3GMAA

Glutaconyl-coa decarboxylase a subunit from clostridium symbiosum co-crystallized with glutaryl-coa
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
584
structure length
558
Chain Sequence
b'MYSMPGYFQNMPTIGKELVNPNPENEQEIKAVESDIHESIKKALDAGITSEEKLNERGQLSAMQRINALIDPGTWCPLNSLFNPENNKFGTTNIVNGLGRVDGKWVYIVASDNKKMAGAWVPGQAENLIRCSDAAKMMHLPLIYLLNCSGVEFPNQDKVYPNRRGGGTPFFRNSELNQLGIPVIVGIYGTNPAGGGYHSISPTILIAHQDANMAVGGAAAEQIIAAQIENSKLKVPAPGSVPIHYDETGFFREVYQNDLGVIDGIKKYISYLPAYNLEFFRVDTPKAPQLPAEDLYSIIPMNQKRPYDIYEVIARLFDNSEFSEYKKGYGPEMVTGLAKVNGLLVGVIANVQGLLMNYPEYKQNSVGIGGKLYRQGLIKMNEFVTLCARDRIPLIWLQDTTGIDVGDEAEKAELLGLGQSLIYSIENSKLPSLEITIRKASAAAHYVLGGPQGNNTNVFSIGTGACEYYVMPGETAANAMYSRKQPIIGKMNDMIQMYTDKSRPKYCTEKGMVDEIVDMTEVRPYIQAFTEAAYQNPQSICPMHQMLTPRSTREFETF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutaconyl-CoA decarboxylase subunit A
molecule tags Lyase
source organism Clostridium symbiosum
publication title An asymmetric model for Na+-translocating glutaconyl-CoA decarboxylases
pubmed doi rcsb
total genus 210
structure length 558
sequence length 584
chains with identical sequence B
ec nomenclature ec 4.1.1.70: Transferred entry: 7.2.4.5.
pdb deposition date 2009-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01039 Carboxyl_trans Carboxyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.680 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Helix bin 3gmaA01
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3gmaA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3gmaA03
3ZWAA 1XO6A 4ZDDA 4RYFA 4JYJA 3IB9A 2DUBA 3PGQA 3TDCA 3MT6A 4JOTA 3IBBA 4K29A 3L3SA 3TVUA 2F9IB 5DU6A 4U18A 3OT6A 4GHNA 2D3TA 4MOUA 4G2RA 4U1AA 4U0GA 3MFMA 1DCIA 5JBWA 3Q1TA 2EJ5A 4FZWC 4I4ZA 5IKLB 2X24A 4EMLA 5E0SH 2CE3A 4FNBA 3ZW8A 5DUCA 1SZOA 4ZDCA 2CBYA 4U0HA 4JSBA 3DORA 2F9IA 4HC8A 2ZL3A 1FC7A 2A7SA 4K2NA 1W2XA 5CTCA 4U19A 1EF8A 3DJAA 3KTJA 3H02A 5DU8A 3U9SB 1YG6A 4FN7A 4IZDA 2IEXA 5INFA 3H0JA 5E0NX 2PBPA 3OC7A 3TT7A 1XX4A 3FF6A 1FC9A 3R0OA 4B3JA 2BZRA 5KDRA 2ZL2A 4DI1A 3M6MA 3SLLA 3SWXA 4QIJA 5G1QA 2DEOA 4KPKA 4JVTA 3QXZA 4JCRA 1UYRA 5CTBA 1VRGA 1XNVA 5DTWA 1NZYA 2HW5A 2ZL0A 4FJWD 4ZU2A 4MXIA 4KWBA 5G1SA 3QXIA 5KDRB 3BPPA 3RSIA 3H0UA 3BF0A 4JCQA 3Q7HA 3RRVA 4ELWA 3WG5A 3GF3A 4FZWA 3U9RB 3NJDA 2J5GA 1O8UA 3T8BA 3N6RB 3V5EA 4FB8A 3R9QA 5JBXA 2Q34A 1N6FA 5DUFA 3G64A 3VIVA 3PZKA 2WTBA 3T8AA 3GF7A 1YG8A 3KTIA 2ZQRA 1WZ8A 1J7XA 3GLMA 4RYFH 2ZL4A 3TT6A 2F9YB 1Q52A 3TLFA 4LK5A 2PPYA 4EMMA 2VSUA 4JCTA 3T3WA 4I52A 1PIXA 5C90A 1TYFA 2A81A 4RCNA 1DUBA 3ZWCA 2F6QA 2GTRA 3P5MA 1N6EA 1Q51A 5G1RA 5INGA 5DZKA 5DKPA 1TG6A 5E0SA 3K8XA 4JYLA 2C8TA 3T89A 2J5II 3QREA 5FUSA 3MOYA 1RJMA 2FZSA 3MYBA 4IZCA 1FC6A 4IZBA 4JWVA 3TZ3A 2F9YA 1MJ3A 3ZWBA 2J5GD 4HNKA 2VX2A 3R6HA 2F6IA 4OMRA 4QFEA 2QQ3A 3PE8A 3T88A 2Q35A 1NZYB 4WZ8B 3Q0GA 1K39A 4ASIA 3KTGA 4OLQA 4KD6A 1UYSA 2VSSE 4Z0MA 3LAOA 3HP0A 4YLHA 3QWDA 3LKEA 3PEAA 2VSSA 3HLN1 2UZFA 3R9SA 3H0SA 3V5IA 4MI2A 2VSUF 4OG1A 4ZDEA 4JCSA 3I47A 3OMEA 4U0GH 3K50A 2VREA 3RSTA 1EF9A 3GKBA 1UYTA 5DTPA 4Q1IA 5C9GA 3Q0JA 5DL1A 4L8KA 2J5SA 4ELSA 4WCZA 5INIA 4QIIA 3FDUA 1FCFA 1HNOA 3BEZA 1XNYA 3M6NA 1N6DA 3NJBA 3QMJA 4FNDA 3KQFA 4B3IA 4EMPA 3QK8A 1RJNA 4B3HA 2Q2XA 1HZDA 5DU4A 1HNUA 4F47A 4NNQA 2VSSF 1OD2A 4GM2A 3HRXA 1Y7OA 3TRRA 2PG8A 4ZDFA 3ST9A 3KTKA 3H81A 3HINA 1K32A 4K3WA 3KTHA 2W3PA 1UIYA 1WDMA 1X0UA 3H0QA 3P85A 1XNWA 1SG4A 1ON9A 4FN8A 5FIFA 2FBMA 3JU1A 4NEKA 3TV5A 4KNPA 3P2LA 1UYVA 4JJTA 2NP9A 2VSUC 3QKAA 4L6WA 3ISAA 3R9TA 1EY3A 3IAVA 2X58A 3ZW9A 2J5IB 5DZKH 3TVWA 2A7KA 1ON3A 4ZDBA 5KJPA 4Q0GA 1JXZA 3QYRA 3STAA 4WYOB 3U9TB 1OD4A 1PJHA 4ELXA 2VSUE 4I42A 1WDKA 3HE2A 2J5IA 5MGBA 1WDLA 2ZQQA 2FW2A 4JFCA 3GMAA
chains in the Genus database with same CATH superfamily
1USEA 1KYOH 3OW2O 1MKMA 5AW9B 1SLQA 2H7HA 4M3LA 4D6TD 3L75J 1URQD 3IB9A 2YIUC 3PGQA 2KSJA 2J5UA 1BGYJ 3WUTA 4JOTA 1VQ9P 4K29A 2R5DA 3R4YA 1NAYA 1ZLLA 3RK3C 1YQ3C 5DU6A 2XDJA 3V2QA 1L0ND 3L70J 3KHUA 3VP9A 4U0GA 3CCMP 1N2DC 1EQ7A 2V7QH 2WPQA 1KYOE 3H1HD 4GT1A 4L74A 2E43A 1ZR4A 3USSA 1PZQA 4IFFA 3RK3D 1KILB 1YBKA 4FNBA 1VQ7P 5KLIC 3OA7A 1S1CX 4U3FD 5M1BA 2BCCJ 2JEEA 1FJPA 2WSCJ 5APQA 1KQFB 1GDTA 2WSFH 2Y0EA 2Y9YA 2A7SA 3C1LA 5CTCA 2VRSA 3M9BA 3KTJA 3U1CA 3H02A 1X79B 3O6QB 1LT9C 3H1KD 2WSFJ 1NU1E 1IFPA 1ZR2A 3H1KG 3EFFK 4PJ0E 3CCVP 1FZBA 1ZP0C 5E0NX 3V2NA 1URQA 1MFTA 1LT1A 2PBPA 2ZAEB 1OW8A 3OC7A 2FXOA 4DZOA 1BSNA 2POHA 2C0XA 2FBWC 5AW0B 4DI1A 1NU1D 1K9MQ 4QIJA 2DEOA 1ZMEC 4Y28J 3A2AA 1PGJA 4RKUJ 2FXPA 4KPKA 1VQLP 3QXZA 1SQBK 1AA0A 2AXTE 1LTBC 4IOIH 1JUNA 4RO0A 2B9BA 1XNVA 5DTWA 1KMIZ 1HJ0A 4HJGH 1JMBA 2IDBA 4EDFA 4UB8E 1YI2P 4H13B 2KNCB 2IX7C 4JYCA 4U3FE 5B66E 5KDRB 1N7SB 2H8PD 3HD7D 3AE6C 3BF0A 1P84I 5AW1B 1YYCA 1PGPA 1OZHA 3BPTA 3CX5H 3GF3A 3NJDA 3FX0A 1N7LA 2ZXXA 2D2CD 2WZ7A 3Q5SA 2QVAA 3BATA 1H8AA 1N6FA 5DUFA 5AW2B 3VIVA 3PZKA 1BE3D 3CXHD 3SFEC 1SQXJ 1N8RQ 4OWFA 1K73Q 2OYOA 4PD4H 3CXHI 3P8CD 2ZVNB 3Q5PA 1DIPA 3GLMA 4RYFH 1D7MA 2A45I 3LIEA 1PP9J 3TT6A 3MZWB 3HUSC 2B87A 1Q52A 5APTA 3B5NC 3EWKA 2C9LY 2P10A 4EI2A 3IN6A 1YHQP 4JCTA 2KI7B 1VF5C 2E5YA 4RCNA 3LIDA 5KLVK 3BCCG 3RBZA 1KORA 1Q51A 1NGMB 5G1RA 5INGA 5DZKA 