3ZW8A

Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) in apo form
Total Genus 277
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
277
sequence length
725
structure length
725
Chain Sequence
PRGSHMAEYLRLPHSLAMIRLCNPPVNAVSPTVIREVRNGLQKAGSDHTVKAIVICGANGNFCAGADIHGFSAFTPGLALGSLVDEIQRYQKPVLAAIQGVALGGGLELALGCHYRIANAKARVGLPEVTLGILPGARGTQLLPRVVGVPVALDLITSGKYLSADEALRLGILDAVVKSDPVEEAIKFAQKIIDKPIEPRRIFNKPVPSLPNMDSVFAEAIAKVRKQYPGVLAPETCVRSIQASVKHPYEVGIKEEEKLFMYLRASGQAKALQYAFFAEKSANKWSTPSGASWKTASAQPVSSVGVLGLGTMGRGIAISFARVGISVVAVESDPKQLDAAKKIITFTLEKEASRAHQNGQASAKPKLRFSSSTKELSTVDLVVEAVFEDMNLKKKVFAELSALCKPGAFLCTNTSALNVDDIASSTDRPQLVIGTHFFSPAHVMRLLEVIPSRYSSPTTIATVMSLSKKIGKIGVVVGNCYGFVGNRMLAPYYNQGFFLLEEGSKPEDVDGVLEEFGFKMGPFRVSDLAGLDVGWKIRKGQGLTGPSLPPGTPVRKRGNSRYSPLGDMLCEAGRFGQKTGKGWYQYDKPLGRIHKPDPWLSTFLSQYREVHHIEQRTISKEEILERCLYSLINEAFRILEEGMAARPEHIDVIYLHGYGWPRHKGGPMFYAASVGLPTVLEKLQKYYRQNPDIPQLEPSDYLRRLVAQGSPPLKEWQSLAGPHGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PEROXISOMAL BIFUNCTIONAL ENZYME
publication title The Isomerase and Hydratase Reaction Mechanism of the Crotonase Active Site of the Multifunctional Enzyme (Type-1), as Deduced from Structures of Complexes with 3S-Hydroxy- Acyl-Coa.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 277
structure length 725
sequence length 725
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.50 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3zw8A03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3zw8A02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3zw8A01
2J5QA 5E0SH 2CD9A 5DBIA 4WCFA 4HFNA 1YBAA 2OBYA 3U5TA 1ZO8A 2X9GA 4ZQGA 2X24A 1D8AA 4K6FA 2ZL4A 4E32A 4PLVA 4ND4A 4ESOA 1WMBA 2VYNA 3ONFA 1P1KA 1UYTA 2Q2XA 1NAHA 3INGA 3SJUA 4A73A 4CUJA 5JFOA 1FMCA 2QZ9A 5TX7A 2A7KA 3AI3A 3OBBA 1VL8A 4FFMA 4IMPA 4N5NA 3L6DA 3T8BA 3STAA 3T7EA 1PGJA 4NHEA 1XO6A 1VE9A 4HFMA 4DLAA 4UUOA 1JKIA 4GQAA 1N9GA 3DAGA 1E77A 1LXCA 1W0CA 4D42A 3GVIA 1ZW1A 5A5FA 1P31A 4NJMA 3U49A 3KVOA 1PS0A 4NBWA 2NU6A 4WECA 4I9UA 1U7HA 3FHLA 1I01A 1P45A 1RM4A 4HFJA 3U0BA 3ZWAA 2IYPA 3PQEA 4LMRA 1ISIA 2YV2A 2UUPA 4O1MA 2GCGA 3PFWO 4E5PA 1EMDA 4L73A 5BT9A 4DUPA 4I52A 2VRBA 1X15A 1C14A 1D7OA 3NV9A 2VWQA 3CPSA 5I7FA 1VL6A 3H3FA 4K1LA 1WDKA 4QQRA 2HK7A 2P9EA 2C7GA 2FY8A 4YBZA 5G4LA 3ZHXA 4FFOA 4FSHA 3ZWPA 2NU7A 3F1KA 1IHXA 3AI1A 