3ZW8A

Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) in apo form
Total Genus 277
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
277
sequence length
725
structure length
725
Chain Sequence
PRGSHMAEYLRLPHSLAMIRLCNPPVNAVSPTVIREVRNGLQKAGSDHTVKAIVICGANGNFCAGADIHGFSAFTPGLALGSLVDEIQRYQKPVLAAIQGVALGGGLELALGCHYRIANAKARVGLPEVTLGILPGARGTQLLPRVVGVPVALDLITSGKYLSADEALRLGILDAVVKSDPVEEAIKFAQKIIDKPIEPRRIFNKPVPSLPNMDSVFAEAIAKVRKQYPGVLAPETCVRSIQASVKHPYEVGIKEEEKLFMYLRASGQAKALQYAFFAEKSANKWSTPSGASWKTASAQPVSSVGVLGLGTMGRGIAISFARVGISVVAVESDPKQLDAAKKIITFTLEKEASRAHQNGQASAKPKLRFSSSTKELSTVDLVVEAVFEDMNLKKKVFAELSALCKPGAFLCTNTSALNVDDIASSTDRPQLVIGTHFFSPAHVMRLLEVIPSRYSSPTTIATVMSLSKKIGKIGVVVGNCYGFVGNRMLAPYYNQGFFLLEEGSKPEDVDGVLEEFGFKMGPFRVSDLAGLDVGWKIRKGQGLTGPSLPPGTPVRKRGNSRYSPLGDMLCEAGRFGQKTGKGWYQYDKPLGRIHKPDPWLSTFLSQYREVHHIEQRTISKEEILERCLYSLINEAFRILEEGMAARPEHIDVIYLHGYGWPRHKGGPMFYAASVGLPTVLEKLQKYYRQNPDIPQLEPSDYLRRLVAQGSPPLKEWQSLAGPHGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords PEROXISOMAL BIFUNCTIONAL ENZYME
publication title The Isomerase and Hydratase Reaction Mechanism of the Crotonase Active Site of the Multifunctional Enzyme (Type-1), as Deduced from Structures of Complexes with 3S-Hydroxy- Acyl-Coa.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 277
structure length 725
sequence length 725
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.50 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3zw8A03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3zw8A02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3zw8A01
3H5AA 4FD3A 2OGUA 5JAZA 1O6ZA 2X4GA 1ENPA 3E82A 2QZZA 4XDZA 1ZJZA 2DC1A 5C90A 1YB4A 5HWSA 5G1SA 2EG9A 5CDUA 1J7XA 3VH2A 4HWKA 4JN6B 4ND1A 4R5HA 3GVIA 3ZZNA 2PR2A 2O7QA 1HDCA 4FB5A 2WMDA 2VRBA 1CDOA 2VSUC 1C0PA 4W7HA 1O8UA 4MOUA 1V6AA 4I5EA 4KZPA 5B37A 1YG8A 3QMJA 2J8ZA 2VZ8A 2ZCUA 5DNAA 1ISFA 1H6BA 3GDOA 2Y66A 5JCJD 5I7FA 1NR7A 3KRTA 2VHWA 1UP6A 1LJ8A 4RPLA 1TB4A 2I65A 1JWBB 3FDUA 4FNBA 1Z74A 4DMLA 2VTEA 5T8KA 2J5II 3PQFA 2B4RO 4PVCA 4UVDA 2B5WA 3IBBA 2NU8A 2J3HA 2QQ5A 4UVGA 4CMEA 5GZ1A 2D5AA 5B4TA 4FN7A 1LLQA 1D4FA 1L7DA 4II2A 3PLRA 4HBGA 2C82A 4KQXA 4TZKA 1NAHA 4CJXA 1VM6A 3U9RB 2J5KA 3I3OA 1Q0HA 1KBZA 1GEGA 1ONPA 5F3RA 6ADHA 2OP1A 5ITVA 5EQFA 4JYLA 1HYGA 5DOZA 1PJTA 3E9MA 5A9TA 4BNMA 2V65A 4W82A 3FHLA 1D3AA 5EESA 1HL3A 2BGMA 4HNKA 3RIHA 1BG6A 1DHTA 3SWXA 1VSUA 1P0FA 5KJ6A 3GK3A 2XPCA 2NVWA 1M67A 2PZMA 3IIEA 3TFQA 3TDKA 4E13A 3WNVA 3ONEA 4YBZA 3RKRA 5A3JA 3PWKA 4IUYA 2C20A 3E9NA 3EYWA 3K8ZA 4M1QA 4NFHA 4J7XA 2DVMA 3JQ9C 3RC7A 2BFOA 5ES3A 4BUCA 3WS7A 3I9KA 4P4NA 2Y1GA 1WAMA 3EDMA 3JV7A 4B79A 4PG5A 3JQAA 4WZ8B 3CSDA 2W2LD 4PLVA 2UZFA 4JJTA 5FIFA 2PV7A 4W99A 4XB2A 1IY8A 1X14A 2HKIA 3F6YA 3PJFA 5JSFA 2C2XA 4YQYA 2F9IA 4FZWA 1OFGA 4BHTA 3C85A 2ZYDA 2OL4A 3PIIA 5FI3A 5BNTA 1ZFNA 4WLOA 5CG2A 3BHIA 4XD2A 4O5OA 3RUEA 4A5OA 1K5HA 4Q3EA 3SXPA 4K6FA 3RUIA 3NTOA 4J2HA 4GX5A 4XCVA 4BNHA 1HE4A 1I30A 1R0KA 4XYEA 2YFQA 3CPSA 1U5AA 3H9EO 5KJEA 2XXJA 4FSHA 5K0ZA 4URFA 3PXXA 1DBVO 2CVOA 3K92A 2JFGA 5G4KB 3ZN2A 1NNUA 4MIEA 4TZTA 1HE3A 4BNIA 2C54A 3D3WB 4D0SA 3PIDA 2CSUA 3HJAA 2FWMX 2CF6A 1KS9A 5DCWA 3NEPX 1Y9AA 3PJGA 3P2YA 4U7WA 1FK8A 1WLYA 3GDFA 2Q50A 3TZKA 4DLLA 1HDXA 1Y8QA 4P8RA 4DPKA 3ZWMA 2GNAA 4Y9DA 4AJJA 3VKUA 3NUGA 5A05A 4N18A 2O4CA 3K8XA 1VL8A 4WCDA 3NT2A 4OLQA 3DTTA 2DAPA 2O3SA 3KTIA 4KUGA 1UZMA 2BLLA 4YWJA 4L4SA 2GO1A 3ZWPA 3ZHYA 3ZW9A 3OEYA 2XXBA 4YJFA 3WXBA 3NDIA 4K1LA 1ZCJA 4IGFA 1K89A 4OXKA 4XYBA 1LLCA 1XQ1A 1I32A 3CE6A 2A7KA 1VL0A 3RAJA 4L6WA 5JDIC 2ET6A 4QFDA 3OIGA 3DZGA 1E3EA 3HN7A 5IJZA 4QIIA 4YAKA 5FF9A 3U62A 3OEWA 2QRKA 1DO8A 1PQWA 2JD2A 5DTWA 4A27A 3U4IA 5G0SA 2YQ5A 4H15A 3RASA 2O3TA 2PWZA 4GHNA 1VKNA 2JD1A 4O59O 4B4VA 4U0KA 3FN4A 3ZDFA 4W9NA 3A9WA 1JDJA 1YDEA 3GPDG 5G0VA 1LSUA 1WZIA 3RCBA 1VSVA 4JXKA 1DAPA 1GCUA 3S1LA 4JCSA 1ZK3A 3DEYX 3K96A 2EJVA 1IPEA 3P5SA 1XNVA 3ORFA 3FTPA 3QVSA 4BNZA 4JFCA 4XDYA 1DFHA 2D59A 2QG4A 8ADHA 3KTKA 2JCVA 2ZTMA 3PQDA 3T4XA 1SB9A 3WOHA 4BKPA 1IHYA 4KWHA 2EGHA 3OSUA 5AYVA 4CM1A 4A7PA 5FEUA 1T24A 4BKRA 4HFMA 5IG2A 3IAVA 4HC8A 3GVCA 3M2PA 3UUWA 3CIFA 3Q0JA 1UDBA 3RQSA 4AJEA 4PG6A 3WMWA 3E9QA 4AICA 2PFGA 1U3WA 1UAYA 2CNBA 4NIMA 2Q35A 4GM2A 4NEKA 4J0EA 4BGIA 3BTSA 4J7CA 3VPSA 4W7IA 3FBGA 3GVXA 4CMEC 4L74A 3PTZA 4CQMA 4J4TA 5E0SA 3WTCA 2AEJA 3WJAA 5JCJA 1PSDA 3OECA 1T1SA 2Q1UA 4Q3DA 4LMRA 3F3SA 2PTGA 3AFMA 2DTXA 2YHIA 4XQEA 4RVSA 3I4FA 2O3QA 1NP3A 4DRYA 4RCNA 2VTDA 2C0CA 4ZDDA 3GZNA 3V2UA 2UUPA 1DC6A 1OBFO 2FOIA 1U4SA 2PGDA 4OQYA 3BTOA 3N7UA 2BGKA 4GVXA 4PLZA 4YRDA 4WEQA 2ZL4A 4I9HA 2CZCA 2OUIA 3M1AA 4PZEA 5EN4A 3V2HA 4B3IA 4BNGA 4ALJA 4CMJA 4XB1A 5K6AA 3ZU4A 3OJ0A 4D44A 4FOSA 3CUKA 1EF8A 5CDSA 3H0UA 1N2SA 1X7GA 1ZVMA 4GLOA 2VRCD 1RJNA 1KVSA 4YA6A 1NAIA 4CODB 4R69A 3WGIA 4CLOB 4OMRA 3ULKA 1GQQA 3SJUA 2J5SA 4DLAA 3PGQA 1YQGA 5L9AA 1L1FA 3HFGA 3ZWXA 5KIAA 1SZOA 4QO7A 2DQ4A 3DR3A 3AY3A 2NQ8A 1SZJG 5EIOA 1ZK4A 2XF8A 5DBGA 3GUCA 4WPGA 1F14A 1QV7A 4XA8A 3ASUA 4CLRB 4EITA 5CG1A 3TSCA 5ENDA 3AM4A 2Y0DA 4BNWA 4RQTA 3JQ8B 3WICA 4I8XA 4XRRA 3MJ4A 1K32A 4BNXA 4Q3NA 1IPFA 3PVZA 2I5PO 5G4KA 3MWDB 1ADBA 3EMKA 