1M1KQ 1VDFA 3KXDA 1RJMA 1WRGA 3MYBA 2LKMA 1FOSF 1M90Q 3CL3D 3N4XA 2CPSA 4IZBA 3A7OA 1FJKA 1JY3N 3MUDC 5APUA 1MJ3A 4WY4D 4MN4C 1BCCJ 1N86A 3R6HA 3H1IG 2F6IA 1EZVD 2FYUK 2YO2A 2ZYGA 2WT7A 2JWAA 2JDIH 1KTMA 2Q35A 1LJ2A 2G8YA 3GHGB 2YNYA 3Q0GA 3PTZA 3LW5J 2E76B 1L4AA 4JBZA 1LTSC 3BVHA 3SWFA 4I6MC 1KN7A 3LAOA 3PHLA 4YLHA 2A45H 3I56P 3PEAA 2VSSA 3M9HA 1FZCB 4OG1A 1T3JA 3O6QA 2FFDB 4U0GH 4K3AA 1EC5A 1LTAC 3WUUA 1S3JA 1BGYG 1EXJA 1SQVE 3L70E 1GW4A 1KB9D 1L0LJ 3GKBA 4Q1IA 1M1JB 3Q0JA 2C0WA 3UIAA 1WT6A 4N78E 1P84E 5INIA 1U7JA 1IJDB 4ZKUA 5AVUB 3ABVC 3FXDA 1HNOA 2ZT9D 3BEZA 2HFED 2AXCA 3CX5D 3CD6P 1H88A 1FE6A 2M8RA 5KJ7C 1CI6B 1N6DA 2W83C 2HPCB 4GODA 1JY2O 4B3IA 3Q5RA 3QK8A 3CI9A 2IBZG 3FWLA 1L0LE 1QX8A 3QH9A 3D71A 1NTZD 3TNUB 1HZDA 3EQ2A 1HNUA 3KQGA 4A7PA 4F47A 1VPCA 4NNQA 4GM2A 1Y7OA 3JSVC 3ST9A 3G9RA 3H81A 2QJKB 3N7NA 4K3WA 1OWAA 2M0BA 4BRYB 1HJBA 3KTHA 1UIYA 1WDMA 3P85A 1S9KE 1Y9BA 4FN8A 5FIFA 1T8ZA 5CMZA 2WSEJ 2IPPA 1G1JA 1SFCB 2YKOA 4KNPA 1BGYD 4GKGA 2HODB 2NP9A 1S5LX 4L6WA 1BCCD 2R3CA 1W2BO 2IYOA 2FYNC 4JF7A 3L70D 1AJYA 2QEXP 5B5EH 5KAIH 4HYTB 5KJ7A 3RL0C 5CBOA 1N73C 2JWDA 4GOEA 2WSCH 1WMKA 2IFNA 2E75D 3RK2D 1DD4A 3AECC 3Q1MA 4ZDBA 3SSUA 1GL2D 5AW5B 3CMAP 2IFMA 3A0BE 2IZ0A 4PD4D 4B86A 4PV1B 3STAA 4WYOB 1Y47A 2PGDA 3U9TB 2YKQA 1PJHA 4I42A 1WDKA 1KILD 4YPCA 3AE3C 2QRXA 1X22A 1NKNA 2FW2A 4H44D 4JFCA 4HH2A 2BEQD 3L75G 1LTJA 2KZIA 1XTGB 5KLIB 2DUBA 3PRJA 2WT7B 1OVUA 1RY3A 1EZVG 3WU2H 4KHXA 2D3TA 4G2RA 1VQKP 1OXZA 1K05A 5IKLB 2IBZE 4JQ0D 1NTKD 2CE3A 1NJIQ 1ZV8A 1NTZJ 3ZW8A 2KSEA 1SZOA 3CC4P 1SFCC 2CBYA 3VOPA 2KXPB 4IFDK 4R4MA 1SQBJ 2F9IA 3Q3DA 1W2XA 1JY2P 4H0LC 3C8VA 2BASA 1VQ5P 4GOFA 1JB0J 1Y8AA 5CHXA 1M57D 3U9SB 2FYUG 1YG6A 3L74G 1FS0E 3L74D 3L72D 1YTZI 2WWWA 3V6IA 5INFA 4K35A 1KB9H 2GA1A 3TT7A 2OYHC 1RF1B 2J59M 2E75C 3RK2C 1SQXD 4W80A 2AEFA 2ZL2A 1OW7A 3M6MA 3NMDA 3SLLA 4WBAA 5G1QA 4HB1A 4JVTA 3WUVA 2KUBA 1L0NE 1UYRA 3V4QA 1NTKG 4OGQC 5K5GB 2ZXEB 1NZYA 2HW5A 1SQQG 1RE4C 2ZL0A 2YIUB 3II6A 4I7ZC 1LT9B 3VN0A 1JM0A 3U1AA 1UIIA 2GUSA 3QXIA 5G1SA 1YJWP 2BEZF 2JO1A 3BPPA 1NVOA 1M8OB 5KJ7D 3H0UA 3R2PA 1KC8Q 1FOSE 3Q7HA 1YJNP 5AW7B 4L73A 4FZWA 3JCUH 2JR8A 2FFDA 3H1HE 3CCUP 2L5GB 3N6RB 4PD4I 5APSA 1KYOI 3R9QA 4D6TJ 3HE5B 2O1JA 5C39A 2RKLA 3L74E 4EOTA 1NHLA 2K88A 1N7SA 1H0TA 1NTKJ 1SFCD 3O8ZA 5CCGC 2N9YB 2NRGA 1S5LH 4KJMA 4OH8B 3B8EB 4IL6E 1IFJA 3P8MC 3TLFA 3H1LE 5L8RJ 1RE3A 1SQBD 1YTZT 2CK3H 1X9VA 2VSUA 1QLED 2BCCD 4IFMA 5C90A 2A81A 3ZWCA 2GTRA 3LW5H 3P5MA 5DKPA 3T89A 2H89C 4I2LC 5KLVJ 3VMAA 3MOYA 4H13D 1PV3A 2Q3EA 4IZCA 3L36A 4C7NB 1SQBE 1SQVK 1OIPA 2YJGA 1S72P 1M56D 2P1JA 4TLFA 3H1KJ 4J2UA 1DX7A 2VX2A 2OYIA 1BCCG 1SFCA 3H1HJ 1RQVA 3PE8A 4I7ZB 3A0HE 4N6JA 4WZ8B 1J2JB 1RF0A 1FZGA 3S4RA 1G2CB 4ZMDA 1SP4A 4KD6A 3CX5I 1UYSA 3HP0A 1LTTC 3QWDA 3IR9A 3HLN1 4AUWA 2WMMA 2VSUF 1PP9E 2Y9ZA 2KS1A 1KYOD 3CMEP 3I47A 1R5LA 4XFJA 5KLVG 1JTHA 3K50A 3CWBG 4Y99C 2Z4EA 2VREA 4O9BA 4TT3H 3CX5E 2Y0DA 1VF5D 1H89A 1UYTA 5DTPA 2DW3A 1PPJG 4L8KA 2YMYA 4ELSA 4WCZA 4LC1A 1NTZE 4QIIA 1KFMA 3GG2A 1GZLA 1CW5A 3SFDC 2HG5D 3M6NA 1ZW0A 4WY4B 3KQFA 2O01J 1U7MA 1EDIA 2GM4A 3I5CA 3L73G 3F5HA 4HKZH 4H0LD 5DJTB 1ZRTD 3CCJP 1GMJA 2RMZA 2KNCA 1LTJC 3TRRA 2PG8A 4ZDFA 1E79H 2KZJA 1GW3A 3L71G 3HRNA 4Z1MH 1SQQJ 3HINA 2V7QJ 3PP5A 2XV5A 1X0UA 1IZNB 2W6AA 3AE1C 2D2CC 1KQGB 1KFNA 4ASWA 1CI6A 1AV1A 3H1LJ 3CXHE 2W6JH 2WPVB 2OYHB 3V2PA 2NPSD 3ISAA 1URQC 2YO3A 3IAVA 2W27A 1HGZA 3H6PA 3TK1A 2A45G 2J5IB 1BDDA 1RE3C 3CWBE 2V4HA 2N1TB 5DZKH 3TVWA 1FDIA 1RQUA 5AVTB 1RF1A 1RH5B 4Q0GA 2K1AA 5APXA 4DOJA 1JXZA 2I8DA 4XA4A 3T97A 3QYRA 5GTIE 3VMXA 3ZDMA 5CCHA 2G3AA 1J1EC 5AVYB 2VSUE 1PPJE 3MGNA 5MGBA 2PRRA 1P84D 1EDKA 2OYIC 1A02J 2K9JA 1YQ4C 2NPSA 1KILA 1EDLA 5AW4B 3ZWAA 1JY2N 2KLUA 1XO6A 1KZUB 2M3EA 4JYJA 4D6TG 1OMIA 3MT6A 1QVFO 1VQ4P 1IK9A 1FZFA 3IBBA 2HLOA 1J1DB 3TVUA 1L0LD 2IZ1A 1KQSO 1NTZK 4WB4A 4U18A 3OJAB 3H25A 4GHNA 3KYQA 1L0NG 2K9YA 3HD7B 1FC2C 1X8YA 3OAKA 4IL6X 3VYIA 4I4ZA 2QJKC 3RBXA 2X24A 1X0TA 1VQ8P 5E0SH 2WPRA 2M5AB 3M91A 1CSBA 3MIWA 3M06A 1LWUB 1SQVJ 2D2CB 4NPDA 4U3FG 3G4SP 1DEEG 5AVSB 4WWIA 1W5CE 2AXTH 1BSHA 1KB9E 4XE5B 4U0HA 1GL2C 4JSBA 3DORA 4HC8A 1LWUC 1IK7A 2QM8A 3A0HH 5CCHC 3D6YA 2ZL3A 3TGUE 3RL0g 1FC7A 3AEBC 2K3RA 2Q5UA 1VQPP 3DJAA 1DH3A 1L0LG 3RL0D 1JO5A 2PAJA 2Y0CA 2ZT9C 4IZDA 3E1RA 1TU3F 4ASVA 1KILE 1YJ9P 4DT0A 3FF6A 3R0OA 3BCCE 2BZRA 5KDRA 3E1IA 1OVRA 2O01N 5APYA 4W7YA 5AVXB 1VQNP 2CPBA 2OTKE 3PLNA 1VRGA 1FZEA 1URQB 3AEFC 3K5BA 4L75A 4ZU2A 4MXIA 5AW8B 1VQOP 2QIWA 1L4AB 1NTMD 1L4AC 3V2RA 1GD2E 2OYHA 5KLVD 2KIKA 2Q6QA 3WMM0 1KB9I 3G71P 4JCQA 3BCCJ 5AW6B 4ELWA 1LNQA 3MD0A 2R44A 3U9RB 3H1ID 1O8UA 1RF0C 2IBZD 3Q2YA 3H1JE 3V5EA 1SQXK 3CC7P 2AEJA 1FAVA 1S9KD 3T8AA 1Q82Q 1SQPE 1YG8A 1JOCA 1WZ8A 3A5TA 1HH0A 5KAIE 2ZL4A 5B5EE 2P7JA 4ZNCA 5CCHD 5BU5A 1KILC 2R5BA 4H13C 4LK5A 2C9NY 2FFDC 3IFMA 4I52A 3A3YB 3FXEA 2WVRA 4OGQD 1PIXA 3VMYA 3HD7C 1DUBA 3PJSK 5CCGA 2H43A 1N6EA 3KDPB 3RGUA 1NTMG 4H44C 4JYLA 1HVVA 4RJTA 4NARA 3NXSA 2FZSA 1SQPG 1VQ6P 1SQXE 2JJLA 4YXWH 1NOHA 1JNMA 1FC6A 2KP8A 1NTME 2XKMA 2WITA 1FU1A 2FYZA 5KAFH 1SQXG 4UB6H 2W6BA 4CPGA 1UIXA 4OMRA 2XNDH 1OVVA 2SPZA 2QQ3A 1SS1A 3CPWO 3T88A 1AQTA 4Y99B 1NTZG 4ASIA 1M1JA 2Q9IA 2LXCB 2K37A 