2V6MA 3A4VA 3I9JA 3IOYA 3TSCA 4BNFA 4DPKA 3TT6A 3K9QO 1KVRA 4PFJA 4BKQA 4U6SA 4PRLA 2DU8A 3CIFA 1DRUA 4FJ2A 1SZJG 3WR5A 1PQPA 3F5QA 4I08A 1PL8A 4RZIA 2C54A 4DXHA 3MTGA 3Q1LA 1PJCA 1U9JA 2HMVA 1ZEJA 4FGWA 4OXYA 3FN4A 4U7WA 5JDCA 3WG5A 3W4JA 2GPTA 4L0QA 1DIAA 3IBBA 1E3JA 3KYDA 3JQ6A 4WLEA 4YXFA 3TVWA 1DO8A 3DZBA 3GGPA 4R68A 1PL6A 3GAZA 3DOOA 5HS6A 2Q45A 4Z6KA 3ITDA 8LDHA 5CFZA 1GZ4A 4WLUA 4Y6SA 4J9VA 3GC6A 3JQAB 1JWAB 4YRAA 3R0IA 4KD6A 3BYZA 5ENVA 1BSVA 1O9BA 3OECA 4XQCA 2ZL2A 1HTBA 2ZQZA 5JCJA 3RCBA 1GDHA 5GZ6A 1OAAA 2FPIA 4GHNA 2D8AA 4MIEA 4L75A 4R1SA 4E30A 1C0LA 1DIGA 2Q99A 4QXMA 1GQYA 3BTUA 4PG4A 3LAOA 4XGNA 5DCUA 4ZHSA 4XJSA 5KJPA 1PJQA 2ZK7A 4WK6A 5BNIA 2G0TA 3K50A 4FB8A 1AE1A 3KRTA 3TPCA 1FCFA 3L9XA 2RH8A 3LT2A 4BNHA 4HY3A 3VHRA 1LLUA 2WEKA 1J5PA 3QHAA 2QQ5A 3JD0A 3K8ZA 1YQXA 1RM0A 1TEHA 1KVUA 2BF7A 9LDBA 3FF6A 4A26A 5CPBA 3D7LA 3PTZA 4MVJI 3TFOA 3H2SA 1PQWA 5IFLA 3PHGA 3I9MA 5I9NA 2EF1A 2X4GA 1JAXA 3KXDA 1WXDA 2VNAA 2O2YA 2OOSA 4GMGA 4XJTA 5JXWA 4LSWA 4EBFA 2NM0A 3WNVA 5CDSA 2IEXA 3LLSA 3RBVA 1HNOA 2EV9A 2BELA 1YOVA 4H16A 1X7DA 4LRTB 4OAQA 4TVOA 3VC7A 3WMWA 1BW9A 3BA1A 3FNFA 2CZCA 1H5QA 1B8UA 4BV9A 3TFQA 3ISAA 3Q2KA 1R0LA 2I6TA 2JCXA 1N8KA 1E3SA 1WW8A 2RCYA 3GY0A 5LC1A 3RU7A 3PWKA 2VSUA 4RPJA 2A92A 4D46A 4BB5A 4BNJA 3KTIA 2WE8A 1D3AA 4CR7A 2VWGA 3NJ8A 2XOXA 1GEGA 1LRLA 3GFGA 1HE5A 2ZYAA 2FMUA 4CMKA 4KPKA 1PX0A 4X54A 2EIHA 1YH3A 5KVSA 4CL3A 1I8TA 3AUTA 3DBHA 1YB1A 2UAGA 2X23A 4WLFA 1EE9A 4JWVA 4YA6A 5K0ZA 1HF3A 4M54A 1VRGA 3WWYA 5BSHA 4N5LA 4RLHA 3I4CA 3PYMA 3RJ5A 5BSGA 4MIYA 4NG5A 2GGSA 4WLVA 1J7XA 4JOTA 4CMIA 1UH5A 1RYEA 1ID1A 1Y1PA 4U0HA 1H94A 3VVCA 1BXGB 2P5UA 3QWDA 1KEWA 2DFDA 5IXSA 1MC5A 3CKYA 2I66A 1VJTA 4R9SA 3W4KA 4CM9D 3H0QA 4IZCA 3DZIA 2BFPA 1HDGO 2JJYA 1ZXLA 4XYBA 5BR7A 2JAPA 4ZRMA 3NJDA 1GPJA 2EW8A 3ONDA 4J7CA 3N6RB 4KWBA 2BLLA 3FCOA 5IN4A 1EVYA 3UCFA 1H2BA 4OOEA 2WTBA 1OC4A 2GF2A 3BHMA 2PGJA 4L8KA 4B4OA 3LC7O 2UUOA 4CM9A 2YHIA 3SJ7A 3WFIA 5COAA 2Q35A 1F17A 3Q7HA 3QK8A 4IM7A 4K29A 3OC7A 3LF1A 2NWQA 2D2IA 2CF5A 3G1UA 4BQPA 4F46A 3D64A 2X0RA 3Q0JA 5HTOA 3MOIA 1MFZA 1JKFA 1JVBA 3MYBA 2RHRA 1HWYA 2PGLA 3V5NA 4Y6RA 5INFA 1FXSA 3WIEA 1ZCJA 4E2WA 1HDCA 2AE1A 3DONA 1ZFNA 3PWSA 3QWHA 4YAIA 4WCFC 2CNBA 2AW5A 1D4FA 3ST7A 4CLOB 1E6UA 5A9SB 4HXYA 4FN7A 4GX5A 3H9UA 3PGJA 2J5RA 2QZZA 4B4UA 1LDMA 3QWFA 3EZYA 3H3JA 1EFKA 5JBWA 3BMNA 5KVCA 1I36A 