5TSDA 3GF3A 1E3JA 3HDHA 3U4DA 5F1KA 5DUCA 5H81A 3VVCA 5AQ1A 5FFFA 1J0XO 3TFOA 5EL0A 3ROMA 3G64A 3UKOA 3KXDA 3ZV5A 4BV9A 2Y1FA 3GFBA 3QK8A 1P33A 4FBGA 3ST7A 4J1TA 4YLHA 4INAA 4R1NA 4J6FA 4CL3A 5CDGA 1EK5A 4RVGA 2E49A 1B8UA 2FR0A 4JJIA 4BKUA 5C3MA 1RM0A 1UZLA 3U4CA 5L4NA 5FUSA 4J3FA 4MVJF 1S7CA 3CEAA 2DUUA 1DAOA 3FNHA 4OMUA 4OKIA 4K29A 1XGKA 1SNYA 3QE3A 1SOVA 5DZKA 1WMBA 3H02A 1XDWA 3HB5X 4ZQFA 3ZGYA 4GWKA 1PWXA 3GQVA 1Y1PA 3KYBA 1DCIA 3TQHA 3PE8A 3LDHA 1KETA 5JC8A 2OBNA 3T88A 4QO8A 1FC6A 3KEQA 3PZRA 2I3AA 3DQPA 4B8WA 2Q1WA 4JX8A 1RJMA 3T8AA 1LLDA 1NFQA 2OP0A 2DTEA 2SCUA 2X0JA 4Z0TA 3JYPA 2J3IA 4B4WA 1BDBA 4YRBA 4MI2A 3L6EA 4U19A 3EVNA 2RH8A 4ALKA 2CBYA 3LC2O 4D46A 3IDSA 2JKVA 1UUFA 3GVHA 1HDZA 4QECA 4PLFA 2EV9A 3VDRA 4CLHA 1KY5A 2GZ1A 3GAZA 2BGLA 4FFLA 5GMOA 3EK2A 3OQ1A 3SEFA 4J49A 3KQFA 3VDQA 4ALNA 3X2FA 1WPQA 3D7LA 4EMLA 1MUUA 4YVFA 6LDHA 2VSSF 4XQGA 3SLKA 3ITKA 5HA5A 2GERA 4W9NC 4D45A 4J2OA 4JSBA 1A9ZA 4DLBA 4CM3A 5C37A 1UYRA 3BZUA 1OOEA 2QW8A 2HAEA 3LVFO 4MPDA 4A10A 4AJHA 3E1KA 4BNTA 4CMCA 4RVUA 1PIXA 4NMHA 5A4DA 1TVEA 3UN1A 3KETA 3DBRA 2HK7A 3GHHA 4DUPA 1DLIA 3DO5A 1B2LA 4M54A 3WSWA 4CV3A 1FC9A 1WZ8A 3E18A 4YCAA 4YYZA 3L6OO 3GOHA 3ZWBA 4D3FA 4E2ZA 3KYCA 3E5MA 5DULA 3PJEA 1Y81A 4ZDEA 3CH6A 2A35A 4G81A 2E37A 4GLLA 4P38A 2EGGA 2C29D 3IKTA 4RLHA 1HEUA 1VC2A 5CHEA 2VYVA 5BT9A 1V9LA 2DBVO 3O4RA 3PWSA 5A5FA 5KDRB 1PGNA 4BS9A 1I10A 5C5IA 1YRLA 1OD4A 4E31A 1JTVA 3H2SA 1DC4A 1FDVA 1AGNA 5THQA 3T7EA 1CETA 1QG6A 4ESOA 1O89A 2NTJA 4CMHA 4GH5A 1B8PA 2YV2A 3LYLA 3U9SB 4E33A 4NQZA 3DOJA 5IDWA 1NR1A 2I76A 1UXGA 5EMHA 4MVJA 3UH1A 2GTRA 3R9TA 1BGVA 1XLTA 4L73A 4OJNA 2W2KB 4BIIA 4CLOA 5EPOA 1PL6A 3TWOA 3DL2A 2WWRA 4B8ZA 4D43A 2VT2A 2XOXA 2X24A 4RL6A 4YAIA 4A0SA 3FSRA 2CD9A 2DU8A 3P19A 4HFRA 2NADA 1H6AA 4OYRA 3B1FA 4WUVA 2ZB3A 1X7HA 4GBJA 4CMKA 1MV8A 2LDXA 3TJRA 4MP3A 1N6FA 1E3WB 3ANLA 1R66A 3DBHA 4J4BA 4RVHA 4QEDA 2NLOA 2A92A 2ZB7A 4NBUA 4YJHB 2WYUA 4CPDA 5T67A 4KUEA 5JDCC 2I67A 2IEDA 4PG4A 1NVMB 2RHCA 4XIJA 3I9LA 4C7JA 3BHJA 4M55A 5DL1A 5TS3A 1R4MA 1F12A 3QYRA 3ADOA 4A03A 2NSDA 3A14A 3Q0GA 4CLXA 2PZJA 3QWHA 3GMSA 2OMEA 2VRCA 1C1XA 4IINA 3QV1A 5L7YA 5ITWA 1SOWA 3R1IA 1T25A 4IMPA 1YQDA 2H5LA 5K9ZA 2JAPA 1XU7A 4ZU3A 3SBOA 1DIHA 4C4OA 1K6IA 1MP0A 4FGWA 1R4NB 2FMUA 1LDBA 1GQYA 1LI4A 7ADHA 3BMNB 3GLMA 5CFZA 2WE8A 4OOFA 2VSSA 4IZDA 1I8TA 1PR9A 3G3EA 3FI9A 4FS3A 2NM0A 3F4LA 3DWFA 2HW5A 3B1JA 1BVUA 2HK9A 4ZQBA 3GEDA 2GRAA 4PFJA 1IYZA 1PZFA 3LAOA 1B3RA 1TG6A 4Z3KA 4CM8B 2EF1A 4CMIB 3PHIA 3MOGA 3K2BA 4E2YA 1U8XX 5C7IO 1DIGA 5L40A 3D5QA 3OQ6A 1A7KA 1B26A 3OHSX 3ZNOA 2WD8A 2Z1MA 2VNAA 4CM4A 3BHMA 3GNTA 1EK6A 1ZEJA 4IGEA 1NBOA 4YACA 2ZTVA 3DZKA 4CQLB 4N5MA 4DBZA 2J5GD 1E6UA 3NX4A 5DT9A 4I52A 4DPLA 5A9SB 4FB8A 1R37A 3DZJA 1PJ3A 1RYDA 1Z73A 3H2ZA 3NT5A 1E5QA 4LMPA 3IP1A 2P5YA 3MEQA 3VH4A 3LSYA 4D79A 3DHNA 2PD3A 4B7UA 4BMVA 4DC0A 4J43A 1VKOA 1CRWG 3O03A 3I6IA 4YAJA 2NP9A 3HB4X 1HZZA 3N74A 4EUHA 3FR7A 5A1TA 3CMMA 3K2EA 1E3SA 4XYMA 4CV0A 3W8FA 1GCOA 3QVWA 3EHEA 3H9QA 3ZI0A 5CPBA 4Q0GA 4RF2A 4JROA 4DYDA 2YY7A 3JYNA 3O8QA 4EW6A 4AJ2A 4OG1A 3WYBA 1LXCA 5DUFA 1CF2O 3HHPA 1OZAA 4YTEA 3LF2A 5TF4A 1GZ6A 4L75A 3H0SA 3HE3A 2JHGA 1BW9A 4IIVA 5ICMA 2Q49A 3CINA 3T4EA 3V5EA 5T57A 3FBTA 2ZK7A 3ZHZA 3NGXA 3S55A 4OSOA 1EY3A 1Y5MA 4X54A 5JMPA 4LN1A 4BO3A 2C59A 4YDRA 2ZATA 4HXYA 3VHRA 1QP8A 2VHXA 1HSZA 1NM5A 4ZRMA 1A27A 4IQ0A 4BNYA 4HNHA 3RROA 4EYEA 1U28A 2V6BA 2NU7A 3DMTC 3RKUA 3KV3O 3FNFA 1C0LA 3SLLA 1NZYB 3S8MA 3TRIA 4TRJA 2Y68A 2I6TA 4K3WA 2J5IA 1X15A 3UW3A 4Z6KA 1ML3A 3OT6A 1M2WA 4QUKA 3V1TC 3VPHA 3WQQA 1YGYA 3K73O 5F21A 3V8BA 3EVTA 3L0DA 4L4RA 3WGQA 3UICA 3S2GA 3V1UA 3OETA 4ASIA 4BO8A 2NVUA 3KLMX 2GDZA 5JBWA 1EDOA 2P2SA 3GHYA 1VL6A 3MJTA 3WIDA 5TJHA 2B69A 1GYQA 3VTZA 3RFVA 4IS2A 5JC1A 4FGSA 3Q11A 2BELA 2CF5A 4I08A 1NHGA 4RDIA 3EW7A 4JBIA 1X13A 1E7QA 3WQSB 3NRCA 5DP2A 4NK4A 5JDIA 2R2GA 4DIFA 3AI2A 1XIVA 2DM6A 4WJZA 4YJDA 2ZTUA 1E92A 3PHJA 3NV9A 4NBVA 4U6SA 4WECA 2AG5A 1LU9A 3M6IA 3PFFA 5GZ3A 2J3KA 1U5CA 2GR9A 3HN2A 4R1SA 5IFLA 2EJ5A 2G1UA 3A28A 1Z6ZA 1GUZA 1MB4A 1PGPA 3KUXA 3LQFA 4WK6A 2X5OA 5IKLB 3MJEA 2HMUA 4WNCA 2P4QA 2Z5LA 1F8GA 5CEFA 3LT2A 4NFYA 3TVWA 3ICPA 4JWVA 4YJHA 3L9XA 3JTMA 2CDCA 1P31A 2VQ3A 3AUTA 1E3IA 2G82A 2ZL0A 3ZCXA 1OD2A 2RCYA 2G0TA 4WKGA 5TQVA 4JP2A 3TN7A 4CMBA 2WDZA 2ZYAA 3JD0A 1ZSYA 4NK5A 4BMSA 1NFFA 3QVTA 5F1PA 2P4HX 1JW9B 3AI3A 1C1DA 4RQUA 1MC5A 4FNDA 5LC1A 5I8WA 1ONNA 1LDGA 2PZKA 4YR9A 1PTJA 1Q7CA 5DU6A 4EEZA 1QSGA 4MP8A 1QKIA 2EP5A 1D1SA 2Y93A 1H6DA 3F4BA 2BRUA 3BTVA 3QKAA 2WYVA 1Y8RA 2AE1A 3H3JA 1SEVA 2UYYA 2D5CA 4MIOA 3VZPA 4CR6A 1PL8A 4JYJA 4BV8A 1VJ0A 3BMCB 2UV8A 1X0UA 1PL7A 1T26A 3H0JA 3M2TA 5L45A 2GUGA 2R00C 3G79A 2Q2QA 1UYVA 3TZ3A 3C1AA 4I9UA 4GGOA 4CM8A 3Q9NA 4CMIA 9LDTA 4D3DA 3ASVA 3W8EA 1WDKA 3R0OA 5DN9A 4IDEA 1UP4A 2BI7A 3QLJA 1E7SA 1O5IA 4IJKA 4WLVA 3JD4A 2VUSA 3DXFA 5DU4A 3C1OA 4D42A 4OM8A 3JD1A 4IJWA 2B0JA 5AXBA 2ZTLA 5C7LO 4Z0HO 3RRVA 4U0GH 4IMRA 1ON9A 2EKQA 1UXJA 5LCXA 4E0BA 3UVEA 2E82A 4ND4A 1I01A 3JQGB 2VUTA 3H65A 1AXEA 3IUSA 1SMKA 1A72A 4BO2A 3MOYA 2V7PA 1M6WA 2DUWA 1ZXLA 4UEOA 3U9TB 1LDEA 1H94A 1M76A 2F6IA 1DRUA 4CLEA 2F1KA 3ANNA 1A71A 4ZDFA 4S1VA 3AM3A 