3ZW8A

Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) in apo form
Total Genus 277
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
277
sequence length
725
structure length
725
Chain Sequence
PRGSHMAEYLRLPHSLAMIRLCNPPVNAVSPTVIREVRNGLQKAGSDHTVKAIVICGANGNFCAGADIHGFSAFTPGLALGSLVDEIQRYQKPVLAAIQGVALGGGLELALGCHYRIANAKARVGLPEVTLGILPGARGTQLLPRVVGVPVALDLITSGKYLSADEALRLGILDAVVKSDPVEEAIKFAQKIIDKPIEPRRIFNKPVPSLPNMDSVFAEAIAKVRKQYPGVLAPETCVRSIQASVKHPYEVGIKEEEKLFMYLRASGQAKALQYAFFAEKSANKWSTPSGASWKTASAQPVSSVGVLGLGTMGRGIAISFARVGISVVAVESDPKQLDAAKKIITFTLEKEASRAHQNGQASAKPKLRFSSSTKELSTVDLVVEAVFEDMNLKKKVFAELSALCKPGAFLCTNTSALNVDDIASSTDRPQLVIGTHFFSPAHVMRLLEVIPSRYSSPTTIATVMSLSKKIGKIGVVVGNCYGFVGNRMLAPYYNQGFFLLEEGSKPEDVDGVLEEFGFKMGPFRVSDLAGLDVGWKIRKGQGLTGPSLPPGTPVRKRGNSRYSPLGDMLCEAGRFGQKTGKGWYQYDKPLGRIHKPDPWLSTFLSQYREVHHIEQRTISKEEILERCLYSLINEAFRILEEGMAARPEHIDVIYLHGYGWPRHKGGPMFYAASVGLPTVLEKLQKYYRQNPDIPQLEPSDYLRRLVAQGSPPLKEWQSLAGPHGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Isomerase and Hydratase Reaction Mechanism of the Crotonase Active Site of the Multifunctional Enzyme (Type-1), as Deduced from Structures of Complexes with 3S-Hydroxy- Acyl-Coa.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
molecule keywords PEROXISOMAL BIFUNCTIONAL ENZYME
total genus 277
structure length 725
sequence length 725
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.50 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3zw8A03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3zw8A02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3zw8A01
1EVZA 2GGSA 1BG6A 4DVJA 3WFIA 4J43A 3EY4A 1M75A 3ZWOA 4D3DA 3DOJA 5DTPA 1LSJA 1YQDA 2WD7A 2ZTLA 3O8QB 7ADHA 1Q2XA 4HUJA 4II2A 1UR5A 5K6AA 5FIFA 1HF3A 1RYEA 4AJPA 3ETEA 1OMOA 2DFVA 3QWAA 3T7CA 4NU5A 1NPTO 5U9CA 2VNAA 1ADCA 1OOEA 2BGLA 1N6EA 1ENYA 2BZRA 2J5RA 4GX1A 2PD4A 3JD4A 4RF5A 4EYEA 4DYDA 2R6JA 3VKVA 1PJ2A 2HW5A 1KBZA 2Y05A 3W4KA 3GLQA 3GUCA 3LQFA 1C3VA 3QIVA 4IDEA 4Y8VA 1OZAA 1PJBA 1DIGA 4DXHA 3MOGA 1NYTA 2CSUA 2VYVA 1GFSA 3SC6A 1YQXA 2YW9A 4NBVA 4J16A 1OD2A 1A4UA 2JFFA 2BGKA 1KEVA 4BO4A 4TVOA 1KEUA 5TF4A 3WOHA 2Z95A 4Y6SA 3UN1A 3U9RB 2FPIA 5IXYA 3QWBA 1NASA 1KVSA 3GVXA 1P3DA 1S7CA 4R1SA 3K9QO 5JNLA 4GLOA 3GFBA 3HQ4O 4GAEA 4CM4B 3QWDA 2BI8A 3STHA 4AL4A 2FBMA 3U49A 2CVQA 3TZKA 4YDRA 3OJLA 5JDIA 2H1SA 5CDYA 5KJFA 4XRGA 2G0TA 3AUTA 4WK6A 3ZWYA 2DFDA 1OAAA 6ADHA 3ITDA 2J3JA 2NNLD 4NPCA 5CEFA 2R00A 3TJRA 1ZEJA 4YT8A 5F3RA 2ZQZA 4JSBA 1XYGA 3DBHA 2EV9A 1UZLA 3W4IA 3PRJA 1XKQA 2E82A 3H02A 2VYVD 3I9KA 3K92A 4KQWA 5FUSA 1N5DA 3PQDA 4GVLA 3ST7A 1EE9A 4R9SA 2VTEA 3L3SA 1CRWG 3AOGA 4PLVA 3H9QA 4YVFA 2O3JA 2Y1GA 3RROA 5CDTA 1HT0A 2VHVA 3HNPA 3QHAA 5BT9A 5L4SA 5BR7A 2AEJA 5G0UA 1LDYA 2VSUC 4LGVA 3STAA 4LN1A 1YS4A 4R5MA 4HXYA 1LI4A 3KEQA 3QW2A 2PD6A 4CL3A 5JYDA 2VN8A 3RUHA 2PK3A 2D3TA 4RPLA 2P91A 2UV8A 1K6XA 4LMPA 4XYMA 1NBOA 4KTVE 4DLAA 1A72A 4K3WA 1UH5A 3L4BC 4E6PA 1ZNQO 4Q3AA 1GQYA 3TV5A 1DC3A 3L6OO 4NBWA 4F46A 2C54A 4JIGA 1SEPA 2POQX 3KHUA 5KWEA 3V1TC 4MXIA 4G2NA 3S2FA 5KOIA 3KTGA 4RPHA 5INIA 1PJLA 2YDXA 4IJWA 3GEDA 2VTDA 1NFQA 2AQ8A 4MOUA 4U1AA 4U6SA 4ZICA 3WGZA 2W98A 4BV9A 2D5CA 1M67A 5CTBA 4XYGA 1HE5A 2VNSA 5DP2A 3WYCA 3PYLA 4WNCA 3VZRA 2A92A 3ENNA 3KYCA 1GU7A 3D4NA 2AQHA 3C7DB 4E2WA 3DJAA 4Z6KA 3ZWAA 1IL0A 2W2LD 3GR6A 1LX6A 4FW8A 5DCUA 3QA9A 3R1IA 4X54A 5EMHA 4GGOA 4UVEA 3K31A 4TQGA 3DHEA 3K50A 4M54A 4GGPA 4QX6A 1V3TA 3H0UA 2Q4BA 2VRCA 3H5RA 3RVDA 3JQ7B 4ZGWA 3RC9A 4D46A 3LT2A 3EZLA 3MZ0A 5AXCA 4BO0A 2OMEA 5L4LA 1E6EA 3RI3A 1X0UA 2VWQA 3MFMA 3KSZO 3BMOB 3RUCA 1P44A 3G49A 3BMQB 2DUUA 2DUBA 1E3IA 5G4KB 4R3WA 4U19A 3OMLA 1T2CA 2G82A 4UVHA 4IJUA 2ZTVA 4NK5A 2R00C 2C59A 2CBYA 1HKUA 4EUHA 3H0QA 1V35A 1O95A 4E13A 3T8BA 4PFJA 1F17A 1XCBA 2P5YA 4DLBA 1V3VA 3Q6IA 3NGXA 4JBHA 4L0QA 4LSMA 3QVXA 5L45A 2FRDA 5AYVA 1JLLA 1LJ8A 3MEQA 2WM3A 4B8WA 3G1UA 1D1SA 4FFPA 4INAA 4L9RA 2FHSA 3OFSA 3GVIA 1IE3A 3GZNA 4GWKA 1HDYA 3OJEA 5CTCA 4DBVO 4JX8A 2HMWA 3OICA 4YQZA 5JFOA 1O89A 4J91A 1GL3A 1I01A 4LCEA 4BL5A 4LCJA 3TQHA 4FFRA 1Q52A 1KOLA 3EVNA 5F1KA 3QKAA 1ON9A 5F21A 5LCXA 3QMJA 1ISMA 1BDBA 1MG5A 2VT2A 1ZFNA 2AE2A 3ZN2A 1RM4A 2VHYA 4IDDA 2XPCA 1U2DA 3KEOA 3V2GA 3L0DA 3NT4A 3QV1A 3I47A 1P1HA 3D1LA 5TQVA 4EDFA 2CFCA 2VSSF 3AFMA 4RCNA 1NQ5A 2E48A 4HFMA 1WMBA 3WGHA 4BO2A 5EESA 3TVUA 3U3XA 1NZYA 5FI5A 1DBVO 4YEDA 4RVUA 2FSVA 4JJTA 2RBEA 2C07A 5G4KA 1X0XA 3RBZA 3PIIA 5KVQA 1GR0A 1JAYA 4CV2A 4DBZA 3ZHBA 4NJMB 1PWXA 3SX2A 3JQ7A 1J49A 4RLSA 4QIJA 4G2RA 4N18A 1FDUA 4MVJG 5KVCA 1KIFA 3IP1A 4IQ8A 4H7PA 5JDIC 2C5AA 2Q4EA 4TRJA 3JTMA 3T88A 4JXKA 4U0GA 4PLYA 1MA0A 1NVMB 2QYTA 4HX5A 4PN3A 5CDSA 2NU9A 1PIXA 1ZK1A 1Z75A 4ZN6A 5AXAA 5L95A 1CETA 1XQ6A 3CTMA 3DZKA 1B0AA 4J3FA 1E7YA 1XLTA 5MGBA 3KETA 2BLLA 4TWRA 3CUKA 2FZSA 1P1FA 1DC6A 3QE3A 1NWCA 5KDRA 1F0YA 3R9TA 2DLDA 3TRRA 3I4FA 3NJ4A 2QRKA 4L8VA 3BHMA 1DSSG 2CE3A 4BNXA 3CMMA 4IM7A 1ON3A 1ISGA 1LLDA 4I52A 4CM9A 2PBPA 1I24A 1N9GA 3G0OA 1F14A 1ZXBA 4JGBA 4MINA 2PPYA 3BMCB 1ZUD1 3L77A 3ZU4A 3LLSA 2QIOA 1JXZA 2BFOA 1ORRA 3H0JA 1PGJA 1HE2A 1I30A 4PLHA 4XQCA 3PGXA 3I52A 4R5HA 2FW2A 2VRBA 3BIOA 4GBJA 4IQ0A 3T4XA 3UICA 4XGNA 