4Z0MA 4C7NA 2Z5IA 5KLVE 3SWYA 3KZIH 3R9SA 2P2UA 3MTUE 5CCGD 3H0SA 3L72E 4MI2A 3B5NB 5B66H 2OYIB 4IL6H 3KZIE 1JMMA 1S5LE 3OMEA 1PFIA 1NTMK 3AE9C 3H1LD 3RSTA 3CLQA 3BRVB 3IF4A 3AEAC 1OX3A 1Q2NA 3S9OA 5C9GA 2BCCE 1RE4A 1L0NJ 1SQPD 4GIFA 2J5SA 3L70G 2YMKA 1Z56A 3GW6A 2QJYB 3FDUA 2K9JB 2QJYC 1LGHB 3L73E 1N73B 2N1TC 5KAFE 1HWTC 1MUUA 3EFGA 2J58A 3B5NA 3W68A 1J1DC 2KS1B 3NJBA 2ZJSE 1AVOA 1NU1G 3H1KE 4AYCA 4EMPA 4U3FJ 1RJNA 1N7SD 4C7RA 3TGUJ 1GL2B 1QL1A 4PV1D 3TF5A 1USDA 4KT0J 2Q2XA 5DU4A 1OFCX 1Q90D 4OVNF 1FDMA 1FBMA 3D6ZA 1LT9A 3L35A 2VSSF 1ZXGA 4JPZB 2WSEH 3NTNA 2RH0A 2XZRA 3KTKA 2A06G 2I1KA 1K32A 1GK6A 2XNXA 1SVFA 3RK3B 3H0QA 4H44B 4GDOA 2QA4P 3B4SA 2FBMA 5EFWB 1NKZB 3TV5A 4WVZA 4R4LA 2O01H 1U57A 2O1KA 4AQRD 2ITAA 3TNUA 3CCQP 3MP7B 1FZCC 3TYYA 3H1LG 2PP6A 4JJTA 3V4WA 2VSUC 3C9IA 1IO4A 2W90A 3M0DC 1NU1J 1EY3A 1AQ5A 1SQQE 2X58A 3ZW9A 1SQPK 2OARA 3TGUG 1VQMP 1BE3G 5HUQA 2A06D 3NFQA 3D70A 5GTHH 1ON3A 2GUVA 5KJPA 2JKVA 3I55P 1L0LK 1AVYA 1A02F 2E76C 5BVZA 1OD4A 1Q81Q 2QJPC 3HE2A 2A06E 3B71A 1ZOYC 3H1JJ 3CCRP 2ZYAA 1P84H 2QSIA 2E74B 4QMAA 4ZDDA 4RYFA 3V5BA 3CWBJ 4H0LB 4UB8H 1T2KC 1SQPJ 3WU2E 3TDCA 2Z5HA 1PL5A 1XTCC 5H2FH 1BE3J 1FZAA 3L3SA 1M1JC 1RF1C 1ZRTE 2F9IB 4OGQB 3BASA 1E5WA 3OT6A 3S1KA 3T97B 4MOUA 4U1AA 3M0AA 5TISH 2KYVA 3MFMA 1DCIA 5JBWA 1PP9D 2EJ5A 3Q1TA 4FZWC 3AE8C 2FYNB 4W7ZA 3TGUD 1KD1Q 4EMLA 2BCCG 2E75B 2YXQB 3RK2B 2I1JA 3GHGA 2QM7A 2NPSC 5DUCA 1NH4A 3L73J 4ZDCA 1PGOA 3TDKA 1T2KD 1BE3E 2LXBA 4YXDC 3W67A 2E42A 3P8CE 3MUDA 1OW6A 1NTMJ 1R5SA 3A0BH 4K2NA 4L76A 4U19A 1EF8A 3CCEP 1QEXA 3L71J 1HGVA 5DU8A 1SQQD 3BCCD 1LTGC 3MHVA 1FDOA 2QE7H 4FN7A 5KKZB 3L72G 1MZ9A 3AE7C 2KK7A 2M5AA 4ZKPA 3H1IJ 2IEXA 3CCSP 3M9QA 1LWUA 1PGQA 1PPJD 1N73A 3HE4A 2XU6A 3L75D 1S4XA 3ITKA 1HBWA 5BU8B 3H0JA 3G3ZA 1IFIA 1XX4A 1L0NK 1FC9A 2H88C 1GL2A 4B3JA 2JP3A 1AFOA 1VF5B 3AE4C 2M3BA 3E7KA 3SWXA 2YXRB 4LLHA 1JY3O 2HPCA 1EZVE 2ZFCA 4JCRA 2B88A 2KLVA 3L71E 4WY4C 2OQQA 5CTBA 1YIJP 2YKPA 2P58A 3HE5A 4FJWD 1G2CA 2LR2A 2E5TA 4PV1C 2FKWB 4KWBA 3H32A 5TISE 1JCCA 5DJUB 3RSIA 5KTBA 4NPFX 1ZN5A 1T3UA 3CWBD 3RRVA 3WG5A 4LGDE 5H2FE 1SQQK 5AW3B 3RL0B 2J5GA 3T8BA 3VP8A 2ZVOB 1IFNA 4FB8A 4DCKA 5JBXA 1KQLA 3HUSA 4U7JA 2Q34A 1NO4A 3G64A 2WTBA 5APVA 3AE2C 1JEKA 4RESB 1K8AQ 3KPEA 3GF7A 2NZ2A 3L75E 3KTIA 2ZQRA 5TJHA 3H32B 1NAFA 3CXHH 3AEEC 1J7XA 2N9BA 1IFDA 5CJ0A 2F9YB 2WTYA 2ZT9B 1PP9G 3BRTB 4WY4A 3B5ND 1HTLC 1SQVG 2R32A 1SQVD 2PPYA 1CZQA 4EMMA 4UB6E 5GTHE 3CCLP 3T3WA 1HUCA 1TYFA 3IAOA 3HUSB 1BDCA 2F6QA 2FYUD 3AE5C 2MKVA 3L71D 2P67A 3FWNA 4EYYQ 1TG6A 5E0SA 3K8XA 2C8TA 2OTLP 2J5II 3QREA 5FUSA 2OGUA 1L4AD 1QVGO 1NU1K 4DJGA 4PJ0H 2HR3A 4JWVA 3HD7A 3TZ3A 2F9YA 2FY8A 3ZWBA 5AVRB 2J5GD 4HNKA 2E76D 4QFEA 1JTHB 5E79E 1NZYB 3H1IE 3U59A 1Q86Q 1K39A 3KTGA 4BWNA 4OLQA 2KOGA 2VSSE 1IC2A 3LKEA 3HTKA 2KB7P 2UZFA 2WPSA 3V5IA 3H1JG 1W2EA 4ZDEA 4JCSA 1K04A 1BGYE 1SQBG 1MFZA 3P7KA 3L37A 1BCCE 4NPEA 4PD4E 4N3YB 3CC2P 4I1LA 3HE4B 1S2EA 1EF9A 5GTIH 2PFXA 2WQYC 2WSSH 4EIJA 5DL1A 1GU4A 1N7SC 3H1HG 2RN0A 3FGAD 2FYUE 2FXMA 2O3JA 3TSIA 2R3SA 1FCFA 1QL2A 1G1IA 1XNYA 3HTKB 4JYBA 2QG4A 4BRYA 3QMJA 4FNDA 1J1EB 4B3HA 5APWA 1NTKK 5E79H 1YITP 2Q3IA 4N78D 2Q7CA 2HODA 1MV8A 2W8ZA 1OD2A 3HRXA 2B89A 5AVVB 1NTKE 3RK3E 4D6TE 1Q7YQ 5CJ4A 2L91A 2FYUJ 2W3PA 1HF9A 3H1JD 2AEMA 3L74J 1XNWA 3L72J 1L2PA 2N1TA 1SG4A 3AEDC 1ON9A 1LP1A 5AVQB 3F89A 1GK4A 3JU1A 1GU5A 4NEKA 3PH0A 1EDJA 5AVWB 3QWOC 5AVZB 3P2LA 3SWKA 1RHZB 1UYVA 1M7LA 2E74C 1JCDA 3QKAA 3R9TA 3G6EP 2Q1KA 3GHGC 2QJPB 2ZYDA 1QGKB 2HYNA 2E74D 3VMZA 4BXLA 3JCUE 1R8EA 1GTWA 1KV4A 1FZCA 2NPSB 3L4FA 1LTJB 2A7KA 1T6AA 1LTIC 1LP1B 3L73D 1NWQA 1DEBA 2MJZA 1H0TB 5CBNA 1NYHA 4HDTA 2IBZI 2N1TD 1DD3A 2IYPA 1EZVI 1JY3P 2B87B 4C46A 3AEGC 1VL2A 4ELXA 1IFMA 3JC22 2UWJE 3M0DA 2OTJP 4YTPC 3VTPC 1EXIA 2J5IA 1WDLA 5KKZC 2ZQQA 3P32A 3GMAA
chains in the Genus database with same CATH topology
3ZWAA 2QSIA 2E74B 2BEQD 1MKMA 1XO6A 4RYFA 4ZDDA 4JYJA 4H0LB 3IB9A 2DUBA 1OMIA 2YIUC 3PGQA 2J5UA 3TDCA 3MT6A 1PL5A 4JOTA 3IBBA 4K29A 3L3SA 3TVUA 1ZRTE 3R4YA 2F9IB 4OGQB 1YQ3C 5DU6A 4U18A 3H25A 3OT6A 4GHNA 3T97B 2D3TA 2K9YA 4MOUA 4G2RA 4U1AA 4U0GA 3MFMA 4IL6X 1K05A 1DCIA 3Q1TA 2EJ5A 4FZWC 5JBWA 3AE8C 4I4ZA 5IKLB 2QJKC 2X24A 4EMLA 5E0SH 2CE3A 4FNBA 2D2CB 5KLIC 1S1CX 2E75B 3ZW8A 5DUCA 5M1BA 1SZOA 4ZDCA 2WSCJ 2CBYA 4YXDC 4U0HA 4JSBA 4R4MA 1KQFB 3DORA 2F9IA 4HC8A 2ZL3A 1IK7A 3Q3DA 3D6YA 1OW6A 3RL0g 1FC7A 2A7SA 3AEBC 4K2NA 1W2XA 4H0LC 5CTCA 4U19A 3C8VA 1EF8A 3DJAA 3KTJA 3H02A 1JB0J 5DU8A 2ZT9C 3U9SB 1FDOA 2WSFJ 1YG6A 4FN7A 4IZDA 1TU3F 3AE7C 2IEXA 1KILE 5INFA 3H0JA 1ZP0C 5E0NX 2PBPA 1OW8A 3OC7A 3TT7A 1XX4A 3FF6A 1FC9A 2E75C 2H88C 3R0OA 4B3JA 2BZRA 2JP3A 5KDRA 2FBWC 2ZL2A 1OW7A 4DI1A 1VF5B 3M6MA 3AE4C 3SLLA 3SWXA 4QIJA 5G1QA 2DEOA 1ZMEC 4Y28J 4RKUJ 2FXPA 4KPKA 4JVTA 3QXZA 4JCRA 1UYRA 4OGQC 2OQQA 5CTBA 1VRGA 1XNVA 5DTWA 1NZYA 2HW5A 1KMIZ 1HJ0A 2ZL0A 3AEFC 4I7ZC 4FJWD 4ZU2A 4MXIA 2IDBA 4PV1C 2QIWA 4H13B 4KWBA 3QXIA 5G1SA 5KDRB 3BPPA 2BEZF 2JO1A 3RSIA 3AE6C 3H0UA 3BF0A 4JCQA 3Q7HA 3RRVA 3BPTA 4ELWA 3WG5A 3GF3A 4FZWA 3U9RB 3NJDA 2J5GA 1O8UA 2D2CD 3T8BA 3Q2YA 3N6RB 3Q5SA 3V5EA 4FB8A 3R9QA 5JBXA 4U7JA 2Q34A 1N6FA 5DUFA 3G64A 3VIVA 3PZKA 2WTBA 3T8AA 3SFEC 3AE2C 