3GMAA

Glutaconyl-coa decarboxylase a subunit from clostridium symbiosum co-crystallized with glutaryl-coa
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
584
structure length
558
Chain Sequence
MYSMPGYFQNMPTIGKELVNPNPENEQEIKAVESDIHESIKKALDAGITSEEKLNERGQLSAMQRINALIDPGTWCPLNSLFNPENNKFGTTNIVNGLGRVDGKWVYIVASDNKKMAGAWVPGQAENLIRCSDAAKMMHLPLIYLLNCSGVEFPNQDKVYPNRRGGGTPFFRNSELNQLGIPVIVGIYGTNPAGGGYHSISPTILIAHQDANMAVGGAAAEQIIAAQIENSKLKVPAPGSVPIHYDETGFFREVYQNDLGVIDGIKKYISYLPAYNLEFFRVDTPKAPQLPAEDLYSIIPMNQKRPYDIYEVIARLFDNSEFSEYKKGYGPEMVTGLAKVNGLLVGVIANVQGLLMNYPEYKQNSVGIGGKLYRQGLIKMNEFVTLCARDRIPLIWLQDTTGIDVGDEAEKAELLGLGQSLIYSIENSKLPSLEITIRKASAAAHYVLGGPQGNNTNVFSIGTGACEYYVMPGETAANAMYSRKQPIIGKMNDMIQMYTDKSRPKYCTEKGMVDEIVDMTEVRPYIQAFTEAAYQNPQSICPMHQMLTPRSTREFETF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutaconyl-CoA decarboxylase subunit A
publication title An asymmetric model for Na+-translocating glutaconyl-CoA decarboxylases
pubmed doi rcsb
source organism Clostridium symbiosum
molecule tags Lyase
total genus 210
structure length 558
sequence length 584
chains with identical sequence B
ec nomenclature ec 4.1.1.70: Transferred entry: 7.2.4.5.
pdb deposition date 2009-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01039 Carboxyl_trans Carboxyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.680 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Helix bin 3gmaA01
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3gmaA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3gmaA03
4U19A 1DUBA 5E0SA 1WDLA 3Q7HA 1EY3A 4K29A 4EMMA 2C8TA 5C90A 3IB9A 5DU4A 2J5IB 5DUCA 3T8AA 3V5EA 3FF6A 3TVWA 3BF0A 1WDMA 2J5GD 3HE2A 5CTCA 4YLHA 3ISAA 4JCQA 3DJAA 4GM2A 4FN8A 5DU6A 4EMLA 2DUBA 3I47A 2Q35A 3STAA 2GTRA 4JCSA 3KTGA 3T3WA 2PBPA 3KTKA 3P2LA 5FUSA 3BEZA 2ZL3A 3GF3A 2Q2XA 4RYFA 2UZFA 3R9QA 1XNYA 4U0HA 2ZQQA 2F9YB 1XNVA 4IZBA 3ZWCA 3U9RB 5MGBA 2ZL0A 1YG6A 3ZW9A 2F9IA 3M6NA 5E0NX 4L8KA 1ON3A 1YG8A 4FZWA 3TRRA 4QIJA 1O8UA 4JOTA 4G2RA 1SZOA 4JWVA 4ELSA 3K8XA 5INIA 4I4ZA 1J7XA 5KDRA 2Q34A 2IEXA 2F6IA 2A7SA 2NP9A 3U9SB 4U0GH 4HC8A 1EF8A 3IBBA 3T88A 3SLLA 5FIFA 3Q0JA 3KTHA 1WDKA 2W3PA 3ZW8A 4U18A 3KTIA 4JCRA 3QXIA 3OC7A 3QMJA 4KD6A 2VSUE 4JYJA 4ZDDA 2PG8A 3H81A 2D3TA 3DORA 5E0SH 5G1RA 4F47A 1WZ8A 3GMAA 2J5GA 1N6FA 3RSIA 3LAOA 5INFA 3R9SA 2PPYA 2WTBA 3H0QA 3RSTA 3JU1A 1Q51A 3ZWBA 3RRVA 4EMPA 3GF7A 2VREA 4LK5A 3OMEA 3SWXA 2J5IA 1W2XA 3TT6A 3H0JA 5INGA 4MI2A 4JFCA 4MXIA 3QK8A 1K32A 2VX2A 4JCTA 4WZ8B 4RYFH 4MOUA 2X58A 3TV5A 2A81A 1DCIA 5C9GA 3QXZA 4Q1IA 3MT6A 4FB8A 3QREA 1TG6A 3G64A 2F9YA 1VRGA 4Z0MA 3OT6A 4FNDA 4JSBA 1TYFA 3HP0A 1UIYA 1HZDA 3R0OA 1FC7A 4K3WA 2VSUC 5JBWA 3R9TA 1UYSA 4FN7A 4Q0GA 3P5MA 1K39A 3H02A 4KNPA 1N6DA 4IZCA 3LKEA 1PIXA 2J5SA 3IAVA 4ELWA 2FZSA 4IZDA 3GKBA 3NJDA 5DZKA 3HLN1 3MYBA 4HNKA 1NZYB 4ZDFA 1Y7OA 3VIVA 4ZDBA 3ST9A 3QKAA 2CE3A 4K2NA 5JBXA 2DEOA 5IKLB 3NJBA 4RCNA 3WG5A 5G1QA 1UYRA 5DKPA 5DTPA 2VSSE 2F6QA 4WYOB 2ZQRA 4DI1A 3T8BA 3MFMA 2FW2A 5DL1A 4JVTA 3TDCA 4ASIA 3K50A 3TZ3A 3PZKA 2A7KA 4I52A 1FC6A 3QWDA 3PE8A 1MJ3A 4QIIA 4QFEA 1JXZA 2BZRA 2J5II 4I42A 1Q52A 3Q0GA 5DUFA 1SG4A 3HRXA 3TT7A 1HNOA 3H0SA 3P85A 4OLQA 1RJMA 1EF9A 5DU8A 4OMRA 5G1SA 2VSUF 3L3SA 2F9IB 1UYVA 3R6HA 5KJPA 4WCZA 4NEKA 2VSSF 3KQFA 1XX4A 2VSUA 1RJNA 3FDUA 4KPKA 4B3IA 1N6EA 3TVUA 4L6WA 2CBYA 1OD4A 2VSSA 4ZDCA 2EJ5A 2QQ3A 1XO6A 4NNQA 5KDRB 3M6MA 3QYRA 4B3HA 4ELXA 3PGQA 1XNWA 3GLMA 2HW5A 3V5IA 3HINA 1OD2A 2ZL2A 3N6RB 4FZWC 4FNBA 3H0UA 3ZWAA 1UYTA 1HNUA 3PEAA 3T89A 5DZKH 1PJHA 3BPPA 3U9TB 4U0GA 4OG1A 4B3JA 1ON9A 4JJTA 3MOYA 5DTWA 1FCFA 2X24A 4FJWD 4ZDEA 1FC9A 2FBMA 1X0UA 2ZL4A 1NZYA 5CTBA 3Q1TA 4U1AA 4GHNA 4JYLA 4KWBA 3TLFA 3KTJA 4ZU2A
chains in the Genus database with same CATH superfamily
4W7YA 1BSNA 1FDOA 1WMKA 1BE3J 3AE8C 2YKPA 3H1LE 4JF7A 4K29A 2DW3A 4EMMA 1BE3D 2E76C 2KLVA 3A0HE 4H13B 3IB9A 1VF5B 3Q5PA 2J5IB 5B5EE 1MZ9A 2N1TD 3G71P 5KLVE 3BATA 1H0TA 2J5GD 1NJIQ 1SS1A 1FZGA 3SFEC 4OWFA 5DU6A 1LTIC 2DUBA 3KTKA 1JEKA 2I1KA 1NTKJ 4IFFA 3P2LA 2E75D 3GF3A 4GIFA 4H13C 2UZFA 1VF5C 2WITA 1XNYA 1YI2P 2OYHB 3H1HJ 4R4MA 1L4AB 2WT7B 2M0BA 3S4RA 2W6AA 3H1HD 3L72D 4JQ0D 1PP9D 4WWIA 3RK2D 2ITAA 2CK3H 1IFIA 1IC2A 1DH3A 3BCCD 3K8XA 2Q9IA 1J7XA 2KP8A 2OYHC 3U9SB 4HC8A 1L4AC 2FFDA 4UB6H 1L0ND 2IZ1A 3H1ID 3T88A 3Q0JA 4BRYB 2WSCJ 3KTHA 1WDKA 5KAFH 3EWKA 3V4QA 2FXPA 4JCRA 1RQVA 4O9BA 4GOFA 3OC7A 3N4XA 2E42A 1SQPE 1RHZB 1VL2A 2O01J 1SQVJ 3PLNA 1OVRA 2W6BA 3VP9A 2D3TA 5APTA 5KTBA 3NFQA 2XU6A 3IAOA 5E0SH 4GDOA 1IFMA 1M1JB 3A7OA 3CMAP 3I55P 3GMAA 1X9VA 1N6FA 3LAOA 5H2FE 3L75J 3CC4P 2PPYA 2Z5HA 2WTBA 1LT9B 3QWOC 1NU1E 4B86A 3C8VA 1FZFA 3VP8A 3JU1A 2JEEA 3RRVA 1T3UA 4L76A 1YJWP 2VREA 3CXHI 1KZUB 1BGYG 2J5IA 5BU8B 1W2XA 2IYOA 1M1JC 3AEGC 3H0JA 5INGA 4U3FD 2YIUB 4L73A 2IBZD 1GD2E 2K9YA 2E74D 4UB8H 2VX2A 4JCTA 4RYFH 1JY3P 2L91A 1LT9C 2X58A 4W80A 3TV5A 1OXZA 3TGUJ 1GK6A 1URQB 2SPZA 1NWQA 3PH0A 1FDIA 1T3JA 4FB8A 1QL2A 1ZOYC 2R5DA 2KK7A 5B66E 1KMIZ 4FNDA 3MTUE 2OYHA 1HZDA 1UIYA 3R9TA 2YIUC 1QLED 1UYSA 1JY2N 1L4AA 4EDFA 2WT7A 2QM8A 3H02A 3S9OA 5L8RJ 3O8ZA 3AE1C 3LKEA 3Q2YA 1PIXA 3R4YA 1SQXG 2BASA 4I7ZB 3IAVA 5CBNA 1LP1B 5B5EH 2GUVA 