3MJVA 4WOKA 1BGVA 4D3SA 1PWZA 2QQ3A 1IY8A 3U5TA 1A7KA 3QXZA 4WUVA 2QZZA 1IULA 2V6BA 2X0RA 4JP3A 4D41A 5DULA 4EEXA 3LKEA 2J8ZA 4RL6A 1BTOA 1XSEA 3WBBA 2GZ3A 3V5NA 3AWDA 4Y6RA 3VDRA 4HC8A 3R9SA 2HK8A 2Q2VA 3DZJA 1IHXA 8LDHA 4EJ0A 1E6WA 1U8FO 3QVWA 2GERA 2X0IA 1E7MA 3DMYA 3ZNPA 4FB5A 3ENKA 4ROSA 3AK4A 5COQA 4Z9FA 3C8MA 2J5GA 3QK8A 3I83A 4RQUA 4L74A 1Q1NA 2RH4A 4GM2A 2IXBA 2WD8A 3I9OA 2UAGA 2NU6A 1B3BA 3DAGA 3ZV5A 5JCJD 2F6QA 4NBTA 2D1YA 4J2OA 3CH6A 3NJ8A 2F9YA 3C1OA 3GC6A 4ZDEA 2OOSA 1X13A 3K6JA 1HSZA 3D3EA 2EW8A 3WYBA 4DIFA 3LT0A 2AEFA 1ML3A 2ZCVA 4PLTA 1I33A 1LUAA 2Y93A 3VDQA 4IDFA 1FC9A 4IUYA 1LDEA 1EEHA 1MX3A 4PG7A 3WQSB 2Z1NA 1ENZA 4JNKA 2EEZA 4IZCA 3AUAA 3WGQA 2J5KA 2FY8A 3S2GA 4QIIA 3CE6A 3IJPA 5I7SA 1T26A 4YQYA 1XU9A 3H3JA 1C0KA 1NP3A 4D3FA 1GEGA 3FTPA 3ADPA 3ICPA 5TLSA 5BSGA 2PZJA 4OKNA 3DOCA 5T6BA 1P0FA 4RVGA 2IEBA 3NYWA 1X15A 1ZSNA 4FFNA 2I99A 4PG8A 1DXYA 3PE8A 4WLEA 3JQ9C 4EMPA 3G64A 4WOJA 5LDGA 4XD2A 4MKRA 3IQDB 3WB9A 4A27A 4FSHA 4W99A 3ROPA 2ZB7A 1VSUA 4J6FA 1EBUA 3L9WA 4U0GH 5HRUA 4B7CA 2JAHA 1O5IA 4YLHA 1N1EA 3P5SA 2VHXA 2R2GA 4DA9A 1UZMA 1AHHA 3R6HA 4DC1A 2NU8A 5E0SH 3FCOA 1LC3A 1NAHA 5DTWA 1WPQA 3GEMA 2I66A 1C1DB 2FPPA 1VE9A 1ISFA 1F06A 3C85A 4LK3A 2BMAA 5DDIP 1T2FA 3RAJA 1Y8RB 1V9LA 2V6FA 3DHNA 4B4OA 1MJ3A 1PGNA 4BGVA 5L7WA 3UF0A 5DL1A 4YBZA 1NQTA 1LDGA 4XQGA 3PLNA 3NX4A 3PFWO 1BDMA 4MP6A 4EEZA 1I32A 1U1IA 4PLZA 1T4DA 1C1DA 2WYWA 5I7EA 1ZIDA 3I9NA 2C8TA 3FF6A 3R6DA 1XA0A 4PG6A 2XAAA 1TA4A 3DAFA 3LT4A 4FGSA 4NNJA 4B79A 1YXMA 1D7OA 1Y8QB 3PWSA 5ENVA 5C7IO 4Z3KA 1SBYA 1JKJA 3V2HA 3HFSA 2IZZA 3BXXA 4G81A 1MG0A 3M6NA 1YONA 4BNUA 4HFRA 3OHSX 1E1KA 4BMNA 1G6KA 1I3KA 1SEVA 4JJIA 5KJ6A 5I8WA 3G3EA 3GVHA 3JQDA 3ZHYA 1P45A 4CUJA 3BHJA 2OFPA 2J3HA 3Q9NA 4YRBA 1E3WB 3AI3A 5A3JA 4TKMA 5DZKA 4GPD1 4DIBA 3MJ4A 4ELSA 3E9NA 9LDBA 3GLMA 3RD5A 3DO5A 1T2AA 1MUUA 1N1GA 4MKZA 3UCFA 4OIMA 4C7KA 1K39A 4NNQA 2W2KB 4IGFA 5C3MA 3H3FA 4NBUA 4RO0A 3I23A 1UXIA 1HZDA 2B35A 1EFKA 3INGA 1NPYA 3EC7A 3AY7A 3MJEA 4XRRA 4XDYA 2YY7A 2GNAA 3SBOA 3QLJA 1UIYA 1TI7A 2YV3A 3PHHA 1KY4A 4YJGB 3GK3A 1PGOA 1MP0A 1KETA 1VI2A 3H6KA 2TMGA 2C29D 4IZHA 1PR9A 4KP7A 5G0VA 1KVRA 3VH2A 3ZV6A 3L4SO 3VH1A 4D0RA 5JBXA 4J7CA 1GUYA 3AY6A 1IHYA 3RUIA 3GG2A 1YDEA 5DP1A 3FTNA 2FOIA 3F5QA 3ONEA 4MIOA 5DF1A 4CR7A 3DR3A 1FCFA 1W6UA 3PDJA 4ONEA 5AQ1A 4ZHSA 3AY3A 2X9NA 2I76A 5TSDA 3T4EA 3PGQA 1GQQA 3U9LA 3SWXA 1BVUA 3PK0A 1OD4A 3GDFA 4DLLA 1GZ3A 3DFUA 4S3MA 4QFCA 5F1PA 1XHLA 3JSAA 1UJMA 3BYZA 4K6CA 1DFHA 2J5IB 1YB1A 1EBFA 3T8AA 1Q51A 5JC1A 5DU8A 4XYLA 1TLTA 1IYZA 4FS3A 1AUPA 2DTDA 2PKQP 2RAFA 4ZDCA 1B8VA 4YWJA 1ENPA 2J6IA 2NTNA 1H94A 2PKRA 3F46A 4IDCA 4ZU3A 5JSFA 1Q7BA 2G5CA 3JQAD 4GWGA 3S8MA 3W4JA 4MI2A 1LRLA 2NVWA 1AHIA 4O6VA 4LVUA 4WNIA 3BEZA 3OC7A 1VM6A 2AA3A 5EJ2A 3W1VA 3BPPA 1WZ8A 4YJHB 5ER6A 1E7WA 4DREA 2QRJA 4BGEA 5FEUA 3RSIA 5IFLA 1GY8A 4XDZA 3GMDA 4GH5A 4TMFA 5B4VA 3D4OA 3X2FA 3BZUA 5IJZA 1DUBA 4Q3NA 1DIRA 1H6CA 5IZ4A 4YJHA 2ZB3A 2O48X 3JD0A 5EL0A 1WMAA 1YGYA 2WYUA 4WEOA 1Z7EA 4UEJA 3H8VA 4UUMA 4PRKA 1HYEA 4FJ2A 3LK7A 1I3MA 2FZWA 4MKXA 1FDSA 4GHNA 1ZK0A 3CINA 4ZVVA 1PR3A 2Q1WA 2Q35A 4EI2A 4Q3DA 1DOHA 2D5AA 4ND1A 2PD3A 4TKLA 4RF3A 1Y5MA 1I3NA 4KTTE 2B5WA 1N7GA 1YQGA 1GCOA 1WZIA 4AJHA 3TDCA 2CY0A 1N2SA 4CQMD 2C7VA 2GASA 1PEDA 2PFGA 2Q46A 3AJRA 2IZ0A 4NI5A 2F00A 1PJTA 4OJNA 5EPOA 1GYPA 1Y7TA 1PL6A 2EJVA 2ZTUA 5HS4A 2QQ5A 4E5MA 3CPSA 5L7YA 5L4NA 4IMPA 2IE0A 4JYJA 3DQPA 3KLPX 1EK5A 1I2CA 3GPIA 1ID1A 4J7XA 1FDVA 1K6JA 3RWBA 5JAIA 2BGMA 5JPIA 1PIWA 3FPLA 4WEQA 1E3SA 1N6DA 5HWSA 4JK3A 1ZH8A 3BTOA 1CEQA 3JQFC 4WZ8B 1Z74A 3KTJA 3E82A 1Y8RA 4IXTA 3AW9A 1QYDA 4R01A 4GX5A 2G76A 5A4DA 3NUGA 3BMNB 3LC1O 4R69A 3ROKA 4DPLA 2HLPA 4W7HA 3JYNA 2Y1FA 4BNNA 4NHEA 3RKRA 4AJ2A 1KEPA 1BXGA 2E6UX 3M1AA 2BHLA 2ILTA 4E0BA 3GGOA 4IPTA 3UGKA 1JWBB 2C2XA 2Y0CA 4OQYA 4MVJD 2GN9A 4J49A 1R16A 2E49A 4F3YA 1X7HA 5A5EA 1ONOA 3I3OA 2VZ8A 3FSRA 1UYTA 3RU9A 2F1KA 4ITUA 4GLLA 3ZNNA 4AJIA 3GKBA 2EG9A 3TFOA 1KS9A 1U3UA 3KB6A 1YL5A 2PV7A 4NK4A 3ICCA 1UXKA 2VSSA 3KTIA 2P68A 3COSA 1R4NB 3N7UA 3T3WA 3R9QA 3QYRA 1XELA 1ZKMA 4BKUA 4CUZA 3WQQA 3NDJA 1YG6A 3RFXA 4BGUA 3WMWA 1X7DA 4QO7A 1GDHA 5JBIA 1GYQA 2GDZA 3QWFA 4BOYA 4E2XA 1ZMOA 4KDEA 4OQZA 4QFEA 4CMJA 3MJCA 3FWZA 3TOXA 4OXKA 1V3UA 5THKA 2A35A 2PGLA 3TRIA 5C7LO 2H5LA 1UUFA 3Q1TA 4WCDA 1E3LA 1U8XX 4P8RA 2AE1A 3U4DA 1F12A 1HDGO 1J0XO 4GKBA 4BMVA 2F9YB 5B37A 1XG5A 4CV1A 3INRA 4XYEA 2Y1EA 2DBQA 1NHGA 3QRWA 5CDGA 2YYYA 5DUFA 1HZJA 3U4CA 4IIUA 3VH4A 3ETDA 3WX0A 3UXYA 1VRWA 2A4KA 4L76A 2A94A 2BFMA 1PJ4A 2NTJA 4OO3A 1E3EA 2CMDA 3E9QA 4XQ9A 4CM8B 4PLPA 1E5LA 4MVJA 3ROQA 2AXQA 1A4IA 1LRKA 3DL2A 1BW9A 1Y5RA 4I9HA 4DI1A 3RFVA 3GGGA 3WWZA 1EE2A 3E8XA 1PZGA 2J3IA 2EKLA 5DOVA 5HA5A 3WSWA 1E77A 1ZMTA 5I7FA 2JJYA 5IAAA 5T57A 4RF4A 2CF5A 2O7QA 5COBA 3E18A 3L9XA 1I36A 4LISA 3ZWPA 4FOSA 1PS8A 3TVWA 1R0LA 3SLLA 5C90A 1O94A 3PDUA 5COAA 4J90A 2Q2WA 3TZHA 1TEHA 3FN4A 1ZK2A 1YJQA 4BO9A 4U5QA 2OL4A 2XOXA 5EQDA 2A7KA 2OZPA 3A14A 2ZL3A 5DBFA 2Q1SA 3A4VA 4YJGA 3H9EO 1T4BA 1PJHA 2FZEA 4IDBA 1UP7A 4BNZA 1CWUA 4B8ZA 1GV0A 3DZFA 3AM5A 3TFQA 3Q3CA 3JQGA 1XO6A 4B3IA 4JOTA 4O5OA 4RZHA 2VT3A 3PHIA 3JQ6A 1DJNA 2DUWA 3DTTA 2QW8A 