3GF7A 1YG8A 2NZ2A 3KTIA 2ZQRA 3AEEC 1WZ8A 1J7XA 3Q5PA 1DIPA 3GLMA 4RYFH 2ZL4A 3TT6A 2F9YB 2ZT9B 1Q52A 3TLFA 3EWKA 2P10A 5L8RJ 4H13C 4LK5A 2PPYA 3IN6A 4EMMA 2VSUA 4JCTA 3T3WA 4I52A 1VF5C 4OGQD 1PIXA 5C90A 1TYFA 2A81A 4RCNA 3IAOA 1DUBA 3ZWCA 2F6QA 2GTRA 3P5MA 3AE5C 1KORA 2MKVA 1N6EA 1Q51A 1NGMB 5G1RA 5INGA 5DZKA 5DKPA 1TG6A 5E0SA 3K8XA 4H44C 4JYLA 2C8TA 4NARA 3T89A 2H89C 2J5II 3QREA 5FUSA 3MOYA 1RJMA 4H13D 2FZSA 3MYBA 1PV3A 4IZCA 1FC6A 2YJGA 4IZBA 4JWVA 3TZ3A 2F9YA 1MJ3A 4J2UA 3ZWBA 2J5GD 4HNKA 2VX2A 3R6HA 2F6IA 1UIXA 2E76D 4OMRA 4QFEA 1RQVA 2QQ3A 3PE8A 4I7ZB 3T88A 1KTMA 2Q35A 1NZYB 2G8YA 4WZ8B 3Q0GA 1K39A 4ASIA 3KTGA 4OLQA 3LW5J 2E76B 4KD6A 1UYSA 2VSSE 4Z0MA 3LAOA 3HP0A 4YLHA 3QWDA 3LKEA 3PEAA 2VSSA 3HLN1 2UZFA 3R9SA 3H0SA 3V5IA 4MI2A 2VSUF 4OG1A 4ZDEA 4JCSA 1K04A 3I47A 4XFJA 3OMEA 3O6QA 4U0GH 3K50A 2VREA 4TT3H 1VF5D 3AE9C 3RSTA 1EXJA 1EF9A 3GKBA 1UYTA 2WQYC 5DTPA 4Q1IA 3AEAC 3S9OA 5C9GA 3Q0JA 5DL1A 4L8KA 3FGAD 2J5SA 4ELSA 4WCZA 2YMKA 5INIA 4QIIA 3ABVC 3FDUA 1FCFA 2QJYC 1HNOA 2ZT9D 3BEZA 1XNYA 3SFDC 3M6NA 3NJBA 1N6DA 3QMJA 4FNDA 3KQFA 4B3IA 4EMPA 2O01J 3Q5RA 3QK8A 1RJNA 4B3HA 4H0LD 4PV1D 3D71A 4KT0J 1HZDA 2Q2XA 5DU4A 1Q90D 1HNUA 3D6ZA 4F47A 4NNQA 2VSSF 1GMJA 1OD2A 4GM2A 3HRXA 1Y7OA 3TRRA 2PG8A 4ZDFA 3ST9A 3KTKA 3G9RA 3RK3E 3H81A 4Z1MH 3HINA 2V7QJ 1K32A 4K3WA 3KTHA 2W3PA 1HF9A 1UIYA 3H0QA 1WDMA 1X0UA 4H44B 3P85A 1XNWA 3AE1C 4GDOA 2D2CC 1KQGB 1SG4A 3AEDC 1ON9A 1Y9BA 4FN8A 5FIFA 2FBMA 2WSEJ 3JU1A 4NEKA 3TV5A 4R4LA 1U57A 2WPVB 4KNPA 3P2LA 1UYVA 4JJTA 2E74C 2NP9A 2VSUC 1S5LX 3QKAA 4L6WA 3ISAA 3R9TA 1EY3A 3IAVA 2X58A 3ZW9A 2FYNC 1AJYA 2J5IB 2E74D 5HUQA 1R8EA 5DZKH 3TVWA 1FDIA 1WMKA 2E75D 1RQUA 2A7KA 3D70A 1ON3A 1DD4A 3AECC 3Q1MA 4ZDBA 5KJPA 4Q0GA 1JXZA 1NYHA 4PV1B 2E76C 3QYRA 4HDTA 3STAA 4WYOB 1DD3A 3U9TB 1OD4A 2G3AA 3AEGC 1PJHA 1VL2A 2QJPC 4ELXA 2VSUE 4I42A 1WDKA 3HE2A 4YTPC 2J5IA 1EXIA 3B71A 5MGBA 1ZOYC 1WDLA 3AE3C 5KKZC 2ZQQA 2FW2A 4H44D 1YQ4C 4JFCA 3GMAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZWA A;  1XO6 A;  4ZDD A;  4RYF A;  4JYJ A;  3IB9 A;  2DUB A;  3PGQ A;  3TDC A;  3MT6 A;  4JOT A;  3IBB A;  4K29 A;  3L3S A;  3TVU A;  2F9I B;  5DU6 A;  4U18 A;  3OT6 A;  4GHN A;  2D3T A;  4MOU A;  4G2R A;  4U1A A;  4U0G A;  3MFM A;  1DCI A;  5JBW A;  3Q1T A;  2EJ5 A;  4FZW C;  4I4Z A;  5IKL B;  2X24 A;  4EML A;  5E0S H;  2CE3 A;  4FNB A;  3ZW8 A;  5DUC A;  1SZO A;  4ZDC A;  2CBY A;  4U0H A;  4JSB A;  3DOR A;  2F9I A;  4HC8 A;  2ZL3 A;  1FC7 A;  2A7S A;  4K2N A;  1W2X A;  5CTC A;  4U19 A;  1EF8 A;  3DJA A;  3KTJ A;  3H02 A;  5DU8 A;  3U9S B;  1YG6 A;  4FN7 A;  4IZD A;  2IEX A;  5INF A;  3H0J A;  5E0N X;  2PBP A;  3OC7 A;  3TT7 A;  1XX4 A;  3FF6 A;  1FC9 A;  3R0O A;  4B3J A;  2BZR A;  5KDR A;  2ZL2 A;  4DI1 A;  3M6M A;  3SLL A;  3SWX A;  4QIJ A;  5G1Q A;  2DEO A;  4KPK A;  4JVT A;  3QXZ A;  4JCR A;  1UYR A;  5CTB A;  1VRG A;  1XNV A;  5DTW A;  1NZY A;  2HW5 A;  2ZL0 A;  4FJW D;  4ZU2 A;  4MXI A;  4KWB A;  5G1S A;  3QXI A;  5KDR B;  3BPP A;  3RSI A;  3H0U A;  3BF0 A;  4JCQ A;  3Q7H A;  3RRV A;  4ELW A;  3WG5 A;  3GF3 A;  4FZW A;  3U9R B;  3NJD A;  2J5G A;  1O8U A;  3T8B A;  3N6R B;  3V5E A;  4FB8 A;  3R9Q A;  5JBX A;  2Q34 A;  1N6F A;  5DUF A;  3G64 A;  3VIV A;  3PZK A;  2WTB A;  3T8A A;  3GF7 A;  1YG8 A;  3KTI A;  2ZQR A;  1WZ8 A;  1J7X A;  3GLM A;  4RYF H;  2ZL4 A;  3TT6 A;  2F9Y B;  1Q52 A;  3TLF A;  4LK5 A;  2PPY A;  4EMM A;  2VSU A;  4JCT A;  3T3W A;  4I52 A;  1PIX A;  5C90 A;  1TYF A;  2A81 A;  4RCN A;  1DUB A;  3ZWC A;  2F6Q A;  2GTR A;  3P5M A;  1N6E A;  1Q51 A;  5G1R A;  5ING A;  5DZK A;  5DKP A;  1TG6 A;  5E0S A;  3K8X A;  4JYL A;  2C8T A;  3T89 A;  2J5I I;  3QRE A;  5FUS A;  3MOY A;  1RJM A;  2FZS A;  3MYB A;  4IZC A;  1FC6 A;  4IZB A;  4JWV A;  3TZ3 A;  2F9Y A;  1MJ3 A;  3ZWB A;  2J5G D;  4HNK A;  2VX2 A;  3R6H A;  2F6I A;  4OMR A;  4QFE A;  2QQ3 A;  3PE8 A;  3T88 A;  2Q35 A;  1NZY B;  4WZ8 B;  3Q0G A;  1K39 A;  4ASI A;  3KTG A;  4OLQ A;  4KD6 A;  1UYS A;  2VSS E;  4Z0M A;  3LAO A;  3HP0 A;  4YLH A;  3QWD A;  3LKE A;  3PEA A;  2VSS A;  3HLN 1;  2UZF A;  3R9S A;  3H0S A;  3V5I A;  4MI2 A;  2VSU F;  4OG1 A;  4ZDE A;  4JCS A;  3I47 A;  3OME A;  4U0G H;  3K50 A;  2VRE A;  3RST A;  1EF9 A;  3GKB A;  1UYT A;  5DTP A;  4Q1I A;  5C9G A;  3Q0J A;  5DL1 A;  4L8K A;  2J5S A;  4ELS A;  4WCZ A;  5INI A;  4QII A;  3FDU A;  1FCF A;  1HNO A;  3BEZ A;  1XNY A;  3M6N A;  1N6D A;  3NJB A;  3QMJ A;  4FND A;  3KQF A;  4B3I A;  4EMP A;  3QK8 A;  1RJN A;  4B3H A;  2Q2X A;  1HZD A;  5DU4 A;  1HNU A;  4F47 A;  4NNQ A;  2VSS F;  1OD2 A;  4GM2 A;  3HRX A;  1Y7O A;  3TRR A;  2PG8 A;  4ZDF A;  3ST9 A;  3KTK A;  3H81 A;  3HIN A;  1K32 A;  4K3W A;  3KTH A;  2W3P A;  1UIY A;  1WDM A;  1X0U A;  3H0Q A;  3P85 A;  1XNW A;  1SG4 A;  1ON9 A;  4FN8 A;  5FIF A;  2FBM A;  3JU1 A;  4NEK A;  3TV5 A;  4KNP A;  3P2L A;  1UYV A;  4JJT A;  2NP9 A;  2VSU C;  3QKA A;  4L6W A;  3ISA A;  3R9T A;  1EY3 A;  3IAV A;  2X58 A;  3ZW9 A;  2J5I B;  5DZK H;  3TVW A;  2A7K A;  1ON3 A;  4ZDB A;  5KJP A;  4Q0G A;  1JXZ A;  3QYR A;  3STA A;  4WYO B;  3U9T B;  1OD4 A;  1PJH A;  4ELX A;  2VSU E;  4I42 A;  1WDK A;  3HE2 A;  2J5I A;  5MGB A;  1WDL A;  2ZQQ A;  2FW2 A;  4JFC A;  3GMA A; 