3S2IA 4F45A 2VSSE 2NU8A 5JBXA 1U5CA 3FPLA 3EZLA 2TMGA 3UH1A 5TS3A 2GLXA 3JD2A 3R9SA 3VPXA 5AXBA 3OMEA 1YBMA 1JU9A 3MJEA 3GVHA 3UXYA 1OC2A 4FB5A 1NFQA 3OA0A 3FDUA 1ZVMA 2D59A 2C82A 1C0KA 3ZV4A 1ONNA 4XGIA 2W90A 2VHVA 1Y81A 2WDZA 3E8XA 1E7MA 3NRCA 3DFZA 3BF0A 3CE6A 4OJNA 3T3WA 5B1YA 3WYCA 1D1SA 2VUTA 4LCEA 2HW5A 4E12A 4CL8A 2NU9A 4MI2A 1M75A 3NTOA 1ZH8A 4HFRA 1DJQA 1PWZA 1R6DA 3FR8A 3L4SO 4J2OA 2BHLA 1BDMA 1MG0A 3W1VA 5TIIA 5U9CA 2BFAA 4GKBA 4IJVA 3VKUA 1IZ9A 3AJRA 4FFLA 3ZDFA 5CG2A 3ICPA 4KUGA 2ZCUA 1P44A 1IPEA 3RJ9A 2WD7B 4FDAA 2C2YA 1V3VA 3GZNB 4WCFB 4DL9A 4K6CA 5L7YA 1D1TA 3FTNA 5B4VA 1LC0A 1O5IA 4KWIA 4Z9YA 5AOVA 4YJHA 4BOYA 2BZRA 2FPPA 5JDCC 4XIYA 1HDYA 2WYWA 1E7RA 2OMEA 4LMPA 4PZCA 4IZDA 3NTQA 3RUCA 2VHZA 3WQRA 2Y99A 4RL6A 2D0IA 5A4DA 3JQ7B 3VDRA 1EY3A 1T1SA 1HE3A 1N2SA 1GYPA 4AJKA 1ZKMA 1X0VA 4RJTA 5H81A 5CAEA 1PZGA 3ZV6A 3MT6A 5DU6A 1PGOA 5BQFA 1HLDA 1A7AA 4DLBA 3GLMA 3ETGA 1HL3A 3L4BC 2YQ4A 4CM8B 2P9CA 3HB4X 1CJCA 1PIWA 4H15A 4NFHA 4Q3EA 4P22A 2B0JA 4MVJD 3O4RA 3O8QB 2Q2VA 3EAGA 1O89A 1DXYA 4FPXA 2Z1MA 1V6AA 4PRKA 1BDBA 1I3MA 3DBLA 3GGOA 3MFMA 5EPOA 2DC1A 3FNHA 2B4TO 1Z45A 6LDHA 3IP1A 2PTGA 4RVSA 2YZ7A 4A10A 4ND2A 3TWOA 1JAYA 5CEJA 4MVJA 3GFBA 3UFXA 4WLNA 3KOUA 3IAVA 3R0OA 2NP9A 1Y6JA 2W4QA 1GUYA 3VPSA 3ICCA 3ENKA 1XQ1A 4MJLA 3NT4A 1P77A 4GH5A 5A3JA 1VC2A 3QLJA 3TQHA 3UUWA 1K39A 2B36A 5F3RA 1WAMA 4RVUA 1YRLA 4E21A 1BXZA 3OIFA 4D0SA 3H2ZA 1DB3A 2W98A 3F6YA 4Y9DA 3RD5A 3ZU3A 4MKXA 1X14A 5JAZA 2Q46A 1EK6A 4IDCA 1KVTA 4K28A 3A14A 4KQWA 1C1DB 2HLPA 2HSDA 1ZMTA 4CMHA 4PG8A 1DBVO 4YJFB 4DYVA 3HADA 3LK7A 4ZA2A 3ZWCA 1EVIA 3UW3A 4E5KA 1T26A 1EVZA 1ENYA 1UUFA 2I76A 4BO0A 1ISGA 1DHRA 1FDTA 2O4CA 3IL2A 3MJTA 3D5QA 4GPD1 1NM5A 4IMRA 4BMNA 1ZIDA 2F9IA 3GUYA 1ADFA 3U9TB 3PJEA 4MVJF 5JAQA 5FUSA 2VCYA 4YAEA 2FOIA 3GR6A 1VJ1A 1UXHA 5G0UA 4GGOA 1IL0A 4CR8A 2WMDA 2V6GA 3ZH2A 5IZ4A 1AHHA 3CMCO 1IPFA 4J7XA 4U8GA 1XIVA 2F00A 2AG8A 4URFA 4Y98A 4WKGA 4YJGA 3GPDG 4AJLA 4ALKA 4DQVA 3RC7A 4CM4A 4IJUA 4ZDFA 1BTOA 1PS8A 4HNKA 3VH3A 3PQDA 1T2AA 4XEHA 4ZVVA 4TROA 5FF9A 5A04A 1R0KA 2YQ5A 4BGVA 5KOIA 2GERA 3QKAA 2FR8A 3IJRA 1P3DA 1DEHA 3X2EA 3EK2A 1E7QA 1QYCA 2NSDA 4YAKA 1Z7BA 3CXRA 3R3SA 1YKFA 3QXZA 4B3HA 3V5EA 4PVCA 1GADO 3M6MA 1H9AA 4IGEA 1P0CA 3RBXA 4U0GH 1UR5A 3NAQA 1KVQA 5KTKA 1VM6A 5CEEA 4DBZA 1PGQA 4CQMD 3Q6IA 5JSFA 1DJNA 1W73A 4E5MA 3WGOA 1PTJA 1XU9A 3RUEA 1DSSG 