3FD8A 3K5PA 3ZU2A 4PLHA 5HS4A 2EIHA 3P2LA 1N9GB 4B7CA 1ORRA 4MDHA 2ZQRA 1I36A 4OXNA 1Q7BA 3ETEA 2HDHA 5JPIA 3DJAA 1MGOA 1ENOA 4D3SA 3Q1TA 4DBVO 1PEDA 1ZSNA 3MCVA 4ZICA 3F47A 3GFGA 1ZMOA 1TI7A 1CJCA 4GVLA 3PDJA 4TRNA 4WYOB 1GV0A 1QV6A 3VPXA 5JW6A 3I9NA 4IDGA 5HBRA 4B3JA 3MWEB 5MDHA 2J5QA 4Q1IA 2DEOA 4ZQEA 4J1NA 5JY6A 1ADGA 3INGA 3NT4A 3OA2A 3WFIA 1E6EA 4FFMA 3STAA 3H6KA 2I9PA 2WD7A 1NWHA 1ZKMA 4BGVA 3I83A 3PWZA 3L6DA 1X1EA 1HNOA 5JO9A 2D1YA 3RSTA 3RUCA 3H9JA 3KB6A 1YWGO 1XELA 4E2XA 2GN8A 2BFPA 1WP4A 2YW9A 3JU1A 1I33A 2EXXA 1UXKA 2WM3A 3JYOA 1AHIA 4E32A 1OC4A 2VT3A 5L4LA 4EDFA 4PGFA 3VPGA 1LA2A 4BNKA 4JGBA 5DCYA 1Y9EA 1YOVB 4E12A 2B35A 5KWEA 1PJCA 1U3TA 2OZPA 5KOIA 3P5MA 4YEDA 2ZQQA 4R01A 3OMLA 2LDBA 1XX4A 4PCVA 2PG8A 3AJRA 4YXFA 4GX0A 4CR7A 1NHWA 3KVOA 1LSOA 4BO4A 5TX7A 4MO2A 3HRXA 2OO5A 1HETA 4Z9YA 3BMOB 4L8KA 1MG5A 5A02A 3NTQA 4ELSA 3VH1A 4DA9A 5GY7A 2EP7A 4RYFA 2PD4A 2JAHA 4IJUA 2HLPA 5IF3A 2B5VA 3RC9A 2JHFA 4NU5A 4OSPA 5IDQA 1HLDA 2AQIA 5L95A 4XYLA 1QXSA 3NJBA 3DTYA 3D5TA 3HUDA 3LLVA 3GNQA 1YL6A 4NDNE 3ZWNA 3TT7A 1ZSVA 5KKAA 3UCXA 1PIWA 2PKQP 2I66A 2RAFA 1YL5A 4BNJA 1T4BA 3ANMA 8LDHA 1X1TA 1WDLA 1IUKA 4XR9A 3WB9A 1QMGA 2HRBA 2Y67A 2X9GA 3MTJA 4N5LA 4RPKA 2OXIA 4BB5A 3ADPA 1J6UA 1RM4A 1IZ0A 4TKLA 4YT5A 1W0CA 3ITDA 3WLFA 1N6EA 3WGZA 3C1TA 4LGVA 2CVQA 4LK3A 3KO8A 4BO5A 3WDSA 3JCZA 3FF4A 4IZHA 3TZ6A 1GZ3A 4P4GA 3BF0A 3L77A 2IZ1A 2HMVA 1PZHA 1D1TA 1HDOA 4EJMA 3OFSA 1KY4A 2HK8A 4JIGA 3C8MA 5CDYA 4PZCA 4JOTA 1PJQA 3JYQA 3DAPA 1L7EA 4NG5A 4EGFA 3BMQB 4GGPA 2O3JA 3Q7HA 4WCZA 4GX1A 3UCFA 4GMGA 3PYXA 2CVZA 1B7GO 2DPGA 3RSHA 3WTBA 3DB2A 4LSWA 2WTBA 3FPCA 1P1HA 4HUJA 3GF7A 1P0CA 4BQPA 1TEHA 2G5CA 4B7XA 4H3VA 3DHEA 1A4UA 3AK4A 1EBFA 1B15A 3NJ4A 1WDMA 3RBXA 1Z45A 2EKPA 4HADA 4KQWA 3D4NA 5B1YA 1T2CA 4ZD6A 4D0RA 3WBFA 1XQ6A 1NQOA 3LZ6A 4IZIA 1MLDA 3C7AA 1DPGA 5B12A 2ZB4A 1EUDA 3GDGA 3G49A 2P9CA 5I8ZA 4Y6RA 5L53A 4LCEA 3EY4A 5ILOA 5JY1A 3ZNQA 1N9GA 4IDDA 3CKYA 3GGOA 5KVVA 1NVTA 5KKCA 3H9UA 5JDCA 1U3VA 2HUNA 1H9AA 4TVOA 2C5EA 7MDHA 1H9BA 4JNKA 2PY6A 5A9RA 3E5RA 4I5GA 1E7YA 3PYLA 3RU7A 1V3TA 5JBIA 5U1PA 3IKVA 1I3KA 3VAZA 2I3GA 5DF1A 5INIA 3ZWOA 5U4QA 4BO0A 5KJFA 1DB3A 2AEFA 1K6XA 3VZRA 3GG2A 2BD0A 2W2LA 5IAAA 5LDHA 4DQUA 3D3WA 3HDJA 2NACA 3DZIA 1JKFA 1YQXA 2JFHA 2YQ4A 1N7GA 1NQTA 4U6QA 4XR4A 3UF0A 1U1IA 4MINA 4Q9NA 3IQDB 2O2YA 3JQBA 3PEAA 5FI5A 4NFSA 3S2FA 4CL8A 3G1TA 3OJOA 4ZVVA 1N8KA 3U3XA 1LTHR 4E5MA 2NU6A 3GGGA 3AUUA 4ITUA 1NQAO 1W73A 4JBHA 4JCQA 4DC1A 1R15A 5FWNA 3I5MA 3A1NA 1E7WA 4TKMA 1QYVA 3JSAA 1GAEO 2F00A 2QYSA 3CMCO 4GSKA 4HY3A 3TL3A 3TPCA 4E4YA 5C9GA 2GSDA 4HNGA 1JVSA 2D8AA 3FTNA 1SBYA 1ZXBA 4HX5A 2WJPA 4OH1A 4ALLA 1U7HA 3FRJA 3H3FA 3ZWAA 1C3VA 3GZ4A 1R0LA 4XIYA 5G0TA 2V6FA 2RH4A 3NJ8A 3NTRA 4AJIA 1VRWA 1XA0A 1R6DA 4KNPA 5A04A 2JCYA 3OBBA 2QX7A 1VI2A 1RJWA 1UR5A 4Z0MA 4JLWA 1HT0A 2H6EA 3IP3A 2DFDA 1YBVA 3ONDA 2X6TA 4ND5A 4YJGB 2ZIZA 5IDYA 5KVSA 5AXAA 3KYDB 3RU9A 4XJTA 3RUFA 4MKRA 5CTBA 2EHDA 2VWPA 1Y6JA 5F5NA 1GV1A 4DL9A 1FXSA 3ABIA 4I5DA 2B83A 2BH9A 3MYBA 3TZCA 3O38A 5E0SH 3GAFA 4R3NA 4D7AA 1KYQA 4OOEA 4O1MA 1LRKA 2WEKA 2Q2WA 3D0OA 4MVJM 4QT0A 1ZMTA 4FFPA 1JQBA 3KLPX 1KVQA 4AJ1A 1DHRA 4A2CA 3DZBA 4LW8A 5BR7A 2DLDA 2F9YB 4QTZA 1LSSA 2NTNA 3I9MA 2RBEA 1PZGA 3RC2A 2JL1A 4R54A 2IRWA 2PZLA 1FC7A 3DMTA 5TT1A 4CLDA 1TT5B 2C2YA 3M6MA 4CV1A 1WXDA 2ZQYA 3ROPA 2VWGA 3MZ0A 2YHUA 4WLNA 3VIVA 1I3MA 1OMOA 1PGOA 4ELXA 5J23A 2GN4A 4OKNA 4FFOA 5JFOA 1NPTO 2IZZA 3BTUA 3QVOA 2CFCA 4S3MA 2IXAA 2R6JA 4NU6A 4Y6SA 2EEZA 3L4BA 4LVUA 4HV4A 1PZEA 2CY0A 2VYND 1GZ4A 4Z0PA 4R1UA 1PX0A 1SCUA 3HDQA 3GNSA 1ZNQO 2UDPA 2YUTA 3JD2A 1BRMA 1HRDA 3JQEA 3KEOA 3RUAA 1HTBA 1W6UA 4NJMB 1V3UA 1LNQA 1O9BA 1X0VA 3HFSA 4I1IA 1UH5A 3VPFA 2DT5A 1GR0A 3WG5A 4E30A 1UJMA 4OAQA 1A7AA 4IDAA 1YB1A 3AY6A 4FN4A 4WLUA 1U3UA 5HRUA 1BXGB 5A03A 4GQAA 3I52A 4IS3A 2EW8A 1Q52A 1JWAB 5THKA 3ETGA 1N1EA 3QXZA 4BGEA 5INGA 2Q3EA 4WLEA 4NJOA 4YQZA 4EMMA 1QORA 4G2NA 1F8FA 1LQTA 2E6UX 2OORA 3AOGA 4RV9A 1FJHA 4OGWA 4YRAA 3DAGA 4TVBA 2GPTA 3TVUA 5HS6A 1P74A 5L51A 2O23A 3DDNA 2VZ0A 1IE3A 2GD1O 2D3TA 2X8LA 1PGJA 3B1KA 3GRPA 3TZHA 4GI2A 4CLRA 1IZ9A 4AJLA 3JQ8A 3QY9A 4OIMA 5DZKH 3PJDA 1JVBA 3IJRA 3OIDA 3NDRA 4UUMA 4LK5A 2Y1OA 4NNQA 2GASA 2AEMA 4EMPA 1FDUA 1HF3A 2IYOA 4M86A 9LDBA 3H5RA 4DREA 3I4CA 5JCXA 1ISMA 1YB5A 2YDXA 3H5NA 3ONFA 4CMAA 5EINA 3DOOA 1DIRA 1XHLA 2W90A 2AQKA 2Q1TA 4XWYA 1YH3A 3D4OA 3GR6A 3WG9A 5T5QA 4XYGA 4R16A 4BNLA 3ZNPA 2AMFA 4JCTA 2R00A 3HADA 2W8ZA 4RZIA 1OC2A 2NU9A 2IE0A 1X7DA 5JNLA 3KSUA 1ZK2A 1M6HA 3ETDA 1E1LA 3JQBC 2X0RA 1YE3A 4DMMA 4FIZA 1EVIA 4FW8A 3BIOA 4K9DA 5CEJA 1RPNA 5TRTA 4UVIA 2IXBA 4M89A 3K9QO 5A5EA 3OJFA 1U9JA 2B36A 2IEBA 1N92A 4IQ8A 2FSVA 4FQ8A 2E48A 3MTGA 4PG7A 2ZKLA 3UAGA 3HDYA 4KD6A 1MC4A 1DC5A 2Y99A 1GU7A 3H7AA 4MKXA 4PIVA 4AJ4A 4R4JA 1U2GA 3TDCA 1LC3A 4MOWA 4C7KA 2GCGA 1ZUD1 3HINA 1DIAA 3CZMA 4DTIA 5A06A 4OQZA 3UHAA 3R9SA 1QYDA 4RLSA 2Y1DA 4O63O 4JBGA 1UYSA 1ZW1A 3R6HA 3GLQA 4JQCA 1XSEA 1YJ8A 4F45A 1ADCA 2Y0EA 3KYDA 1KVUA 1ON3A 1HSOA 3QREA 2ZYGA 5L7WA 2X5KO 3GY0A 3B6ZA 4RVFA 2O3UA 4XX0A 3QP9A 3E8XA 4RDHA 3EC7A 3UGKA 5MGBA 1O8CA 2H1SA 4LSMA 4BB6A 1J5PA 1GUYA 1PR3A 3QXIA 4U0HA 1HDGO 1ZBQA 4R3WA 