3NT5A 1Y9AA 2VHZA 1Y1PA 1JWAB 3VTZA 3S2EA 4AJEA 2ZCUA 3JQAA 2LDXA 2YHIB 1QRRA 3F1LA 5I9NA 2VHWA 3PYXA 1QXSA 4DMMA 3WQRA 1E1NA 1QP8A 3NRCA 3P2LA 3MJTA 2OBYA 3FBGA 4J1QA 3RBXA 4F45A 5I9LA 3LC2O 3P2YA 1GZ4A 5T64A 3HDHA 1YJ8A 4ZQGA 2BD0A 3K8ZA 3K73O 3VZQA 5MDHA 2ZL0A 2UUPA 5JE8A 2PG8A 1U3WA 2PH5A 4JJGA 3C7AA 4QEDA 1T2DA 4ZRMA 5B4UA 1N6FA 1BXZA 2X6TA 3HB4X 4XB1A 3ULKA 5H83A 3Q7HA 3Q11A 2HRZA 2VSUE 3OQ6A 2ZKLA 4J1SA 4YR9A 4FPXA 4ELXA 1YBMA 2PWZA 2IODA 3V1UA 1J6UA 5KNLA 4AFNA 2PH3A 1VL0A 4I5GA 5EQFA 2ZJ1A 1KVQA 5FF9A 3E6AA 4CV0A 5JMPA 4B3HA 3I6IA 4BO5A 4UUPA 2HMSA 3EDMA 6LDHA 1B7GO 2FR0A 1QYWA 3WGTA 3FBTA 3H7AA 1R0KA 4PLFA 3VPXA 4BKQA 1EVYA 3B20A 1N8KA 3KRTA 1A9YA 3IL2A 3GH3A 3DBVO 2Z5LA 1V8BA 2CF6A 2FR1A 4WCFC 3GN1A 3WDSA 5CDUA 3HB5X 3SXPA 3VTFA 3WXBA 5CG1A 4FJ0A 3ZWMA 4GX0A 4CJXA 1TXGA 2Y67A 3KSUA 4I5EA 1LDMA 3ZWCA 4CQLA 5ES3A 3KYCB 2OXIA 3DBLB 4E31A 5A9RA 3OMEA 3GGPA 3V8BA 2D0IA 4FDAA 1K5HA 4ALIA 2BI7A 3A06A 3OP4A 5JW6A 1IPFA 3K30A 3O4RA 1N92A 3PP8A 3WG9A 1AXGA 1SZOA 2DPHA 1NVGA 2O3RA 1PZFA 4R54A 3ISAA 2HKIA 3PHLA 4AJ1A 4D0SA 3ZV4A 2EXXA 3FHLA 2BFAA 2V6MA 2GCGA 1Q0QA 5GMOA 3WIDA 4LK5A 3INTA 5A04A 2GN6A 3HADA 7MDHA 2WTBA 1Q7CA 3D3WA 3QXIA 1UYVA 2EGHA 1O6ZA 4YCAA 1ISHA 2W4QA 1PZHA 1J7XA 3AU8A 1NPDA 4YB8A 2GSDA 3WLFA 3FNHA 4MVJH 4JCRA 1Y8QA 3HLN1 3RUFA 3OF2A 3VHRA 1E1LA 1B16A 4RVHA 3M2PA 3PEAA 4U7WA 1KVTA 1JKFA 2Q3EA 4DC0A 1QV7A 3RQSA 3HRXA 4H15A 2NP9A 4W7IA 1XIVA 3CEAA 3EHEA 3NTQA 4MIYA 2AMFA 2ZQYA 2X5OA 4DIOA 5DOZA 2AEMA 1ZK4A 5DCYA 3TN7A 3OEYA 2DC1A 1K2WA 2EF1A 5IF3A 4NG5A 1ZJYA 4O1MA 3DZGA 5JO9A 3EYWA 3MWEB 4J0FA 3V5IA 3DBRB 4GSLA 2EWMA 2Y1OA 1R12A 1PJ3A 2CZCA 3DBRA 5T67A 1I0ZA 1WZEA 3QWHA 5CHEA 3LDHA 4HADA 3RC1A 1O8UA 2X1HA 1Y7OA 3TZCA 1DC4A 1U3TA 1P0CA 2F9IA 3VPFA 5KKAA 4HNGA 1E7SA 5KKCA 1ONPA 2AG8A 4FR5A 3BMNA 2WSBA 3SJ7A 3ASUA 2X24A 4NQZA 2FWMX 4KQXA 3ORFA 1MFPA 4MP3A 1GYRA 2HCTA 5KVSA 2Q45A 4IJVA 5KJPA 2P9GA 4DL9A 3UKOA 4J9VA 4R4JA 1ZBQA 5TT0A 4KNPA 4RVDA 1CERA 3HE2A 3FD8A 4OH1A 3AI1A 2O3SA 4KWHA 3W8FA 4B4VA 2E4AA 2J5SA 2GPTA 3JD3A 5JDCC 3MTGA 2I3GA 3ZU5A 4PLGA 3OETA 3ZV3A 4CMIB 4GVXA 1ONNA 4AICA 1PS9A 1FDTA 1QG6A 1T24A 3T7EA 4FN8A 1JA9A 4ALNA 3IS3A 1DCIA 1R4NA 1E3WA 4BUCA 4CUKA 2Q2QA 3IKVA 2CNBA 3D7LA 1WNTA 2NADA 4CQMA 2B4TO 2W2LA 1BWSA 1W2XA 3F4LA 1YL7A 1JDJA 3WGIA 1VJTA 4WCZA 2IYOA 4OM8A 4WYOB 3MTJA 3WTBA 1X14A 4E21A 1P74A 3F9IA 4CR8A 3FI9A 1DO8A 2NVUA 3EGOA 3WGGA 5C5IA 3HE3A 5CEJA 3VPHA 2IRWA 3HWRA 4XGKA 4BKRA 4CPDA 4AJJA 4O59O 1BXGB 1NFRA 3EW7A 4YACA 5BQFA 1R4MA 1A5ZA 1KYQA 4KOAA 3AUUA 5IZCA 4OXNA 1AGNA 4A2CA 2VQ3A 1YL6A 1DFGA 4YPOA 4BGIA 2J5II 4ID9A 3OEWA 4BNVA 1NQOA 3I1JA 5DU6A 2CDAA 3GRPA 4E5KA 2J3KA 1FC6A 4FFLA 2ZQQA 3EMKA 4XWYA 1CDOA 1LLQA 3IC5A 4IMRA 4Q3BA 2NVBA 1FDWA 3LC7O 3C1AA 2C2YA 4N5MA 4RQTA 4QQRA 2B0JA 4HY3A 1E92A 1W73A 5DZKH 2X9GA 4TSKA 5G0WA 3IB9A 2TMDA 1NZYB 3A1NA 2FSSA 1QYVA 2HJSA 4RF2A 1HSOA 2BELA 4I5FA 2J5GD 4XR4A 2DTEA 1KERA 2PZKA 2QHXA 1RJNA 2ZK7A 3GEGA 2JD2A 3D4PA 1H9AA 3KVOA 4XIJA 3K2BA 1SCUA 2HDHA 4PG4A 4Z3DA 4CM1A 1ZEMA 3T89A 1C0PA 4EUFA 1JAXA 1NAIA 1NXQA 2HMVA 5ICSA 4ZU2A 2GN8A 4FIZA 4WECA 5B12A 3WG5A 3R0IA 4BB6A 1MXHA 1UXGA 3RSTA 5E0SA 3I9MA 3PHJA 4LRSB 1JN0A 1TT5B 1WDKA 3TL2A 3CZMA 1LXCA 5DUCA 1QLJA 3O9ZA 2X8LA 3SJUA 5DU4A 5BNTA 3D5QA 1EUDA 3OH8A 1HE4A 3DZBA 2DEOA 2QRLA 4IJKA 1H9BA 4N7RA 2GN4A 3PEFA 4E3ZA 4NJOA 3M6MA 4KWBA 3AOEC 1DRUA 4P4LA 3TF5A 2WMDA 3DXFA 4R3NA 3V2UA 1X1EA 2FN7A 3HN7A 3WS7A 5F5NA 4MOWA 4D7AA 1RKXA 4EMLA 1GPJA 5A3VA 3H9JA 4WLUA 4PLWA 3GAZA 5A03A 3ZCXA 1EDOA 1QV6A 1W4ZA 4WKGA 4CQLB 1I3LA 5KVVA 4JBGA 1DFIA 4GSKA 2ZIZA 3CXRA 2OBNA 4JP2A 5T8KA 1I10A 2B4RO 3P7MA 3VIVA 1G1AA 3WWYA 2DM6A 3OT6A 3GN2A 4TZKA 1NNUA 3VZPA 3JYPA 1AE1A 3RJ5A 1SZJG 2CD9A 3I9JA 3DMTA 1N7HA 3PI7A 3RBVA 2OP1A 3A28A 1P31A 2DPGA 4RZIA 3JQCA 4RYFH 1L1FA 2VSUA 3IAVA 3BTUA 4Q39A 3PQEA 3AFNA 5GY7A 3QQPA 4XJTA 1NVTA 3FF4A 1DPGA 3G17A 4WLVA 1HETA 2EP5A 3SC4A 1WXDA 1EFLA 2ZL2A 4ZA2A 1M6HA 1O0SA 3KYDB 3Q1LA 4CQMB 4DGSA 1VSVA 1DAPA 4DYVA 1UDCA 2VZ9A 4IXWA 2CVZA 3ANMA 5GZ6A 4ESOA 4QFDA 3H9GA 4E2ZA 4YT4A 3RUAA 2YV1A 3DMTC 1KC1A 1IOLA 2C0CA 4CM6A 5TS3A 1RYDA 2DBVO 1XNWA 4RORA 1GQ2A 3PZBA 4WGGA 4ALJA 4R1TA 3HHPA 5IG2A 2UDPA 3LT1A 4EZBA 4FB8A 3ZWVA 4CODB 1SOWA 2UUOA 3OJFA 3C1TA 4FGWA 3QVTA 1EY3A 2DBRA 4HNHA 3UOGA 1ISJA 1ENOA 4PVCA 2PA3A 3WBFA 3ZGYA 4TRRA 1YRLA 3N58A 5U1PA 1VJ0A 1PJSA 1Z73A 3PLRA 3NKLA 3ZHXA 3GF3A 3R3JA 3ZWBA 4L6WA 3WJAA 4PZEA 1MC4A 4UEKA 1U4SA 4AJNA 2GF2A 2YHIA 3BTVA 3HDQA 3IDSA 3VOSA 3CZRA 3LU1A 4E5PA 2DU8A 3JD2A 3KYBA 1D3AA 4XX0A 2J5IA 3BA1A 5CAEA 3ON5A 2NLOA 5TX7A 5CPBA 1EVJA 2RH8A 3EAGA 2EJ5A 3DONA 3F1KA 4N54A 1YH3A 4Q9NA 3W6ZA 1HE3A 4RCVA 2EERA 1UAYA 5JC8A 1UYRA 3JYOA 4FJWD 3I4CA 2Q2XA 4K2NA 1HDZA 1PJCA 3ZDFA 4CM4A 4TROA 4L75A 3K96A 1B8PA 2X86A 4A7PA 1HRDA 1RJWA 4WLOA 3OIFA 5IDQA 3HDYA 3ZH2A 3U9TB 4J4HA 5JY1A 4JYLA 4NBRA 4CLEA 1ADBA 1X0VA 3AUSA 3DFZA 3GZ4A 4K6FA 4EMMA 3LYLA 2JD0A 3G79A 3ZWXA 4HKTA 3KTDA 3HINA 3TSCA 2A9FA 3LF2A 3WSVA 5G1RA 1KEWA 1XQ1A 4NU6A 1VKOA 1PL7A 2P4QA 4Z9YA 3O26A 3HG7A 1MB4A 2VCYA 1U2GA 1LSOA 1GTMA 9LDTA 1A71A 5AOVA 4DUPA 1EVIA 2I6TA 3L6EA 1OC4A 2EGGA 3BMCA 1NWHA 4GX2A 1HDOA 2HMTA 4BNMA 1X1TA 4CLRB 4Z0PA 