2G17A 1R16A 1QMGA 3DBRA 5ER9A 3WBFA 4EUEA 1U3UA 1IE3A 3F4LA 1XDWA 2R6JA 4O59O 5DT9A 4ZU2A 3KTJA 3G1TA 3BTVA 1H6BA 4XYLA 5A02A 3PFFA 1PJSA 3TZCA 2UDPA 2VUSA 1CQJA 3C1OA 4NNJA 4HC8A 4IDEA 1ENZA 2VX2A 1SB8A 4ELWA 2VOEA 1QYVA 2ZTVA 7ADHA 4IQ0A 5EJ2A 5G2OA 5TJHA 1PU2A 4AJ4A 4ZDBA 1T2FA 4YCAA 4QFDA 4NQZA 1FDVA 2EW2A 1NPYA 4JP3A 4YTEA 5JY6A 4LCJA 1EFLA 1SCUA 3SXPA 1KS9A 4PG6A 3I1JA 5KKAA 3O38A 2XXBA 3MWDB 2C29D 4BGUA 5F1KA 3VKVA 2J3JA 4J7UA 1E7YA 3GN1A 1P0FA 5DOVA 4D43A 1O0SA 3KTDA 4ELSA 1ISJA 3HDJA 4W99A 2PG8A 5G1SA 3KYBA 4WYOB 1LDYA 3GEDA 1YQGA 1KOLA 3K92A 2DAPA 4K9DA 4EJ6A 3BMQB 3GH3A 3KBOA 4B4VA 1H6AA 3PK0A 4BO1A 4R51A 3WQSB 2V7PA 3PHLA 1DLIA 4CMGA 2Q2QA 5F21A 1HYHA 3ZZNA 1NQOA 2PA3A 1F8GA 1NZYA 2HDHA 4BO5A 3FPCA 1MXFA 2VTDA 5A1TA 1GUZA 3RC9A 2YDYA 2O7QA 2NUAA 3VPHA 1T2EA 4Q1IA 2PGDA 2DBZA 4JK3A 4WNCA 3ST9A 1NPTO 3RC2A 1I24A 4LISA 4IDDA 3EMKA 3D5TA 4G65A 2P4HX 2CDBA 3EGOA 4YQZA 4XDYA 2PBPA 1QLHA 1B3BA 2ZB7A 3OICA 2W2KB 4A7PA 4CLXA 3U9RB 3G0OA 4JQCA 4B3JA 3F47A 2NNLD 3LSYA 4MP3A 4PLGA 4IQGA 4RPLA 4BKUA 1T4DA 3AFMA 2ZCVA 3E48A 5A9TA 3UOGA 3DOCA 3Q9NA 4RQUA 5FI5A 1E0DA 1FDWA 5TRTA 3X2FA 1J0XO 4JSBA 2DEOA 1YQDA 2GNAA 1FC9A 3VDQA 2SCUA 4PLYA 1ZJZA 5L3ZA 3F5SA 4GVXA 5CDTA 1U4OA 4MOWA 2ZIZA 4G2RA 2E6UX 3I23A 2O3QA 3RSTA 5C5IA 2B5WA 3SWXA 1R15A 5DCWA 4M87A 4KP7A 1J6UA 3JQEA 1Q7BA 4CMBA 5L7WA 3W8EA 3B1KA 4YWJA 1KY4A 4CV3A 3DHYA 3KSZO 1NQAO 3ASVA 5A03A 4TMFA 1X7GA 2GN8A 1Z82A 2EKLA 3VH1A 1LTHR 2EHDA 1MGOA 4OH1A 2EERA 4II2A 3G3EA 5THKA 3MZ0A 3GF3A 2BKAA 1E3EA 4ASIA 1LNQA 5DUCA 5CG1A 3KLPX 2POQX 3JD4A 1U2DA 3E9QA 1A5ZA 2IXBA 4WZ8B 2IYOA 5I9LA 1FC7A 2QRJA 3O03A 1XR3A 1KETA 4W82A 3DAPA 3ZNNA 4BQRA 4L76A 1W4ZA 3K31A 4D3SA 1ORRA 1W8DA 5DCYA 4KQXA 5DZKH 1W2XA 1QORA 1BVUA 4R1TA 1ZK2A 4M49A 3HG7A 1VJ0A 4GKVA 4DI1A 1Q0HA 4CM1A 3QY9A 5KKCA 1GCOA 4XYEA 3NT2A 2RAFA 4FJ1A 2EWMA 4ALIA 1V35A 1LU9A 2J5IB 3S8MA 4RLSA 1S6YA 8ADHA 3PYXA 4D45A 3MJCA 1UXIA 4BS9A 5DU4A 3OJEA 4JN6B 1ADBA 3MCVA 3TDCA 3TVUA 3ULKA 3DO5A 5COQA 4H7PA 3E9MA 3I47A 1TLTA 3HB5X 3WWZA 1VKOA 3GNTA 2O3TA 3LKEA 2O3SA 4EMLA 1NVTA 1DIRA 3PIDA 3QVXA 1NFFA 4NK5A 3E5RA 3KHUA 5IDYA 4BGEA 3CH6A 3GEGA 2XF8A 4O5OA 2Y1OA 2E48A 2ZATA 5EINA 4GI2A 3EYWA 5G1RA 4QEDA 4OMRA 5HBRA 1JLLA 2X0JA 2FP4A 5T64A 3U4HA 2HMWA 3BHJA 1YG6A 1XELA 2O7SA 4JCQA 4QIJA 4Z3KA 1ISFA 1X13A 3U09A 2JHGA 3LF2A 3UN1A 4AVYA 1DLJA 3HDYA 4OOFA 1HLPA 