1BDDA 1FZBA 1URQC 3T97B 4OGQD 1J2JB 3H1KJ 2YMKA 4I6MC 3U1CA 1VDFA 1L0LD 2OTJP 3I56P 1NZYB 1NTKE 2BCCD 1QVGO 1PZQA 3E1IA 1UIXA 3CX5H 3CXHE 2CPBA 4ZDFA 3AE6C 2LXCB 4ZDBA 3L73J 1U7JA 2AXTE 3BVHA 1NTMG 2UWJE 1K05A 2KI7B 1DIPA 1HF9A 1JCCA 5JBXA 2DEOA 4EOTA 1FJKA 4I7ZC 3IN6A 3WG5A 1NH4A 1ZV8A 5DTPA 1OVVA 3C9IA 2F6QA 2ZQRA 1EDKA 3T8BA 4N78D 3K50A 3RL0B 3TZ3A 2KOGA 1RE4C 4ZKPA 2KZIA 1CSBA 1PGQA 2WSEH 1EZVI 1X79B 3PE8A 1A02F 1M1JA 2R32A 4ASWA 1BCCD 3CL3D 2E76D 3R2PA 3Q0GA 1ZRTE 2BEQD 1KV4A 3HRXA 1SLQA 1HNOA 1LT9A 2W6JH 2OYIB 5DU8A 2GUSA 1N7SB 1Y8AA 2YNYA 3RL0C 1DD3A 4YXDC 1JTHB 5AW6B 2Q6QA 3RBZA 2F9IB 2K1AA 3M9HA 1P84I 4NEKA 4RO0A 1QVFO 2VSSF 2A06D 5AW1B 1RJNA 4JPZB 4H44C 1VPCA 2M3EA 3L72G 1OMIA 2PP6A 3E1RA 5AW7B 1JY3O 2CBYA 4XFJA 1PP9G 3P7KA 2VSSA 1GL2D 1FZCB 4ZDCA 2OYIC 1JMMA 2M5AB 1N7SC 3BCCG 5KDRB 4NNQA 3B71A 2WSSH 1URQA 3M6MA 3L71E 3QYRA 4ELXA 1M56D 2KSJA 3V5IA 1LJ2A 3II6A 2B88A 1L0NG 1HNUA 3CCMP 4WY4B 5DZKH 1Z56A 3H1IG 5AVVB 3U9TB 2OGUA 3S1KA 2FKWB 1NAYA 1FZCC 3H1LD 3CPWO 1LP1A 1SP4A 1AVYA 1LTTC 3CC7P 3T97A 3CWBE 3M0DC 3A0BE 2YKOA 3K5BA 1YTZT 4FJWD 1KFMA 1FC9A 5KLVD 3JC22 3RK3E 1NZYA 1RE4A 5GTHE 5CTBA 3BASA 2C0XA 3PTZA 4WY4C 4K3AA 3GG2A 2PAJA 3CX5D 1P84E 4KWBA 3TLFA 4IOIH 2QSIA 2HPCB 1HWTC 1FJPA 3G3ZA 3F5HA 2WWWA 3OW2O 1EY3A 5APYA 1RY3A 2B89A 3P32A 2C8TA 3KDPB 2K9JB 1KB9I 1R5LA 1VQMP 2O1KA 1VQLP 3T8AA 5E79E 3FF6A 2IFMA 1JY3N 3TVWA 2AEFA 1OW6A 3H1KE 1BGYJ 4U3FG 3LIEA 1GZLA 1LGHB 2IBZG 2FYUK 1E5WA 1ZR2A 1OW8A 5AW2B 3I47A 1EDLA 3RK3B 3SWYA 1JB0J 3T3WA 3GHGB 2IYPA 3H32A 4DZOA 4PD4I 2OYIA 4U0HA 1PPJE 4IFMA 3W67A 2RKLA 2F9YB 1N7SA 4HJGH 1XTGB 2AXTH 4IZBA 3ZWCA 2KIKA 4U7JA 1N73B 3U9RB 4N3YB 1JTHA 1NTMK 2R44A 1ZR4A 2F9IA 3M6NA 4WBAA 1ON3A 4TT3H 1M8OB 1G2CB 2W90A 3RK3C 1H8AA 4G2RA 3GHGC 4JWVA 1SQPD 1NTZE 1SQXJ 2PFXA 1S5LH 1FZCA 3D6ZA 2M5AA 1FAVA 4I4ZA 5KDRA 1L0LG 1QX8A 2IPPA 2IEXA 2F6IA 1N73C 2BCCG 2NP9A 1KB9E 3M0DA 2P7JA 3IR9A 3E7KA 4U0GH 2Y0EA 1Q86Q 1LTGC 5AW4B 3IBBA 5FIFA 4WY4A 4ZNCA 1NTMJ 2Q1KA 1NU1D 4U18A 3JCUH 3WU2H 4JYJA 3L74E 4ZDDA 2A45I 1VQ9P 4PD4E 1HH0A 3DORA 2H8PD 2M3BA 2QVAA 3AEBC 1K04A 2OTKE 3V2QA 4DOJA 1SVFA 1Q7YQ 1WZ8A 5GTIH 1NGMB 2V7QJ 5INFA 1BCCG 4GOEA 2NPSD 5AVRB 2OARA 2H7HA 4IL6X 3HE5B 2HPCA 2FBWC 2KYVA 2QIWA 2ZYAA 2WSFJ 4L75A 1FZAA 2ZT9D 3OMEA 3SWXA 2K9JA 4ZKUA 1DX7A 3KZIE 1OZHA 3L70E 2HLOA 3H1JE 2A06G 4Z1MH 2R5BA 2W83C 1IFDA 4RESB 4GKGA 2K3RA 3A0BH 2Z4EA 1G1IA 2B9BA 3RGUA 3L72J 3GHGA 5CJ4A 3MT6A 1PP9J 2O1JA 3CCQP 1SQQG 1SQVK 3BCCJ 3G64A 1P84H 1K73Q 2F9YA 2I8DA 1VRGA 2JJLA 2YXRB 1N73A 2WPRA 3HP0A 2K88A 3MZWB 1SQBE 2H88C 1RQUA 1K39A 5KAIE 3OA7A 1L0NJ 3HUSB 4AUWA 2J5SA 1G2CA 1IFPA 3H1IJ 1CW5A 3B5ND 4ELWA 3H1LG 1FE6A 2WVRA 5AVXB 3HLN1 2P10A 1YQ4C 1IJDB 1JM0A 1CZQA 5AVWB 5KLVG 4D6TD 1PGOA 2YKQA 1K9MQ 2P67A 4KT0J 3QKAA 4C7RA 3AEDC 4W7ZA 4EI2A 1ZRTD 3O6QB 3RL0g 4I1LA 3HUSC 5IKLB 3NJBA 3EQ2A 4RJTA 5DKPA 3HD7B 2VSSE 4NPDA 4WYOB 1GK4A 3SFDC 1S4XA 4JVTA 2V4HA 3CCJP 4ASIA 2N9YB 3PZKA 5APUA 2FYUE 4I52A 1FC6A 1YYCA 2R3SA 4TLFA 1VQOP 4PV1B 5K5GB 4QIIA 2ZJSE 3AEFC 4QFEA 1KQLA 2BZRA 4I42A 5CCGC 4U3FJ 1SG4A 1AVOA 1KQSO 1IO4A 3HD7C 4OLQA 5KJ7C 3HE5A 1L0LK 5CCHC 4OMRA 3L71D 5AW9B 1NTME 2QEXP 5G1SA 3L3SA 2H43A 1MFZA 1VQ5P 4ZMDA 3LW5H 4WCZA 1EZVD 4PV1C 5HUQA 1BE3E 4KPKA 1N6EA 2JKVA 1Q82Q 4L6WA 3KPEA 4PD4H 5AW3B 3CCLP 3V2NA 2EJ5A 1SQPG 4B3HA 3AE9C 3A0HH 1SFCB 3GLMA 3HINA 1L0LJ 3CCRP 1FC2C 1JMBA 2BCCJ 3H0UA 1GU5A 1P84D 3PEAA 3T89A 3PJSK 4OH8B 3BPPA 1NO4A 3F89A 3N7NA 1EDJA 1U57A 1ON9A 1NU1G 3M9BA 3HUSA 4DT0A 3TDKA 1YHQP 3CCVP 2X24A 3WUVA 2O01N 1KTMA 1M57D 3H1HE 2FBMA 2XKMA 3FX0A 1SFCC 2ZL4A 4H0LD 1IK7A 3VMXA 4U1AA 3BCCE 4JYLA 2WPVB 4ZU2A 3P8CE 1DUBA 2AXCA 2PRRA 2JWAA 3O6QA 1RH5B 1Y9BA 5CCGA 2H89C 1WDLA 1BCCJ 1GDTA 2WZ7A 2A45H 3HD7A 2E75B 5C39A 1YQ3C 5C90A 3Q5SA 1PPJD 5KJ7A 1S5LX 2OQQA 4C7NB 1GW3A 4H44B 5CCHA 2Y9ZA 3H32B 2N9BA 3M91A 3V5EA 4A7PA 2I1JA 3BF0A 1WDMA 1FDMA 1X8YA 1T8ZA 4YLHA 1HTLC 3ISAA 1USDA 4JCQA 4FN8A 2CPSA 4EMLA 1LTJB 1MUUA 4GODA 2Q35A 3STAA 2GTRA 1YTZI 3AECC 2PBPA 2Z5IA 3RK2B 3D71A 1NTZD 2E75C 1SQVE 3BEZA 2Q2XA 4J2UA 3FXEA 4H13D 3SWFA 1VF5D 1PFIA 1NKZB 1PGPA 2XV5A 1KB9D 4M3LA 1KYOI 2ZL0A 1YG6A 1SQQJ 1LTSC 3L75E 5E0NX 1LTJC 3TRRA 1SQQD 2ZXXA 4HB1A 4JOTA 5H2FH 5AVQB 2QRXA 3RK2C 3AE4C 3D70A 2C9NY 2Q7CA 2D2CB 3VYIA 3L74D 4NARA 5INIA 1OWAA 4PD4D 3H1LJ 2Q34A 3HRNA 2FYZA 2ZVNB 2W27A 3CLQA 1T2KC 3CCSP 4D6TG 1SFCA 2Q3IA 2WPQA 1ZMEC 1L4AD 1PV3A 5KLVJ 1Q90D 3A3YB 5DJUB 2JDIH 3SLLA 2ZXEB 3TGUE 2W3PA 2HG5D 4NPEA 3ZW8A 2FXMA 3KTIA 4YPCA 4HYTB 2D2CC 4AQRD 4BWNA 3TF5A 1LWUB 2PG8A 3UIAA 3H81A 1ZW0A 5APQA 1YBKA 1KYOE 3EFGA 3L70D 5G1RA 3H1JD 4F47A 1W2EA 5B66H 2JR8A 2J5GA 3RSIA 2E74B 5CBOA 2IFNA 2XNXA 3NTNA 1NYHA 1K8AQ 1SQPK 3H0QA 3RSTA 2WSEJ 5AW8B 3MUDC 1Y47A 1KFNA 1LWUC 1SQXK 3L71G 4LK5A 3WUTA 1OFCX 3L73E 4C7NA 3P8MC 3TT6A 3HD7D 1ZXGA 4MI2A 4WB4A 1SQBD 4JFCA 1M1KQ 1EZVG 3CXHH 4MXIA 2E74C 1S9KE 4NPFX 1K32A 5KAFE 4BXLA 1NU1K 4Y99B 4MOUA 1YITP 1H89A 1LTJA 2ZYDA 2A81A 1DCIA 4OGQB 3L37A 3CWBG 4K35A 2YO2A 3QREA 1SQPJ 3FXDA 2G3AA 3L36A 1GTWA 1N86A 3AEAC 4Z0MA 1FU1A 1TYFA 3R0OA 1TU3F 1FC7A 4K3WA 5JBWA 1NVOA 4FN7A 4RKUJ 4Q0GA 3P5MA 1S72P 4Y99C 4IZCA 2HYNA 5CHXA 2FZSA 3GKBA 3NJDA 4OGQC 1URQD 3CX5I 