3D0OA 3W6UA 3VVBA 5A9SA 1VC2A 4BVAA 4MP8A 4OG1A 1GD1O 4FN4A 2GR9A 3LLVA 4JCQA 4GMGA 2HO5A 2FP4A 1PQUA 1BSVA 5G0TA 4MVJE 1HDCA 4I08A 4DPMA 3PIDA 3NTOA 1TB4A 2O7SA 1ULUA 2JFGA 1JTVA 1TVEA 5TT1A 5JS6A 4G65A 1PQPA 2EJWA 3B1JA 1PZEA 3SEFA 4A5OA 3PJDA 1RJMA 2B69A 4YJFA 3EUWA 5DKPA 1EQUA 3P19A 4YJDA 3JQBA 3GPDG 3V1YA 4J1NA 5DBIA 4IBOA 4ZQBA 3ZWNA 4JJFA 4ALKA 3E5RA 5BSHA 3DZIA 2WDZA 1LRJA 2YDYA 2GD1O 2DT5A 4YTEA 3S55A 2EKQA 1J4AA 4MVJP 3W8EA 5KJCA 1M2WA 4JCOA 1UP6A 2P5UA 4Z9XA 4CMGA 2A81A 3SLKA 1K0UA 2HK7A 3UW3A 4U0HA 2HUNA 2H9IA 4YT2A 5I7VA 3OQ1A 4II3A 1I8TA 1IB6A 1D8AA 3Q2KA 1H0KA 1YB5A 4HFNA 1HYGA 5JDCA 2D4AA 3IIEA 1NFFA 1VLLA 3CIFA 3PVZA 2Y99A 4KDFA 3RC2A 1NTOA 2IYPA 1IUKA 2NVUB 1Z6ZA 3TZ3A 3UVEA 3EZYA 2YUTA 1G0NA 2Q50A 1UDAA 3R3SA 1E0DA 1DRWA 3DTYA 1A27A 3O03A 2DQ4A 3GNSA 3GT0A 4FZWA 3GG9A 5GZ1A 1FK8A 2HU2A 3FRJA 4JWVA 2PNFA 3C24A 4KUHA 4ZQEA 4RVFA 5A06A 3U0BA 2Y0DA 4FZWC 5KTKA 4U6QA 5BNIA 2X5KO 4J9UE 4WPGA 4UEOA 1YDWA 1BXKA 2NM0A 4MIEA 4CMCA 5L7TA 3VAZA 4Z0HO 1JVSA 1PU2A 4M86A 2JCYA 1YBAA 4OSPA 1HNOA 1H6DA 3AM3A 3WTCA 4IZDA 5HTOA 4UREA 4I8XA 4PGFA 1HEUA 1WLYA 3MJSA 4CLXA 4M49A 4NFHA 1TG6A 1L7DA 4LMRA 1YVEI 1MGOA 2WE7A 5ICMA 3S2IA 2JCXA 2W8ZA 2JCVA 5A9TA 5B4TA 2EW2A 4OL9A 4JROA 1LQUA 2NACA 4WLNA 3BMQA 5G1QA 1U5CA 4YAGA 2A7SA 4BNHA 4OSOA 3NT2A 2JKVA 4Y9DA 2WJPA 5B1YA 4BKPA 4XGIA 4DQXA 4QXMA 1PJQA 4PVDA 4PRLA 2PZLA 3AOEA 1P33A 2WWRA 3MOYA 1P9LA 1YB4A 2GRAA 1ZW1A 4GMFA 4DQVA 1ZCJA 4ILKA 4AJLA 4IQGA 3ROMA 2VWHA 3KM0A 4R68A 1J5PA 3HP0A 3ANLA 4FOOA 1BW9B 2AQIA 3PJEA 4NFYA 1K3TA 3GDOA 1QKIA 3WJ7A 3OSUA 4E12A 4MJLA 4HP8A 5EINA 1YKFA 3ZNQA 5JBWA 1VL6A 1EQ2A 3K5PA 5JCJA 2O4UX 1F8FA 3ZNOA 1FC7A 1YO6A 1YOVA 3VH3A 3PHGA 4HBGA 4W6ZA 3KLMX 4IZIA 2DAPA 3WGYA 2VYNA 4URFA 4CM9D 2RHCA 5C7OO 4MVJM 2QYSA 4GKVA 1SO8A 4XZ3A 5HM8A 3LZ6A 2Q1TA 4O0LA 3VC7A 3G1TA 3NEPX 2ZJ0A 2Z1MA 1C1XA 3UCEA 4BNLA 4AJ4A 3HSKA 1LNQA 3DEYX 3RJ9A 4CMHA 3C3XA 1HXHA 3ZW9A 1JKIA 2WD7B 1H6AA 2B37A 3NDIA 2VOJA 3O8QA 3PXXA 4B7XA 4WJZA 5ITVA 4ELWA 4OYRA 2Q49A 2NSDA 3TZQA 3ONDA 1UXJA 1DIAA 3OIDA 3NGLA 5L40A 3EVTA 5JAMA 4AG3A 1GEEA 1Y6JA 3KO8A 2VREA 4R1NA 4JQCA 3UHAA 2ZYGA 3RFTA 5IZCC 5JMWA 5JYEA 3GNQA 1SB9A 1UXHA 2VSUF 4CV3A 3Q9UA 4I9NA 4IY1A 5A05A 3JQGB 2LDBA 3IMFA 2IXAA 1YBVA 3QVSA 4PCVA 4E4YA 5BSFA 3W8DA 5A5FA 5K9ZA 3FNFA 1QYCA 2JAPA 3JQ8A 3JCZA 1DLIA 4WCFB 4CMIA 2XXBA 4HWKA 3P5MA 2CDCA 2O2YA 2YZ7A 3I9LA 5JLAA 2EIHA 2O50A 4ZRNA 2UZFA 4C4OA 5K6AC 2OGUA 3QWIA 3Q0GA 1YOVB 1GUZA 3H5AA 2ZATA 3BMOA 4Q3CA 4EJMA 3ABIA 3TLFA 4U8GA 2ZL4A 4BNKA 5FWNA 3JQEA 2D8AA 2NQTA 2ZB8A 4NZ9A 1GADO 2E37A 4Z0MA 1LEHA 4ZDBA 1UP4A 2Y68A 3RKUA 1CQIA 4G5HA 4OGWA 1F8GA 2RCYA 2Y1CA 1NM5A 4XR9A 4BQPA 1RPNA 5IXSA 4PIVA 4W9NA 4ALMA 4LW8A 4WLFA 5T5QA 3MOIA 3U4IA 4P4GA 3WICA 2OHXA 1DJQA 4BQRA 2EKPA 4K1LA 4Q3EA 3PQFA 5LDHA 1PSDA 5IKLB 1YG8A 1O9BA 2C82A 3OECA 5BNFA 3GF4A 2BFPA 3UCXA 1X7GA 3NV9A 5CEEA 2JL1A 1HLDA 4LRTB 5CP8A 1HL3A 2PTGA 3MT6A 4Q0GA 3GHYA 4XEHA 3E03A 3BAZA 1GPDG 1DB3A 4TZTA 4DRYA 3GUYA 1H2BA 4BMSA 1YWGO 2P2SA 3D64A 3L07A 2IEXA 4M8SA 3ZU3A 4TRMA 5HS6A 3U9SB 3RC7A 3UAGA 1B2LA 4IINA 4YAEA 4FCCA 4CR6A 4YXFA 1GAEO 1K32A 1QR6A 1EMDA 4L4SA 2I67A 5JCXA 4FN7A 1RM5A 5CFZA 4ZDDA 4A0SA 4CL8A 1PS0A 3FNEA 4R16A 4OKIA 4Z0TA 3TT7A 1GV1A 4KUEA 3TWOA 1HNUA 4AJKA 3RIHA 4YA6A 4RJTA 4PZCA 3R0OA 2Y1DA 4PLCA 4RPJA 4CM7A 2PGDA 2XXJA 3M2TA 3JYLA 1KY5A 1LSSA 1K6IA 4M89A 5TNXA 1E3JA 1EUZA 2EHDA 2ZYAA 3OJ0A 1JVBA 4CLRA 1CF2O 4KWIA 3K2EA 3NDRA 5A9SB 3ZU2A 2O23A 4EJ6A 2X0JA 1ARZA 4CLHA 1U4OA 3GQVA 2AQKA 1M6WA 5DZSA 3GDGA 4D44A 3DBHB 4F6LA 3WYEA 5JAQA 3S1LA 3D5TA 5E0NX 4OXYA 1U28A 2YV2A 3QY9A 4N5LA 1SPXA 3FWNA 4FC6A 3MYBA 1CYDA 3BF0A 4K9DA 4Y67A 2FMUA 4JVTA 4FJ1A 1C1XB 4YYZA 2HSDA 4DWVA 3F47A 5C37A 4BO3A 3KUXA 1LBEA 4AVYA 3GVCA 4J7UA 4D42A 3LF1A 2VX2A 3I6QA 4H3VA 4XYBA 1L7EA 3L6DA 5IN4A 4MVJI 2B36A 1YE3A 4H16A 3F3SA 4M55A 2VYND 4UAGA 5EIOA 2X23A 2P4HX 2X9VA 3ONFA 1ZZEA 2O3TA 3PGJA 4XA8A 3BTSA 3H9UA 2YFHA 4BNYA 1CJCA 1MFZA 3AI2A 1DRVA 4O63O 3U62A 1OFGA 1B3RA 4IS2A 2DTXA 3B70A 3HJAA 1PL8A 4QECA 2O4CA 1SMKA 3D3WB 4B4WA 5IDWA 5C9GA 3JQ8B 4OOFA 1LSUA 4WCFA 2VSSE 2O3UA 4NEKA 1QLHA 2G17A 3KXDA 5DN9A 4JCSA 4Q1IA 3KSDO 3JD1A 1T1RA 3QJ5A 3PWZA 3GF7A 2O2SA 3A9WA 4R41A 4UVIA 1WWKA 2ZYDA 4KD6A 1GZ6A 2FPGA 5AVOA 4JCTA 4I42A 4BHTA 4AJOA 2YFQA 3GFGA 2J5QA 3H5NA 3TDKA 5KDRB 4OMRA 4L8KA 4GQAA 1HDRA 3KV3O 4YAKA 4NDNE 4R9RA 1JU9A 3TPCA 3HZZA 2F6IA 3JQAB 4PG5A 4XQEA 1HTBA 1H6BA 3OBBA 1P1KA 2BRUA 1D4FA 3NJBA 2H6EA 3FPCA 4IDGA 4W4TA 3SVTA 3IUPA 5A1TA 2B4QA 3ZW8A 1ZVMA 1LDNA 1XR3A 4ND5A 4RLHA 4CM3A 1I5RA 4XIYA 4YAIA 5JXWA 1GUFA 2YQ5A 1FF9A 5KJEA 5KCZA 3AM4A 1LC0A 1ZK3A 4HV4A 3DAPA 5JAZA 3N6RB 5HBRA 3JQ9A 3WNVA 1XDWA 3ASVA 1Z45A 1QORA 3GRKA 3QREA 2I9PA 2DBZA 3FNGA 3DWFA 3WLEA 2AW5A 4B4UA 4XKJA 1A9ZA 1AXEA 1Y9EA 4MVJF 1C0LA 1W8DA 2VOEA 2ZTMA 5KIAA 4FBGA 5ENDA 4E5NA 4EITA 4J0EA 1NR7A 4BV8A 4DMLA 2Q99A 4MDHA 1SB8A 2C5EA 1Y81A 3GHHA 3EK2A 4LVCA 4CMKA 4MO2A 1OC2A 4YRAA 5DT9A 1DLJA 3PWKA 3TOZA 2V6GA 5DCWA 2BKAA 5L53A 4ASIA 2C7GA 2G1UA 4YT5A 1S6YA 4K28A 1T25A 2IDZA 3RUEA 4BNWA 3IOYA 3IKTA 4NR0A 5INFA 3JQFA 2D2IA 1KC3A 1TT5A 2OP0A 4ZJUA 2NTVA 1U7TA 4KPKA 1K89A 1EZ4A 1HWYA 3PJGA 1LA2A 