2NVUA 2E49A 1TVEA 4UEOA 1L7DA 1SOVA 1DIHA 3GG2A 4ZQEA 2F9IB 2FZWA 2AEJA 3WYBA 4DBVO 1E3WA 5HWSA 4JYLA 3GRKA 1DRWA 1YWGO 4R3WA 5CDUA 4BNLA 1UP6A 5DL1A 4Y8VA 1GEEA 4XB1A 1AXGA 1HEUA 1SZOA 2C20A 4BNGA 4NK4A 1B0AA 4EMMA 4ALNA 4W9NC 4HV4A 1GD1O 4IDFA 4W7IA 5FFFA 2VUUA 1EK5A 2VN8A 4LGVA 2IE0A 3S2GA 1ONPA 1NASA 2VREA 2OZPA 3L3SA 4YJGB 1E1LA 1HXHA 1CF2O 4MKRA 1DOHA 1EVJA 1KC1A 3H9GA 2I65A 2J8ZA 3DZKA 3HDHA 4U0GA 3KSDO 4FOSA 4UVEA 3UF0A 4NFSA 5JCJD 4ND5A 2HMTA 4R16A 3RVDA 5B4UA 1G6KA 3C7CB 3HE3A 5LDGA 4FS3A 4RPGA 3RUAA 3SLKA 5COBA 3IQDB 2DTXA 1B8VA 1YL5A 3OJ0A 3TRRA 4D0RA 4B8WA 3RKUA 1GYQA 4MVJM 4XKJA 3SEFA 3ZNOA 5CDYA 3DMTA 3G79A 3WLFA 1SEPA 1ZK3A 3E18A 4L6WA 1E1NA 1N7GA 1Y7TA 4N18A 5KIAA 4U0JA 2DUUA 2ZQQA 5ICSA 4J0EA 4ROSA 4WOJA 3U62A 1KBZA 3ADOA 4FCCA 3IB9A 3OFSA 3RASA 5JDIA 5TJ9A 2E82A 1BG6A 2GASA 1RJMA 2B35A 5ENDA 2YFHA 3IMFA 4EZBA 3VTFA 3O9ZA 4GLOA 1LA2A 4IZBA 4AJ2A 1X1EA 3VZSA 1E3LA 2BFMA 4JJFA 3DBVO 4CQMB 2H63A 4NU5A 4B7UA 4ND1A 3AI2A 4NEKA 3ZV3A 3MWEB 1PR9A 3FNEA 4CQLA 4D3FA 4EW6A 5J23A 2C5AA 1NPDA 3GA0A 3HFGA 3WICA 4R3NA 3ZV5A 1AGNA 4AJNA 4E5YA 3ROQA 4CMJA 5DU8A 3GUCA 1GFSA 3JV7A 5TC4A 4XIJA 5TGDA 4OSOA 3TZKA 4BHTA 2EJWA 1L7EA 2PWZA 4BO7A 2X8LA 3IKVA 3K8XA 1RKXA 3NGXA 3MJ4A 4W4TA 5DN9A 2NACA 2Q2WA 5G0WA 4AL4A 1KEPA 4KMSA 1U3VA 3ADPA 1K6XA 3U4IA 4L4SA 4XR4A 5CTCA 3LQFA 3KO8A 1GU7A 4RV9A 5I9MA 5KJ6A 6ADHA 1LSUA 1TA4A 3GN2A 3H9QA 4DGSA 1F12A 2PK3A 4IZIA 4QX6A 2JFFA 1R4MB 5G4KA 3WS7A 2EKQA 2YDXA 4IIUA 3KB6A 4OKIA 4XGKA 5TF4A 3DHNA 4F6LA 1E7SA 2DUWA 1TT5B 2IZ1A 4KOAA 4XQEA 3RU9A 2QRKA 4TRNA 4D41A 1E6WA 4C7JA 2YY7A 2XXJA 3P5SA 2OXIA 2IEDA 4EEZA 1QSGA 1LEHA 3I9KA 1NP3A 2Q4BA 3ZHYA 1YS4A 2C59A 4CM7A 3GMAA 2C5EA 4YDRA 1XNVA 2A35A 2NLOA 4R54A 4BNYA 3ENNA 3RUIA 4E6PA 3JYOA 1R37A 3JQFA 5JLAA 4WLOA 4CMAA 1E6EA 1IOLA 3GGGA 4A0SA 4FIZA 5JO9A 1DHTA 4UVHA 1C1XB 4PCVA 5JYEA 4W7HA 1H6CA 3BZUA 3KEQA 5I8ZA 4E33A 2EJ5A 2VSUF 1I5RA 4P8RA 5EN4A 3WMXA 4QIIA 3KSUA 2QW8A 2X9NA 3BIOA 4TRJA 4AJHA 4TSKA 5GMOA 3MJSA 5HM8A 1NQTA 1ENOA 2ZTUA 1Y9AA 2OP0A 3S2EA 2VWPA 4R1NA 1CRWG 1ZSYA 1B26A 4IXTA 1VSUA 4EUHA 1MA0A 3PZBA 2H5LA 3GZ4A 5T6BA 4B8ZA 2HMSA 1Y5MA 5JS6A 3D3EA 5DZKA 4YAGA 2P9GA 2I99A 1SC6A 1H9BA 4JLWA 3EVTA 1F06A 5DF1A 2X58A 3P2OA 5JPIA 4DPLA 5CDGA 5ITVA 3H0SA 3A1NA 1A7KA 1UP7A 4R69A 4Z9XA 4UULA 4CV2A 2VSSA 4HBGA 3CUKA 4HNGA 2J5GA 2OL4A 4L9RA 1VI2A 3L77A 2QRLA 3E9NA 4UVDA 