3MOIA 1T2AA 3VKVA 5JAQA 3EUWA 4AVYA 5L7TA 4I42A 5COQA 1DUBA 4B4OA 2VUUA 2VWHA 4W4TA 1NWCA 1XU9A 1U4OA 3GUYA 4PLWA 4WGGA 2CDAA 5COAA 3GA0A 1RM3A 3INTA 2F9YA 3COSA 1QLJA 2AG8A 5ENVA 5JE8A 2FSSA 5IN4A 2DTDA 5HTOA 2D2IA 3PFWO 1GFSA 1E5LA 2ZJ0A 3U5TA 5DTPA 1Q0LA 2AA3A 4RO0A 3TZQA 4CM5A 1Y5RA 1C0KA 4MVJH 1K0UA 3M1LA 2A9FA 1DXYA 2F9IB 3W4IA 2AQHA 3WNQA 4AJOA 1LRLA 1YKFA 2CMDA 2FN7A 5IXSA 2NTVA 3KHUA 5DOVA 1QYXA 2Z1NA 1T2EA 2POQX 5U9CA 5KDRA 1D7OA 3KBOA 3Q3CA 3EZYA 4QFCA 1GQ2A 3L4BC 5TT0A 4B4UA 2W3PA 4PRKA 3ICCA 1LSJA 2ILTA 3Q0EA 1EQ2A 4LVCA 3CXRA 2PKRA 1H0KA 3Q6IA 4JP3A 4Q39A 3S2IA 3MFMA 1HYEA 3QQPA 4FPXA 3WGYA 1PJHA 2VWQA 3O26A 2QRLA 4N54A 1DJQA 1I5RA 2NV6A 2HSDA 3AW9A 2HU2A 3LU1A 3QRWA 4FC6A 4NBTA 3GEGA 3ZV3A 1B0AA 2DBRA 2Q99A 3MJCA 5FYDA 3P85A 3G0OA 4F46A 3C24A 3RBVA 1HKUA 1K3TA 4UEKA 4UVEA 4XJSA 1U7TA 5G4LA 5TJ9A 2TMGA 2W2KA 2WSBA 2VYNA 3OF2A 3DFUA 4CM9D 1Z82A 1J49A 4PN3A 1NASA 1SC6A 1Y8QB 1ISIA 2YFHA 3U49A 2FP4A 1F0YA 2GGSA 4FC7A 1WNTA 1YVEI 3KZVA 3RI3A 4BKOA 4IJVA 2G76A 2UVDA 3RFTA 1BWSA 1E3WA 2PBPA 3UCEA 2C8TA 3NYWA 3W8DA 1DC3A 3ENNA 1P1JA 1CQJA 4IQGA 3RVDA 3I9OA 4ND3A 1A5ZA 3PHHA 2B4TO 3OM9A 3PZBA 2Q1SA 2HO5A 3DC2A 4R41A 1BHSA 3OC7A 4Q3BA 5AOVA 3HQ4O 1T1RA 5F5LA 3SC4A 3WGOA 3I1JA 4HFJA 4L4XA 1RKXA 1DEHA 3RUHA 4XGKA 1JKJA 1B14A 4RCVA 3AY7A 3TF5A 1IOLA 1EVJA 1R4NA 2YDYA 1ZO8A 4G65A 3KTJA 3F1KA 3BMNA 3NJDA 2P9GA 2AW5A 1U2DA 3ZWCA 4RPGA 5L3ZA 1YBAA 3AU9A 1EVYA 3ON5A 1DRVA 4OL9A 3WSVA 3L9WA 3H9GA 4AJNA 1YJQA 3PHGA 1ZH8A 2A94A 4PLTA 3A06A 4IDCA 1UXHA 2VNSA 4IM7A 4CM7A 4UULA 4CQMD 1UAGA 1CYDA 5G0UA 4RF3A 4BGUA 2A81A 3F5QA 3OP4A 3GC6A 4ALIA 3L07A 1KC1A 3AUAA 3AWDA 3IAHA 5KTKA 1Q51A 4RF4A 4P4LA 4XQ9A 3S2EA 4EBFA 4EI2A 2VHVA 3GKBA 4CQLA 3JYLA 3NDJA 4J4HA 3GMAA 3I9JA 4Z9XA 2X23A 5A9SA 1PJLA 4ZQGA 1FMCA 2O50A 4AFNA 3FWNA 4CMGA 1NX6A 1G1AA 3BPPA 3W6ZA 3OA0A 4H7PA 3H81A 1R16A 1Y7OA 1NPYA 2J5RA 4PZDA 1UP7A 4BMNA 3CZRA 5ICSA 5CDTA 2EJWA 2FHSA 4DXHA 4KTVE 4KDFA 4CQMB 3TV5A 1HDYA 3V5NA 4I5FA 2BFMA 3GRKA 1CWUA 1RM5A 4BNUA 2VREA 2GLXA 2QZ9A 3TNLA 2RHRA 4R51A 1UDCA 1E3LA 4KWIA 2YHIB 3AUSA 1LRJA 1BTOA 3BEZA 2HCTA 2OHXA 3QWDA 1AXGA 2QQ3A 2GZ3A 4IXTA 5G1RA 4WOKA 5DBFA 1R0SA 3IOYA 1A4IA 2O7SA 3VC7A 3WIEA 3GZNB 2J5GA 4Z9FA 2Q4EA 3ZV4A 1FDWA 1KIFA 5AXCA 3HZZA 5I7EA 3QWAA 4DIOA 5DZSA 4IDBA 5KJCA 4TRMA 4PLCA 3RC1A 4HKTA 5KJPA 2B37A 3WFJA 3JQDA 3ZU5A 4UUNA 2JFFA 1GY8A 3RJ9A 5DCUA 4J16A 1O94A 1ULUA 1LQUA 5TC4A 1NTOA 3WBBA 4YT2A 1LBEA 4RJTA 3ROKA 4JJGA 4TRRA 5DKPA 3PRJA 1MJ3A 1NZYA 2X5JO 3RJ5A 3DAFA 2X1HA 4M87A 4MJLA 3AU8A 2DBQA 1NPDA 2GN9A 3KTGA 3ZU3A 1WZEA 4L8VA 5G0WA 5I9NA 2BMAA 3INRA 4XGNA 1AUPA 1N1GA 4R68A 4MXIA 4DI1A 2PH3A 4FFNA 4IIUA 4FJ2A 4G2RA 3W6UA 4YAEA 4YAGA 1BVRA 4K28A 4Z3DA 5BSEA 3OQBA 1XO6A 3W4KA 5KNLA 4MIYA 1R12A 2FR8A 3T7CA 1W4ZA 3DMYA 4NBRA 5CP8A 5EQDA 3WQRA 5IXYA 5CTCA 3LT4A 2UUOA 4BO6A 2TMDA 1EMDA 1J4AA 2PGLA 4ZDBA 4ZA2A 4RPHA 1VRGA 4U8GA 1FF9A 5T6BA 2WYWA 2HJSA 1HNUA 1ARZA 4HP8A 2H9IA 3FR8A 4IPTA 2YZ7A 4LRSB 2GZ2A 4MKZA 2HQ1A 1IHXA 3QWIA 1V3VA 1EZ4A 3ZWVA 3FNEA 1LEHA 1UDAA 4IXWA 2H63A 1BXKA 4Q3CA 3JQ7B 1P1KA 2GN6A 3K30A 5KVQA 4QIJA 1V35A 2BFAA 1B3BA 2D4AA 3PGJA 1ZEMA 2B4QA 5JYDA 3PDUA 1DRWA 4NH4A 1JXZA 3U0BA 2Z95A 3HNPA 4M8SA 4O0LA 3PHLA 1S6YA 5I7VA 1I2CA 4OHUA 4CM9A 2O4UX 5ILGA 1JN0A 4ZJUA 1HZJA 4NI5A 5ER9A 5BSFA 1G0OA 1XNYA 1PJ2A 2QRJA 2O48X 5JS6A 1FDSA 3H8VA 2VHZA 4PLYA 4WCFB 1W2XA 3FPLA 3P7MA 1ONOA 4F6CA 1DDOA 1SEPA 3HWRA 2X0IA 1NXQA 4KWBA 3ZNNA 1XYGA 2X22A 1GD1O 1BMDA 1XEAA 2Y1EA 3BMCA 3C7CB 4YT4A 1EFLA 3WR5A 1GPDG 3F9IA 4KPKA 1DSSG 1GEEA 1Q2XA 3Q2IA 2Q2VA 3HLN1 4ILKA 1SO8A 4GL4A 4F6LA 4QQRA 4U18A 4GMFA 3WWYA 5JO0A 2VYVD 2Q46A 3BXXA 3HP0A 1KEUA 4AG3A 1P1IA 1Q7GA 5EERA 3SX2A 4NR0A 4ND2A 2C7GA 2DFVA 1JAYA 4ZN6A 4WOJA 1BDMA 1VPDA 4MVJP 5T64A 1GADO 3D64A 5C7OO 2C7VA 1OI7A 3GN1A 1LLUA 4RORA 3FF6A 3L3SA 3D1LA 3SC6A 3DBRB 3GH3A 3ZH2A 3T3WA 3R6DA 4DPMA 1ID1A 3F5SA 3OJLA 1EEHA 3IC5A 2FZWA 4DQVA 2CDBA 5T8KC 4DVJA 2A7SA 3JQGA 2VCYA 4BNNA 2DUBA 1O95A 3KYCB 1ENYA 4MVJD 1PJBA 1E0DA 3IB9A 2QIOA 5INFA 1PGQA 1QRRA 1XCBA 2E4AA 5IZCA 5JMWA 3U4HA 1WWKA 5DU8A 5AXDA 5TIIA 4NBWA 4DGSA 1IB6A 3HE2A 3PPIA 2ZL3A 3RWBA 1H93A 2P91A 3NAQA 1LUAA 1ISJA 1I2ZA 2W4QA 1E7RA 4KP7A 4BL5A 5I9LA 1SG4A 1AN9A 1Q0QA 2VOJA 1KEVA 4RF5A 4BOYA 5JAIA 4MP6A 1FDTA 2F6QA 3STHA 3DOCA 2IODA 1HWYA 3F46A 4G5HA 2Q34A 1EQUA 1GTMA 4PRLA 4WEOA 2JCXA 1DFIA 2NNLD 3R3JA 4R9SA 3U9LA 1HLPA 5COBA 2ZJ1A 3EAGA 2J6IA 4J90A 4OXYA 1EVZA 4FR5A 3E03A 4BQRA 5CEEA 1SB8A 4FOOA 3LT1A 2FZEA 4BVAA 2X9VA 4U1AA 4EUEA 4I9NA 3IMFA 4WNIA 1P1FA 5JBXA 3FWZA 4QSMA 3GN2A 4J9UE 3JQFA 1QYCA 3FCOA 4FZWC 4Y67A 3UXYA 3Q2KA 4UREA 1AHHA 1ULSA 3DBHB 2Q4BA 4FDAA 2AE2A 1T4DA 3KSZO 3L4SO 5B4UA 2UAGA 4HFNA 3BA1A 4RYFH 1VJ1A 1XG5A 1LDYA 4CUZA 3ZWYA 1YL7A 4XEHA 2Y05A 1R4MB 1P1RA 1QR6A 4K6CA 1SPXA 4FJ0A 4R1TA 5BSGA 3GEMA 1C1XB 5H82A 2QYTA 1UIYA 2I99A 2PD6A 4CUKA 2BZRA 4Y8VA 1H5QA 1DJNA 4ZHSA 1YOVA 3QWFA 3PP8A 1DFGA 4UUPA 5JAMA 1NQ5A 2BHLA 2FRDA 1P45A 4DIBA 1PU2A 1ISGA 1E77A 2OOSA 1Y7TA 1XR3A 2IYPA 2Y1CA 1Z75A 4CV2A 3E6AA 4DQXA 5B4VA 3PZKA 4ALMA 3TLFA 2FPPA 3BMOA 3OH8A 5H83A 1VLLA 4ROSA 4E5NA 2V6MA 3D3EA 4ZU2A 3TT6A 3TOXA 3PI7A 4IDFA 4FJ1A 2IZ0A 2A4KA 