1NU1J 3MYBA 5AVYB 3ITKA 2WSCH 1EQ7A 5M1BA 3BRVB 1BDCA 3BRTB 2MJZA 1Y7OA 3VIVA 1NAFA 3ST9A 2HR3A 3AEEC 1Q81Q 2O01H 1OW7A 2YO3A 4RCNA 1LTAC 3I5CA 5DJTB 3G6EP 1SFCD 1UYRA 5EFWB 3Q3DA 3MFMA 5DL1A 3FWNA 3MUDA 1PPJG 3TDCA 4YTPC 1LWUA 1D7MA 2L5GB 2A7KA 1HVVA 1EXJA 1GW4A 1KILE 1WRGA 1HUCA 1ZP0C 4IL6E 3AE2C 1AQTA 2XNDH 1Q52A 3L35A 3TT7A 3H0SA 1IZNB 1L0NK 1MFTA 3P85A 1MKMA 1L2PA 1HBWA 1GL2B 1NTZG 4YXWH 1EF9A 3PHLA 3OAKA 4ASVA 3CX5E 4LC1A 3RL0D 2J58A 1FS0E 4QMAA 1KORA 2XDJA 2KLUA 3ABVC 2KB7P 5GTHH 3EFFK 3FDUA 2OTLP 1NTKD 2P2UA 1NOHA 2FXOA 4H44D 3CXHD 3TVUA 4I2LC 4XA4A 4JYCA 2P1JA 1OD4A 1JOCA 1YIJP 1GL2C 3V5BA 3AE5C 4CPGA 3VMAA 1AQ5A 1VQ7P 2XZRA 1KILB 2QQ3A 1KYOH 1AJYA 1XO6A 1N7SD 3L74G 1FZEA 5KLIB 3SSUA 1BGYE 1FOSF 2HW5A 1OD2A 2QG4A 2C0WA 5E79H 4FZWC 1HGVA 5AW5B 3MIWA 1PGJA 3ZWAA 2KZJA 3MD0A 3TNUB 4D6TJ 2PGDA 4EYYQ 4WVZA 3P8CD 1QGKB 1IFJA 3V2RA 1M90Q 4B3JA 3HE4A 1JCDA 1T2KD 3NMDA 1KILC 3BPTA 4XE5B 4OVNF 5KLIC 1OX3A 3TYYA 1Q2NA 1EXIA 1E79H 1MV8A 3L70G 1RF1B 3H1JG 1W2BO 2D2CD 1JY2O 4GHNA 1LTBC 4WY4D 2GA1A 1GMJA 2ZFCA 3KTJA 3WUUA 4U19A 1N7LA 5E0SA 2KUBA 1SQXE 3Q7HA 1SQVD 1HJBA 3V6IA 2POHA 3LIDA 3KYQA 1RF0C 2LKMA 1AFOA 5DU4A 2A45G 5DUCA 2M8RA 3G4SP 3L71J 1QL1A 4C46A 1RF1C 1USEA 3L75D 1KB9H 3HE2A 5CTCA 1SQBG 3AE3C 5APWA 3OJAB 4DJGA 3DJAA 4GM2A 5AVTB 4JCSA 5AVSB 3KTGA 1CI6B 4JBZA 5FUSA 3KHUA 1KC8Q 4HDTA 2ZL3A 1GL2A 4MN4C 4RYFA 3R9QA 3PRJA 2QE7H 2ZQQA 1WT6A 1XNVA 3L4FA 3CWBJ 5MGBA 2FY8A 2Q3EA 3ZW9A 3ZDMA 3V2PA 3CI9A 5AVZB 2MKVA 2AEMA 3CWBD 4LGDE 4L8KA 1YG8A 4FZWA 3TGUD 4QIJA 3KXDA 1O8UA 3RK3D 1J1DB 1U7MA 5APXA 1SZOA 3KQGA 1DD4A 4ELSA 1NKNA 2ZAEB 1KILA 4L74A 2ZVOB 2J5UA 4AYCA 2A7SA 4DCKA 4IL6H 2FYUG 1KYOD 3NXSA 3CD6P 2J59M 3B8EB 3A5TA 2BEZF 3KZIH 2E5YA 1EF8A 2KNCB 3TNUA 2N1TB 1J1DC 2NPSB 3HTKB 3L72E 1NTZK 5BU5A 2HFED 3H1KD 2Q5UA 3QXIA 2B87B 1PP9E 2KXPB 3QMJA 4KD6A 2VSUE 5AVUB 1RF0A 2ZT9B 3L73D 4KJMA 4BRYA 2LXBA 2IBZI 1EC5A 1SQQK 2YJGA 1S9KD 1L0NE 1RF1A 1YJNP 1BE3G 2HODB 2N1TC 3H1IE 2NPSC 3R9SA 5KAIH 3FWLA 4R4LA 2C9LY 5APVA 3Q1MA 1S5LE 4D6TE 2QJYB 2IDBA 3AE7C 1Q51A 4Y28J 3ZWBA 4EMPA 3QH9A 1HJ0A 3GF7A 2ZT9C 1RE3C 1NTZJ 1VQ6P 1JUNA 3JSVC 2KS1B 1S3JA 1DEBA 1HGZA 3GW6A 5TISE 3VMYA 1VQ8P 2IZ0A 4PJ0E 3QK8A 5KLVK 1BSHA 3A2AA 1IK9A 4WZ8B 1NTKG 2GM4A 1M7LA 5CMZA 3JCUE 3TK1A 3CCEP 3LW5J 3B5NB 3WU2E 1ZN5A 3VTPC 2QJYC 1CI6A 1LT1A 2E43A 5C9GA 3QXZA 4Q1IA 1R8EA 2YXQB 1FBMA 3H1HG 1TG6A 3L74J 4LLHA 5GTIE 3OT6A 4JSBA 2G8YA 2VSUC 4U3FE 2WPSA 2IBZE 4KNPA 1N6DA 5KKZB 4KHXA 1N2DC 3B4SA 3B5NC 1QEXA 1KQFB 1JO5A 4IZDA 3Q5RA 5BVZA 5DZKA 3M06A 2VRSA 1EZVE 1G1JA 4HNKA 3IF4A 2RN0A 1W5CE 5TJHA 2OYOA 1SQBK 3CMEP 1EDIA 1UIIA 2ZYGA 3D6YA 2YMYA 1KILD 2QJKB 3FGAD 2CE3A 2QM7A 4K2NA 5KKZC 3L70J 3H1JJ 2KNCA 5AW0B 1VQ4P 2N1TA 1R5SA 5G1QA 2NPSA 2O3JA 3HTKA 2LR2A 1SQVG 4DI1A 2B87A 2FW2A 3M9QA 2V7QH 3MHVA 3RBXA 1L0LE 2P58A 2BCCE 3MP7B 1H0TB 1RE3A 3CC2P 2FYNB 3PP5A 2JO1A 3L75G 3QWDA 5APSA 2QJPB 2QJKC 1MJ3A 2WSFH 2Y9YA 2RMZA 3SWKA 4N6JA 1JXZA 1XTCC 4IFDK 2J5II 1FOSE 1KD1Q 1SQBJ 2AEJA 5CCGD 5DUFA 4JYBA 2HODA 4UB6E 4GT1A 2QA4P 3VOPA 1RJMA 1DEEG 1X22A 5KJ7D 3W68A 1A02J 5CCHD 4N78E 3CCUP 2VSUF 1BGYD 1NHLA 2Y0DA 3USSA 2FYNC 2KS1A 3V4WA 1UYVA 3R6HA 5KJPA 2QJPC 4EIJA 3VMZA 4PV1D 3KQFA 1XX4A 2VSUA 1S2EA 2IX7C 3TGUG 1BCCE 4B3IA 1ZLLA 1YJ9P 1T6AA 5CJ0A 1PL5A 2K37A 3B5NA 1LNQA 2KSEA 2WTYA 4HKZH 1IFNA 1AA0A 3HE4B 1AV1A 1GU4A 3G9RA 3U59A 1S1CX 3PGQA 1XNWA 3VN0A 4H0LB 2FFDB 2ZL2A 3N6RB 1X0TA 2JP3A 4FNBA 1J1EB 2FYUJ 3IFMA 1UYTA 1JNMA 2A06E 2WQYC 1OVUA 3TSIA 1PJHA 2NRGA 1OIPA 1VQKP 4U0GA 2FYUD 4OG1A 3M0AA 1VQPP 1SQXD 1N8RQ 3MGNA 4HH2A 2Y0CA 1JY2P 3H1KG 1KQGB 3MOYA 2R3CA 4JJTA 4UB8E 2E5TA 1VQNP 3H6PA 5DTWA 1FCFA 5TISH 3WMM0 2E76B 4ZDEA 3C1LA 4PJ0H 2WMMA 1SQQE 3L73G 4H0LC 1X0UA 2FFDC 2W8ZA 3U1AA 3H25A 2RH0A 1KN7A 1H88A 1J1EC 3Q1TA 2JWDA 1NTKK 1NTMD 2NZ2A
chains in the Genus database with same CATH topology
4U19A 1DUBA 5E0SA 1FDOA 1WMKA 3O6QA 1Y9BA 2H89C 1WDLA 3AE8C 3Q7HA 1EY3A 2E75B 4K29A 4EMMA 1YQ3C 2C8TA 5C90A 2E76C 3Q5SA 3IB9A 4H13B 1VF5B 1S5LX 2OQQA 3Q5PA 5DU4A 4H44B 2J5IB 5DUCA 3T8AA 3V5EA 3FF6A 3TVWA 3BF0A 1WDMA 1OW6A 2J5GD 3HE2A 5CTCA 4YLHA 3ISAA 3AE3C 3SFEC 4JCQA 3DJAA 4GM2A 4FN8A 5DU6A 4EMLA 1OW8A 2DUBA 3I47A 2Q35A 3STAA 2GTRA 1JB0J 4JCSA 3KTGA 3AECC 2PBPA 3KTKA 3T3WA 3D71A 3P2LA 5FUSA 2E75C 3BEZA 2E75D 4HDTA 2ZL3A 3GF3A 2Q2XA 4J2UA 2UZFA 4H13C 4RYFA 1VF5C 3R9QA 1XNYA 4H13D 1VF5D 4U0HA 2ZQQA 2F9YB 1XNVA 4IZBA 3ZWCA 4U7JA 3U9RB 5MGBA 2ZL0A 1YG6A 4R4MA 3ZW9A 2F9IA 3M6NA 2MKVA 5E0NX 4L8KA 1ON3A 1YG8A 4FZWA 4TT3H 3TRRA 4QIJA 1O8UA 4JOTA 4G2RA 3AE4C 3D70A 1SZOA 4JWVA 1DD4A 4ELSA 2D2CB 3K8XA 3D6ZA 4NARA 5INIA 4I4ZA 1J7XA 2J5UA 5KDRA 2Q34A 2IEXA 2F6IA 2A7SA 2NP9A 3U9SB 4U0GH 4HC8A 1ZMEC 1PV3A 2BEZF 1Q90D 1EF8A 3IBBA 3T88A 3SLLA 5FIFA 3Q0JA 2WSCJ 3KTHA 1WDKA 2W3PA 3EWKA 4U18A 3ZW8A 3KTIA 2FXPA 4JCRA 3QXIA 1RQVA 2D2CC 3OC7A 3QMJA 4KD6A 2VSUE 4JYJA 4ZDDA 1VL2A 2PG8A 2O01J 3H81A 2ZT9B 2D3TA 3DORA 3AEBC 1K04A 3IAOA 5E0SH 4GDOA 5G1RA 4F47A 1WZ8A 2YJGA 1NGMB 2V7QJ 3GMAA 2J5GA 1N6FA 3RSIA 3LAOA 2E74B 5INFA 1NYHA 3R9SA 2PPYA 2WTBA 4R4LA 4IL6X 3Q1MA 3H0QA 3RSTA 2WSEJ 3C8VA 2FBWC 2QIWA 3JU1A 2IDBA 3AE7C 1Q51A 4Y28J 3ZWBA 3RRVA 4EMPA 2WSFJ 1HJ0A 3GF7A 2ZT9C 