2NTVA 3GHHA 5JC8A 5KCZA 1O8UA 1K6JA 3BMOA 4UVIA 3KZVA 3C3XA 3QE3A 4ZU3A 2HRZA 1WDLA 4JJIA 4ZICA 2NVBA 1T24A 3U9LA 3ON5A 3NJBA 5A06A 3SLLA 1I10A 2HJSA 4MPDA 5E0SA 4Q3AA 1N6DA 2W3PA 4JJTA 2ZJ0A 1HSZA 3UCXA 1QR6A 4FJ0A 2HK9A 3AU8A 5IF3A 2FZSA 1ZK4A 4FOOA 4ILKA 3T7CA 1EF9A 4UVGA 1E1MA 4AJIA 4DIFA 3TOXA 4UUPA 4R5HA 1JQBA 2CBYA 1Y8QA 4JGBA 4WCDA 1ULSA 4H3VA 1DC5A 1M66A 3F46A 3R9QA 1E7WA 3PQFA 4N54A 4YAJA 1TG6A 3A06A 5DDIP 2ZL0A 1Z73A 2FWMX 5HRUA 4GM2A 4GMFA 4BNMA 2JFGA 4G81A 4QECA 3AY7A 2ZB4A 1Q51A 1GCUA 4FC7A 4YEDA 2AXQA 1WZIA 2VNSA 1F8FA 3V2UA 1N1GA 1AUPA 1JWBB 1WDMA 4D3DA 3UVEA 1N9GB 4OM8A 5B37A 4NJMB 3SBOA 2DUBA 4RVHA 4Q39A 4ZQFA 4OQYA 3U3XA 2A4KA 2Y1GA 2Y1FA 4NJOA 2O48X 3WSVA 3ANNA 5T8KA 3DMTC 4P4NA 2AA3A 2CSUA 4YVFA 1CWUA 3QJ5A 4LSMA 5C7IO 3ZHBA 5EERA 1DPGA 2LDBA 2BFOA 1YONA 1YDEA 4YPOA 2Q1UA 4J91A 2A9FA 4KDEA 1PS9A 2H1SA 4XD2A 3P5MA 3RROA 4CLRA 5I7EA 4IS2A 1EBFA 3NGLA 1LDNA 1EF8A 2FW2A 1DC4A 1GZ3A 4MVJP 3JQBA 1Z6ZA 4HP8A 1YGYA 2RHCA 1K5HA 1T25A 1TT7A 4CPDA 4D44A 4FNDA 4BIIA 3E1KA 3M1LA 1LC3A 4CMEA 1BVRA 5G0SA 3O26A 5EESA 5KJFA 1ZZEA 5A9RA 2IODA 3PI7A 1I3NA 5KDRA 2Z5LA 5IN5A 3IKTA 4DIOA 5JMPA 2YJZA 3JQ8A 1QYWA 3BHIA 3HLN1 3LYLA 3P2LA 3OT6A 4HWKA 4A2CA 5C37A 5TT0A 1PSDA 2D5CA 3GVCA 1F14A 4AFNA 4QFCA 3U4DA 3KYDB 4I4ZA 3KYCA 1DDOA 5BNFA 2PD3A 3G17A 2VRCD 1K3TA 1YE3A 4MVJE 5KVVA 4CM6A 1P1HA 5GY7A 3HQ4O 2AMFA 2CY0A 4WGGA 3PLNA 3DOJA 4IY1A 4I8XA 1ZXBA 4ALJA 3CEAA 4OO3A 4PN3A 5GZ1A 3B20A 1VPDA 4FBGA 5DP2A 3SC4A 3GKBA 2GR9A 3KQFA 1LDGA 4J1QA 3GLQA 1QXSA 1T2DA 1TYFA 3OA2A 2AQHA 2VRCA 2VSUC 3NX4A 2VT3A 3N58A 4KUEA 2I3AA 4P4GA 4GWGA 1GYRA 4R41A 3RRVA 4EMPA 2FSSA 2NVWA 4JCOA 1I3LA 3INRA 5L4NA 4BNZA 3QSGA 4CODB 4DVJA 5ES3A 3C8MA 4LK3A 3W6UA 4J90A 1WVGA 3R3JA 1N5DA 5CTBA 2NQTA 5TQVA 1GV1A 4G2NA 4S3MA 1GUFA 1TXGA 1EBUA 3ZN2A 4B7CA 2D5AA 4FGSA 5HA5A 1UJMA 3RBZA 5BSFA 4BUCA 4K3WA 5DULA 3ROMA 3BTSA 4JXKA 1HDRA 1PWXA 1LJ8A 1QYDA 4YRDA 4I42A 1SMKA 3ZWBA 5CP8A 1YXMA 3B70A 1B2LA 4JBIA 2Y0DA 3JQFC 4MKZA 4RF5A 3ZNQA 4XZ3A 2Q4EA 1JN0A 2NV6A 3L9WA 4IIVA 4R1UA 3NDIA 1K0UA 4DC1A 3CSDA 5F5NA 2I5PO 2GN9A 4Y67A 3M6IA 1VSVA 5A5EA 3H5AA 1YOVB 2Q50A 3DQPA 1PGPA 2DPGA 3FTPA 3QVWA 1S7CA 3DC2A 1BW9B 1QG6A 4PLHA 4OIMA 4RF3A 1XGKA 5FI3A 3DZGA 1LDEA 3Q0EA 4CM5A 4O6VA 1LQUA 4CLHA 4RYFH 3JYQA 3V2HA 1HZZA 3JSAA 4HKTA 3HZZA 2BGLA 2OP1A 4QO8A 5KWEA 3DHEA 1RWBA 4BKPA 3RC1A 2O3UA 3K2BA 2IXAA 