3JQ7A 3RSIA 3QIVA 3BAZA 1PJSA 3MJVA 3WYEA 1NYTA 1EUCA 4MVJG 4NHEA 1KEPA 3KSDO 4JCRA 3DBVO 1VE9A 1ZK0A 1Q1NA 1MG0A 1Z7EA 2C07A 2Y0CA 5IZ4A 1F17A 4CM4B 3Q1LA 2VSUF 1KVRA 1DLJA 1ENZA 1PS9A 4KOAA 1EDZA 2W98A 4ZGWA 5TLSA 1P44A 1EF9A 1V0JA 1WMAA 2JD0A 3T89A 2NVBA 1JA9A 1MFZA 5A3VA 1RYEA 3ISAA 3T8BA 2C5AA 4KUHA 1LX6A 5CAEA 1CQIA 4PVDA 1I3NA 3JQCA 4WCFA 1N7HA 4FJWD 4U5QA 2BI8A 4AL4A 2AQ8A 1T2FA 2VX2A 4GPD1 1YXMA 5LDGA 3JD3A 4BO7A 4EEXA 3LLSA 4PG8A 4W6ZA 4JVTA 4EZBA 2Q45A 3GMDA 1GDHA 1AE1A 2GF2A 4Y98A 4XRGA 1C0IA 3H0QA 1I2BA 3ZWWA 1ZIDA 2YYYA 4F47A 1KOLA 4GKBA 2AHRA 4H16A 4PLGA 3QW2A 3PQEA 3GT0A 4RZHA 3O8QB 2HMSA 4DYVA 3M6NA 3I6QA 4RPJA 4RVDA 1B8VA 3VVBA 5BQFA 4KDEA 1B16A 2X7HA 1QLHA 4ZQHA 3VZSA 4E21A 3DFZA 1BW9B 3DZHA 3LK7A 3VTFA 3BMQA 3IUPA 1K39A 3OICA 3AOEA 3W1VA 3OMEA 1P3DA 4ZRNA 3MT6A 1K2WA 4LISA 4ELWA 1LDNA 1KEWA 2X86A 3G1UA 1JAXA 2CE3A 3NKLA 4ID9A 2VN8A 1MXHA 3PGXA 4ONEA 4UAGA 3SJ7A 4E5KA 2FZSA 4LCJA 1PQUA 1V8BA 5G2OA 1OAAA 1TXGA 4BO1A 5I7SA 5JXWA 3LC1O 3V5IA 2Q2XA 1KVTA 4BO9A 1CIVA 3E48A 2PA3A 2JJYA 4TQGA 3DONA 2J5IB 2PLAA 3ENKA 3DORA 3LF1A 1I3LA 4GSLA 5IN5A 3W4JA 3WGHA 3PEFA 2DPHA 2EW2A 2FR1A 3RBZA 5IDXA 3WMXA 5G1QA 2X0NA 4FFRA 2NVUB 5IZCC 1F06A 1PWZA 2NUAA 5L4SA 4A73A 4RGBA 1PQPA 5HM8A 2DKNA 4UVHA 2P9EA 4QX6A 1CEQA 1JLLA 3H4VA 4E5YA 5JLAA 1I0ZA 2OBYA 1E1NA 3AFNA 2NWQA 3ROQA 1ZZEA 1H6CA 2PKQO 1ISHA 1E1MA 3KM0A 4J7UA 5ADHA 1UYTA 3WLEA 2FW2A 5KVCA 1X0XA 3GVPA 3KOUA 5I9MA 3G17A 2J3JA 3WWZA 3LC7O 1KC3A 4TWRA 5CPFA 3DBLB 3NGLA 1P9LA 3ZV6A 4OO3A 5K6AC 4K2NA 1GYPA 1MA0A 3R3SA 4GWGA 4PLPA 1JKIA 4LRTB 4IZBA 2PNFA 3GG9A 2AXQA 3QJ5A 4BKQA 1PJ4A 3GF4A 1G0NA 2VSUA 4EJ6A 3RUDA 3K50A 1MXFA 4N5NA 2P68A 3IL2A 3EGOA 1QYWA 2ZCVA 3C7DB 5EJ2A 4Q3AA 4GKVA 2BF7A 4P22A 4BNVA 5KJ1A 3TOZA 2VOEA 3JQFC 4KTTE 5AVOA 3V1YA 2G17A 2NQTA 5BNIA 4WE3A 4B3HA 3QA9A 4R5MA 1MFPA 1O0SA 3LKEA 1C1DB 2YV3A 4E6PA 1GUFA 3JQ6A 4JK3A 3CTMA 2HMTA 3KTDA 4XQCA 1YBMA 1EUZA 2DBZA 3B20A 1N5DA 3QSGA 2RIRA 1YO6A 1ADFA 4A26A 1Y8RB 2O2SA 4O6VA 2CUKA 3SLGA 3N6RB 3D4PA 5JYEA 1WW8A 3I47A 3R0IA 5E0NX 1HXHA 1C14A 2HJRA 3F1LA 4YJGA 1KERA 3UFXA 4UEJA 4KMSA 1SAYA 2V6GA 2IDZA 2XAAA 2OFPA 1HE5A 4BNFA 2BKAA 4L76A 3JQAD 2EWMA 4AJPA 4J1QA 1P77A 5TNXA 3LT0A 4FN8A 4FCCA 1ZJYA 4N7RA 1RWBA 1D8AA 3DHYA 4II3A 1A9YA 3ZHXA 4IBOA 3JQ9A 1UZNA 3TRRA 1XNWA 4E5PA 3K6JA 3K31A 1BXZA 3IJPA 4MVJI 4Y6PA 3OIFA 2HMWA 3GPIA 4CM6A 3R9QA 1U8FO 3FNGA 3V2GA 4GX2A 1HZDA 1H2HA 4NNJA 3HSKA 1E1KA 1VJTA 1ZK1A 3RD5A 4EUFA 1EFKA 2WE7A 2ZQZA 4R9RA 3ZHBA 4F3YA 4XZ3A 5GZ6A 2FPIA 1G6KA 1PS0A 1K6JA 1FCFA 3VOSA 3B70A 2D0IA 2FBMA 1LC0A 2PPYA 2EKLA 4M49A 4YB8A 3KTHA 1TT5A 4L0QA 4WCFC 3ZW8A 2YV1A 3O9ZA 1UXIA 3JQAB 3U09A 2HRZA 2PGJA 3QWBA 4J1SA 1H2BA 2GYYA 1E6WA 3WGTA 3VH3A 1DOHA 4AJKA 4EJ0A 4QFEA 4J9VA 2P5UA 2X58A 5BSHA 3SVTA 3VZQA 3BYZA 3TL2A 1DIBA 1M75A 4YT8A 4MVJE 4U0JA 1LDMA 4U0GA 3AM5A 1XWFA 4GAEA 1TA4A 4TSKA 3QHAA 4DWVA 3MJSA 5ER6A 1YDWA 4NJMA 3WGGA 4CR8A 5KCZA 3HG7A 2O3RA 4J91A 4NZ9A 3AOEC 4CUJA 1JU9A 3QVXA 4L9RA 1BXGA 1PS8A 5BNFA 2EERA 4UUOA 1N6DA 4XGIA 5TGDA 4E3ZA 3OJEA 2PH5A 2PK3A 2VSUE 2FY8A 3WX0A 1I24A 1YS4A 3I23A 1TLTA 3C3XA 1IULA 2FPGA 1YONA 2WD7B 4JJFA 2ZL2A 1BSVA 3PK0A 4JCOA 1CERA 1Z7BA 4NPCA 1T2DA 3P2OA 3UOGA 1EBUA 1EE9A 1MX3A 3WYCA 5DDIP 4J0FA 3WJ7A 2YJZA 1NFRA 4E2WA 1EE2A 3A4VA 4YPOA 1GPJA 4TROA 3X2EA 2IEXA 1IL0A 1GL3A 5F1OA 1HYHA 4IY1A 2QHXA 1M66A 5DP1A 1TYFA 3EZLA 4XKJA 3IS3A 1W8DA 3PLNA 4D41A 1GYRA 1HDRA 3DZFA 4K26A 4WASA 1YG6A 4IZCA 1E7MA 2VZ9A 3AI1A 4WLFA 3GGPA 2VSSE 4I4ZA 2X9NA 4YJFB 2VHYA 5DBIA 1XKQA 3Q9UA 1HE2A 3N58A 3RFXA 3PYMA 4TMFA 4ZDCA 1WVGA 3DBLA 3ST9A 1NVGA 1TT7A 4QXMA 2ZB8A
chains in the Genus database with same CATH superfamily
1UJ2A 1QU2A 5JAZA 1ENPA 2H7VA 4G0XA 2DC1A 1OD6A 4KO2S 4UJ5A 2CV2A 1KJZA 1YB4A 3HWX1 1OYYA 3AVYA 4KKXB 3WK9A 2VJAA 4D99A 1JX6A 3GFTA 2GEFA 3HY6A 5JJKA 2XBMA 1J7XA 4QRIA 4HWKA 3AR2A 4JN6B 2IU4A 1VJRA 1KKLA 3GI1A 1GGNA 2EZUA 2JFXA 3QVJA 3TNJA 5AW2A 1HDCA 4YV0A 2WMDA 5C35A 1DAEA 3ILXA 4ZWNA 1O8UA 4A1FA 4MOUA 4RMGA 2PVCA 1J21A 1SHJA 3UBTA 3KCQA 3RTAA 5JG7A 4CEHB 3RYFA 1YG8A 3QMJA 2VZ8A 2HA0A 3JU3A 2ZIXA 4JMLA 4GOJA 4Y1FA 1EK0A 3WMEA 1ZIPA 4PYMA 2G70A 2EFCB 2FFHA 1AK9A 4IIDA 3UHOA 4XJVA 3NALA 1TW3A 1YHYA 3TLMA 4E5UA 3OLZA 4R40A 1LK0A 1I2MA 1NOKA 1JWBB 2XUGA 4D98A 2JH3A 3FDUA 1RJFA 4DMLA 2ZLBA 2BY4A 5E38A 4HMOA 4PVCA 3VR2D 2QSJA 2B21A 4Y3UA 2NU8A 4HNUA 2RGRA 5B4TA 4II2A 1D4FA 4TZKA 1E79D 3IAXA 3PDHA 4RV5A 2ODAA 4CJXA 4N39A 1Q0HA 2HNKA 1NQVA 1MB9A 1QOPB 2RIPA 2QM0A 1I5EA 3RGGA 1UBCA 4BP1A 5ITVA 1S0UA 2F8LA 4LJRA 1K9VF 5TMEA 3SS8A 2RMKA 3X1YA 2V65A 3V4ZA 5GIOE 5EESA 4URVR 3KC2A 3U4GA 1SBTA 3GMTA 1EVLA 2VLIA 1TU4A 1TUBA 3C16C 3QG1A 1IZYA 4GYJA 1DHTA 4HDKB 4OHRA 2QMHA 4TT3D 3RARA 3SWXA 2OO3A 2RC6A 2XPCA 1A4RA 3F97A 3HYTA 3PEUA 2PZMA 4PZAA 3R0VA 4M1WA 5EIWA 4ARZA 4DLPA 3WNVA 3VU8A 4KGVA 2ZVPX 3T7TA 3H2YA 4IUYA 1U0GA 3EYWA 2GWHA 2ST1A 2VP5A 3DF9A 5K3BA 1W52X 1J1UA 4URUR 3W78A 2O5CA 3N28A 3ONNA 3BWXA 4OEHA 4PANA 4M0UA 3RC7A 5ES3A 3K1TA 1YCHA 3E9ZA 1ZD2P 4Q9AA 1AURA 2IE8A 3AJ8A 4KB5A 1KZ6A 3GZJA 3RRMA 3JQAA 4WZ8B 3PXUA 1DUSA 1OI2A 4BJHB 4PHGA 5FIFA 4KQKA 3IVMA 3MT0A 4JR0A 2HKIA 3PJFA 4FYIA 5E3HA 1RJGA 4LX0A 4YQYA 5JFGA 