#chains in the Genus database with same CATH topology
 1USE A;  1KYO H;  3OW2 O;  1MKM A;  5AW9 B;  1SLQ A;  2H7H A;  4M3L A;  4D6T D;  3L75 J;  1URQ D;  3IB9 A;  2YIU C;  3PGQ A;  2KSJ A;  2J5U A;  1BGY J;  3WUT A;  4JOT A;  1VQ9 P;  4K29 A;  2R5D A;  3R4Y A;  1NAY A;  1ZLL A;  3RK3 C;  1YQ3 C;  5DU6 A;  2XDJ A;  3V2Q A;  1L0N D;  3L70 J;  3KHU A;  3VP9 A;  4U0G A;  3CCM P;  1N2D C;  1EQ7 A;  2V7Q H;  2WPQ A;  1KYO E;  3H1H D;  4GT1 A;  4L74 A;  2E43 A;  1ZR4 A;  3USS A;  1PZQ A;  4IFF A;  3RK3 D;  1KIL B;  1YBK A;  4FNB A;  1VQ7 P;  5KLI C;  3OA7 A;  1S1C X;  4U3F D;  5M1B A;  2BCC J;  2JEE A;  1FJP A;  2WSC J;  5APQ A;  1KQF B;  1GDT A;  2WSF H;  2Y0E A;  2Y9Y A;  2A7S A;  3C1L A;  5CTC A;  2VRS A;  3M9B A;  3KTJ A;  3U1C A;  3H02 A;  1X79 B;  3O6Q B;  1LT9 C;  3H1K D;  2WSF J;  1NU1 E;  1IFP A;  1ZR2 A;  3H1K G;  3EFF K;  4PJ0 E;  3CCV P;  1FZB A;  1ZP0 C;  5E0N X;  3V2N A;  1URQ A;  1MFT A;  1LT1 A;  2PBP A;  2ZAE B;  1OW8 A;  3OC7 A;  2FXO A;  4DZO A;  1BSN A;  2POH A;  2C0X A;  2FBW C;  5AW0 B;  4DI1 A;  1NU1 D;  1K9M Q;  4QIJ A;  2DEO A;  1ZME C;  4Y28 J;  3A2A A;  1PGJ A;  4RKU J;  2FXP A;  4KPK A;  1VQL P;  3QXZ A;  1SQB K;  1AA0 A;  2AXT E;  1LTB C;  4IOI H;  1JUN A;  4RO0 A;  2B9B A;  1XNV A;  5DTW A;  1KMI Z;  1HJ0 A;  4HJG H;  1JMB A;  2IDB A;  4EDF A;  4UB8 E;  1YI2 P;  4H13 B;  2KNC B;  2IX7 C;  4JYC A;  4U3F E;  5B66 E;  5KDR B;  1N7S B;  2H8P D;  3HD7 D;  3AE6 C;  3BF0 A;  1P84 I;  5AW1 B;  1YYC A;  1PGP A;  1OZH A;  3BPT A;  3CX5 H;  3GF3 A;  3NJD A;  3FX0 A;  1N7L A;  2ZXX A;  2D2C D;  2WZ7 A;  3Q5S A;  2QVA A;  3BAT A;  1H8A A;  1N6F A;  5DUF A;  5AW2 B;  3VIV A;  3PZK A;  1BE3 D;  3CXH D;  3SFE C;  1SQX J;  1N8R Q;  4OWF A;  1K73 Q;  2OYO A;  4PD4 H;  3CXH I;  3P8C D;  2ZVN B;  3Q5P A;  1DIP A;  3GLM A;  4RYF H;  1D7M A;  2A45 I;  3LIE A;  1PP9 J;  3TT6 A;  3MZW B;  3HUS C;  2B87 A;  1Q52 A;  5APT A;  3B5N C;  3EWK A;  2C9L Y;  2P10 A;  4EI2 A;  3IN6 A;  1YHQ P;  4JCT A;  2KI7 B;  1VF5 C;  2E5Y A;  4RCN A;  3LID A;  5KLV K;  3BCC G;  3RBZ A;  1KOR A;  1Q51 A;  1NGM B;  5G1R A;  5ING A;  5DZK A;  1M1K Q;  1VDF A;  3KXD A;  1RJM A;  1WRG A;  3MYB A;  2LKM A;  1FOS F;  1M90 Q;  3CL3 D;  3N4X A;  2CPS A;  4IZB A;  3A7O A;  1FJK A;  1JY3 N;  3MUD C;  5APU A;  1MJ3 A;  4WY4 D;  4MN4 C;  1BCC J;  1N86 A;  3R6H A;  3H1I G;  2F6I A;  1EZV D;  2FYU K;  2YO2 A;  2ZYG A;  2WT7 A;  2JWA A;  2JDI H;  1KTM A;  2Q35 A;  1LJ2 A;  2G8Y A;  3GHG B;  2YNY A;  3Q0G A;  3PTZ A;  3LW5 J;  2E76 B;  1L4A A;  4JBZ A;  1LTS C;  3BVH A;  3SWF A;  4I6M C;  1KN7 A;  3LAO A;  3PHL A;  4YLH A;  2A45 H;  3I56 P;  3PEA A;  2VSS A;  3M9H A;  1FZC B;  4OG1 A;  1T3J A;  3O6Q A;  2FFD B;  4U0G H;  4K3A A;  1EC5 A;  1LTA C;  3WUU A;  1S3J A;  1BGY G;  1EXJ A;  1SQV E;  3L70 E;  1GW4 A;  1KB9 D;  1L0L J;  3GKB A;  4Q1I A;  1M1J B;  3Q0J A;  2C0W A;  3UIA A;  1WT6 A;  4N78 E;  1P84 E;  5INI A;  1U7J A;  1IJD B;  4ZKU A;  5AVU B;  3ABV C;  3FXD A;  1HNO A;  2ZT9 D;  3BEZ A;  2HFE D;  2AXC A;  3CX5 D;  3CD6 P;  1H88 A;  1FE6 A;  2M8R A;  5KJ7 C;  1CI6 B;  1N6D A;  2W83 C;  2HPC B;  4GOD A;  1JY2 O;  4B3I A;  3Q5R A;  3QK8 A;  3CI9 A;  2IBZ G;  3FWL A;  1L0L E;  1QX8 A;  3QH9 A;  3D71 A;  1NTZ D;  3TNU B;  1HZD A;  3EQ2 A;  1HNU A;  3KQG A;  4A7P A;  4F47 A;  1VPC A;  4NNQ A;  4GM2 A;  1Y7O A;  3JSV C;  3ST9 A;  3G9R A;  3H81 A;  2QJK B;  3N7N A;  4K3W A;  1OWA A;  2M0B A;  4BRY B;  1HJB A;  3KTH A;  1UIY A;  1WDM A;  3P85 A;  1S9K E;  1Y9B A;  4FN8 A;  5FIF A;  1T8Z A;  5CMZ A;  2WSE J;  2IPP A;  1G1J A;  1SFC B;  2YKO A;  4KNP A;  1BGY D;  4GKG A;  2HOD B;  2NP9 A;  1S5L X;  4L6W A;  1BCC D;  2R3C A;  1W2B O;  2IYO A;  2FYN C;  4JF7 A;  3L70 D;  1AJY A;  2QEX P;  5B5E H;  5KAI H;  4HYT B;  5KJ7 A;  3RL0 C;  5CBO A;  1N73 C;  2JWD A;  4GOE A;  2WSC H;  1WMK A;  2IFN A;  2E75 D;  3RK2 D;  1DD4 A;  3AEC C;  3Q1M A;  4ZDB A;  3SSU A;  1GL2 D;  5AW5 B;  3CMA P;  2IFM A;  3A0B E;  2IZ0 A;  4PD4 D;  4B86 A;  4PV1 B;  3STA A;  4WYO B;  1Y47 A;  2PGD A;  3U9T B;  2YKQ A;  1PJH A;  4I42 A;  1WDK A;  1KIL D;  4YPC A;  3AE3 C;  2QRX A;  1X22 A;  1NKN A;  2FW2 A;  4H44 D;  4JFC A;  4HH2 A;  2BEQ D;  3L75 G;  1LTJ A;  2KZI A;  1XTG B;  5KLI B;  2DUB A;  3PRJ A;  2WT7 B;  1OVU A;  1RY3 A;  1EZV G;  3WU2 H;  4KHX A;  2D3T A;  4G2R A;  1VQK P;  1OXZ A;  1K05 A;  5IKL B;  2IBZ E;  4JQ0 D;  1NTK D;  2CE3 A;  1NJI Q;  1ZV8 A;  1NTZ J;  3ZW8 A;  2KSE A;  1SZO A;  3CC4 P;  1SFC C;  2CBY A;  3VOP A;  2KXP B;  4IFD K;  4R4M A;  1SQB J;  2F9I A;  3Q3D A;  1W2X A;  1JY2 P;  4H0L C;  3C8V A;  2BAS A;  1VQ5 P;  4GOF A;  1JB0 J;  1Y8A A;  5CHX A;  1M57 D;  3U9S B;  2FYU G;  1YG6 A;  3L74 G;  1FS0 E;  3L74 D;  3L72 D;  1YTZ I;  2WWW A;  3V6I A;  5INF A;  4K35 A;  1KB9 H;  2GA1 A;  3TT7 A;  2OYH C;  1RF1 B;  2J59 M;  2E75 C;  3RK2 C;  1SQX D;  4W80 A;  2AEF A;  2ZL2 A;  1OW7 A;  3M6M A;  3NMD A;  3SLL A;  4WBA A;  5G1Q A;  4HB1 A;  4JVT A;  3WUV A;  2KUB A;  1L0N E;  1UYR A;  3V4Q A;  1NTK G;  4OGQ C;  5K5G B;  2ZXE B;  1NZY A;  2HW5 A;  1SQQ G;  1RE4 C;  2ZL0 A;  