5DBFA 1HZDA 3PE8A 2Y05A 4IGFA 3AFNA 4MO2A 2VHWA 3DBHB 5G1QA 2FZEA 1P1FA 3JU1A 3D4NA 2VYVD 2UYYA 3ZU5A 1B3RA 3C7AA 3ANLA 3TDKA 2Y1EA 1U8XX 4L8VA 3DTTA 1LSSA 2GO1A 3BXXA 2FRDA 1KY5A 1Y8RA 1FK8A 1XCBA 4YACA 1Q7CA 1P33A 2WSBA 3DZHA 1J49A 4CMIB 3QP9A 2BI7A 5TNXA 1P1JA 4R01A 2EJVA 3T8AA 5FEUA 3BPPA 3I5MA 1MX3A 3GDGA 1QLJA 2VYVA 4FN4A 4AICA 1G1AA 3GDOA 1Z75A 3TF5A 4YYZA 3I6IA 2DT5A 1ZEMA 4I9HA 4IDAA 4IUYA 2PH3A 3GDFA 4KZPA 4UAGA 5ILGA 2Y0CA 4EEXA 4I5DA 2OBNA 4CLDA 1PZFA 5T57A 2EGHA 4A5OA 5DP1A 5AXDA 4J4HA 3LDHA 2YHIB 5K9ZA 1NWCA 1PIXA 5F1OA 1QV6A 1IHYA 4OL9A 1XHLA 4Z0PA 5CHEA 4NDNE 3PPIA 4TKLA 1HNUA 3K30A 3ORFA 4TWRA 1Z7EA 2QX7A 2NTJA 3U4CA 3AUSA 4ALMA 2FPGA 3HN2A 5JYDA 1PZEA 1GL3A 5I8WA 1UXGA 4M8SA 2C2XA 4NH4A 3NT5A 1A4UA 4GGPA 2GRAA 1B8PA 1CETA 1Q1NA 4C4OA 3SX2A 2D4AA 2NADA 4YT5A 1NFRA 2G1UA 1I2CA 4FZWA 3GEMA 5LCXA 3VH4A 3KTGA 1ISHA 3BMNB 3Q0GA 5IZCA 1U7TA 2P2SA 1SAYA 4I5EA 4TZKA 3GF7A 2F6IA 4I1IA 1N1EA 5INGA 1DCIA 4AJOA 1ZUD1 4ZN6A 4EI2A 1K6IA 3TRIA 4A27A 2D1YA 3BMOB 2DBVO 1LDBA 1EDOA 1HDZA 1XLTA 2HJRA 1YVEI 3CMMA 3KUXA 4NI5A 4TVBA 4BKOA 4BO6A 3Q1TA 4YT8A 1KEUA 1GY8A 2JCVA 4CUZA 3M2TA 4INAA 5KJCA 1MXHA 2RIRA 2B83A 4QT0A 4PZEA 4J1SA 3WJAA 1T4BA 2AEFA 1I3KA 1U3WA 2IDZA 1P9LA 4Z0MA 5JNLA 5EIOA 3UCEA 3NUGA 3JQDA 3RFVA 3PGXA 4F6CA 3IJPA 4E0BA 4F3YA 1LI4A 2QYSA 1Y8QB 1DUBA 5BNTA 3H0JA 4CMEC 3EDMA 1Q0LA 3R9TA 4PGFA 3DFUA 1WWKA 4Q3DA 3QMJA 3OH8A 4EJMA 1OFGA 1ADCA 2ZYGA 3QQPA 2EXXA 2Q1TA 1GTMA 2Z1NA 4YJHB 2G82A 3A28A 3H65A 4GX2A 3ZWYA 4UEJA 1T1RA 5FIFA 1PGNA 3C1AA 1PZHA 3OMLA 3L6EA 3NDJA 3QVTA 5DOZA 3PZRA 1LLCA 2AQIA 3FSRA 3FBTA 3JQGA 3EHEA 5FWNA 4MP8A 4PLFA 4FN8A 3W8FA 1UXKA 3C85A 3IUPA 4Q3NA 3QRWA 2DKNA 5A9SA 4CLOA 2R2GA 4MVJG 3EUWA 4RGBA 5T67A 2ET6A 3OM9A 2GDZA 1MFPA 4NBVA 2A7SA 1X0XA 2HCTA 3P2YA 5ICMA 2HUNA 3FNGA 1IZ0A 2Y0EA 1V8BA 1GQ2A 2PKQO 2EP7A 3FRJA 1SBYA 5IKLB 3PXXA 1E92A 1CERA 2P91A 1A72A 4CLRB 4E2YA 5L53A 1UAGA 2VT2A 4I5FA 4AJ1A 1U3TA 3DBLB 3UHAA 2J3IA 1B16A 5DTWA 2X0NA 1PJ4A 3MOGA 1UP4A 1NVGA 5DBGA 3T4EA 5DTPA 3BMCA 3JQCA 4IXWA 2PY6A 2PZLA 2X7HA 4IBOA 1MC4A 1I2BA 2W8ZA 3IAHA 2YUTA 1U1IA 2FR1A 4BO9A 2A94A 4B4WA 1NVMB 4OHUA 5KDRB 3KTHA 1ENPA 2R00A 3ROKA 1M76A 4CR6A 2JD2A 1C0PA 1ZK0A 2JKVA 3QWBA 1NAIA 3D3WA 5L45A 2DM6A 3L07A 3TV5A 3NYWA 3PHHA 3WDSA 3S1LA 4Q9NA 2YV1A 3JD1A 4J9UE 4ALLA 2W2LA 3I9OA 4XDZA 1UAYA 4J0FA 5IDXA 2FR0A 3PEFA 1ZBQA 2GSDA 2WD7A 