1SOVA 3ZHZA 2Y0EA 4L4XA 3IBBA 2VUUA 2DVMA 5TIIA 1DEHA 1JQBA 1P77A 2VWGA 1MXFA 4K26A 3U4HA 3E9MA 5TJHA 4M1QA 1I2ZA 1Z82A 1NR1A 1RM3A 5H82A 3DORA 1DIBA 1OBFO 4L4RA 4RPKA 5ER9A 1EUCA 1MV8A 3GA0A 1WVGA 1W0CA 1WAMA 4GL4A 4KMSA 3V5EA 1XGKA 5TGDA 4UUOA 3UH1A 5L3ZA 3KTHA 1R15A 4GI2A 1H93A 1Z7BA 5J23A 1VJ1A 3Q0JA 4ZQHA 2PKQO 2HRBA 3MCVA 4OLQA 4J2HA 1U5AA 1XX4A 2SCUA 3B1FA 1OI7A 5CPFA 4U0KA 5F1OA 5KJ1A 3ST9A 1ZSVA 2I65A 1PX0A 1CIVA 2GZ2A 1XWFA 1NX6A 2Q1UA 2X7HA 2VUSA 5FFFA 2HQ1A 4FD3A 4J4BA 5IDYA 1B8UA 2UVDA 4BNFA 4QTZA 1RWBA 1EK6A 1SNYA 2P9EA 5CG2A 1EF9A 1U3VA 4HFJA 4RVSA 1CQJA 4E2YA 2GZ1A 3H4VA 1H2HA 3ETGA 3F6YA 5JY6A 3OIGA 1WDMA 1E1MA 1MC5A 4FFOA 2C20A 4XCVA 5I8ZA 4DPKA 2XF8A 4EBFA 4FNBA 4U18A 3OQBA 3JYQA 4R51A 4NIMA 1T1SA 2B83A 4OMUA 3IJRA 3KTKA 4NJMA 1QYXA 3ADOA 1LLCA 1JW9B 1XEAA 1BHSA 4Y98A 3VKUA 1H5QA 1XNYA 3NAQA 4RGBA 3ANNA 4HNKA 3O38A 3DZHA 4RPGA 2X58A 1D1TA 2CDBA 3DB2A 3E1KA 4YAJA 1U7HA 3GVPA 2VWPA 3M1LA 4BO8A 3RCBA 4JBIA 2ET6A 4B7UA 1M76A 3PTZA 4BNGA 1FJHA 3KOUA 4E33A 1SC6A 5F5LA 3KBOA 1EDZA 3RSHA 1VKNA 2X5JO 1GCUA 1UYSA 3DOOA 1ISIA 1R4MB 3RUDA 1ULSA 5TC4A 3GMAA 4MPDA 1V0JA 1B14A 4Y6PA 4L73A 4DTIA 5ADHA 2YQ4A 2JFHA 4D45A 1BMDA 2AHRA 3TNLA 4CMEA 4WASA 4IZBA 3OA0A 3OM9A 2GYYA 1FMCA 3UUWA 4J1TA 3JU1A 3GY0A 2PGJA 2WE8A 2PLAA 3I5MA 4NMHA 4A03A 3ZZNA 5DNAA 3AU9A 4ALLA 1N9GB 3GZNB 4YRDA 3QP9A 2PY6A 3ZWWA 1PQWA 3E48A 5G1SA 4UVGA 4EUEA 3M6IA 3ITKA 4F47A 3PZRA 4BNIA 1B15A 5EN4A 5IDXA 4UULA 1DHRA 1XU7A 4JLWA 3DC2A 2D59A 1UZNA 2X0NA 3PFFA 1AN9A 3JQBC 3VPSA 3WIEA 3PPIA 3GNTA 2YHUA 4ZDFA 1HDXA 1I2BA 3B6ZA 2F9IB 4IDAA 1A7AA 4A10A 5EERA 3HFGA 1DIHA 4P38A 5H81A 3WGOA 1ZXLA 1ZO8A 2GUGA 2RHRA 5I9MA 2OORA 4QT0A 4J4TA 5AXDA 4I4ZA 2YJZA 1C14A 4BB5A 2HAEA 1IZ9A 1WW8A 3WR5A 4EGFA 1T2EA 2O3QA 3Q2IA 5AXBA 8ADHA 2UYYA 3GMSA 3PYMA 2CVOA 1Q0HA 4ND4A 3CSDA 1ADGA 2Q34A 2PR2A 3BHIA 4YJFB 1IPEA 4BIIA 3TT6A 3HN2A 1R37A 5BSEA 3NJDA 3WFJA 2ZB4A 3LVFO 5ILGA 4BO7A 1MLDA 4E32A 2IZ1A 1LU9A 3N74A 1Q0LA 4DQUA 2IEDA 4BO1A 2VUTA 4OHUA 3PJFA 4C7JA 4CM5A 3KQFA 1E7RA 1VL8A 5A02A 1P1JA 1UAGA 3OJOA 1DHTA 4U0JA 5L9AA 4BNJA 4A73A 2QG4A 4IGEA 1DDOA 2NQ8A 5IN5A 3H81A 2GLXA 3F5SA 4D79A 3LAOA 3CKYA 3RASA 4I1IA 1HLPA 3H2SA 1SG4A 3H2ZA 4FQ8A 4I9UA 3VPGA 1E5QA 3MWDB 4JN6B 4CMBA 1KVUA 4ND3A 2HJRA 1HYHA 3ZI0A 1NHWA 2GO1A 4K29A 4FC7A 1TT7A 2QX7A 1P1RA 3RU7A 4RDHA 4A26A 1P1IA 1ZJZA 1BVRA 3QVOA 2CUKA 2I3AA 1R0SA 4OAQA 5FYDA 3C7CB 2HMUA 4CLDA 2OUIA 1LDBA 3FDUA 2ZQRA 1ZSYA 4KZPA 2NWQA 1RM0A 1Q7GA 4XJSA 5G2OA 3VVCA 5G0SA 4RDIA 3Q0EA 1FXSA 3K8XA 1C0IA 2PZMA 2DKNA 2HK9A 1G0OA 3IUSA 3KYDA 1B26A 2P9CA 1UDBA 4ZQFA 5L51A 1PTJA 1QSGA 3PZKA 4JFCA 4CMAA 1VPDA 2AG5A 2V7PA 4PZDA 4QSMA 1NQAO 2W2KA 5G4LA 4EW6A 1IZ0A 2X22A 4F6CA 2WEKA 3CMCO 4TRNA 1PGPA 3RRVA 1V6AA 4OOEA 1R66A 3DBLA 2W90A 4M87A 1DC5A 3IP3A 2BH9A 5TJ9A 5INGA 4NH4A 1HZZA 4QUKA 3TZ6A 5FI3A 5TRTA 3HDJA 3F4BA 1BRMA 4S1VA 4WE3A 3WNQA 4BO6A 3FR7A 1M66A 1LLUA 3L4BA 5GZ3A 4CLOA 2JD1A 2NV6A 5ITWA 2W3PA 4CLOB 2QZ9A 3GAFA 4UUNA 4BS9A 5LC1A 4W82A 3X2EA 1R6DA 5JO0A 3B1KA 2RIRA 4NFSA 4FFMA 2B5VA 2VRCD 5DBGA 4CM8A 3WMXA 1DAOA 1WP4A 1TYFA 4RV9A 2Y66A 5K0ZA 4BKOA 3P2OA 2JHGA 2OO5A 5THQA 4R1UA 3JV7A 1O8CA 4D43A 4BNTA 3OA2A 1U9JA 2GTRA 1E7QA 3TL3A 4RYFA 4LSWA 4IS3A 4P4NA 1VRGA 5U4QA 3UFXA 3GOHA 3HUDA 1PGQA 2VZ0A 4ND2A 4UVDA 3NTRA 3E5MA 4CMEC 4E30A 4QO8A 4N5NA 2NU7A 1LQTA 4KUGA 3QSGA 3U09A 5ILOA 4TVBA 1LTHR 2X4GA 1E6UA 4ZD6A 4XB2A 4FNDA 4E5YA 3FR8A 3H0SA 2BF7A 4B3JA 3DHYA 2I5PO 4W9NC 1ADFA 1QMGA 2NUAA 2V65A 4IIVA 3P85A 3IAHA 3VZSA 1XNVA 4P22A 5T8KC 2EP7A 2H63A 3SLGA 3KZVA 3H65A 1SAYA 3DDNA 1WDLA 2JHFA 2WYVA 2FR8A 3LSYA 1EF8A 4I5DA
chains in the Genus database with same CATH superfamily
1XNRB 1BG6A 3N39C 1LPBB 1TM3E 3MRVA 4PGGA 2J08A 5SZHB 3M4ZA 2D0DA 1WABA 3WGLA 1AX9A 5DBEX 2X0FA 4QPCA 3UG6A 4OH7A 4Q9LA 1E2EA 1EGVB 1VHWA 3O8QB 3UJBA 2ZUUA 3TKYA 5K0SA 1OXTA 1JHDA 5B3JA 4RDXA 5K6AA 2K87A 2WTXA 2V9CA 3U2QA 4W5QA 1ZGAA 4WWHA 2CDNA 5AI6A 1X1BA 3UYKA 4HDAA 3GEBA 5DBHX 4INOA 1EJ0A 2DFVA 2MIIA 3BKXA 3QWAA 4WINA 4DV3B 3DCIA 4ZOLB 1OOEA 1X80B 1N6EA 5SYAA 4S1WA 2J5RA 4GX1A 4RF5A 4TLMB 4QGSA 3T3HA 1AKTA 4F1WA 5K8TA 3ZE2B 1EZZA 1KFKB 2G9VA 3FGPA 3IEIA 3P9YA 4HJXA 4CTOA 3GUCA 1U1CA 3DEKA 4IDEA 4M1YA 2OD9A 3VRHA 5LJIA 3FUXA 1O08A 1OLOA 1WM1A 1OPRA 3H16A 1GFSA 5LQSA 5GIOE 4ZZ3A 4DDVA 4NBVA 2W0MA 3AVQA 1QAOA 1XEWY 5F77A 1OWNA 3VR5H 5B55A 2JFFA 7AT1A 3P9QA 1ZGHA 1X7YA 3RF7A 4Y6SA 1YZKA 3U9RB 5K8LA 4C0KA 3FCXA 2OE2A 2UYHA 4HNTA 3BOSA 1DKNA 1VBNA 4N76A 4GLOA 3HQ4O 4MYDA 4J3JA 2HRRA 4MHOA 4CM4B 5IHPA 1E62A 3DXXA 3AETB 3U49A 2RG7A 2H17A 2R7LA 1M1NA 3L0SA 1FX1A 5CDYA 4X8MA 5KJFA 4AG5A 1BFDA 1Z56C 2F43A 2OILA 2VQ6A 3AUTA 3FPFA 4KXFB 4WERA 1OAAA 3SXUA 4AZ3A 3ITDA 4EIWA 5HGXA 2NNLD 4NPCA 1DJPA 2EVWX 2R00A 3WL5A 1A8HA 2OCAA 2YIJA 3W5BA 5KNDH 3BF7A 3K2QA 4MYCA 1XYGA 4C7BA 3PDWA 4DUGA 4JSBA 1UZLA 4D0GA 3PRJA 1NVVR 5FUSA 2VYVD 3K92A 4MV9A 2K7FA 5GVRA 3ST7A 1K8QA 2PMCA 4AECA 3L3SA 1CRWG 1PR4A 3WP0A 3NHYA 1XNGA 3OOHA 5CDTA 1HT0A 1ODIA 1K0FA 3VYVA 1N0UA 4X1YB 5BT9A 4HAXA 5BR7A 3CUSA 2AEJA 1YB2A 5JROA 1A95A 3K4HA 4TTVA 4LGVA 4Y2TA 4HAZA 2O05A 4R5MA 3UC9A 3KEQA 1YD7A 3T12A 1PEAA 4JEMA 2FN4A 2VN8A 3SDSA 3RUHA 1EHCA 1U0EA 