2YIU B;  3II6 A;  4I7Z C;  1LT9 B;  3VN0 A;  1JM0 A;  3U1A A;  1UII A;  2GUS A;  3QXI A;  5G1S A;  1YJW P;  2BEZ F;  2JO1 A;  3BPP A;  1NVO A;  1M8O B;  5KJ7 D;  3H0U A;  3R2P A;  1KC8 Q;  1FOS E;  3Q7H A;  1YJN P;  5AW7 B;  4L73 A;  4FZW A;  3JCU H;  2JR8 A;  2FFD A;  3H1H E;  3CCU P;  2L5G B;  3N6R B;  4PD4 I;  5APS A;  1KYO I;  3R9Q A;  4D6T J;  3HE5 B;  2O1J A;  5C39 A;  2RKL A;  3L74 E;  4EOT A;  1NHL A;  2K88 A;  1N7S A;  1H0T A;  1NTK J;  1SFC D;  3O8Z A;  5CCG C;  2N9Y B;  2NRG A;  1S5L H;  4KJM A;  4OH8 B;  3B8E B;  4IL6 E;  1IFJ A;  3P8M C;  3TLF A;  3H1L E;  5L8R J;  1RE3 A;  1SQB D;  1YTZ T;  2CK3 H;  1X9V A;  2VSU A;  1QLE D;  2BCC D;  4IFM A;  5C90 A;  2A81 A;  3ZWC A;  2GTR A;  3LW5 H;  3P5M A;  5DKP A;  3T89 A;  2H89 C;  4I2L C;  5KLV J;  3VMA A;  3MOY A;  4H13 D;  1PV3 A;  2Q3E A;  4IZC A;  3L36 A;  4C7N B;  1SQB E;  1SQV K;  1OIP A;  2YJG A;  1S72 P;  1M56 D;  2P1J A;  4TLF A;  3H1K J;  4J2U A;  1DX7 A;  2VX2 A;  2OYI A;  1BCC G;  1SFC A;  3H1H J;  1RQV A;  3PE8 A;  4I7Z B;  3A0H E;  4N6J A;  4WZ8 B;  1J2J B;  1RF0 A;  1FZG A;  3S4R A;  1G2C B;  4ZMD A;  1SP4 A;  4KD6 A;  3CX5 I;  1UYS A;  3HP0 A;  1LTT C;  3QWD A;  3IR9 A;  3HLN 1;  4AUW A;  2WMM A;  2VSU F;  1PP9 E;  2Y9Z A;  2KS1 A;  1KYO D;  3CME P;  3I47 A;  1R5L A;  4XFJ A;  5KLV G;  1JTH A;  3K50 A;  3CWB G;  4Y99 C;  2Z4E A;  2VRE A;  4O9B A;  4TT3 H;  3CX5 E;  2Y0D A;  1VF5 D;  1H89 A;  1UYT A;  5DTP A;  2DW3 A;  1PPJ G;  4L8K A;  2YMY A;  4ELS A;  4WCZ A;  4LC1 A;  1NTZ E;  4QII A;  1KFM A;  3GG2 A;  1GZL A;  1CW5 A;  3SFD C;  2HG5 D;  3M6N A;  1ZW0 A;  4WY4 B;  3KQF A;  2O01 J;  1U7M A;  1EDI A;  2GM4 A;  3I5C A;  3L73 G;  3F5H A;  4HKZ H;  4H0L D;  5DJT B;  1ZRT D;  3CCJ P;  1GMJ A;  2RMZ A;  2KNC A;  1LTJ C;  3TRR A;  2PG8 A;  4ZDF A;  1E79 H;  2KZJ A;  1GW3 A;  3L71 G;  3HRN A;  4Z1M H;  1SQQ J;  3HIN A;  2V7Q J;  3PP5 A;  2XV5 A;  1X0U A;  1IZN B;  2W6A A;  3AE1 C;  2D2C C;  1KQG B;  1KFN A;  4ASW A;  1CI6 A;  1AV1 A;  3H1L J;  3CXH E;  2W6J H;  2WPV B;  2OYH B;  3V2P A;  2NPS D;  3ISA A;  1URQ C;  2YO3 A;  3IAV A;  2W27 A;  1HGZ A;  3H6P A;  3TK1 A;  2A45 G;  2J5I B;  1BDD A;  1RE3 C;  3CWB E;  2V4H A;  2N1T B;  5DZK H;  3TVW A;  1FDI A;  1RQU A;  5AVT B;  1RF1 A;  1RH5 B;  4Q0G A;  2K1A A;  5APX A;  4DOJ A;  1JXZ A;  2I8D A;  4XA4 A;  3T97 A;  3QYR A;  5GTI E;  3VMX A;  3ZDM A;  5CCH A;  2G3A A;  1J1E C;  5AVY B;  2VSU E;  1PPJ E;  3MGN A;  5MGB A;  2PRR A;  1P84 D;  1EDK A;  2OYI C;  1A02 J;  2K9J A;  1YQ4 C;  2NPS A;  1KIL A;  1EDL A;  5AW4 B;  3ZWA A;  1JY2 N;  2KLU A;  1XO6 A;  1KZU B;  2M3E A;  4JYJ A;  4D6T G;  1OMI A;  3MT6 A;  1QVF O;  1VQ4 P;  1IK9 A;  1FZF A;  3IBB A;  2HLO A;  1J1D B;  3TVU A;  1L0L D;  2IZ1 A;  1KQS O;  1NTZ K;  4WB4 A;  4U18 A;  3OJA B;  3H25 A;  4GHN A;  3KYQ A;  1L0N G;  2K9Y A;  3HD7 B;  1FC2 C;  1X8Y A;  3OAK A;  4IL6 X;  3VYI A;  4I4Z A;  2QJK C;  3RBX A;  2X24 A;  1X0T A;  1VQ8 P;  5E0S H;  2WPR A;  2M5A B;  3M91 A;  1CSB A;  3MIW A;  3M06 A;  1LWU B;  1SQV J;  2D2C B;  4NPD A;  4U3F G;  3G4S P;  1DEE G;  5AVS B;  4WWI A;  1W5C E;  2AXT H;  1BSH A;  1KB9 E;  4XE5 B;  4U0H A;  1GL2 C;  4JSB A;  3DOR A;  4HC8 A;  1LWU C;  1IK7 A;  2QM8 A;  3A0H H;  5CCH C;  3D6Y A;  2ZL3 A;  3TGU E;  3RL0 g;  1FC7 A;  3AEB C;  2K3R A;  2Q5U A;  1VQP P;  3DJA A;  1DH3 A;  1L0L G;  3RL0 D;  1JO5 A;  2PAJ A;  2Y0C A;  2ZT9 C;  4IZD A;  3E1R A;  1TU3 F;  4ASV A;  1KIL E;  1YJ9 P;  4DT0 A;  3FF6 A;  3R0O A;  3BCC E;  2BZR A;  5KDR A;  3E1I A;  1OVR A;  2O01 N;  5APY A;  4W7Y A;  5AVX B;  1VQN P;  2CPB A;  2OTK E;  3PLN A;  1VRG A;  1FZE A;  1URQ B;  3AEF C;  3K5B A;  4L75 A;  4ZU2 A;  4MXI A;  5AW8 B;  1VQO P;  2QIW A;  1L4A B;  1NTM D;  1L4A C;  3V2R A;  1GD2 E;  2OYH A;  5KLV D;  2KIK A;  2Q6Q A;  3WMM 0;  1KB9 I;  3G71 P;  4JCQ A;  3BCC J;  5AW6 B;  4ELW A;  1LNQ A;  3MD0 A;  2R44 A;  3U9R B;  3H1I D;  1O8U A;  1RF0 C;  2IBZ D;  3Q2Y A;  3H1J E;  3V5E A;  1SQX K;  3CC7 P;  2AEJ A;  1FAV A;  1S9K D;  3T8A A;  1Q82 Q;  1SQP E;  1YG8 A;  1JOC A;  1WZ8 A;  3A5T A;  1HH0 A;  5KAI E;  2ZL4 A;  5B5E E;  2P7J A;  4ZNC A;  5CCH D;  5BU5 A;  1KIL C;  2R5B A;  4H13 C;  4LK5 A;  2C9N Y;  2FFD C;  3IFM A;  4I52 A;  3A3Y B;  3FXE A;  2WVR A;  4OGQ D;  1PIX A;  3VMY A;  3HD7 C;  1DUB A;  3PJS K;  5CCG A;  2H43 A;  1N6E A;  3KDP B;  3RGU A;  1NTM G;  4H44 C;  4JYL A;  1HVV A;  4RJT A;  4NAR A;  3NXS A;  2FZS A;  1SQP G;  1VQ6 P;  1SQX E;  2JJL A;  4YXW H;  1NOH A;  1JNM A;  1FC6 A;  2KP8 A;  1NTM E;  2XKM A;  2WIT A;  1FU1 A;  2FYZ A;  5KAF H;  1SQX G;  4UB6 H;  2W6B A;  4CPG A;  1UIX A;  4OMR A;  2XND H;  1OVV A;  2SPZ A;  2QQ3 A;  1SS1 A;  3CPW O;  3T88 A;  1AQT A;  4Y99 B;  1NTZ G;  4ASI A;  1M1J A;  2Q9I A;  2LXC B;  2K37 A;  4Z0M A;  4C7N A;  2Z5I A;  5KLV E;  3SWY A;  3KZI H;  3R9S A;  2P2U A;  3MTU E;  5CCG D;  3H0S A;  3L72 E;  4MI2 A;  3B5N B;  5B66 H;  2OYI B;  4IL6 H;  3KZI E;  1JMM A;  1S5L E;  3OME A;  1PFI A;  1NTM K;  3AE9 C;  3H1L D;  3RST A;  3CLQ A;  3BRV B;  3IF4 A;  3AEA C;  1OX3 A;  1Q2N A;  3S9O A;  5C9G A;  2BCC E;  1RE4 A;  1L0N J;  1SQP D;  4GIF A;  2J5S A;  3L70 