2VREA 4LK5A 2ZT9D 3OMEA 3SWXA 2J5IA 1W2XA 3TT6A 3AEGC 3H0JA 5INGA 4MI2A 4JFCA 4MXIA 2E74C 3QK8A 4Z1MH 1K32A 2K9YA 2E74D 2VX2A 4JCTA 4WZ8B 4RYFH 4MOUA 2X58A 3TV5A 2A81A 3LW5J 2QJYC 1DCIA 4OGQB 5C9GA 3QXZA 4Q1IA 1R8EA 3MT6A 1FDIA 4FB8A 3QREA 1TG6A 1ZOYC 2G3AA 3G64A 2F9YA 3AEAC 1VRGA 4Z0MA 3OT6A 1KMIZ 4FNDA 4JSBA 1TYFA 3HP0A 1UIYA 1HZDA 3R0OA 1TU3F 2G8YA 1FC7A 2VSUC 4K3WA 2YIUC 5JBWA 3R9TA 1UYSA 4FN7A 4RKUJ 2H88C 4Q0GA 3P5MA 1RQUA 1K39A 3H02A 4KNPA 3S9OA 1N6DA 5L8RJ 3AE1C 4IZCA 3LKEA 3Q2YA 1PIXA 3R4YA 4I7ZB 2J5SA 3IAVA 4ELWA 1KQFB 2FZSA 3Q5RA 4IZDA 3GKBA 3NJDA 4OGQC 3T97B 5DZKA 4OGQD 3HLN1 3MYBA 2YMKA 4HNKA 2P10A 1YQ4C 1NZYB 5M1BA 1UIXA 4ZDFA 1Y7OA 3AE6C 3VIVA 4ZDBA 2NZ2A 4KT0J 3D6YA 3ST9A 3QKAA 2CE3A 3FGAD 3AEEC 1K05A 4K2NA 3AEDC 1DIPA 5KKZC 1HF9A 5JBXA 1OW7A 3RL0g 2DEOA 5IKLB 4I7ZC 3IN6A 3NJBA 4RCNA 3WG5A 5G1QA 1UYRA 5DKPA 5DTPA 2VSSE 3Q3DA 2F6QA 4WYOB 2ZQRA 4DI1A 3SFDC 3T8BA 3MFMA 2FW2A 5DL1A 4JVTA 3TDCA 4ASIA 4YTPC 3K50A 3TZ3A 3PZKA 2A7KA 4I52A 1FC6A 1EXJA 2JO1A 3QWDA 3PE8A 2QJKC 1MJ3A 4PV1B 4QIIA 1KILE 3AEFC 4QFEA 1ZP0C 3AE2C 1JXZA 2BZRA 2J5II 4I42A 2E76D 1Q52A 3Q0GA 1ZRTE 2BEQD 5DUFA 1SG4A 3HRXA 3TT7A 1HNOA 3H0SA 3P85A 4OLQA 1RJMA 1MKMA 1EF9A 5DU8A 4OMRA 1DD3A 4YXDC 2VSUF 5G1SA 3L3SA 1KORA 2FYNC 2F9IB 1UYVA 3R6HA 5KJPA 2QJPC 4WCZA 3ABVC 4NEKA 4PV1C 2VSSF 4PV1D 3KQFA 1XX4A 5HUQA 2VSUA 1RJNA 3FDUA 4KPKA 4H44C 4B3IA 4H44D 1N6EA 3TVUA 1OMIA 4L6WA 2CBYA 1OD4A 4XFJA 3AE5C 2VSSA 1PL5A 4ZDCA 2EJ5A 2QQ3A 1AJYA 1XO6A 4NNQA 5KDRB 3B71A 3M6MA 3QYRA 4B3HA 3G9RA 4ELXA 3AE9C 1S1CX 3PGQA 1XNWA 3GLMA 2HW5A 3V5IA 4H0LB 3HINA 1OD2A 2ZL2A 3N6RB 2JP3A 4FZWC 4FNBA 3H0UA 3ZWAA 1UYTA 1HNUA 3PEAA 3T89A 2WQYC 5DZKH 1PJHA 3BPPA 3U9TB 4U0GA 4OG1A 1U57A 4B3JA 1ON9A 1KQGB 3MOYA 4JJTA 3BPTA 5DTWA 1FCFA 5KLIC 2X24A 1KTMA 2E76B 4FJWD 4ZDEA 1FC9A 2FBMA 1EXIA 4H0LC 1X0UA 3RK3E 1NZYA 2ZL4A 4H0LD 3H25A 1IK7A 5CTBA 3Q1TA 4U1AA 2D2CD 4GHNA 1GMJA 4JYLA 4KWBA 3TLFA 2WPVB 2QSIA 3KTJA 4ZU2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U19 A;  1DUB A;  5E0S A;  1WDL A;  3Q7H A;  1EY3 A;  4K29 A;  4EMM A;  2C8T A;  5C90 A;  3IB9 A;  5DU4 A;  2J5I B;  5DUC A;  3T8A A;  3V5E A;  3FF6 A;  3TVW A;  3BF0 A;  1WDM A;  2J5G D;  3HE2 A;  5CTC A;  4YLH A;  3ISA A;  4JCQ A;  3DJA A;  4GM2 A;  4FN8 A;  5DU6 A;  4EML A;  2DUB A;  3I47 A;  2Q35 A;  3STA A;  2GTR A;  4JCS A;  3KTG A;  3T3W A;  2PBP A;  3KTK A;  3P2L A;  5FUS A;  3BEZ A;  2ZL3 A;  3GF3 A;  2Q2X A;  4RYF A;  2UZF A;  3R9Q A;  1XNY A;  4U0H A;  2ZQQ A;  2F9Y B;  1XNV A;  4IZB A;  3ZWC A;  3U9R B;  5MGB A;  2ZL0 A;  1YG6 A;  3ZW9 A;  2F9I A;  3M6N A;  5E0N X;  4L8K A;  1ON3 A;  1YG8 A;  4FZW A;  3TRR A;  4QIJ A;  1O8U A;  4JOT A;  4G2R A;  1SZO A;  4JWV A;  4ELS A;  3K8X A;  5INI A;  4I4Z A;  1J7X A;  5KDR A;  2Q34 A;  2IEX A;  2F6I A;  2A7S A;  2NP9 A;  3U9S B;  4U0G H;  4HC8 A;  1EF8 A;  3IBB A;  3T88 A;  3SLL A;  5FIF A;  3Q0J A;  3KTH A;  1WDK A;  2W3P A;  3ZW8 A;  4U18 A;  3KTI A;  4JCR A;  3QXI A;  3OC7 A;  3QMJ A;  4KD6 A;  2VSU E;  4JYJ A;  4ZDD A;  2PG8 A;  3H81 A;  2D3T A;  3DOR A;  5E0S H;  5G1R A;  4F47 A;  1WZ8 A;  3GMA A;  2J5G A;  1N6F A;  3RSI A;  3LAO A;  5INF A;  3R9S A;  2PPY A;  2WTB A;  3H0Q A;  3RST A;  3JU1 A;  1Q51 A;  3ZWB A;  3RRV A;  4EMP A;  3GF7 A;  2VRE A;  4LK5 A;  3OME A;  3SWX A;  2J5I A;  1W2X A;  3TT6 A;  3H0J A;  5ING A;  4MI2 A;  4JFC A;  4MXI A;  3QK8 A;  1K32 A;  2VX2 A;  4JCT A;  4WZ8 B;  4RYF H;  4MOU A;  2X58 A;  3TV5 A;  2A81 A;  1DCI A;  5C9G A;  3QXZ A;  4Q1I A;  3MT6 A;  4FB8 A;  3QRE A;  1TG6 A;  3G64 A;  2F9Y A;  1VRG A;  4Z0M A;  3OT6 A;  4FND A;  4JSB A;  1TYF A;  3HP0 A;  1UIY A;  1HZD A;  3R0O A;  1FC7 A;  4K3W A;  2VSU C;  5JBW A;  3R9T A;  1UYS A;  4FN7 A;  4Q0G A;  3P5M A;  1K39 A;  3H02 A;  4KNP A;  1N6D A;  4IZC A;  3LKE A;  1PIX A;  2J5S A;  3IAV A;  4ELW A;  2FZS A;  4IZD A;  3GKB A;  3NJD A;  5DZK A;  3HLN 1;  3MYB A;  4HNK A;  1NZY B;  4ZDF A;  1Y7O A;  3VIV A;  4ZDB A;  3ST9 A;  3QKA A;  2CE3 A;  4K2N A;  5JBX A;  2DEO A;  5IKL B;  3NJB A;  4RCN A;  3WG5 A;  5G1Q A;  1UYR A;  5DKP A;  5DTP A;  2VSS E;  2F6Q A;  4WYO B;  2ZQR A;  4DI1 A;  3T8B A;  3MFM A;  2FW2 A;  5DL1 A;  4JVT A;  3TDC A;  4ASI A;  3K50 A;  3TZ3 A;  3PZK A;  2A7K A;  4I52 A;  1FC6 A;  3QWD A;  3PE8 A;  1MJ3 A;  4QII A;  4QFE A;  1JXZ A;  2BZR A;  2J5I I;  4I42 A;  1Q52 A;  3Q0G A;  5DUF A;  1SG4 A;  3HRX A;  3TT7 A;  1HNO A;  3H0S A;  3P85 A;  4OLQ A;  1RJM A;  1EF9 A;  5DU8 A;  4OMR A;  5G1S A;  2VSU F;  3L3S A;  2F9I B;  1UYV A;  3R6H A;  5KJP A;  4WCZ A;  4NEK A;  2VSS F;  3KQF A;  1XX4 A;  2VSU A;  1RJN A;  3FDU A;  4KPK A;  4B3I A;  1N6E A;  3TVU A;  4L6W A;  2CBY A;  1OD4 A;  2VSS A;  4ZDC A;  2EJ5 A;  2QQ3 A;  1XO6 A;  4NNQ A;  5KDR B;  3M6M A;  3QYR A;  4B3H A;  4ELX A;  3PGQ A;  1XNW A;  3GLM A;  2HW5 A;  3V5I A;  3HIN A;  1OD2 A;  2ZL2 A;  3N6R B;  4FZW C;  4FNB A;  3H0U A;  3ZWA A;  1UYT A;  1HNU A;  3PEA A;  3T89 A;  5DZK H;  1PJH A;  3BPP A;  3U9T B;  4U0G A;  4OG1 A;  4B3J A;  1ON9 A;  4JJT A;  3MOY A;  5DTW A;  1FCF A;  2X24 A;  4FJW D;  4ZDE A;  1FC9 A;  2FBM A;  1X0U A;  2ZL4 A;  1NZY A;  5CTB A;  3Q1T A;  4U1A A;  4GHN A;  4JYL A;  4KWB A;  3TLF A;  3KTJ A;  4ZU2 A; 