1WSAA 2OHOA 4RPLA 4OHZA 3X1YA 1RWVA 3UA4A 2VP2A 4XEUA 3EVFA 1E0AA 4KTVE 4FDLA 5HR5A 4K3WA 1UH5A 4D9GA 2DLCX 2YHAA 4QELA 4E6PA 1OH6A 1XTVA 1C3EA 1GQYA 1DC3A 1QIIA 1TZCA 2AJLI 3L6OO 4NBWA 3TV5A 1OTYA 2POQX 3MS2A 3SZMA 1UBMS 3CX6A 1Q22A 3QELB 1NUUA 1B0ZA 3ZY6A 5CA1B 1GQOA 2HBZA 4G2NA 1UANA 3R09A 4RPHA 1QDEA 3PBKA 5JQGA 1E5TA 1GIAA 4TS9A 2YDXA 4XW2A 5DRTA 3GEDA 1HEYA 5IBQA 3REQB 2IPLA 2MU1A 3M6XA 3HKCB 2A0XA 3PC6A 2W98A 1UKVY 5BT8A 5JCOC 3FZNA 3I05A 4PC1A 1ZIXA 2G67A 3OM0A 1KO7A 2IEAA 3HA5A 2XAUA 4XD7A 1ZJ6A 2GD2A 1OX5A 1E6CA 3M6WA 3P26A 1KQOA 4I4IA 4YRQA 1DEOA 3QE9Y 2PMDA 1TU0A 1AS2A 4UHEA 1RHUA 5BMOA 1BX0A 1S8FA 1B41A 5I4CA 1I4WA 4ATNA 2RI0A 4CL2A 3GLGE 5LZ7A 4YJ3A 3AXSA 3EISA 4Z6KA 2A1UB 1LX6A 1UBHS 3P27A 1EFDN 4KRXA 4FW8A 3E9YA 3CCFA 1C3JA 4YRJA 3RS0A 1T34A 3JARA 4GGOA 3NDPA 4EJMA 4DNXA 3SHOA 5BSTA 2ZWMA 3AWIA 2Q4BA 4O8ZA 2YN4A 2XUFA 3THXA 1KO1A 3GLIE 5IM5A 4LDPA 4UBKA 5DCLA 4ENUA 1ACMA 3RC9A 1AKYA 2XCLA 4D46A 4G5YA 1G3MA 2JEZA 1MT0A 1P61B 5EEGA 1RHRA 2DKFA 3EZLA 3H2YA 3MZ0A 3QNUA 4HBZA 3TRJA 4BO0A 1MAUA 3WBBA 3IMKA 1PZNA 3MFMA 2KE5A 3BMOB 3RYCA 1GTZA 4D9JA 2DUUA 5KU7A 2GS9A 2HT1A 3C8ZA 4ZZ2A 4HT3B 2WF6A 2XNDA 3IMEA 5G4KB 1T2CA 3KVRA 3Q85A 3KB1A 4K3VA 5EMLA 4U19A 1F60A 1AUXA 3LQ2A 4PZ9A 2ZTVA 2GEDA 4DMKA 1HKUA 2FKNA 4YFYA 3BQ9A 3UB3A 1G2IA 1V35A 3KKPA 3AT1A 2H1LA 2ID9A 3B5IA 3UMYA 1EFUA 3T8BA 3TD6A 4LYFA 4XD7D 2QXUA 1O95D 1Z5GA 2FPWA 4X1YA 3II6X 3IAXA 2P9BA 4DKJA 1V3VA 1FNBA 3BXHA 3VO2A 4OHMA 1OT3A 3QVXA 1JLLA 1LJ8A 1A9TA 2W6QA 1WZCA 3MEQA 4KLNA 4B8WA 1D1SA 1FVXA 3QXGA 4GWKA 2Y4OA 3GZNA 3OFSA 3Q7RA 1W4AA 4Q66C 2GHRA 3OICA 3BFPA 1O89A 3ZLTA 1GL3A 4BJ6A 4BL5A 2H1OA 3ZGOA 2C9BA 1VYHA 3CNHA 1I4DD 2O2JA 3DKIA 3TQHA 1N6KA 3EVNA 3NC4A 3X3HA 4ZYUA 4DANA 4LV5B 3QMJA 1BDBA 2VT2A 1ZFNA 1C29B 4BEBA 4CF5A 1TUGA 2SKEA 1A4XA 3L0DA 4M38A 3VR4A 3VPDA 3VX4A 1P1HA 3D1LA 5TQVA 4AY5A 2XB8A 5EIEA 2FMTA 2C96A 4LF6B 4HFMA 3QKRB 3S27A 1ORTA 4HWGA 1Z4QA 2YVLA 1NZYA 2H2FA 2G0NA 2PLFA 4KGZA 4RVUA 2FSVA 1VLJA 1LV7A 3P9RA 1OHHD 4M1ZA 5JFGA 2Q27A 4NLLA 3AVTA 1G9TA 2BUBA 2XE4A 1RCUA 3AEKB 4IRXA 4QOSA 3RBZA 1IWOA 2H65A 5A7FA 3C8HA 4WOCA 4YJ2B 1HMYA 2QUAA 2ZJBA 1KJYA 1NMQA 3B1XA 2F59A 3E9RA 1SQ0A 4ZVNA 1UPFA 2P65A 2NUBA 4LG1A 3WBKA 3UMVA 2QRGA 1EWVA 2A9QA 2MOKA 3VZBA 3D59A 2JF0A 1AM4D 2Y92A 3IOBA 4G2RA 3ZGXA 1EX6A 2EP8A 5E1DA 1CLEA 3EWNA 3VO8A 1XZDA 2HJVA 5JDIC 4RTOA 2C5AA 3UJ3X 4TRJA 4EVSA 1FQKA 1RVDA 2J6CA 2YR0A 4JXKA 4PLYA 2QYTA 1E1CB 2QNRA 4RZ2A 4WZAB 5AR1A 2I1LA 2NU9A 4IMIB 4OFZA 3FSGA 4X60A 1W35A 4OB6A 3IHLA 5TEWA 3WMFA 4ZN6A 4EHKA 4JLOA 3NRBA 5H4HA 1XQ6A 3NC1C 1RJFA 1B0AA 5EZYA 3Q1KA 1HE8B 5ALIA 4TWRA 4EW1A 2OXRA 1VIYA 1TYCA 1JG4A 1UOEA 1VI6A 2H9YA 1F4PA 2FOLA 4FR2A 5HPYB 3LAWA 4NJEA 5CLLA 3VDXA 4UTXA 1QE0A 4JP8A 5LQMA 5HQTA 2J7KA 2DR2A 2ZWOA 2ODWA 4YPFA 3RRVA 1O9HA 4O3MA 5LD2B 1HT3A 4BEWA 4BNXA 2OSVA 1H1LA 4I55A 3KDPA 1OJ7A 3EGEA 5GADl 2H11A 4P53A 3BMCB 1XDZA 4L9SA 3L77A 2RIPA 4Y2PA 5K6RA 4BFLA 2WJ6A 1NKTA 2F3SA 4DLBA 1P2TA 4OQFA 3TO5A 2XNSA 1ORRA 4WFJA 4EPVA 1HE2A 2HB6A 3R6TA 5F9HA 3H0JA 2FETA 3G85A 2Q3DA 3QNMA 4R5HA 3RFFA 2PFKA 4KBGA 5ALZA 1QCDA 4MW7A 2H4ZA 1C4KA 2OZLA 2ZW9A 2WYHA 4WOKA 2AOUB 2AOXA 2II6A 2QQ3A 2WYIA 1IY8A 4DZTA 5ULLA 2HF2A 4R84A 3BE8A 3CVYA 3BGDA 2Y71A 1MGPA 1Y4SA 1JBEA 3TCKA 4JP3A 1TADA 2BBTA 2BGIA 4EEXA 3LKEA 1BTOA 1YQWA 2BDTA 3V5NA 3AWDA 4LJKA 2ZRDA 3DZJA 1IHXA 4KODA 3AX6A 5B53A 1QVRA 3B5EA 4KU4A 4BN0A 3K8OE 4N47A 3W7AA 8LDHA 4J1TC 1U8FO 4FHEA 1NMEA 3DMYA 4FB5A 4ZJYA 5CT9A 1N0IA 4N41A 2F1HA 3R5FA 2QVXX 4OQQA 3JPYA 4E15A 3N8IA 2J5GA 3QK8A 2CZGA 3D6HA 5IVPA 2IXEA 3IT3A 3DYVA 4RXUA 1Q1NA 4RBNA 4RYDA 2QYHA 4NYIQ 4RH1A 4GM2A 4G25A 1TEZA 1D2RA 2PO7A 4BP3A 2UYQA 1U2RA 4QXAA 3RM3A 2XB2A 2PANA 2V4MA 4FTWA 3AEZA 2DF8A 1XU4A 3AI7A 1JHRA 3UT0A 4B81A 2BI4A 3NBUA 2YNMD 5CDSA 1K8XB 1NE2A 2NQ2C 4C01A 3VNVA 1CW2B 3D3EA 2EW8A 2ZGVA 3RJZA 3R9XA 1ML3A 2QTMA 4O4HF 1PX2A 3GEEA 4PLTA 1XF9A 4TTQA 1LUAA 2Y93A 1OLUB 3GYBA 4C3UA 1FC9A 2X9QA 5HUJA 2XF2A 1EEHA 3WQSB 2VNIA 1QH8B 2IGTA 2Z1NA 3A9UA 3FNIA 3SFTA 1U2TA 4D1YA 3PEWA 5HJ7A 1LBTA 2W2XA 3WGQA 3LFUA 2VPXA 4MLDA 3S2GA 1KQPA 2JFPA 4BV2A 3IJPA 3ED5A 3TTXA 2R87A 2QW0X 1TOAA 1C0KA 2GX6A 2O5VA 3AF5A 1LW6E 1X8LA 3CGGA 1VHJA 3S70A 2WT4A 1NGSA 4REMA 4OKNA 5BSGA 4PV7A 4ZPXA 1OGIA 2KW5A 4L08A 5ALYA 2AZTA 5DYIA 1J1IA 2I99A 1DXYA 4WLEA 6REQA 1BDJA 3QPCA 1D0IA 2F1JA 2H16A 1IM5A 3IQDB 2I7DA 4MKRA 4NOMA 4GI3A 4X41A 5ALGA 4U9IS 1XQ9A 4J6FA 4O25A 4AZ3B 2JGMA 2CNOA 4L7QA 1HYBA 1U2DC 2A58A 1I80A 1O5IA 3JQRA 5EIWA 2ZZMA 4ZCQA 5F76A 2CGEA 4DC1A 4FDMA 5JTTA 1OE0A 4CKEA 1OFTA 5DJ5A 4IX1A 5DN6D 1F06A 5LYJB 3ENWA 1WW3A 2PGIA 4LK3A 1KQNA 4LOAA 1FU4A 3BAFA 2V6FA 1MJ3A 5C8YB 1ISSA 2JGDA 2P0AA 3UF0A 1GRNA 1NQTA 2J6BA 4PBRA 3PLNA 3A9RA 1VQ1A 2GFQA 3M49A 1BDMA 2FXIA 1I1OA 4DB4A 4HUTA 1Z83A 2MSKA 1H5NA 1W1UA 4KQHA 3O2NA 5KTNA 1RAAA 1TK2A 3CC8A 2A14A 2GTIA 2Z3VA 3DAFA 1ESDA 5GWXA 5FUXA 2EJBA 1QTNA 1RZ3A 4B79A 5AM2A 3DUFB 1ZJWA 5G3YA 2WM2A 2VP3A 4Z3KA 4L8GA 3NBKA 4JUBA 3N7TA 1SBYA 5C7IO 1YDGA 3EZ7A 3V2HA 4LF8B 2IZZA 2XDYA 3KOOA 4A16A 1RJGA 4BNUA 3OHSX 4BMXA 1COWA 1E1KA 4DNQA 1G6KA 4WY2A 1SEVA 4OHVA 2OQVA 4DJ5X 5KJ6A 1CKEA 2A9RA 5JEEA 4HDMB 2CBXA 1U0HC 4KAAA 