G;  2YMK A;  1Z56 A;  3GW6 A;  2QJY B;  3FDU A;  2K9J B;  2QJY C;  1LGH B;  3L73 E;  1N73 B;  2N1T C;  5KAF E;  1HWT C;  1MUU A;  3EFG A;  2J58 A;  3B5N A;  3W68 A;  1J1D C;  2KS1 B;  3NJB A;  2ZJS E;  1AVO A;  1NU1 G;  3H1K E;  4AYC A;  4EMP A;  4U3F J;  1RJN A;  1N7S D;  4C7R A;  3TGU J;  1GL2 B;  1QL1 A;  4PV1 D;  3TF5 A;  1USD A;  4KT0 J;  2Q2X A;  5DU4 A;  1OFC X;  1Q90 D;  4OVN F;  1FDM A;  1FBM A;  3D6Z A;  1LT9 A;  3L35 A;  2VSS F;  1ZXG A;  4JPZ B;  2WSE H;  3NTN A;  2RH0 A;  2XZR A;  3KTK A;  2A06 G;  2I1K A;  1K32 A;  1GK6 A;  2XNX A;  1SVF A;  3RK3 B;  3H0Q A;  4H44 B;  4GDO A;  2QA4 P;  3B4S A;  2FBM A;  5EFW B;  1NKZ B;  3TV5 A;  4WVZ A;  4R4L A;  2O01 H;  1U57 A;  2O1K A;  4AQR D;  2ITA A;  3TNU A;  3CCQ P;  3MP7 B;  1FZC C;  3TYY A;  3H1L G;  2PP6 A;  4JJT A;  3V4W A;  2VSU C;  3C9I A;  1IO4 A;  2W90 A;  3M0D C;  1NU1 J;  1EY3 A;  1AQ5 A;  1SQQ E;  2X58 A;  3ZW9 A;  1SQP K;  2OAR A;  3TGU G;  1VQM P;  1BE3 G;  5HUQ A;  2A06 D;  3NFQ A;  3D70 A;  5GTH H;  1ON3 A;  2GUV A;  5KJP A;  2JKV A;  3I55 P;  1L0L K;  1AVY A;  1A02 F;  2E76 C;  5BVZ A;  1OD4 A;  1Q81 Q;  2QJP C;  3HE2 A;  2A06 E;  3B71 A;  1ZOY C;  3H1J J;  3CCR P;  2ZYA A;  1P84 H;  2QSI A;  2E74 B;  4QMA A;  4ZDD A;  4RYF A;  3V5B A;  3CWB J;  4H0L B;  4UB8 H;  1T2K C;  1SQP J;  3WU2 E;  3TDC A;  2Z5H A;  1PL5 A;  1XTC C;  5H2F H;  1BE3 J;  1FZA A;  3L3S A;  1M1J C;  1RF1 C;  1ZRT E;  2F9I B;  4OGQ B;  3BAS A;  1E5W A;  3OT6 A;  3S1K A;  3T97 B;  4MOU A;  4U1A A;  3M0A A;  5TIS H;  2KYV A;  3MFM A;  1DCI A;  5JBW A;  1PP9 D;  2EJ5 A;  3Q1T A;  4FZW C;  3AE8 C;  2FYN B;  4W7Z A;  3TGU D;  1KD1 Q;  4EML A;  2BCC G;  2E75 B;  2YXQ B;  3RK2 B;  2I1J A;  3GHG A;  2QM7 A;  2NPS C;  5DUC A;  1NH4 A;  3L73 J;  4ZDC A;  1PGO A;  3TDK A;  1T2K D;  1BE3 E;  2LXB A;  4YXD C;  3W67 A;  2E42 A;  3P8C E;  3MUD A;  1OW6 A;  1NTM J;  1R5S A;  3A0B H;  4K2N A;  4L76 A;  4U19 A;  1EF8 A;  3CCE P;  1QEX A;  3L71 J;  1HGV A;  5DU8 A;  1SQQ D;  3BCC D;  1LTG C;  3MHV A;  1FDO A;  2QE7 H;  4FN7 A;  5KKZ B;  3L72 G;  1MZ9 A;  3AE7 C;  2KK7 A;  2M5A A;  4ZKP A;  3H1I J;  2IEX A;  3CCS P;  3M9Q A;  1LWU A;  1PGQ A;  1PPJ D;  1N73 A;  3HE4 A;  2XU6 A;  3L75 D;  1S4X A;  3ITK A;  1HBW A;  5BU8 B;  3H0J A;  3G3Z A;  1IFI A;  1XX4 A;  1L0N K;  1FC9 A;  2H88 C;  1GL2 A;  4B3J A;  2JP3 A;  1AFO A;  1VF5 B;  3AE4 C;  2M3B A;  3E7K A;  3SWX A;  2YXR B;  4LLH A;  1JY3 O;  2HPC A;  1EZV E;  2ZFC A;  4JCR A;  2B88 A;  2KLV A;  3L71 E;  4WY4 C;  2OQQ A;  5CTB A;  1YIJ P;  2YKP A;  2P58 A;  3HE5 A;  4FJW D;  1G2C A;  2LR2 A;  2E5T A;  4PV1 C;  2FKW B;  4KWB A;  3H32 A;  5TIS E;  1JCC A;  5DJU B;  3RSI A;  5KTB A;  4NPF X;  1ZN5 A;  1T3U A;  3CWB D;  3RRV A;  3WG5 A;  4LGD E;  5H2F E;  1SQQ K;  5AW3 B;  3RL0 B;  2J5G A;  3T8B A;  3VP8 A;  2ZVO B;  1IFN A;  4FB8 A;  4DCK A;  5JBX A;  1KQL A;  3HUS A;  4U7J A;  2Q34 A;  1NO4 A;  3G64 A;  2WTB A;  5APV A;  3AE2 C;  1JEK A;  4RES B;  1K8A Q;  3KPE A;  3GF7 A;  2NZ2 A;  3L75 E;  3KTI A;  2ZQR A;  5TJH A;  3H32 B;  1NAF A;  3CXH H;  3AEE C;  1J7X A;  2N9B A;  1IFD A;  5CJ0 A;  2F9Y B;  2WTY A;  2ZT9 B;  1PP9 G;  3BRT B;  4WY4 A;  3B5N D;  1HTL C;  1SQV G;  2R32 A;  1SQV D;  2PPY A;  1CZQ A;  4EMM A;  4UB6 E;  5GTH E;  3CCL P;  3T3W A;  1HUC A;  1TYF A;  3IAO A;  3HUS B;  1BDC A;  2F6Q A;  2FYU D;  3AE5 C;  2MKV A;  3L71 D;  2P67 A;  3FWN A;  4EYY Q;  1TG6 A;  5E0S A;  3K8X A;  2C8T A;  2OTL P;  2J5I I;  3QRE A;  5FUS A;  2OGU A;  1L4A D;  1QVG O;  1NU1 K;  4DJG A;  4PJ0 H;  2HR3 A;  4JWV A;  3HD7 A;  3TZ3 A;  2F9Y A;  2FY8 A;  3ZWB A;  5AVR B;  2J5G D;  4HNK A;  2E76 D;  4QFE A;  1JTH B;  5E79 E;  1NZY B;  3H1I E;  3U59 A;  1Q86 Q;  1K39 A;  3KTG A;  4BWN A;  4OLQ A;  2KOG A;  2VSS E;  1IC2 A;  3LKE A;  3HTK A;  2KB7 P;  2UZF A;  2WPS A;  3V5I A;  3H1J G;  1W2E A;  4ZDE A;  4JCS A;  1K04 A;  1BGY E;  1SQB G;  1MFZ A;  3P7K A;  3L37 A;  1BCC E;  4NPE A;  4PD4 E;  4N3Y B;  3CC2 P;  4I1L A;  3HE4 B;  1S2E A;  1EF9 A;  5GTI H;  2PFX A;  2WQY C;  2WSS H;  4EIJ A;  5DL1 A;  1GU4 A;  1N7S C;  3H1H G;  2RN0 A;  3FGA D;  2FYU E;  2FXM A;  2O3J A;  3TSI A;  2R3S A;  1FCF A;  1QL2 A;  1G1I A;  1XNY A;  3HTK B;  4JYB A;  2QG4 A;  4BRY A;  3QMJ A;  4FND A;  1J1E B;  4B3H A;  5APW A;  1NTK K;  5E79 H;  1YIT P;  2Q3I A;  4N78 D;  2Q7C A;  2HOD A;  1MV8 A;  2W8Z A;  1OD2 A;  3HRX A;  2B89 A;  5AVV B;  1NTK E;  3RK3 E;  4D6T E;  1Q7Y Q;  5CJ4 A;  2L91 A;  2FYU J;  2W3P A;  1HF9 A;  3H1J D;  2AEM A;  3L74 J;  1XNW A;  3L72 J;  1L2P A;  2N1T A;  1SG4 A;  3AED C;  1ON9 A;  1LP1 A;  5AVQ B;  3F89 A;  1GK4 A;  3JU1 A;  1GU5 A;  4NEK A;  3PH0 A;  1EDJ A;  5AVW B;  3QWO C;  5AVZ B;  3P2L A;  3SWK A;  1RHZ B;  1UYV A;  1M7L A;  2E74 C;  1JCD A;  3QKA A;  3R9T A;  3G6E P;  2Q1K A;  3GHG C;  2QJP B;  2ZYD A;  1QGK B;  2HYN A;  2E74 D;  3VMZ A;  4BXL A;  3JCU E;  1R8E A;  1GTW A;  1KV4 A;  1FZC A;  2NPS B;  3L4F A;  1LTJ B;  2A7K A;  1T6A A;  1LTI C;  1LP1 B;  3L73 D;  1NWQ A;  1DEB A;  2MJZ A;  1H0T B;  5CBN A;  1NYH A;  4HDT A;  2IBZ I;  2N1T D;  1DD3 A;  2IYP A;  1EZV I;  1JY3 P;  2B87 B;  4C46 A;  3AEG C;  1VL2 A;  4ELX A;  1IFM A;  3JC2 2;  2UWJ E;  3M0D A;  2OTJ P;  4YTP C;  3VTP C;  1EXI A;  2J5I A;  1WDL A;  5KKZ C;  2ZQQ A;  3P32 A;  3GMA A; 