#chains in the Genus database with same CATH topology
 4W7Y A;  1BSN A;  1FDO A;  1WMK A;  1BE3 J;  3AE8 C;  2YKP A;  3H1L E;  4JF7 A;  4K29 A;  2DW3 A;  4EMM A;  1BE3 D;  2E76 C;  2KLV A;  3A0H E;  4H13 B;  3IB9 A;  1VF5 B;  3Q5P A;  2J5I B;  5B5E E;  1MZ9 A;  2N1T D;  3G71 P;  5KLV E;  3BAT A;  1H0T A;  2J5G D;  1NJI Q;  1SS1 A;  1FZG A;  3SFE C;  4OWF A;  5DU6 A;  1LTI C;  2DUB A;  3KTK A;  1JEK A;  2I1K A;  1NTK J;  4IFF A;  3P2L A;  2E75 D;  3GF3 A;  4GIF A;  4H13 C;  2UZF A;  1VF5 C;  2WIT A;  1XNY A;  1YI2 P;  2OYH B;  3H1H J;  4R4M A;  1L4A B;  2WT7 B;  2M0B A;  3S4R A;  2W6A A;  3H1H D;  3L72 D;  4JQ0 D;  1PP9 D;  4WWI A;  3RK2 D;  2ITA A;  2CK3 H;  1IFI A;  1IC2 A;  1DH3 A;  3BCC D;  3K8X A;  2Q9I A;  1J7X A;  2KP8 A;  2OYH C;  3U9S B;  4HC8 A;  1L4A C;  2FFD A;  4UB6 H;  1L0N D;  2IZ1 A;  3H1I D;  3T88 A;  3Q0J A;  4BRY B;  2WSC J;  3KTH A;  1WDK A;  5KAF H;  3EWK A;  3V4Q A;  2FXP A;  4JCR A;  1RQV A;  4O9B A;  4GOF A;  3OC7 A;  3N4X A;  2E42 A;  1SQP E;  1RHZ B;  1VL2 A;  2O01 J;  1SQV J;  3PLN A;  1OVR A;  2W6B A;  3VP9 A;  2D3T A;  5APT A;  5KTB A;  3NFQ A;  2XU6 A;  3IAO A;  5E0S H;  4GDO A;  1IFM A;  1M1J B;  3A7O A;  3CMA P;  3I55 P;  3GMA A;  1X9V A;  1N6F A;  3LAO A;  5H2F E;  3L75 J;  3CC4 P;  2PPY A;  2Z5H A;  2WTB A;  1LT9 B;  3QWO C;  1NU1 E;  4B86 A;  3C8V A;  1FZF A;  3VP8 A;  3JU1 A;  2JEE A;  3RRV A;  1T3U A;  4L76 A;  1YJW P;  2VRE A;  3CXH I;  1KZU B;  1BGY G;  2J5I A;  5BU8 B;  1W2X A;  2IYO A;  1M1J C;  3AEG C;  3H0J A;  5ING A;  4U3F D;  2YIU B;  4L73 A;  2IBZ D;  1GD2 E;  2K9Y A;  2E74 D;  4UB8 H;  2VX2 A;  4JCT A;  4RYF H;  1JY3 P;  2L91 A;  1LT9 C;  2X58 A;  4W80 A;  3TV5 A;  1OXZ A;  3TGU J;  1GK6 A;  1URQ B;  2SPZ A;  1NWQ A;  3PH0 A;  1FDI A;  1T3J A;  4FB8 A;  1QL2 A;  1ZOY C;  2R5D A;  2KK7 A;  5B66 E;  1KMI Z;  4FND A;  3MTU E;  2OYH A;  1HZD A;  1UIY A;  3R9T A;  2YIU C;  1QLE D;  1UYS A;  1JY2 N;  1L4A A;  4EDF A;  2WT7 A;  2QM8 A;  3H02 A;  3S9O A;  5L8R J;  3O8Z A;  3AE1 C;  3LKE A;  3Q2Y A;  1PIX A;  3R4Y A;  1SQX G;  2BAS A;  4I7Z B;  3IAV A;  5CBN A;  1LP1 B;  5B5E H;  2GUV A;  1BDD A;  1FZB A;  1URQ C;  3T97 B;  4OGQ D;  1J2J B;  3H1K J;  2YMK A;  4I6M C;  3U1C A;  1VDF A;  1L0L D;  2OTJ P;  3I56 P;  1NZY B;  1NTK E;  2BCC D;  1QVG O;  1PZQ A;  3E1I A;  1UIX A;  3CX5 H;  3CXH E;  2CPB A;  4ZDF A;  3AE6 C;  2LXC B;  4ZDB A;  3L73 J;  1U7J A;  2AXT E;  3BVH A;  1NTM G;  2UWJ E;  1K05 A;  2KI7 B;  1DIP A;  1HF9 A;  1JCC A;  5JBX A;  2DEO A;  4EOT A;  1FJK A;  4I7Z C;  3IN6 A;  3WG5 A;  1NH4 A;  1ZV8 A;  5DTP A;  1OVV A;  3C9I A;  2F6Q A;  2ZQR A;  1EDK A;  3T8B A;  4N78 D;  3K50 A;  3RL0 B;  3TZ3 A;  2KOG A;  1RE4 C;  4ZKP A;  2KZI A;  1CSB A;  1PGQ A;  2WSE H;  1EZV I;  1X79 B;  3PE8 A;  1A02 F;  1M1J A;  2R32 A;  4ASW A;  1BCC D;  3CL3 D;  2E76 D;  3R2P A;  3Q0G A;  1ZRT E;  2BEQ D;  1KV4 A;  3HRX A;  1SLQ A;  1HNO A;  1LT9 A;  2W6J H;  2OYI B;  5DU8 A;  2GUS A;  1N7S B;  1Y8A A;  2YNY A;  3RL0 C;  1DD3 A;  4YXD C;  1JTH B;  5AW6 B;  2Q6Q A;  3RBZ A;  2F9I B;  2K1A A;  3M9H A;  1P84 I;  4NEK A;  4RO0 A;  1QVF O;  2VSS F;  2A06 D;  5AW1 B;  1RJN A;  4JPZ B;  4H44 C;  1VPC A;  2M3E A;  3L72 G;  1OMI A;  2PP6 A;  3E1R A;  5AW7 B;  1JY3 O;  2CBY A;  4XFJ A;  1PP9 G;  3P7K A;  2VSS A;  1GL2 D;  1FZC B;  4ZDC A;  2OYI C;  1JMM A;  2M5A B;  1N7S C;  3BCC G;  5KDR B;  4NNQ A;  3B71 A;  2WSS H;  1URQ A;  3M6M A;  3L71 E;  3QYR A;  4ELX A;  1M56 D;  2KSJ A;  3V5I A;  1LJ2 A;  3II6 A;  2B88 A;  1L0N G;  1HNU A;  3CCM P;  4WY4 B;  5DZK H;  1Z56 A;  3H1I G;  5AVV B;  3U9T B;  2OGU A;  3S1K A;  2FKW B;  1NAY A;  1FZC C;  3H1L D;  3CPW O;  1LP1 A;  1SP4 A;  1AVY A;  1LTT C;  3CC7 P;  3T97 A;  3CWB E;  3M0D C;  3A0B E;  2YKO A;  3K5B A;  1YTZ T;  4FJW D;  1KFM A;  1FC9 A;  5KLV D;  3JC2 2;  3RK3 E;  1NZY A;  1RE4 A;  5GTH E;  5CTB A;  3BAS A;  2C0X A;  3PTZ A;  4WY4 C;  4K3A A;  3GG2 A;  2PAJ A;  3CX5 D;  1P84 E;  4KWB A;  3TLF A;  4IOI H;  2QSI A;  2HPC B;  1HWT C;  1FJP A;  3G3Z A;  3F5H A;  2WWW A;  3OW2 O;  1EY3 A;  5APY A;  1RY3 A;  2B89 A;  3P32 A;  2C8T A;  3KDP B;  2K9J B;  1KB9 I;  1R5L A;  1VQM P;  2O1K A;  1VQL P;  3T8A A;  5E79 E;  3FF6 A;  2IFM A;  1JY3 N;  3TVW A;  2AEF A;  1OW6 A;  3H1K E;  1BGY J;  4U3F G;  3LIE A;  1GZL A;  1LGH B;  2IBZ G;  2FYU K;  1E5W A;  1ZR2 A;  1OW8 A;  5AW2 B;  3I47 A;  1EDL A;  3RK3 B;  3SWY A;  1JB0 J;  3T3W A;  3GHG B;  2IYP A;  3H32 A;  4DZO A;  4PD4 I;  2OYI A;  4U0H A;  1PPJ E;  4IFM A;  3W67 A;  2RKL A;  2F9Y B;  1N7S A;  4HJG H;  1XTG B;  2AXT H;  4IZB A;  3ZWC A;  2KIK A;  4U7J A;  1N73 B;  3U9R B;  4N3Y B;  1JTH A;  1NTM K;  2R44 A;  1ZR4 A;  2F9I A;  3M6N A;  4WBA A;  1ON3 A;  4TT3 H;  1M8O B;  1G2C B;  2W90 A;  3RK3 C;  1H8A A;  4G2R A;  3GHG C;  4JWV A;  1SQP D;  1NTZ E;  1SQX J;  2PFX A;  1S5L H;  1FZC A;  3D6Z A;  2M5A A;  1FAV A;  4I4Z A;  5KDR A;  1L0L G;  1QX8 A;  2IPP A;  2IEX A;  2F6I A;  1N73 C;  2BCC G;  2NP9 A;  1KB9 E;  3M0D A;  2P7J A;  3IR9 A;  3E7K A;  4U0G H;  2Y0E A;  1Q86 Q;  1LTG C;  5AW4 B;  3IBB A;  5FIF A;  