2H16A 2F9IA 1L5FA 2BEVA 4EKEA 2PUFA 1JG3A 4FZWA 1YK1A 3PIIA 2RAUA 4B80A 1EGHA 1WMDA 2VEOA 3USZA 2QPOA 1ZFNA 4MEBA 4WLOA 5CG2A 3BX1A 3F7MA 1C30B 3AXSA 1CUYA 1FFAA 1GTVA 1SCAA 1TQ8A 3B3QA 3C48A 3FZQA 4JNCA 5HRCA 3F6SA 1SH7A 4HPXB 4UM8B 5FTMA 3M6LA 5LA6A 3RSQA 2OXFA 4DEVA 3QVLA 4FZWC 4XCVA 4GX5A 1W85A 4BNHA 4DAEA 3UT5A 1I30A 1R0KA 3LCJA 4V03A 2CLEB 3FZNA 1UQUA 2XXJA 3V1LA 3FNBA 2A4MA 1DBVO 3M1YA 4LYDA 1WXXA 2CVOA 2JFGA 5G4KB 3ZN2A 5JI3E 4BMZA 2HTFA 5IX8A 1NNUA 3M3DA 5CU7A 4KXWA 4GQBA 2G88A 5DHSA 1HE3A 4BNIA 3JZDA 5JD3A 1T9CA 1NW6A 3PIDA 3ZI7A 4Q37A 1KS9A 5DM60 3NEPX 2ZITA 1GZUA 4LYAA 4WXRA 3E1SA 4HDRB 2FKNA 1U28C 3MAAC 4CFSA 4KLZA 3I6ZA 4LJ7A 4LY6A 4U7WA 3GDFA 2MIIA 2KPOA 2H7YA 2P35A 1GTJ1 3MCTA 3UUEA 5BOSA 2D7DA 2ZB2A 3G2PA 2QDKA 4BQOA 4PAGA 1CE8A 2X4LA 2JS7A 1D2CA 1EX9A 5CB4F 3A4LA 2IZ5A 4N18A 1IY9A 5A05A 2A1TS 1VCHA 3LBNA 4HLNA 4P7FA 3MT7A 1L7XA 2O3SA 3OOYA 3KTIA 4QLBA 1RTTA 2BLLA 2XXAB 4B3BA 4A0RA 4EZEA 2BR4A 2XMPA 3ZW9A 2FX2A 1GIAA 2J07A 3NDIA 4G41A 1LVUA 2GCPA 1KMHA 4IGFA 1G2OA 1RP1A 1SA0B 2IEZA 1N3IA 2IPNA 3HU3A 4KXUA 4L02A 4M0MA 4WY8A 4G6ZA 3OPYI 4QBKA 4ZU1X 2ZXFA 3OIGA 2QTLA 2FRXA 2YVKA 4C87A 2FMXA 3CU5A 3MGAA 3MFYA 3QU5A 2PFSA 1KJQA 4X90A 2BFCB 1E0JA 5E6RA 4A27A 5G0SA 1ZJWA 4CYMA 1FYEA 1I7DA 4DQDA 3JR7A 5DTIA 2O3TA 1XZJA 4IDQA 3FCCA 1KGSA 4V02A 1RNLA 1GAQA 3VO1A 4E88A 3FPSA 3OZSA 3FYHA 1EX6A 1TVCA 2H4FA 2WWTA 5I4KA 4EVIA 3H9BA 1X1DA 4COOA 1QE3A 2Z3ZA 3LW7A 4W9NA 4RTSA 1Z88A 3CZCA 5DYWA 4KE8A 2P7IA 3HFJA 1VSVA 4B1FA 2KS6A 2XADA 4OQQA 3S1LA 3UYKA 4HT3B 3CTVA 1HK7A 1XB2A 3QFHA 2OR3A 4H6PA 5AT1A 1UOPA 1ZK3A 5G1PA 3K96A 3MQFA 1MEEA 3H6HA 4YRCA 1DFHA 1C2YA 2QG4A 3KTKA 1QH1A 2I34A 2YZMA 3WB1A 4BE4A 4BVFA 3NBZC 3RR2A 4Z3OA 2B78A 1KY2A 4HXGA 1KMNA 4KWHA 3GFOA 3OSUA 1RRPA 4OAPA 3ACCA 4KO4S 1AQIA 1IQPA 3KKQA 1TD1A 4GZ6A 3VOAA 3IAVA 1HEYA 3UUWA 1KWKA 1EB9A 2ECQA 3CIFA 3MJDA 4PO3X 5I7UA 3RQSA 5ALVA 3MERA 4G1UC 1FFHA 1EI9A 3JPYA 1IN6A 3KTFA 4URYR 4NIMA 5CW2A 2JFYA 5FWDA 3ZKWA 3OX1A 4KQ6A 4J7CA 1TKCA 4V0OA 4XOUA 3NUQA 2DSNA 1HA3A 1Y7IA 3PTZA 4ECEA 2IL1A 2RH9B 4PSVA 2CW5A 4J4TA 4CQMA 1JIVA 3WTCA 1VI6A 1DKMA 1WSAA 2QAGA 4W1QA 3QLEA 5JCJA 4D3XA 3O3CA 2QQFA 3JWJA 4Q3DA 2WK1A 2R96A 3SQDA 2PTGA 3DD1A 3AFMA 4MQ6A 3ELWA 4RVSA 1QTQA 3T8AA 1ZH4A 2IEGA 5KQMA 3S81A 4BWGA 2BFFA 2IIQA 2WTNA 1YCDA 2V8BA 2VYFA 1KPIA 2VTDA 1CNMA 4TZ0A 3IGFA 3NVMB 1C29B 1OBFO 3CWZA 4L15A 3RUPA 1JLRA 2QLFA 1FIUA 3GAAA 4MW0A 2JI7A 3B6IA 4UKDA 3N7UA 1TUEA 4PLZA 3UB4A 1SULA 2HU5A 2H8GA 2IYNA 2ZL4A 5ARDA 4B3IA 4TSFA 4ALJA 4K81B 4PPYA 4CMJA 5K6AA 2X13A 4HDMA 1MJGA 3BB4A 3OZEA 4FOSA 4RK0A 1EF8A 5CHYA 1X7GA 2CXQA 2OOKA 2RI6A 4GLOA 4KR9A 3UB3A 3ZGXA 5K8VA 4RTNA 4YA6A 4MV1A 4CODB 1JFSA 4R69A 1GA4A 2VF2A 1G20A 1PEKE 4CLOB 1WZNA 3DTVB 3ULKA 1Z13A 5IP5A 5ICFA 2WFMA 3LV8A 1DXHA 4X60A 1EA5A 3UAZA 4CKZA 3HFGA 1IHDA 1SZOA 1T3HA 1KI1A 1SZJG 1TTPB 5EIOA 2B61A 1QVRA 4FOPA 1ZK4A 4A16A 2QAJA 3GUCA 1D0VA 1F14A 4FONA 3NTUA 2C31A 2GLTA 4KMRA 5CG1A 3TSCA 2J5XA 4QTYA 1ODCA 1SOMA 1VMEA 5CT5A 1J56A 2GOYA 1CJMA 4TM8A 4BNXA 4DHWA 6Q21A 2VTBA 3AEZA 3IH5A 5BWNA 4R8RA 5FT9A 2V7GA 2W2QA 2XECA 1ADBA 1GZVA 3MWDB 2GJKA 2OQ2A 3R6WA 3Q3GE 4FYJA 5TSDA 3H99A 4BIMA 4DIEA 4LHYA 3WIBA 5DUCA 5AQ1A 5FFFA 5C18A 1YKGA 1J0XO 4ZC8A 1A82A 1NG1A 3TRKA 3VYTB 4YV7A 3H1AA 3M81A 1KQFA 3BSYA 3ZV5A 1OZFA 1V43A 1ZVJA 3FE2A 2Q5FA 4TTPA 3IT2A 5F3WB 2A57A 1R74A 1K06A 1KAGA 4KGZA 3ST7A 4PGAA 1YOBA 2QJOA 4J1TA 1FBNA 3AV0B 5GONB 4NXMB 2QGFA 1DS6A 4CL3A 3AVVA 4RVGA 4JJIA 2FR0A 3SIXA 3PDIA 1RM0A 4X66B 3NHPA 4XSGA 5ECDA 1N25A 1T4MA 4YJ2B 1RPZA 2LNDA 4X1YA 3IEIA 3OUUA 5AK4A 1L5HB 3DG9A 8ABPA 1S7CA 1QZTA 9ATCA 1U0EA 2YCBA 2ODWA 1C1HA 1FS5A 1Z8HA 4OKIA 4OMUA 4AYWA 2PRSA 4RKQA 1SNYA 3QE3A 1SOVA 4JSTA 1XDWA 1F5NA 1UK8A 5JXIA 4ZQFA 2JIQA 4WXMA 3JWPA 4G26A 4O2BF 1NLYA 1PWXA 2R6HA 1TK2A 3KYBA 4IOMA 1OROA 2XX3A 3LUPA 3IBGA 4L51A 3RIMA 3TQHA 4A23A 4X1KB 5CFQA 1DCIA 1H22A 3B9PA 4WY5A 4DRXA 3I39X 4IOLA 3AF5A 3OMXA 1Y6FA 3AP2A 4FHEA 4H18A 1MNAA 1QG0A 1NFQA 1W9MA 2C2OA 2X0JA 4F97A 4MI2A 2FOLA 4YRBA 1XRRA 3EVNA 2WPDD 3EEQA 2QNRA 3GCGA 1IHOA 5I9TA 1ZISA 4G8DA 4IH9A 1HG0A 3LC2O 1J22A 1FQJA 2ZU6A 5EA2A 4IQ4A 5DM70 4FGLA 4J3NA 1HDZA 1OVGA 4RULA 1P8AA 4QECA 4XX0B 4P84A 1SUWA 4B7AA 5HDQA 1INLA 4CLHA 1N6IA 1NF9A 3M7IA 4GP9A 2J3DA 2FQQA 2WUFA 3DCYA 3TW6A 1EHYA 2HBZA 3IOBA 4FZVA 4JEIA 3SEFA 4R7TA 5CA0F 1QX4A 4J6EA 3VAAA 3X2FA 2ZJ2A 4JLMA 5J59A 2JVJA 2IUSA 1RIIA 6LDHA 3N75A 3UAYA 3W05A 4AN4A 3ITKA 1ZN8A 1T0IA 5GVRA 1D2HA 4J03A 2R3SA 5ALNA 4D45A 2XE8A 5ALJA 4FBMA 5EG5A 5FRDA 3EE6A 4DV7B 4EW1A 3Q85A 4DLBA 4CM3A 5BVHA 3K5HA 4I0WB 2QW8A 1SY7A 4CG3A 4LZPA 4MPDA 4A10A 1S8OA 4BNTA 3ZD7A 1PIXA 5A4DA 1US8A 3SM9A 3GHHA 2XR1A 3K0CC 3KL4A 4I81A 1ZGJA 4XFJA 4F3NA 3DO5A 3WA6A 1B2LA 3M0EA 4YPVA 1WZ8A 3L1VA 4GT1A 3P9SA 4JQSA 5DBHX 5FPQA 4BJ1A 4YYZA 3AEKB 4WL0A 1PLJA 3MMSA 3ZD8A 3T5CA 1U1FA 5D2CA 5DULA 4QGSA 2J0QA 3CH6A 4G81A 2E37A 5EXPA 4JJ6A 1IVNA 3FKSA 1HNZB 4ZI5A 3FOEC 1NJGA 4ZT7A 1VC2A 3SOZA 5B53A 5TE9A 2VYVA 2ODBA 4O4JB 4KSYA 2W6JD 2AN1A 4GXTA 4GZ3A 2JBWA 2QJTA 1I3OA 1PGNA 1N0IA 4BS9A 5C5IA 4IZ6A 3GT7A 16PKA 1JTVA 2AJDA 3I0ZA 1PR6A 3D8RA 1C0EA 4P0PB 3MHTA 3UMYA 1AN0A 3OSZA 5CFNA 5KINB 1CETA 