#chains in the Genus database with same CATH homology
 3ZWA A;  2QSI A;  2E74 B;  2BEQ D;  1MKM A;  1XO6 A;  4RYF A;  4ZDD A;  4JYJ A;  4H0L B;  3IB9 A;  2DUB A;  1OMI A;  2YIU C;  3PGQ A;  2J5U A;  3TDC A;  3MT6 A;  1PL5 A;  4JOT A;  3IBB A;  4K29 A;  3L3S A;  3TVU A;  1ZRT E;  3R4Y A;  2F9I B;  4OGQ B;  1YQ3 C;  5DU6 A;  4U18 A;  3H25 A;  3OT6 A;  4GHN A;  3T97 B;  2D3T A;  2K9Y A;  4MOU A;  4G2R A;  4U1A A;  4U0G A;  3MFM A;  4IL6 X;  1K05 A;  1DCI A;  3Q1T A;  2EJ5 A;  4FZW C;  5JBW A;  3AE8 C;  4I4Z A;  5IKL B;  2QJK C;  2X24 A;  4EML A;  5E0S H;  2CE3 A;  4FNB A;  2D2C B;  5KLI C;  1S1C X;  2E75 B;  3ZW8 A;  5DUC A;  5M1B A;  1SZO A;  4ZDC A;  2WSC J;  2CBY A;  4YXD C;  4U0H A;  4JSB A;  4R4M A;  1KQF B;  3DOR A;  2F9I A;  4HC8 A;  2ZL3 A;  1IK7 A;  3Q3D A;  3D6Y A;  1OW6 A;  3RL0 g;  1FC7 A;  2A7S A;  3AEB C;  4K2N A;  1W2X A;  4H0L C;  5CTC A;  4U19 A;  3C8V A;  1EF8 A;  3DJA A;  3KTJ A;  3H02 A;  1JB0 J;  5DU8 A;  2ZT9 C;  3U9S B;  1FDO A;  2WSF J;  1YG6 A;  4FN7 A;  4IZD A;  1TU3 F;  3AE7 C;  2IEX A;  1KIL E;  5INF A;  3H0J A;  1ZP0 C;  5E0N X;  2PBP A;  1OW8 A;  3OC7 A;  3TT7 A;  1XX4 A;  3FF6 A;  1FC9 A;  2E75 C;  2H88 C;  3R0O A;  4B3J A;  2BZR A;  2JP3 A;  5KDR A;  2FBW C;  2ZL2 A;  1OW7 A;  4DI1 A;  1VF5 B;  3M6M A;  3AE4 C;  3SLL A;  3SWX A;  4QIJ A;  5G1Q A;  2DEO A;  1ZME C;  4Y28 J;  4RKU J;  2FXP A;  4KPK A;  4JVT A;  3QXZ A;  4JCR A;  1UYR A;  4OGQ C;  2OQQ A;  5CTB A;  1VRG A;  1XNV A;  5DTW A;  1NZY A;  2HW5 A;  1KMI Z;  1HJ0 A;  2ZL0 A;  3AEF C;  4I7Z C;  4FJW D;  4ZU2 A;  4MXI A;  2IDB A;  4PV1 C;  2QIW A;  4H13 B;  4KWB A;  3QXI A;  5G1S A;  5KDR B;  3BPP A;  2BEZ F;  2JO1 A;  3RSI A;  3AE6 C;  3H0U A;  3BF0 A;  4JCQ A;  3Q7H A;  3RRV A;  3BPT A;  4ELW A;  3WG5 A;  3GF3 A;  4FZW A;  3U9R B;  3NJD A;  2J5G A;  1O8U A;  2D2C D;  3T8B A;  3Q2Y A;  3N6R B;  3Q5S A;  3V5E A;  4FB8 A;  3R9Q A;  5JBX A;  4U7J A;  2Q34 A;  1N6F A;  5DUF A;  3G64 A;  3VIV A;  3PZK A;  2WTB A;  3T8A A;  3SFE C;  3AE2 C;  3GF7 A;  1YG8 A;  2NZ2 A;  3KTI A;  2ZQR A;  3AEE C;  1WZ8 A;  1J7X A;  3Q5P A;  1DIP A;  3GLM A;  4RYF H;  2ZL4 A;  3TT6 A;  2F9Y B;  2ZT9 B;  1Q52 A;  3TLF A;  3EWK A;  2P10 A;  5L8R J;  4H13 C;  4LK5 A;  2PPY A;  3IN6 A;  4EMM A;  2VSU A;  4JCT A;  3T3W A;  4I52 A;  1VF5 C;  4OGQ D;  1PIX A;  5C90 A;  1TYF A;  2A81 A;  4RCN A;  3IAO A;  1DUB A;  3ZWC A;  2F6Q A;  2GTR A;  3P5M A;  3AE5 C;  1KOR A;  2MKV A;  1N6E A;  1Q51 A;  1NGM B;  5G1R A;  5ING A;  5DZK A;  5DKP A;  1TG6 A;  5E0S A;  3K8X A;  4H44 C;  4JYL A;  2C8T A;  4NAR A;  3T89 A;  2H89 C;  2J5I I;  3QRE A;  5FUS A;  3MOY A;  1RJM A;  4H13 D;  2FZS A;  3MYB A;  1PV3 A;  4IZC A;  1FC6 A;  2YJG A;  4IZB A;  4JWV A;  3TZ3 A;  2F9Y A;  1MJ3 A;  4J2U A;  3ZWB A;  2J5G D;  4HNK A;  2VX2 A;  3R6H A;  2F6I A;  1UIX A;  2E76 D;  4OMR A;  4QFE A;  1RQV A;  2QQ3 A;  3PE8 A;  4I7Z B;  3T88 A;  1KTM A;  2Q35 A;  1NZY B;  2G8Y A;  4WZ8 B;  3Q0G A;  1K39 A;  4ASI A;  3KTG A;  4OLQ A;  3LW5 J;  2E76 B;  4KD6 A;  1UYS A;  2VSS E;  4Z0M A;  3LAO A;  3HP0 A;  4YLH A;  3QWD A;  3LKE A;  3PEA A;  2VSS A;  3HLN 1;  2UZF A;  3R9S A;  3H0S A;  3V5I A;  4MI2 A;  2VSU F;  4OG1 A;  4ZDE A;  4JCS A;  1K04 A;  3I47 A;  4XFJ A;  3OME A;  3O6Q A;  4U0G H;  3K50 A;  2VRE A;  4TT3 H;  1VF5 D;  3AE9 C;  3RST A;  1EXJ A;  1EF9 A;  3GKB A;  1UYT A;  2WQY C;  5DTP A;  4Q1I A;  3AEA C;  3S9O A;  5C9G A;  3Q0J A;  5DL1 A;  4L8K A;  3FGA D;  2J5S A;  4ELS A;  4WCZ A;  2YMK A;  5INI A;  4QII A;  3ABV C;  3FDU A;  1FCF A;  2QJY C;  1HNO A;  2ZT9 D;  3BEZ A;  1XNY A;  3SFD C;  3M6N A;  3NJB A;  1N6D A;  3QMJ A;  4FND A;  3KQF A;  4B3I A;  4EMP A;  2O01 J;  3Q5R A;  3QK8 A;  1RJN A;  4B3H A;  4H0L D;  4PV1 D;  3D71 A;  4KT0 J;  1HZD A;  2Q2X A;  5DU4 A;  1Q90 D;  1HNU A;  3D6Z A;  4F47 A;  4NNQ A;  2VSS F;  1GMJ A;  1OD2 A;  4GM2 A;  3HRX A;  1Y7O A;  3TRR A;  2PG8 A;  4ZDF A;  3ST9 A;  3KTK A;  3G9R A;  3RK3 E;  3H81 A;  4Z1M H;  3HIN A;  2V7Q J;  1K32 A;  4K3W A;  3KTH A;  2W3P A;  1HF9 A;  1UIY A;  3H0Q A;  1WDM A;  1X0U A;  4H44 B;  3P85 A;  1XNW A;  3AE1 C;  4GDO A;  2D2C C;  1KQG B;  1SG4 A;  3AED C;  1ON9 A;  1Y9B A;  4FN8 A;  5FIF A;  2FBM A;  2WSE J;  3JU1 A;  4NEK A;  3TV5 A;  4R4L A;  1U57 A;  2WPV B;  4KNP A;  3P2L A;  1UYV A;  4JJT A;  2E74 C;  2NP9 A;  2VSU C;  1S5L X;  3QKA A;  4L6W A;  3ISA A;  3R9T A;  1EY3 A;  3IAV A;  2X58 A;  3ZW9 A;  2FYN C;  1AJY A;  2J5I B;  2E74 D;  5HUQ A;  1R8E A;  5DZK H;  3TVW A;  1FDI A;  1WMK A;  2E75 D;  1RQU A;  2A7K A;  3D70 A;  1ON3 A;  1DD4 A;  3AEC C;  3Q1M A;  4ZDB A;  5KJP A;  4Q0G A;  1JXZ A;  1NYH A;  4PV1 B;  2E76 C;  3QYR A;  4HDT A;  3STA A;  4WYO B;  1DD3 A;  3U9T B;  1OD4 A;  2G3A A;  3AEG C;  1PJH A;  1VL2 A;  2QJP C;  4ELX A;  2VSU E;  4I42 A;  1WDK A;  3HE2 A;  4YTP C;  2J5I A;  1EXI A;  3B71 A;  5MGB A;  1ZOY C;  1WDL A;  3AE3 C;  5KKZ C;  2ZQQ A;  2FW2 A;  4H44 D;  1YQ4 C;  4JFC A;  3GMA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...