7 A;  3U9T B;  4WZ8 B;  5CTC A;  2WQY C;  2D2C D;  2K9Y A;  4JCR A;  1TYF A;  3AE2 C;  4RYF A;  4FND A;  1UIX A;  2QJP C;  3T88 A;  3AE5 C;  1PIX A;  3STA A;  3QMJ A;  5DUF A;  3R9T A;  2F9I B;  3G9R A;  1VF5 C;  4U0H A;  2BEZ F;  4JYJ A;  3RSI A;  1Q90 D;  2E75 B;  3KTI A;  4MI2 A;  5G1Q A;  5KJP A;  4FN7 A;  4JOT A;  4JSB A;  1XNV A;  2FYN C;  4QII A;  1HNU A;  1FDI A;  3H0Q A;  1PL5 A;  3VIV A;  2GTR A;  2J5G D;  1IK7 A;  3O6Q A;  2D3T A;  3OC7 A;  1VF5 D;  1RQV A;  3PE8 A;  3GF3 A;  4QIJ A;  1VF5 B;  1NZY A;  4F47 A;  2WSF J;  4I42 A;  1UIY A;  3AEA C;  4FN8 A;  2X24 A;  3DJA A;  2E75 C;  1WZ8 A;  3H0S A;  3MFM A;  4NEK A;  1FC9 A;  3V5I A;  1X0U A;  2Q35 A;  1JXZ A;  4Z1M H;  2ZT9 C;  2H88 C;  1OW8 A;  1N6F A;  3R9Q A;  4XFJ A;  1UYT A;  3QXZ A;  1KQG B;  4L8K A;  3KTH A;  3TDC A;  5DZK H;  2ZL3 A;  3T8A A;  2JP3 A;  4EMP A;  4H0L B;  3QYR A;  3T8B A;  3LW5 J;  2Q34 A;  3QK8 A;  4NNQ A;  1SZO A;  2F6Q A;  3SFD C;  3D6Z A;  5DZK A;  2ZT9 D;  3GLM A;  1XO6 A;  2FZS A;  3SLL A;  2H89 C;  3LKE A;  1ON3 A;  1XNY A;  3BPP A;  1PV3 A;  3KQF A;  2ZT9 B;  3P85 A;  3ISA A;  1HJ0 A;  4R4L A;  2J5I A;  2VX2 A;  3TVW A;  4L6W A;  4U0G H;  4RCN A;  4ELS A;  3OT6 A;  5M1B A;  3AE1 C;  1R8E A;  4B3J A;  1EXJ A;  2UZF A;  4U1A A;  4U19 A;  4JJT A;  5DU6 A;  2ZL2 A;  4Z0M A;  4H0L C;  3BEZ A;  5C90 A;  3AE9 C;  1NZY B;  3AEF C;  2VSS A;  1HNO A;  3H0U A;  2PBP A;  2E75 D;  4ZU2 A;  3EWK A;  3PEA A;  2PPY A;  5DU4 A;  3AED C;  3TLF A;  2FXP A;  4GDO A;  3H0J A;  4MOU A;  2D2C C;  2F9Y A;  1Q51 A;  2YJG A;  4YXD C;  3HLN 1;  4H13 B;  3OME A;  5CTB A;  3T97 B;  1ZME C;  3ZW8 A;  1WMK A;  3QKA A;  1S5L X;  3IB9 A;  3Q2Y A;  1DUB A;  2VSU F;  1TG6 A;  2F6I A;  3Q5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...