5JR3A 1QTNA 4YQFA 1E62A 3HVUA 3PPWA 4NQZA 2ZW9A 2ONJA 3DOJA 3RVPA 1U63A 3WAKA 1Z22A 5IDWA 1RBQA 1NR1A 2BJVA 2D3WA 3O8BA 1FJ2A 2Z9DA 3UH1A 1P75A 2KBFA 5CBPA 2B3DA 3R9TA 3E23A 1EFUA 1QO7A 1GPLA 1YR9A 2ZWVA 3G9UA 4BIIA 5ERGB 4BQSA 5EPOA 4KPGA 3TWOA 3RRFA 2F59A 4D43A 3ZD9A 4FWTA 1BE6A 2X24A 3FCSB 4RL6A 2MCFA 2EZTA 4NU8X 4YAIA 1JZQA 4F96A 4OJKA 5FFMA 4L0DA 1G6HA 1OWMA 1OZ0A 4XOIA 3B1FA 1PUXA 4WUVA 4BVKA 2ZB3A 3EXG1 2BBOA 2JEOA 3A3KA 1YZTA 4EJSB 1ZAKA 1N6FA 4DN6A 4QXQA 1MENA 3KT0A 5KOYA 2GM5A 4LSGA 2RDMA 4Q5IA 3AKYA 4QEDA 4RVHA 3RWOA 1RI1A 3QFCA 4EMBA 3L0PA 1LBIA 1M8KA 3E7PA 3U17A 4QVIA 2IEDA 3AUXA 1WL8A 1EWVA 1NVMB 3NHZA 4HH1A 4JKYA 3NNNA 4PYLA 4UDNA 4C7JA 5A4MS 3M4JA 5TS3A 3UPTA 3L0BA 3RS0A 3NNDA 1C80A 1AG9A 3V1MA 1CKEA 5L7YA 1C1XA 4ZVUA 1SOWA 2GEKA 3F67A 1YQDA 3IHTA 2ZIUB 4ZU3A 3EWAA 1DIHA 2P2YA 4QJIA 1ZH2A 4FGWA 2XWSA 1PW7A 2AH5A 2ZJBA 3BF7A 3LBHA 3KQVA 3FHCB 2XOEA 5DX1A 5M3BA 4L95C 4FZRA 1HQYE 1LI4A 1RKBA 1OV4A 1DTWB 4KV7A 7ADHA 3GLMA 5CFZA 2JHAA 4XWKA 1H0RA 4OOFA 4DMCA 2HW5A 1FMLA 3FI9A 4J8PA 2NM0A 2YNMA 2D8MA 4TQUS 1SVLA 2AX3A 4LQ4A 4PX3A 2GRAA 3G85A 3QG5A 1IYZA 2V7WA 4MA5A 3VHXB 4AF8A 1IM8A 4Z4HA 1PZFA 3TCNA 2JG3A 2VTVA 2Z8YA 2N1MA 2M6KA 2P4SA 2XA9A 2LGJA 3PHIA 3IV7A 1ZUNA 5IK2A 2B7LA 5L40A 5IUJC 1ESDA 3OQ6A 1XTIA 4LGCA 2ATVA 2WD8A 1RQ7A 5GQSA 2WFLB 1UXOA 1JSLA 1U2QA 3BHMA 3GNTA 3ZJYA 2FW7A 1XHFA 3DT6A 4LOHA 4FFDA 1MB2A 2ZTVA 4CQLB 4DHEA 3VO8A 1ADJA 2J5GD 1E6UA 1GUBA 3NX4A 3A6HA 4N8EA 2V0CA 5FL7A 3RAFC 5A9SB 3IOMA 4JU8A 3LQKA 1CZHA 1R37A 3DZJA 3HCDA 1RYDA 3NT5A 1GLGA 4LMPA 1E5QA 1Q22A 3PR1A 2DWUA 4L8LA 4LTDA 2D0DA 2A5FA 2DSTA 1NNI1 4OYHA 3L93A 2QL9A 4BBPA 5B36A 5KYKA 3P96A 1JG2A 3L4KA 1Y4UA 2XMZA 2HH9A 4UNQA 5A2GA 3M6FA 2UXDB 1SBNE 2WZDA 3IESA 4ENTA 2JANA 5HIJA 3DXZA 4BNDB 4EUHA 4K3UA 3V8PA 3DF7A 4NE2A 2HIHA 2BFBA 1KGDA 3AR5A 1M3SA 4ZT6A 1T35A 2ZRQA 4DYDA 4RS3A 3SBEA 3JYNA 3O8QA 3UGQA 5B2EA 1X42A 2V45A 3PA8A 4AJ2A 4EX7A 1SKQA 5DUFA 1CF2O 1NN0A 1NVFA 1OZAA 3FGPA 3LIPA 4W8GA 3LF2A 4YTEA 3T06B 5FPKA 2BBSA 1GZ6A 2OM2A 4I55B 4IIVA 1DKRA 1TJNA 1X74A 3QI2A 3T7RA 3T99A 3TR6A 3QKRA 4EPYA 3V5EA 1M2VA 4B35A 4EF6A 1WTCA 4BMCA 3AEQA 2V98A 4JBYA 4DLKA 1EY3A 1Y5MA 5JMPA 4F6RA 4BO3A 1JFFA 2VXBA 3IPYA 2ZATA 4RQBA 4ARAA 4BFCA 4HXYA 1GQOA 2A7XA 4UC0A 1CW2B 1QP8A 3CUTA 4DZRA 3WLHA 2QSUA 1JMVA 5CB6A 1Q7EA 1A27A 2I8LA 1E0AA 4GE0A 5F7ZA 3WHKA 2J30A 4EYEA 1NQXA 3UWPA 4LC1A 1C50A 1Q15A 3KV3O 4DZZA 1Z6QA 1C0LA 2Q5CA 1HURA 3S8MA 4RZXA 3TRIA 4KR3A 4TRJA 5EY5B 4K3WA 1JBEA 2YIMA 3UW3A 3S7TA 1UFQA 4Z6KA 3OT6A 2AYYA 4FHZA 5IKXA 3VPHA 3WQQA 1QMPA 3NU1A 1SVWA 3K73O 3V8BA 3VO9A 5B2FA 1FVOA 4IIBA 3F8TA 4YLEA 3S2ZA 3ECSA 5LQMA 4PTZA 3UICA 1JG6A 1YQ9A 4A8TA 3DH0A 3OETA 4BO8A 4ENQA 2PFKA 2PT6A 2P2SA 3GHYA 4YGXB 2UU9B 1QFYA 3FCEA 3MJTA 4BVHA 3L05A 1Z7WA 2C7RA 2HA2A 2O2ZA 4Q4JB 3GGCA 1SXPA 1K2VN 1V25A 3V6LA 3VTZA 4GKKB 1A50B 4FGSA 3Q11A 1YR2A 3R23A 2JNWA 1NHGA 3UJDA 2WTUA 3AINA 4BUJA 5AK5A 3RK4A 1JEEA 4MYRA 3II6X 3OM1A 2OWDA 3WQSB 4TWJA 1RVV1 2BKLA 2XAUA 3IAAA 1XIVA 1F8YA 1NBME 2CLDX 2E0IA 2YR0A 2QRZA 2ZE8A 3EN0A 1FNMA 3FMOB 3VJMA 4DMRA 1NT4A 4YJDA 5IXJA 2ZTUA 1LK5A 3JWEA 1XPRA 4NBVA 4DLVA 1LU9A 2DHQA 2J3KA 1FY2A 1WQ1R 2HBYA 1ZCFA 1SU6A 3DTNA 2G1UA 1YQQA 3A28A 1GUZA 5AHOA 3G5MA 1YULA 1XLTC 2VK2A 2A9RA 1A77A 2BH2A 3LBFA 1IONA 2HMUA 3UAXA 4ZOCA 2XKAA 2Z5LA 2Q9CA 4NFYA 2H2HA 4PTYA 2VG8A 3RJMA 3VNUA 2CDCA 3FAKA 1N2EA 3N2YA 4BE7B 3AEUA 2O8CA 1KYXA 4QWMA 4QYWA 4G1CA 2QRVB 3TTUA 2HN9A 2FVYA 1OD2A 3PPXA 1RWNA 4BAUA 2I6UA 4PS1A 2XDYA 1AKWA 1FX0B 1EDEA 3GJSA 3HJBA 4C78A 1V7ZA 1NW3A 2G07A 1FQKA 3U7QA 2I1LA 1IUNA 2GK6A 3R7SA 3AI3A 3CS3A 3HN6A 3WLNA 2CHUA 3K0AB 4QLOA 5LC1A 2ADOA 1VE3A 2WUGA 3K1AB 3LBYA 1FDRA 1THMA 4B32A 1HMPA 1UDRA 2AR9A 5DX0A 2QTHA 2Y1LA 1D1SA 2REQB 1Y9JA 4D4IA 3PGMA 3ZE2B 3QKAA 2I6SA 2AE1A 1V11B 1X1RA 3URMA 1SEVA 3RS9A 5HIKA 1E2EA 1GTRA 4L6CA 3EXHC 4IILA 4BV8A 4G8BA 4C7VA 5EZ6B 3F74A 2FVXA 1PL7A 3OT1A 3V33A 2AZ4A 2IS4A 4IDNA 5FORA 2FV8A 3L7MA 4Q93A 5CNMA 3T7SA 1OLSA 3C1AA 4I9UA 1XX6A 4GGOA 4L6IA 4GRDA 2HGZA 3T7DA 4GUDA 3K70C 3ASVA 4WBSA 1TEVA 4O5AA 1O87A 3W8EA 5ITZA 3L7IA 3R0OA 2FQ1A 4C6HA 3KWFA 3ZTYA 3A3OA 3EOBI 1VP3A 4F06A 3ADDA 4OBWA 4QGAA 4AURA 3JD4A 2FSVC 5CK4A 4FYXA 4GUAA 2QTZA 1ETHA 4LTMA 4RABA 3AHDA 5AXBA 3TMAA 3RRVA 4M76B 1M7GA 4PM4A 2PRJA 2PMDA 4IMRA 4YROA 4EELA 3AHIA 3ICOA 3W3AA 1QIEA 1ONSA 3MGGA 4TL9A 1KYVA 1NTRA 2CLKB 4R2KA 3UVEA 2PZGA 1IVYA 2R1TA 1I01A 4HQKA 4N9QA 3QVKA 3WL5A 5FUWA 5INTA 1Z0IA 3V8EA 2B2CA 3TRFA 1RYFA 4HDOB 5JROA 1AXEA 2F4NA 3OPYA 3IUSA 1EVKA 1JQ3A 2ZR8A 4BO2A 1Q7TA 4DT1A 5LQAA 3MOYA 2BEJA 3PS9A 3MMXA 1JT2A 4DCSA 5EUQB 4DMHA 4DQKA 3LOPA 1NIPA 1LDEA 1H94A 1K4YA 2YHAA 4Q9IA 3BK1A 2F1KA 2ZP1A 4UTXA 3SYMA 5HUJA 1UODA 2G1PA 4YAFA 2Y3IA 3RM3A 3ZU2A 4RWZA 5GADl 1BU8A 2GZMA 3PXEA 2W00A 2P9QA 1HZZC 1IRIA 3F8SA 3OFNA 3PE3A 1IH8A 1Z2AA 1RZ3A 4B7CA 5AVRA 2ZQRA 5DTEA 4EHBA 1KQPA 1SK9A 4FDMA 3UPUA 1A1VA 1M0SA 2HRDA 1WR8A 2Q07A 3ZCPA 4XD7D 5HKBA 1NI4A 1MGOA 1DO2A 4JBLA 4Y2YA 3ZE6A 1C8VB 2DFTA 4MITA 3ED5A 4ZICA 3FCUB 4TKUB 1NONA 4TV8A 3BT7A 1ELOA 1Q1AA 4UPDA 3ZHSA 1E4EA 4QUGA 1U0JA 3P26A 1I0LA 3VPXA 2HSGA 3DE4X 3I9NA 4KJZA 4ZYZA 5JALA 1A7JA 2A1UA 2O5VA 2ZI7A 4PHHA 2PRYA 