4WY4 A;  4ZNC A;  1NTM J;  2Q1K A;  1NU1 D;  4U18 A;  3JCU H;  3WU2 H;  4JYJ A;  3L74 E;  4ZDD A;  2A45 I;  1VQ9 P;  4PD4 E;  1HH0 A;  3DOR A;  2H8P D;  2M3B A;  2QVA A;  3AEB C;  1K04 A;  2OTK E;  3V2Q A;  4DOJ A;  1SVF A;  1Q7Y Q;  1WZ8 A;  5GTI H;  1NGM B;  2V7Q J;  5INF A;  1BCC G;  4GOE A;  2NPS D;  5AVR B;  2OAR A;  2H7H A;  4IL6 X;  3HE5 B;  2HPC A;  2FBW C;  2KYV A;  2QIW A;  2ZYA A;  2WSF J;  4L75 A;  1FZA A;  2ZT9 D;  3OME A;  3SWX A;  2K9J A;  4ZKU A;  1DX7 A;  3KZI E;  1OZH A;  3L70 E;  2HLO A;  3H1J E;  2A06 G;  4Z1M H;  2R5B A;  2W83 C;  1IFD A;  4RES B;  4GKG A;  2K3R A;  3A0B H;  2Z4E A;  1G1I A;  2B9B A;  3RGU A;  3L72 J;  3GHG A;  5CJ4 A;  3MT6 A;  1PP9 J;  2O1J A;  3CCQ P;  1SQQ G;  1SQV K;  3BCC J;  3G64 A;  1P84 H;  1K73 Q;  2F9Y A;  2I8D A;  1VRG A;  2JJL A;  2YXR B;  1N73 A;  2WPR A;  3HP0 A;  2K88 A;  3MZW B;  1SQB E;  2H88 C;  1RQU A;  1K39 A;  5KAI E;  3OA7 A;  1L0N J;  3HUS B;  4AUW A;  2J5S A;  1G2C A;  1IFP A;  3H1I J;  1CW5 A;  3B5N D;  4ELW A;  3H1L G;  1FE6 A;  2WVR A;  5AVX B;  3HLN 1;  2P10 A;  1YQ4 C;  1IJD B;  1JM0 A;  1CZQ A;  5AVW B;  5KLV G;  4D6T D;  1PGO A;  2YKQ A;  1K9M Q;  2P67 A;  4KT0 J;  3QKA A;  4C7R A;  3AED C;  4W7Z A;  4EI2 A;  1ZRT D;  3O6Q B;  3RL0 g;  4I1L A;  3HUS C;  5IKL B;  3NJB A;  3EQ2 A;  4RJT A;  5DKP A;  3HD7 B;  2VSS E;  4NPD A;  4WYO B;  1GK4 A;  3SFD C;  1S4X A;  4JVT A;  2V4H A;  3CCJ P;  4ASI A;  2N9Y B;  3PZK A;  5APU A;  2FYU E;  4I52 A;  1FC6 A;  1YYC A;  2R3S A;  4TLF A;  1VQO P;  4PV1 B;  5K5G B;  4QII A;  2ZJS E;  3AEF C;  4QFE A;  1KQL A;  2BZR A;  4I42 A;  5CCG C;  4U3F J;  1SG4 A;  1AVO A;  1KQS O;  1IO4 A;  3HD7 C;  4OLQ A;  5KJ7 C;  3HE5 A;  1L0L K;  5CCH C;  4OMR A;  3L71 D;  5AW9 B;  1NTM E;  2QEX P;  5G1S A;  3L3S A;  2H43 A;  1MFZ A;  1VQ5 P;  4ZMD A;  3LW5 H;  4WCZ A;  1EZV D;  4PV1 C;  5HUQ A;  1BE3 E;  4KPK A;  1N6E A;  2JKV A;  1Q82 Q;  4L6W A;  3KPE A;  4PD4 H;  5AW3 B;  3CCL P;  3V2N A;  2EJ5 A;  1SQP G;  4B3H A;  3AE9 C;  3A0H H;  1SFC B;  3GLM A;  3HIN A;  1L0L J;  3CCR P;  1FC2 C;  1JMB A;  2BCC J;  3H0U A;  1GU5 A;  1P84 D;  3PEA A;  3T89 A;  3PJS K;  4OH8 B;  3BPP A;  1NO4 A;  3F89 A;  3N7N A;  1EDJ A;  1U57 A;  1ON9 A;  1NU1 G;  3M9B A;  3HUS A;  4DT0 A;  3TDK A;  1YHQ P;  3CCV P;  2X24 A;  3WUV A;  2O01 N;  1KTM A;  1M57 D;  3H1H E;  2FBM A;  2XKM A;  3FX0 A;  1SFC C;  2ZL4 A;  4H0L D;  1IK7 A;  3VMX A;  4U1A A;  3BCC E;  4JYL A;  2WPV B;  4ZU2 A;  3P8C E;  1DUB A;  2AXC A;  2PRR A;  2JWA A;  3O6Q A;  1RH5 B;  1Y9B A;  5CCG A;  2H89 C;  1WDL A;  1BCC J;  1GDT A;  2WZ7 A;  2A45 H;  3HD7 A;  2E75 B;  5C39 A;  1YQ3 C;  5C90 A;  3Q5S A;  1PPJ D;  5KJ7 A;  1S5L X;  2OQQ A;  4C7N B;  1GW3 A;  4H44 B;  5CCH A;  2Y9Z A;  3H32 B;  2N9B A;  3M91 A;  3V5E A;  4A7P A;  2I1J A;  3BF0 A;  1WDM A;  1FDM A;  1X8Y A;  1T8Z A;  4YLH A;  1HTL C;  3ISA A;  1USD A;  4JCQ A;  4FN8 A;  2CPS A;  4EML A;  1LTJ B;  1MUU A;  4GOD A;  2Q35 A;  3STA A;  2GTR A;  1YTZ I;  3AEC C;  2PBP A;  2Z5I A;  3RK2 B;  3D71 A;  1NTZ D;  2E75 C;  1SQV E;  3BEZ A;  2Q2X A;  4J2U A;  3FXE A;  4H13 D;  3SWF A;  1VF5 D;  1PFI A;  1NKZ B;  1PGP A;  2XV5 A;  1KB9 D;  4M3L A;  1KYO I;  2ZL0 A;  1YG6 A;  1SQQ J;  1LTS C;  3L75 E;  5E0N X;  1LTJ C;  3TRR A;  1SQQ D;  2ZXX A;  4HB1 A;  4JOT A;  5H2F H;  5AVQ B;  2QRX A;  3RK2 C;  3AE4 C;  3D70 A;  2C9N Y;  2Q7C A;  2D2C B;  3VYI A;  3L74 D;  4NAR A;  5INI A;  1OWA A;  4PD4 D;  3H1L J;  2Q34 A;  3HRN A;  2FYZ A;  2ZVN B;  2W27 A;  3CLQ A;  1T2K C;  3CCS P;  4D6T G;  1SFC A;  2Q3I A;  2WPQ A;  1ZME C;  1L4A D;  1PV3 A;  5KLV J;  1Q90 D;  3A3Y B;  5DJU B;  2JDI H;  3SLL A;  2ZXE B;  3TGU E;  2W3P A;  2HG5 D;  4NPE A;  3ZW8 A;  2FXM A;  3KTI A;  4YPC A;  4HYT B;  2D2C C;  4AQR D;  4BWN A;  3TF5 A;  1LWU B;  2PG8 A;  3UIA A;  3H81 A;  1ZW0 A;  5APQ A;  1YBK A;  1KYO E;  3EFG A;  3L70 D;  5G1R A;  3H1J D;  4F47 A;  1W2E A;  5B66 H;  2JR8 A;  2J5G A;  3RSI A;  2E74 B;  5CBO A;  2IFN A;  2XNX A;  3NTN A;  1NYH A;  1K8A Q;  1SQP K;  3H0Q A;  3RST A;  2WSE J;  5AW8 B;  3MUD C;  1Y47 A;  1KFN A;  1LWU C;  1SQX K;  3L71 G;  4LK5 A;  3WUT A;  1OFC X;  3L73 E;  4C7N A;  3P8M C;  3TT6 A;  3HD7 D;  1ZXG A;  4MI2 A;  4WB4 A;  1SQB D;  4JFC A;  1M1K Q;  1EZV G;  3CXH H;  4MXI A;  2E74 C;  1S9K E;  4NPF X;  1K32 A;  5KAF E;  4BXL A;  1NU1 K;  4Y99 B;  4MOU A;  1YIT P;  1H89 A;  1LTJ A;  2ZYD A;  2A81 A;  1DCI A;  4OGQ B;  3L37 A;  3CWB G;  4K35 A;  2YO2 A;  3QRE A;  1SQP J;  3FXD A;  2G3A A;  3L36 A;  1GTW A;  1N86 A;  3AEA C;  4Z0M A;  1FU1 A;  1TYF A;  3R0O A;  1TU3 F;  1FC7 A;  4K3W A;  5JBW A;  1NVO A;  4FN7 A;  4RKU J;  4Q0G A;  3P5M A;  1S72 P;  4Y99 C;  4IZC A;  2HYN A;  5CHX A;  2FZS A;  3GKB A;  3NJD A;  4OGQ C;  1URQ D;  3CX5 I;  1NU1 J;  3MYB A;  5AVY B;  3ITK A;  2WSC H;  1EQ7 A;  5M1B A;  3BRV B;  1BDC A;  3BRT B;  2MJZ A;  1Y7O A;  3VIV A;  1NAF A;  3ST9 A;  2HR3 A;  3AEE C;  1Q81 Q;  2O01 H;  1OW7 A;  2YO3 A;  4RCN A;  1LTA C;  3I5C A;  5DJT B;  3G6E P;  1SFC D;  1UYR A;  5EFW B;  3Q3D A;  3MFM A;  5DL1 A;  3FWN A;  3MUD A;  1PPJ G;  3TDC A;  4YTP C;  1LWU A;  1D7M A;  2L5G B;  2A7K