1M1YA 1V8FA 3P97A 2F8SA 3ESDA 5M04A 4OAPA 1Y1TA 1CR6A 2QG9A 3Q9NA 5AI5A 3RSGA 4JHXA 2WJVA 1VL1A 2JI7A 3AI3A 4G4SP 3KX2A 5A3JA 4R31A 4ELSA 2X2EA 9LDBA 1PP4A 5EKDA 2QM8A 3DO5A 1KP3A 1MUUA 3DZDA 1XP8A 2YJ6A 2WIJA 4OIMA 1XD2B 3ZDQA 1K39A 4G3XA 4WQMA 2JGRA 1U1FA 3SR0A 3GPLA 1AURA 3E27A 1K8ZB 4QPPA 4NBUA 3EPLA 3I23A 1M5TA 1UXIA 3QPDA 3MT8A 4TM7A 5HE9A 1IUPA 3ACDA 4U02A 3R6GA 4KO3S 3GUVA 3KQVA 2G36A 3H75A 2XRMA 1WHTB 4EG3A 3GPBA 1OLXA 2MSDB 2J3LA 3QE4A 5PGMA 4ZMSA 5BPFA 2W58A 1H1LB 3VVMA 2PS1A 4JJAA 3WVNA 3KKLA 3HXOA 2Y1KA 5F4BA 1JFVA 2JGFA 3EAFA 1JDZA 2VP4A 1KY4A 3AHGA 2A5LA 2WY2D 3GK3A 1MP0A 3H6KA 1VI2A 3IP8A 4ND7A 3MTEA 4QOEA 3CVWA 2IH4A 3VH2A 5F7XA 3QLUC 3QW4B 3FCYA 4H1WA 3L4SO 4CDMA 4RULA 3P2MA 3DS8A 4J7CA 3OZWA 3LGAA 4P86A 2HK6A 4ZDJA 3GG2A 4R9UC 2H1CA 2QAJA 4M0LA 3F5QA 2KLHA 3GMIA 4Q9IA 3ONEA 4MIOA 4Q1AA 4XLLA 4CR7A 2J3QA 2BIFA 2ZUBA 3ELWA 4O8CA 5EZYB 3AY3A 3PGQA 3L1VA 1LWNA 4A82A 2UZ1B 3B12A 2H2DA 4PHFA 4WA7A 3DPIA 4RY2A 4CRWB 4C4RA 3FG9A 4F2HA 3LCRA 4QFCA 5F1PA 2NAFA 3SZUA 4C1NA 5JVDF 4JIMA 3CRMA 4CIBA 1DFHA 5FUQA 3QX9A 1C7IA 1DTEA 1YB1A 2I1WA 1Q51A 3CKLA 2ACKA 2WA2A 1XT6A 3PNOA 4BDSA 3DB1A 1BA2A 4DRXA 4ZALA 4F04A 4ZDCA 3F46A 2C97A 1JKMA 2CYCA 3BRCA 1IQRA 2DBYA 2C2KA 5IKOA 4YMSA 4YCNA 2RD2A 2G5CA 4GWGA 4HATA 3IEMA 4EYGA 3N6RA 1MDFA 4WNIA 4LZNA 1AHIA 1QQ5A 3O9MA 2AMJA 3RV4A 5C8VA 2JLQA 3SQOA 3IPYA 2QT0A 3IUNA 3E15A 5EJ2A 2W6ZA 2LRHA 1WZ8A 1FVHA 1P0PA 5ER6A 4BZXA 1AA9A 1JR3E 4EQ6A 4OXQA 3N3BC 3SOZA 1KU0A 1XCJA 2SNIE 2BM8A 4I14A 4RVOA 3DLCA 4XDZA 2YYAA 1N33B 1D9XA 3FZQA 3T7AA 2DB3A 1FMTA 2C3PA 4G67A 2QSUA 4Z2AA 3AB8A 3T5TA 5A5DA 1S3IA 4AB1A 4LJSA 3GLFB 4M7OA 2LR0A 4WFKA 5JJBA 5KYVA 5EL0A 1QOPB 3LVQE 1NN1A 1D6SA 4W5HA 3TZLA 2WYUA 1ZI9A 4NJEB 1Z7EA 4UEJA 3H8VA 2WSLA 4PRKA 5C2JB 2ECFA 4FNOA 1JDVA 1D2HA 2FX5A 3LK7A 1M34B 4YONB 5F7ZA 1FDSA 3BDIA 3RSQA 5HF6A 4GHNA 3WP1B 4BRWA 3EIXA 5EJ8A 2WR8A 3WNZA 2D1FA 4EI2A 4Q3DA 3V4SA 2PD3A 3LNCA 4TKLA 1JS1X 1MQSA 3GLVA 1I3NA 4FYMA 4KE9A 4KTTE 5L8VA 5L6LB 2G3YA 3GGDA 4QLBA 4RHFA 1TMYA 3UUEA 4AJHA 2WKRA 3H5WA 3OFJA 3G7NA 1N2SA 4CQMD 2Q1XA 1TUEA 5KHAA 1O1YA 2D2VA 2JK1A 1R0WA 4X7BA 5AW3A 3FOZA 4LE2A 4GZ5A 4NI5A 4ZI7B 2F00A 5EPOA 4LJRA 1GYPA 4DV2B 3PD1A 1RPAA 1TEXA 1MKYA 5CU7A 5HS4A 2QQ5A 2YX1A 4NOLA 2E1RA 5JEDA 4ZK6A 2IE0A 4X94A 4GHWA 3WGUA 2QR5A 4ME6A 1E8DA 1EK5A 2M1ZA 2Q7DA 2PL3A 4J7XA 3WSTA 2XHEA 1JYEA 1U0LA 3A2KA 1KZ6A 2WFAA 3D54D 3M70A 3ZE8A 2R48A 4F12A 4MQFA 1ZGCA 1C9YA 3VBCA 3HKBA 5LP6B 5AW9A 4W5TA 4WZ8B 1TTHA 1E96A 2VSFA 3E82A 3H11B 1BD3A 3K15A 1TEVA 4IXTA 1RBQA 3AW9A 4N3BA 1OBHA 3RRBA 4DLRA 2NOAA 4FMCF 4MMZB 1JHQA 4OXXA 3BMNB 4R69A 5ALSA 3ROKA 4DCUA 4DPLA 1NBAA 4H18A 2CKDA 1NNEA 1OPXA 3JYNA 4QIHA 1TJ4A 2HHCA 4BNNA 4AJ2A 1MAAA 3GGSA 3I1IA 3R7WA 2REQB 1L5ZA 3F6EX 2ATXA 3E9ZA 1BXGA 2GHTA 3L41A 4Y9TA 2BHLA 3TGWA 3ADDA 1T0HB 3L0OA 4IPTA 1BKDR 1QQ7A 1JWBB 2C2XA 4JYAB 1CQZA 4JQYA 4J49A 2AKYA 2ZSJA 4N3CA 2E49A 3FROA 4QEKA 1FIUA 4F85A 3KKOA 1M0TA 2A33A 2PSEA 3ZWKA 3P45A 4GLLA 2X2OA 3ZNNA 4MVYA 3TFOA 4C0JA 4KO1S 1U3UA 1YL5A 1RBYA 2PV7A 4NK4A 4MHTA 1YDHA 5C0OE 4Z7NB 5CA1A 1RW4A 1GG9A 3QPAA 2P68A 1GKKA 1M3SA 3N7UA 3A58B 3CV3A 1T5DX 1SUWA 1XELA 1H69A 2DCUA 2F2TA 2Y9YA 2J48A 3FDFA 3GD7A 3RFXA 4OHYA 1L7RA 4BGUA 1X7DA 4GNKA 5DXAA 2COUA 3HFJA 5DHAA 2GJ4A 4QU9A 5B36A 4CKWA 3ZVKA 4OTZA 4C7OA 4TT8A 2XIJA 4E11A 2CE2X 3EEQA 4UBJA 4QFEA 2ZBFA 3L7KA 5CGZA 3JRNA 1RWXA 1Y3CE 4ZYLA 5H8WA 3ASZA 1J5EB 1T0IA 4OXKA 1OZGA 5THKA 3AG6A 2A35A 2VZEA 2IXFA 1QGYA 3UHJA 3Q1TA 3PDIA 1Z8DA 2PRYA 2VF8A 4M3NA 4RKWA 3TL6A 4D9KA 3PQCA 2FH5B 4P8RA 1F12A 4TXNA 4ZEMA 5ARCA 4JWTA 2P7HA 4JVLA 4YP7A 3PCXA 1ZGBA 2FJPA 2QPOA 4N3GA 4HRYA 2WUVA 4OXRA 4MRNA 5DX0A 4YUYA 1HZJA 1XZJA 5KSPA 2MHCA 1AVTA 3T61A 2RB4A 4LDNA 3VH4A 2XKBA 3UXYA 2A4KA 1RPTA 1VP9A 4EGJA 4IOLA 3OSZA 4OI1A 3S40A 4AM8A 1NDUA 5CA0B 4QDUA 5KNCD 1P9RA 5JJLA 3RARA 5IAOA 1JKXA 5GV7A 5C4IA 5DYWA 3ROQA 2AXQA 1P18A 1LF0A 2YXDA 3D7NA 3U17A 4CTJA 4B3MB 1NRIA 5JZSA 3QITA 1E2QA 1EAMA 1Y5RA 1QS0B 3B3GA 4UPDA 3C4QA 4G0NA 4DI1A 1GU1A 4S24A 3GGGA 2PGNA 1ICEA 1JLMA 2R6ZA 5CDHA 5LLDA 2EKLA 5KO2A 3EOBI 3FCEA 3PKZA 5I7FA 2JJYA 1XCLA 2ZPAA 5T57A 4WY5A 2ZE7A 1D2NA 4B9EA 2ODBA 2FB9A 3IIIA 3E18A 5BN3A 1TJ5A 1CDDA 1LVHA 4FOSA 2ISCA 1FE8A 2P0EA 3G68A 2XA1A 4CCYB 1O94A 4D3ZA 1FTGA 2XYHA 4XTCS 3V8EA 1TEHA 5BP7A 3O5AA 3Q7SA 4JOSA 1J2UA 2A7KA 2E3JA 3RREA 5EQDA 3S7TA 3KU1A 1HFWA 3A14A 1DQZA 2E89A 2BHRA 2Q1SA 1VBFA 4GOND 2AKAB 2RHLA 3AHHA 4B2PA 1T4BA 4ZAXA 3KKEA 4MGIR 1AMNA 1T8WA 3RU2A 1PJHA 3EJWA 1XMQB 2ETXA 1UP7A 4BNZA 2MJLA 5JXIA 1GV0A 1FEZA 1PG5A 3TFQA 2GLUA 1JIXA 3W8RA 4B3IA 4JOTA 1D2MA 3BWYA 4O5OA 4RK5A 4XH9B 4HSGA 1V8ZA 3JQ6A 5C5DA 5K03A 1A1SA 1SIBE 4O2BF 1L7QA 2QW8A 4MW1A 5GPBA 3ZBQA 3EGIA 3PD0A 3TM5A 3VTZA 2GPNA 2VP9A 3H5TA 2ZCUA 4KPUA 2YHIB 4KRGA 1XK7A 3F1LA 5I9NA 2ZI7A 3NBAA 3PYXA 1B23P 1M2OB 3ZGVA 3GIWA 1BEZA 3IMGA 1DQSA 4BN5A 3REGA 3WQRA 3C2QA 2IYFA 3QX8A 3KUDA 4G1FA 4G0QA 4TKZA 4ZEVA 5AVVA 2C4TA 1BCRA 1YB6A 5DH9A 4EHIA 2OBYA 1VBMA 2GM9A 3BD6A 3GH1A 1OXKB 2HHAA 3AEUB 4HLQB 5BN3B 3VXKA 3DZCA 3HDHA 1TK9A 3K8ZA 4D4JA 2JI4A 2V97A 3H97A 1YJ5A 2GBFA 3K73O 4PICA 5IK2A 2ZL0A 2VLIA 3AESA 5JZMA 5J5CA 1TAGA 1DWPA 2C3UA 4TMXA 4ZRMA 