1W5TA 2QRQA 4J1NA 2VSOA 2I54A 5M34A 1H0SA 4FFMA 5F64A 3JS5A 5IYZA 1N4AA 2YH2A 4MVWA 1T4CB 3PWZA 5FHRA 5A6SA 5FULA 1HNOA 1RAGA 4X6UA 2WHEA 5E9JA 4P2GA 4QNRA 5BOVA 3TD9A 3RUCA 1EFRD 4F4UA 5DI9A 2DKOA 2HX1A 3GJRA 3KB6A 1VLQA 3GW8A 4WMLA 2E21A 4UEWA 1S3FA 1YWGO 2NU6B 2EJUA 3ZQ4A 5J2TB 2C9OA 2O2HA 1P6QA 2ZS9A 4KLAA 4X3CA 4E2XA 2WM3A 3JVDA 1UXKA 1Z7YA 3E27A 3JYOA 3LH5A 3O83A 1TYAE 4E32A 3TOVA 5MGNA 4RM3A 3WMFA 1OC4A 4B46A 5L4LA 1KNQA 5CIYA 2AUTA 4PGFA 4CHGA 4PBRA 4LTNA 1LA2A 1Y8AA 4KLRA 4S2UA 4D4JA 4R8MA 4RH3A 1PJCA 4F3KA 1U3TA 2BKUA 4JI0B 4KH1A 3OQMA 2L0XA 5A4FS 4YP1A 1T43A 2JEYA 2ZQQA 3TI9A 4MR7B 1M34E 4G0UA 1CUGA 1JHMA 3H5VA 2WJZB 1UBSB 1VG1A 3HPQA 4PCVA 3TMKA 3UV6A 1XRMA 2OD7A 1RYMA 4A8JA 4KI7A 4L5IA 2ZUTA 3TL6A 4NV0A 3GPCA 4BO4A 1O9GA 5DWVA 4YRGA 2OO5A 1VSBA 4BEVA 3ZIDA 1MG5A 4L3WA 2VJKA 3H5OA 1N2BA 1UMBB 4WXHA 4RK5A 3NASA 4Q6WA 3H0KA 5HX7A 3GD7A 2PD4A 3N07A 4O0MA 2B1GA 4FTWA 4IJUA 3TW0A 1ZRMA 3QK7A 3QBTA 4LZOA 1TECE 1EUCB 4TTJA 4XYLA 3VJRA 1KHHA 2Q0HA 1R0YA 1N6HA 2QK4A 2LXNA 3D5TA 3DTYA 3UH0A 4NDNE 5G3ZA 2E4ZA 5MFPA 2G1JA 4MMYB 3IEXA 4L0CA 3V7NA 1PIWA 2XNCA 2I66A 4BNJA 2F90A 3ANMA 1TZBA 2WSIA 3THWA 3BIJA 2BMEA 3I1YA 5KOHA 1IUKA 5CAEB 4X95A 2HRBA 4LC9A 2X9GA 2Q5QA 4KFUA 4RPKA 4MUFA 5ABPA 5EJ5A 221PA 3ADPA 1WHTB 4GICA 4QXAA 5EWJB 1CUEA 2Q2OA 1W0CA 2VPPA 3O0TA 4U3JB 4YI3A 5AOCA 3PQCA 5EJ9A 1RZVA 1U7DA 3U7FB 1N6EA 1CUDA 3I2GA 2OFWA 1MX9A 2Y2UA 3H97A 4JWTA 4LGVA 4LK3A 4L08A 4F3TA 2IHBA 2R1VA 4BO5A 4I4TF 4Z8YA 3WDSA 4YS6A 5EHZA 3KLOA 3CUVA 3TZ6A 1GZ3A 2AN4A 1YHNA 1E6KA 1D7AA 4PN7A 2WM8A 3DE0X 3PQ7A 5JJ5A 2BSQA 2PUBA 3TIIA 1VGQA 1R27A 3OFSA 3OZAA 5JFTA 2HK8A 2PKWA 3B7WA 3KT3A 2CVPA 4JOTA 3SZUA 4DNXA 4RY2A 4EMUA 2BI4A 4U02A 2YMLA 3A9UA 1B4DA 3B7GA 4YYEA 1WCXA 4EGFA 3BMQB 1GP2A 1V8PA 3DKIA 4GGPA 3KKLA 4GMGA 3PYXA 2CVZA 5GM1A 3Q9LA 1NJ1A 3WTBA 1PT6A 2H07A 3KBBA 2ADFA 3C14C 2WTBA 5C1DA 1OU0A 1P1HA 2F3SA 2HA5A 5AR1A 4Z4GA 4BQPA 2X1LA 4FCWA 2G5GX 4DM7A 4H3VA 3RBXA 3AK4A 1WDMA 2XCLA 3OFKA 5BN3B 4NABA 1FTSA 4HWRA 4E2FA 1Z45A 4QRHA 1V5EA 1CHNA 5B1YA 4D0RA 5F2NA 3MRVA 3KKEA 3TJMA 4JCSA 2DR3A 1NQOA 5CVDA 3QEOA 2VK4A 1DPGA 4GR5A 4OP1A 2HGSA 2X3YA 4RNDB 3G49A 1RAIA 4AYTA 2JGMA 2P9CA 2VSXA 2CXUA 5CRIA 4UBIA 4ZVMA 3T1VA 2WIGA 2NUPB 3T5BA 4P31A 5DNVA 3WLOA 5KQPA 1KP9A 1HQKA 4BUZA 4IDDA 5KNBA 1R0RE 3O4GA 5A4IS 2O8DB 1B1AA 1F60A 1P73A 4G85A 1I7NA 4PGHA 5L3SB 5LYJF 3MXOA 3PQ4A 4LOJA 3NOOA 2Q3LA 2ZT6A 2OA0A 1QIKA 2HUNA 2JCGA 4TVOA 3TX2A 1JLLB 1H9BA 4TXLA 3BIFA 7MDHA 4GI7A 2H0RA 3GEIA 1X1CA 4LQDA 4OA8A 4I5GA 4HNSA 5EIAA 4X3PA 1E7YA 1MC8A 1U9IC 3P9PA 1BXRA 3O2JA 4M1MA 5JBIA 3G82C 1ZR4A 1EB8A 1KDZA 3O94A 1K8XB 5BMVF 5EE9A 1P9WA 3IX7A 3TR0A 3DZDA 3EGXA 4YMIA 4ZIRB 1JSZA 1QKKA 1JHRA 4PZ9A 1W7AA 4WK4B 4D57A 2NAPA 1DB3A 4BEBA 4FMCB 3AILA 3IBCA 1U4NA 5LDHA 1B42A 4DANA 2NACA 5FWXA 4BN5A 4U6QA 1SUDA 1BMQA 1N7GA 2YQ4A 3QMVA 3HUEA 3REQB 1LTQA 1NE2A 1O94C 2XUZA 4HPJB 4J0GA 4Q9NA 2O2YA 3SZOA 4B9EA 3CVUA 1JYFA 1NSFA 1Z29A 1YQEA 2PV0A 3QV2A 3TTYA 4BC1A 5FI5A 2YN4A 4KR0A 1V1MB 1FC6A 1XTUA 3G1TA 1KFJB 4PGGA 3ZEIA 1TNDA 3OBIA 2PU7A 3NUZA 3FKQA 2G9RA 3AHGA 3AR9A 4GHWA 4DC1A 4LYYA 1XLVA 4AUNA 2GA9A 5GVSA 3R40A 2HK6A 3N0WA 2F00A 1YDFA 2QYSA 1NUPA 3KOMA 4GSKA 4HY3A 2A0FA 3TL3A 5EHXA 1OASA 2VUHB 3QHQA 3PA6A 4HNGA 5BUZA 1ZHOA 4ALLA 3RIYA 2WJPA 2QN9A 3L7CA 4I1YA 3EZXA 3FRJA 3ZWAA 1C3VA 1GCAA 4O33A 4XIYA 4X93A 5AJVB 4RYLA 4OX9B 2G80A 1CRPA 2I03A 1U8CB 1FZQA 3B8EA 2JJ2D 3MPUA 3I04A 4WDQA 1STOA 2H1RA 3O2QB 4LJ6A 2BOVA 1E5TA 3NTRA 3WGLA 2BGGA 2FR8C 4IOJA 4LZJA 3KS9A 4C0SA 4EVSA 4KNPA 4JA0A 1T2VA 2ORED 2Q5OA 1FP7A 1NMXA 4JLWA 4LHEA 1HT0A 3L5OA 4D02A 2QTAA 1N8TA 2CNWD 3SI7A 3O74A 2QR5A 4C5CA 4HCJA 1AGRA 2ZJ7A 5IM4F 4YLGA 4O3MA 1IAQA 4I4LA 2H5JA 1XC7A 2CXSA 1YI1A 3G0GA 1LKZA 1VDMA 2DT8A 5HQTA 1TUGA 3LG2A 4GPTA 2EQBA 2C5BA 4QUDA 4F9TA 4JC4A 2EHJA 5F5NA 2QRPA 1EJ6A 1AKRA 2OK8A 1VBKA 5A5VA 2WUWE 1QNLA 4CF4A 2C58A 2FK7A 3MYBA 3R7NA 3O38A 2FQXA 4M0FA 3TZCA 3ZKAA 4B6EA 5BUQA 5DXJA 3QHPA 1FRFS 1A9QA 4KO1S 3HP4A 2Q2WA 1Q44A 2ZSDA 5J63A 2R1ZA 5H3CA 1SC9A 4QT0A 1JQBA 1BE0A 1VJ5A 1KVQA 2YBDA 4URWR 1YVUA 3PNOA 1I7LA 3BQMB 3SSMA 1M1YE 2WTMA 3O91A 2F9YB 4FNGA 1YZ3A 2ASEA 5DE3A 2NTNA 3NHUA 2K87A 3QEJA 1SHKA 2IRWA 2JGJA 3AIIA 3BS4A 4UCWA 3CO5A 4YPFA 2CHEA 4HTFB 1FC7A 4HLQB 4X44A 2DWQA 1AKUA 1UKZA 1R3DA 2R6AA 2ZRNA 3DLCA 2JGRA 4INJA 3UWMA 1PGOA 4IRMA 3TYXA 2O54A 1OXSC 5JFOA 1A5BB 2X0EA 2PXXA 4MW6A 2UUAB 4S3MA 4LGYA 3OCUA 4KNWA 1T5BA 4M7OA 4CFYA 3W04A 2J33A 1IJFA 3D0RA 4AMVA 4JJKA 2VF7A 5DK4A 1HE1C 4C7BA 4LZAA 1AZLA 1E8DA 3NFRA 4QOSA 4C07A 2H3HA 3LCCA 4R1UA 4H1TA 4RZQA 5FQOA 5DGTA 3GNSA 2XMCA 2YUTA 3M89A 2QI9C 4DQ0A 1L3BA 1UBJS 1XAGA 4OYLA 2QZPA 1YS6A 1G7CA 3JQEA 3L0OA 1HTBA 1JEQA 5AW1A 3K9NA 4ID3A 1J2YA 3BRSA 4NBLA 2HU7A 5JSHA 2DT5A 3D6NB 4PQGA 1D5CA 1GR0A 3AKDA 3WG5A 2VSQA 1GG2A 2O8NA 4Y7CA 5C1BA 3RTEA 2FJUA 1OBHA 5CNJA 1BXGB 1L4KA 3RIEA 2FN9A 4YRQA 4QA9A 4IS3A 4TGLA 4GKJB 5THKA 4JDUA 4HDNA 4AMYA 1VRVA 2ZGVA 2FPGB 2Q3EA 4G9BA 1IZ7A 4WLEA 3W2IA 5H59A 1J1ZA 3I30X 3OD5A 2IJGX 1H2ZA 1QORA 2CLOB 2VHTA 2Z5GA 1F8FA 1N6RA 3AOGA 3HU5A 2FEOA 1RE1A 3ZZ1A 3EYAA 2JGDA 2WKSA 5DNYB 2CL6X 5E4YA 3AKZA 1UWKA 3DAGA 4JWKA 1W1UA 4MUBA 2WF6A 3CF