A;  1HVV A;  1EXJ A;  1GW4 A;  1KIL E;  1WRG A;  1HUC A;  1ZP0 C;  4IL6 E;  3AE2 C;  1AQT A;  2XND H;  1Q52 A;  3L35 A;  3TT7 A;  3H0S A;  1IZN B;  1L0N K;  1MFT A;  3P85 A;  1MKM A;  1L2P A;  1HBW A;  1GL2 B;  1NTZ G;  4YXW H;  1EF9 A;  3PHL A;  3OAK A;  4ASV A;  3CX5 E;  4LC1 A;  3RL0 D;  2J58 A;  1FS0 E;  4QMA A;  1KOR A;  2XDJ A;  2KLU A;  3ABV C;  2KB7 P;  5GTH H;  3EFF K;  3FDU A;  2OTL P;  1NTK D;  2P2U A;  1NOH A;  2FXO A;  4H44 D;  3CXH D;  3TVU A;  4I2L C;  4XA4 A;  4JYC A;  2P1J A;  1OD4 A;  1JOC A;  1YIJ P;  1GL2 C;  3V5B A;  3AE5 C;  4CPG A;  3VMA A;  1AQ5 A;  1VQ7 P;  2XZR A;  1KIL B;  2QQ3 A;  1KYO H;  1AJY A;  1XO6 A;  1N7S D;  3L74 G;  1FZE A;  5KLI B;  3SSU A;  1BGY E;  1FOS F;  2HW5 A;  1OD2 A;  2QG4 A;  2C0W A;  5E79 H;  4FZW C;  1HGV A;  5AW5 B;  3MIW A;  1PGJ A;  3ZWA A;  2KZJ A;  3MD0 A;  3TNU B;  4D6T J;  2PGD A;  4EYY Q;  4WVZ A;  3P8C D;  1QGK B;  1IFJ A;  3V2R A;  1M90 Q;  4B3J A;  3HE4 A;  1JCD A;  1T2K D;  3NMD A;  1KIL C;  3BPT A;  4XE5 B;  4OVN F;  5KLI C;  1OX3 A;  3TYY A;  1Q2N A;  1EXI A;  1E79 H;  1MV8 A;  3L70 G;  1RF1 B;  3H1J G;  1W2B O;  2D2C D;  1JY2 O;  4GHN A;  1LTB C;  4WY4 D;  2GA1 A;  1GMJ A;  2ZFC A;  3KTJ A;  3WUU A;  4U19 A;  1N7L A;  5E0S A;  2KUB A;  1SQX E;  3Q7H A;  1SQV D;  1HJB A;  3V6I A;  2POH A;  3LID A;  3KYQ A;  1RF0 C;  2LKM A;  1AFO A;  5DU4 A;  2A45 G;  5DUC A;  2M8R A;  3G4S P;  3L71 J;  1QL1 A;  4C46 A;  1RF1 C;  1USE A;  3L75 D;  1KB9 H;  3HE2 A;  5CTC A;  1SQB G;  3AE3 C;  5APW A;  3OJA B;  4DJG A;  3DJA A;  4GM2 A;  5AVT B;  4JCS A;  5AVS B;  3KTG A;  1CI6 B;  4JBZ A;  5FUS A;  3KHU A;  1KC8 Q;  4HDT A;  2ZL3 A;  1GL2 A;  4MN4 C;  4RYF A;  3R9Q A;  3PRJ A;  2QE7 H;  2ZQQ A;  1WT6 A;  1XNV A;  3L4F A;  3CWB J;  5MGB A;  2FY8 A;  2Q3E A;  3ZW9 A;  3ZDM A;  3V2P A;  3CI9 A;  5AVZ B;  2MKV A;  2AEM A;  3CWB D;  4LGD E;  4L8K A;  1YG8 A;  4FZW A;  3TGU D;  4QIJ A;  3KXD A;  1O8U A;  3RK3 D;  1J1D B;  1U7M A;  5APX A;  1SZO A;  3KQG A;  1DD4 A;  4ELS A;  1NKN A;  2ZAE B;  1KIL A;  4L74 A;  2ZVO B;  2J5U A;  4AYC A;  2A7S A;  4DCK A;  4IL6 H;  2FYU G;  1KYO D;  3NXS A;  3CD6 P;  2J59 M;  3B8E B;  3A5T A;  2BEZ F;  3KZI H;  2E5Y A;  1EF8 A;  2KNC B;  3TNU A;  2N1T B;  1J1D C;  2NPS B;  3HTK B;  3L72 E;  1NTZ K;  5BU5 A;  2HFE D;  3H1K D;  2Q5U A;  3QXI A;  2B87 B;  1PP9 E;  2KXP B;  3QMJ A;  4KD6 A;  2VSU E;  5AVU B;  1RF0 A;  2ZT9 B;  3L73 D;  4KJM A;  4BRY A;  2LXB A;  2IBZ I;  1EC5 A;  1SQQ K;  2YJG A;  1S9K D;  1L0N E;  1RF1 A;  1YJN P;  1BE3 G;  2HOD B;  2N1T C;  3H1I E;  2NPS C;  3R9S A;  5KAI H;  3FWL A;  4R4L A;  2C9L Y;  5APV A;  3Q1M A;  1S5L E;  4D6T E;  2QJY B;  2IDB A;  3AE7 C;  1Q51 A;  4Y28 J;  3ZWB A;  4EMP A;  3QH9 A;  1HJ0 A;  3GF7 A;  2ZT9 C;  1RE3 C;  1NTZ J;  1VQ6 P;  1JUN A;  3JSV C;  2KS1 B;  1S3J A;  1DEB A;  1HGZ A;  3GW6 A;  5TIS E;  3VMY A;  1VQ8 P;  2IZ0 A;  4PJ0 E;  3QK8 A;  5KLV K;  1BSH A;  3A2A A;  1IK9 A;  4WZ8 B;  1NTK G;  2GM4 A;  1M7L A;  5CMZ A;  3JCU E;  3TK1 A;  3CCE P;  3LW5 J;  3B5N B;  3WU2 E;  1ZN5 A;  3VTP C;  2QJY C;  1CI6 A;  1LT1 A;  2E43 A;  5C9G A;  3QXZ A;  4Q1I A;  1R8E A;  2YXQ B;  1FBM A;  3H1H G;  1TG6 A;  3L74 J;  4LLH A;  5GTI E;  3OT6 A;  4JSB A;  2G8Y A;  2VSU C;  4U3F E;  2WPS A;  2IBZ E;  4KNP A;  1N6D A;  5KKZ B;  4KHX A;  1N2D C;  3B4S A;  3B5N C;  1QEX A;  1KQF B;  1JO5 A;  4IZD A;  3Q5R A;  5BVZ A;  5DZK A;  3M06 A;  2VRS A;  1EZV E;  1G1J A;  4HNK A;  3IF4 A;  2RN0 A;  1W5C E;  5TJH A;  2OYO A;  1SQB K;  3CME P;  1EDI A;  1UII A;  2ZYG A;  3D6Y A;  2YMY A;  1KIL D;  2QJK B;  3FGA D;  2CE3 A;  2QM7 A;  4K2N A;  5KKZ C;  3L70 J;  3H1J J;  2KNC A;  5AW0 B;  1VQ4 P;  2N1T A;  1R5S A;  5G1Q A;  2NPS A;  2O3J A;  3HTK A;  2LR2 A;  1SQV G;  4DI1 A;  2B87 A;  2FW2 A;  3M9Q A;  2V7Q H;  3MHV A;  3RBX A;  1L0L E;  2P58 A;  2BCC E;  3MP7 B;  1H0T B;  1RE3 A;  3CC2 P;  2FYN B;  3PP5 A;  2JO1 A;  3L75 G;  3QWD A;  5APS A;  2QJP B;  2QJK C;  1MJ3 A;  2WSF H;  2Y9Y A;  2RMZ A;  3SWK A;  4N6J A;  1JXZ A;  1XTC C;  4IFD K;  2J5I I;  1FOS E;  1KD1 Q;  1SQB J;  2AEJ A;  5CCG D;  5DUF A;  4JYB A;  2HOD A;  4UB6 E;  4GT1 A;  2QA4 P;  3VOP A;  1RJM A;  1DEE G;  1X22 A;  5KJ7 D;  3W68 A;  1A02 J;  5CCH D;  4N78 E;  3CCU P;  2VSU F;  1BGY D;  1NHL A;  2Y0D A;  3USS A;  2FYN C;  2KS1 A;  3V4W A;  1UYV A;  3R6H A;  5KJP A;  2QJP C;  4EIJ A;  3VMZ A;  4PV1 D;  3KQF A;  1XX4 A;  2VSU A;  1S2E A;  2IX7 C;  3TGU G;  1BCC E;  4B3I A;  1ZLL A;  1YJ9 P;  1T6A A;  5CJ0 A;  1PL5 A;  2K37 A;  3B5N A;  1LNQ A;  2KSE A;  2WTY A;  4HKZ H;  1IFN A;  1AA0 A;  3HE4 B;  1AV1 A;  1GU4 A;  3G9R A;  3U59 A;  1S1C X;  3PGQ A;  1XNW A;  3VN0 A;  4H0L B;  2FFD B;  2ZL2 A;  3N6R B;  1X0T A;  2JP3 A;  4FNB A;  1J1E B;  2FYU J;  3IFM A;  1UYT A;  1JNM A;  2A06 E;  2WQY C;  1OVU A;  3TSI A;  1PJH A;  2NRG A;  1OIP A;  1VQK P;  4U0G A;  2FYU D;  4OG1 A;  3M0A A;  1VQP P;  1SQX D;  1N8R Q;  3MGN A;  4HH2 A;  2Y0C A;  1JY2 P;  3H1K G;  1KQG B;  3MOY A;  2R3C A;  4JJT A;  4UB8 E;  2E5T A;  1VQN P;  3H6P A;  5DTW A;  1FCF A;  5TIS H;  3WMM 0;  2E76 B;  4ZDE A;  3C1L A;  4PJ0 H;  2WMM A;  1SQQ E;  3L73 G;  4H0L C;  1X0U A;  2FFD C;  2W8Z A;  3U1A A;  3H25 A;  2RH0 A;  1KN7 A;  1H88 A;  1J1E C;  3Q1T A;  2JWD A;  1NTK K;  1NTM D;  2NZ2 A; 