2IX9A 3RUPA 4BRSA 1N6FA 2EW1A 3ULKA 1U0RA 3G0DA 3Q11A 4P5EA 5YASA 1ILWA 2YJ4A 2A5GA 1NLZA 4Z4HA 3DF9A 3ZK8A 4NXMB 1EM6A 1M8JA 3O4JA 3BGWA 4PSUA 5IARA 1B93A 3EUFA 3I9V1 3KG2A 3ONVA 4I5GA 4IVQA 4Q1FA 4GMHA 3LKDA 1DXQA 4ZV9A 5FF9A 3E6AA 4EB3A 1DVRA 3V97A 5JMPA 1BDIA 3NMUF 4Z5XA 3EEBA 3I6IA 1UZAA 2XCSB 4U7HA 1EWYA 2OLEA 2EJCA 3T7RA 3WGTA 4Z51A 4BKQA 1N8KA 2OG1A 5LJLA 1SU6A 3TOCA 4RMNA 5KMGB 3DBVO 1XDGA 3CO0S 4HNAB 2CF6A 4U7FA 4WCFC 5CUQA 3WDSA 3HB5X 1XKLA 1YU9A 3KQQA 2H2IA 2XUIA 4FJ0A 5AKJA 4M0EA 1QU2A 2R1VB 2AYZA 2C9OA 3SSMA 4DDHA 2R7KA 3FY4A 1TXGA 3DE6X 4ZREA 4XM0A 2ZBDA 1QO0A 4I5EA 1LDMA 1DNPA 1RE1A 1PNQA 3UAZA 1ILEA 4Y1EA 2XDWA 1OAOC 4PANA 5A9RA 4TV8B 1FFHA 2COEA 3MQFA 1VMKA 4RKFA 4Z2YA 2CLIB 4ALIA 3LWDA 1GO2A 3U37A 5DHQA 4Z54A 4LXYA 5K01A 1AXGA 2A78A 3HL0A 1A76A 4E08A 2O3RA 4R54A 1PZFA 1Z6AA 3PHLA 1P2FA 3FHLA 3ZOKA 2V6MA 1Q0QA 3E23A 1Z37A 3KUUA 5GMOA 1IBSA 3WBJA 4G0UA 3INTA 1TK3A 1TVMA 4Q82A 3REOA 4TZ0A 1Q7CA 1FLAA 2P41A 5JSZA 1Z12A 3HLKA 1KYIA 3OFNA 4YCAA 5FLEX 1ISHA 4FT2A 4P81A 2G83A 1JH9A 1Y6RA 1NPDA 4LZPA 2GSDA 2C2MA 4HVLA 2J5XA 5KQRA 1O6BA 1Y8QA 2HFJA 1DO2A 2CLDX 3OEHA 1DEKA 4FE4A 4JR1A 1KMMA 4MQMA 3RUFA 1THGA 3HLN1 1S2GA 1ZONA 4RVHA 3CZCA 1PT7A 4PCUA 1KVTA 5LQKA 1JKFA 3DBIA 2Q3EA 2XMSA 1OLSA 3RQSA 3CM0A 3HRXA 1E2KA 2OK7A 1MTZA 4EAQA 2V7UA 5E9QA 4RY9A 4PO9A 1YACA 1SUIA 1M1YB 1II8B 3RVNA 3D1JA 3KTOA 3P8ZA 1R6XA 5ALNA 3WMGA 1N6OA 3JAMA 3SC2B 1GSHA 3ABSB 4DMRA 1ZK4A 1GPH1 3RRYA 3Q12A 1S02A 3B8EA 5HZHA 2UUAB 3LA6A 2PZAA 2WJWA 1G60A 5IP5A 4ZT2A 1R5BA 1K2WA 2HF7A 4C0XA 1RAHA 3RVMA 3MWEB 1ZRHA 4FFVA 2J45A 1QCYA 3TCXB 3DBRB 4GRDA 4L85A 2OHGA 5I4IA 3RC1A 4C06A 1WZEA 1Y0BA 1GNSA 2V7GA 3AV0B 1T8TA 3LDHA 3QWHA 3GARA 3TW8B 3TZCA 1CEEA 1AQLA 3IEPA 3CPHA 4UHFA 1I1NA 1P6QA 3C70A 4ZGBA 5LKAA 1W1IA 2XZPA 2V9PA 4JZKA 1T4CB 4KZKA 4FCTA 2R1UA 1FTNA 2GRUA 3EZ9A 2H51A 3LBYA 3FAZA 3SJ7A 3THWB 1JFTA 1A7JA 2HHHB 1M6NA 4PW0A 1XEFA 3AZPA 3ORFA 2ATVA 2E7ZA 3NEJA 4MP3A 1GYRA 3K05A 3Q15C 4V3CA 4FYPA 5KNCH 1SCIA 3A25A 2Q6OA 3K1JA 4RK7A 4ZRDA 1ZOOA 4DADA 4RTMA 1R50A 2P9GA 4ZO9A 2E87A 1DKLA 3KXKA 2QL6A 2DP4E 1U11A 1W7AA 2HL6A 5IDVA 1D9ZA 3DMDA 1JAHA 2BY4A 4R4JA 1WJGA 4F9FA 2VDOB 2CBZA 4LX8A 2BKVA 5TT0A 5DM2A 2WAOA 4OH1A 2IQIA 3H42B 2WSSA 5JDCC 3MTGA 1XNJA 2VTVA 3OETA 4X6UA 5LA6F 3TW6A 3AP3A 4NE2A 4AICA 4YV1A 4MZXA 3IS3A 3EZ6A 3MUFA 5AOAA 2WM9B 4G5SA 2VJDA 4P3NA 1MPXA 1ODJA 1DWQA 5IU6A 1N6HA 3HJNA 3IKVA 4JJ8A 5I7AA 5SICE 3RRXA 3THRA 3AO0B 3QKSA 1ITZA 4MPJA 5KWJA 1CZUA 4JV5B 2KI5A 5JAPA 3Q7EA 1KSFX 1W2XA 1JMVA 4AO6A 3CRRA 5IWCA 4HTFB 4DYHA 2IA5A 2C92A 3WGIA 2PX4A 3I4LA 1OFUA 2BEWB 1DTWB 1BX3A 4AMZA 4E21A 3LQ1A 2WFZA 2QWXA 1DO8A 3CZAA 3QKUA 4IWNA 5ITZA 5FL7A 5DKPA 3WGGA 4AUEA 4FBMA 3R3HA 1R8JA 4C08A 3HE3A 4E7PA 3ISVA 4MMXB 4BKRA 3BERA 1SHJA 3F8WA 2PJZA 1F8YA 1WW2A 5IF3A 5K0FA 3I0ZA 3EXHA 3LMKA 2H2AA 3H84A 1JR2A 4KOAA 4S1TA 3KPJA 1RT9A 1XAJA 2QRNA 4OXNA 3W5AA 3RS3A 3CBQA 3ZX5A 5KSWB 4MYTA 4I1RA 1DFGA 5AJTA 5GAJA 4CCAA 4YPOA 3H1TA 3S3TA 2VJKA 4BGIA 4JU8A 4DNOA 4LOKA 2J5II 4IZCA 3K5IA 3I1JA 3VKGA 3RWOA 2CDAA 3GRPA 4KR0A 1ZVVA 4KNVA 1DCMA 5CD9A 3FTDA 2ZQQA 1QPGA 1CDOA 3OLQA 1FDWA 2VSXA 4G4IA 2HJWA 3IV6A 1I7DA 3JWEA 4PSVA 4DSAA 4RQTA 2R5NA 1W73A 4YRLA 3UYLA 5G0WA 2YXBA 1W46A 3CNEA 4EFKA 3HWX1 3U13A 3Q8KA 4UJ5A 1PEKE 5A0VA 1G20B 1QHYA 3PC7A 1Y1SA 5CFRA 1TM4E 2BELA 1X77A 4BN4A 3AHDA 2P90A 1O95C 4I1OA 4KQ1A 5CVTA 2DTEA 3C0KA 1RJNA 4Q93A 1ZJ5A 2NXJA 1ZHOA 3FCCA 2BFBB 5KOHB 1SCKA 1X92A 2JD2A 2WQ6A 2UZIR 5FBRB 4CIVA 3G5MA 2XGJA 2GPWA 1N0HA 3NVDA 4Z3DA 5JWRA 4HN2A 1GFIA 2ZRQA 1NAIA 3GLHA 2HMVA 3OZIA 4R1QA 2BFEA 5L9AA 2FMXA 2ZBUA 1XZBA 3L1IA 3NTUA 4FIZA 4N0EA 4TOIA 5GJWC 5B12A 3WG5A 4DGQA 5EQTA 3RNOA 5HZMA 1MXHA 1DXOA 1UXGA 5IBCA 2QDXA 3RSTA 4OHWA 4IJ6A 3W90A 2W70A 1LXCA 5JXHA 5DU4A 4UHBA 3VR6D 4ZV7A 1M1NB 3SMVA 3T1NA 4NMWA 3OQIA 1E1DA 1WMFA 1R5JA 1H9BA 3V4RA 2GN4A 3CNOA 1PL0A 2EFCB 1AKMA 5DYYA 4NJOA 4R7GA 5LP6F 3P2EA 4MPTA 1X9IA 4A23A 3C48A 1NW3A 2RKBA 5JQGF 5LR6A 3KS9A 2IWRA 1D07A 1L5SA 3GJ8A 4WRRA 2Z3ZA 3L1HA 2FQQA 1T4CA 3HN7A 1J39A 4D7AA 1SVUA 4PLWA 4CBVA 3K72B 1QV6A 1W4ZA 1GP2A 4PNHA 3OIUA 4GYKA 2WZDA 3N53A 1H65A 1JYSA 1I3LA 1UDRA 4JSRA 3JASB 2AD5A 1DFIA 2ZT6A 2AHOA 3A1FA 4CN9A 4DOMA 2GK3A 2AT1A 3BIXA 4OLBA 4TXJA 3EB9A 2B4RO 4Q7MB 3W3AH 3P7MA 4E5SA 2A5FA 3F6RA 3R7DA 3KFVA 2J30A 3EXFA 3TNFA 4Q4AB 5LMZA 2RHWA 3D8RA 2ZM5A 4YYEA 4BWVA 4HWSA 3OT6A 3SJBA 2FMFA 4HDTA 3HEMA 1AE1A 3L4EA 1U7XA 1SZJG 4Q21A 4LRYA 3WRXC 1NRJB 2PPVA 3F6PA 1E1YA 4MW2A 4RZIA 1P31A 2DPGA 1DELA 4C0HA 1S01A 1TJNA 1GKYA 3UM9A 5IKPA 2ZDQA 5C3UA 1OXVA 3BZWA 2LIPA 3VYWA 3QQPA 4XJTA 4P92A 3G17A 3FF4A 4WLVA 2EP5A 1XZLA 4FKMA 1IG3A 1EFLA 3LPMA 3JR7A 3SU8A 2HR1A 2ZL2A 1M6HA 2CVPA 1NBIA 3OHMA 3PNKA 2AN4A 2J3EA 2PMBA 1SUEA 1FSFA 2CLSA 4DYVA 1DAPA 6ABPA 5FBZA 4BX0A 3AR8A 3LQKA 4RD2A 4DR6B 4KYUA 5GZ6A 1HG1A 3H9GA 4XPIB 3RUAA 2DX7A 2YV1A 3DMTC 3WDLA 1L4BA 4DC9A 4WXYB 3WI7A 4CM6A 3K0CC 3UO8B 3G9QA 1JI3A 1GQ2A 1RQ2A 4WGGA 2JGJA 5E95A 3VMMA 4AYTA 1LF5A 3TRHA 2GHIA 4G8BA 4X7PA 2PMWB 4AX8A 3PTLA 3KNZA 3L7OA 3OO1A 1EY3A 2KX7A 3GPCA 1ENOA 4Y2GA 4B34A 2O9JA 4PVCA 4B1FA 3SQDA 1C8LA 3ZGYA 1A7UA 4CHTA 4P3XA 1J2TA 4QULA 5U1PA 5K0JA 3DT8A 5ERXA 3PLRA