#chains in the Genus database with same CATH homology
 4U19 A;  1DUB A;  5E0S A;  1FDO A;  1WMK A;  3O6Q A;  1Y9B A;  2H89 C;  1WDL A;  3AE8 C;  3Q7H A;  1EY3 A;  2E75 B;  4K29 A;  4EMM A;  1YQ3 C;  2C8T A;  5C90 A;  2E76 C;  3Q5S A;  3IB9 A;  4H13 B;  1VF5 B;  1S5L X;  2OQQ A;  3Q5P A;  5DU4 A;  4H44 B;  2J5I B;  5DUC A;  3T8A A;  3V5E A;  3FF6 A;  3TVW A;  3BF0 A;  1WDM A;  1OW6 A;  2J5G D;  3HE2 A;  5CTC A;  4YLH A;  3ISA A;  3AE3 C;  3SFE C;  4JCQ A;  3DJA A;  4GM2 A;  4FN8 A;  5DU6 A;  4EML A;  1OW8 A;  2DUB A;  3I47 A;  2Q35 A;  3STA A;  2GTR A;  1JB0 J;  4JCS A;  3KTG A;  3AEC C;  2PBP A;  3KTK A;  3T3W A;  3D71 A;  3P2L A;  5FUS A;  2E75 C;  3BEZ A;  2E75 D;  4HDT A;  2ZL3 A;  3GF3 A;  2Q2X A;  4J2U A;  2UZF A;  4H13 C;  4RYF A;  1VF5 C;  3R9Q A;  1XNY A;  4H13 D;  1VF5 D;  4U0H A;  2ZQQ A;  2F9Y B;  1XNV A;  4IZB A;  3ZWC A;  4U7J A;  3U9R B;  5MGB A;  2ZL0 A;  1YG6 A;  4R4M A;  3ZW9 A;  2F9I A;  3M6N A;  2MKV A;  5E0N X;  4L8K A;  1ON3 A;  1YG8 A;  4FZW A;  4TT3 H;  3TRR A;  4QIJ A;  1O8U A;  4JOT A;  4G2R A;  3AE4 C;  3D70 A;  1SZO A;  4JWV A;  1DD4 A;  4ELS A;  2D2C B;  3K8X A;  3D6Z A;  4NAR A;  5INI A;  4I4Z A;  1J7X A;  2J5U A;  5KDR A;  2Q34 A;  2IEX A;  2F6I A;  2A7S A;  2NP9 A;  3U9S B;  4U0G H;  4HC8 A;  1ZME C;  1PV3 A;  2BEZ F;  1Q90 D;  1EF8 A;  3IBB A;  3T88 A;  3SLL A;  5FIF A;  3Q0J A;  2WSC J;  3KTH A;  1WDK A;  2W3P A;  3EWK A;  4U18 A;  3ZW8 A;  3KTI A;  2FXP A;  4JCR A;  3QXI A;  1RQV A;  2D2C C;  3OC7 A;  3QMJ A;  4KD6 A;  2VSU E;  4JYJ A;  4ZDD A;  1VL2 A;  2PG8 A;  2O01 J;  3H81 A;  2ZT9 B;  2D3T A;  3DOR A;  3AEB C;  1K04 A;  3IAO A;  5E0S H;  4GDO A;  5G1R A;  4F47 A;  1WZ8 A;  2YJG A;  1NGM B;  2V7Q J;  3GMA A;  2J5G A;  1N6F A;  3RSI A;  3LAO A;  2E74 B;  5INF A;  1NYH A;  3R9S A;  2PPY A;  2WTB A;  4R4L A;  4IL6 X;  3Q1M A;  3H0Q A;  3RST A;  2WSE J;  3C8V A;  2FBW C;  2QIW A;  3JU1 A;  2IDB A;  3AE7 C;  1Q51 A;  4Y28 J;  3ZWB A;  3RRV A;  4EMP A;  2WSF J;  1HJ0 A;  3GF7 A;  2ZT9 C;  2VRE A;  4LK5 A;  2ZT9 D;  3OME A;  3SWX A;  2J5I A;  1W2X A;  3TT6 A;  3AEG C;  3H0J A;  5ING A;  4MI2 A;  4JFC A;  4MXI A;  2E74 C;  3QK8 A;  4Z1M H;  1K32 A;  2K9Y A;  2E74 D;  2VX2 A;  4JCT A;  4WZ8 B;  4RYF H;  4MOU A;  2X58 A;  3TV5 A;  2A81 A;  3LW5 J;  2QJY C;  1DCI A;  4OGQ B;  5C9G A;  3QXZ A;  4Q1I A;  1R8E A;  3MT6 A;  1FDI A;  4FB8 A;  3QRE A;  1TG6 A;  1ZOY C;  2G3A A;  3G64 A;  2F9Y A;  3AEA C;  1VRG A;  4Z0M A;  3OT6 A;  1KMI Z;  4FND A;  4JSB A;  1TYF A;  3HP0 A;  1UIY A;  1HZD A;  3R0O A;  1TU3 F;  2G8Y A;  1FC7 A;  2VSU C;  4K3W A;  2YIU C;  5JBW A;  3R9T A;  1UYS A;  4FN7 A;  4RKU J;  2H88 C;  4Q0G A;  3P5M A;  1RQU A;  1K39 A;  3H02 A;  4KNP A;  3S9O A;  1N6D A;  5L8R J;  3AE1 C;  4IZC A;  3LKE A;  3Q2Y A;  1PIX A;  3R4Y A;  4I7Z B;  2J5S A;  3IAV A;  4ELW A;  1KQF B;  2FZS A;  3Q5R A;  4IZD A;  3GKB A;  3NJD A;  4OGQ C;  3T97 B;  5DZK A;  4OGQ D;  3HLN 1;  3MYB A;  2YMK A;  4HNK A;  2P10 A;  1YQ4 C;  1NZY B;  5M1B A;  1UIX A;  4ZDF A;  1Y7O A;  3AE6 C;  3VIV A;  4ZDB A;  2NZ2 A;  4KT0 J;  3D6Y A;  3ST9 A;  3QKA A;  2CE3 A;  3FGA D;  3AEE C;  1K05 A;  4K2N A;  3AED C;  1DIP A;  5KKZ C;  1HF9 A;  5JBX A;  1OW7 A;  3RL0 g;  2DEO A;  5IKL B;  4I7Z C;  3IN6 A;  3NJB A;  4RCN A;  3WG5 A;  5G1Q A;  1UYR A;  5DKP A;  5DTP A;  2VSS E;  3Q3D A;  2F6Q A;  4WYO B;  2ZQR A;  4DI1 A;  3SFD C;  3T8B A;  3MFM A;  2FW2 A;  5DL1 A;  4JVT A;  3TDC A;  4ASI A;  4YTP C;  3K50 A;  3TZ3 A;  3PZK A;  2A7K A;  4I52 A;  1FC6 A;  1EXJ A;  2JO1 A;  3QWD A;  3PE8 A;  2QJK C;  1MJ3 A;  4PV1 B;  4QII A;  1KIL E;  3AEF C;  4QFE A;  1ZP0 C;  3AE2 C;  1JXZ A;  2BZR A;  2J5I I;  4I42 A;  2E76 D;  1Q52 A;  3Q0G A;  1ZRT E;  2BEQ D;  5DUF A;  1SG4 A;  3HRX A;  3TT7 A;  1HNO A;  3H0S A;  3P85 A;  4OLQ A;  1RJM A;  1MKM A;  1EF9 A;  5DU8 A;  4OMR A;  1DD3 A;  4YXD C;  2VSU F;  5G1S A;  3L3S A;  1KOR A;  2FYN C;  2F9I B;  1UYV A;  3R6H A;  5KJP A;  2QJP C;  4WCZ A;  3ABV C;  4NEK A;  4PV1 C;  2VSS F;  4PV1 D;  3KQF A;  1XX4 A;  5HUQ A;  2VSU A;  1RJN A;  3FDU A;  4KPK A;  4H44 C;  4B3I A;  4H44 D;  1N6E A;  3TVU A;  1OMI A;  4L6W A;  2CBY A;  1OD4 A;  4XFJ A;  3AE5 C;  2VSS A;  1PL5 A;  4ZDC A;  2EJ5 A;  2QQ3 A;  1AJY A;  1XO6 A;  4NNQ A;  5KDR B;  3B71 A;  3M6M A;  3QYR A;  4B3H A;  3G9R A;  4ELX A;  3AE9 C;  1S1C X;  3PGQ A;  1XNW A;  3GLM A;  2HW5 A;  3V5I A;  4H0L B;  3HIN A;  1OD2 A;  2ZL2 A;  3N6R B;  2JP3 A;  4FZW C;  4FNB A;  3H0U A;  3ZWA A;  1UYT A;  1HNU A;  3PEA A;  3T89 A;  2WQY C;  5DZK H;  1PJH A;  3BPP A;  3U9T B;  4U0G A;  4OG1 A;  1U57 A;  4B3J A;  1ON9 A;  1KQG B;  3MOY A;  4JJT A;  3BPT A;  5DTW A;  1FCF A;  5KLI C;  2X24 A;  1KTM A;  2E76 B;  4FJW D;  4ZDE A;  1FC9 A;  2FBM A;  1EXI A;  4H0L C;  1X0U A;  3RK3 E;  1NZY A;  2ZL4 A;  4H0L D;  3H25 A;  1IK7 A;  5CTB A;  3Q1T A;  4U1A A;  2D2C D;  4GHN A;  1GMJ A;  4JYL A;  4KWB A;  3TLF A;  2WPV B;  2QSI A;  3KTJ A;  4ZU2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...