3OIGA 3S55A 3CZMA 4JCTA 1W6UA 2PH5A 2WYVA 1A9YA 3GZNA 4TKMA 1Z74A 5KJ1A 5C90A 3V8BA 4NMHA 1XYGA 2HQ1A 3GK3A 4NU6A 5JO0A 5ILOA 4ZDEA 1RYDA 4GSKA 4U1AA 1DAPA 4BMVA 4BMSA 2F9YA 1PJ2A 5AVOA 1PEDA 3JQ7A 3E5MA 4U6QA 1IB6A 4CM3A 5JMWA 3EW7A 3NTRA 4BNTA 1KEVA 2OUIA 2GZ1A 4P4LA 5KVQA 2PD6A 3WSWA 4BB6A 3UGKA 3IUSA 4NR0A 1XNWA 3NKLA 3WLEA 2C7VA 2UZFA 3JCZA 2PLAA 4B3IA 4P38A 1CDOA 4GX1A 3TZHA 1E5LA 2P4QA 1H2HA 3GF4A 1X7HA 1LUAA 1QV7A 3DMYA 3P85A 5F5LA 4CM8A 2J3HA 2ZQYA 1VL0A 1LBEA 1ZK1A 3H0UA 3O8QA 4XA8A 4J1NA 4CM4B 9LDTA 4RYFA 2WE7A 1SEVA 2FN7A 2YW9A 3H5RA 2DLDA 3HWRA 3ZNPA 5JC1A 4BKRA 5TSDA 2WWRA 3WTBA 1XNYA 4E5NA 2AQKA 4OMUA 4E3ZA 4E31A 1E5QA 2DTDA 3JQ9A 4L4XA 5TT1A 5GZ3A 4ZDCA 4U0KA 1XU7A 2Q1SA 3NDRA 1PJ3A 2B37A 2B4RO 2CUKA 2B4QA 3DEYX 2ZJ1A 4PLWA 3WJ7A 4BV8A 2Y67A 4L4RA 4NNQA 2JCYA 5EMHA 1EQUA 2CMDA 2IRWA 3PGQA 3NJ4A 1JW9B 1UYRA 4Z0HO 1UDBA 4FNBA 2EKPA 1LQTA 4OXKA 5IDQA 2DVMA 1CYDA 3KM0A 3WOHA 3DDNA 4EJ0A 4U19A 1DFGA 1MV8A 3RI3A 1HSOA 4Q3BA 1OD2A 2D3TA 3CINA 1DIBA 1GZ6A 3VZRA 5B12A 3AU9A 1A9ZA 2I9PA 4MVJH 4JCRA 4FZWC 1C1DA 4JFCA 4OGWA 3DTYA 2G5CA 1Q2XA 4U5QA 4YJFA 2CF6A 4GBJA 1LLQA 1ONOA 5L4SA 1MUUA 2HMUA 3VVBA 3DBRB 1Y8RB 1OZAA 3VAZA 5IZCC 4ID9A 3UICA 2V6FA 4XYMA 1A27A 1DFHA 1VKNA 1P1RA 2CDAA 2PZKA 3LT4A 4IINA 4O63O 1NHGA 2IEBA 2P68A 3L0DA 3L4BA 3OJLA 4FFNA 4OG1A 3SLGA 1M2WA 3VIVA 1MLDA 2E37A 3VZQA 3ZW8A 5F1PA 3AM4A 2VZ9A 4RO0A 2FBMA 1C0IA 1JDJA 1F0YA 1WP4A 4WE3A 3TL3A 1EDZA 3H9EO 2OHXA 4PLZA 3ZWNA 4ONEA 1HRDA 3V1TC 3ETDA 4G5HA 3PJGA 3MOYA 4Q3CA 5C9GA 1AHIA 4YQYA 4AJPA 1HDOA 3W4IA 1PJHA 1NYTA 3QA9A 5ADHA 3OSUA 2J5II 3OP4A 4MP6A 4N5MA 3KV3O 3H6KA 1NWHA 3JYNA 2AEMA 1K89A 3LT1A 1BGVA 2Z95A 4NBTA 4D79A 5EQFA 1FF9A 5FYDA 2C0CA 4QTZA 5A3VA 4IJKA 1EQ2A 4J43A 4WPGA 3PWZA 2I67A 1UZLA 1V9LA 4BGIA 1EE2A 2C8TA 3PJFA 3F4BA 4XWYA 4B79A 2X6TA 2P5YA 4XRRA 1WNTA 2OORA 1XEAA 3OHSX 4GAEA 2TMDA 3G64A 3WGTA 1LSOA 2J3KA 1NBOA 2VHYA 1HE2A 4WJZA 1I33A 4KUHA 3K5PA 4JIGA 2JFHA 2RBEA 4DPMA 1NZYB 3WQQA 3ZI0A 1BMDA 3KETA 2Y1CA 3M1AA 3PIIA 4QUKA 1Y7OA 3QVSA 5JBIA 2VSUE 1GR0A 3GMDA 3I3OA 3RWBA 5DNAA 2Q1WA 4BNVA 3BEZA 3PP8A 4QO7A 4YJDA 5BSEA 2E4AA 5EQDA 3OJFA 4WUVA 2BRUA 5I7VA 2PZJA 2CDCA 5JAMA 3V1YA 1H6DA 2Q3EA 1GV0A 2RH4A 1QYXA 3PHIA 3EY4A 4PG7A 5B4TA 3HP0A 2EEZA 2ZKLA 1KERA 3QIVA 2XAAA 2O4UX 4YR9A 3WTCA 3PHJA 4K26A 4IDGA 4BL5A 2B5VA 3OQ1A 3PYLA 4KTVE 3WGQA 5JY1A 3TLFA 1B7GO 1N6FA 3OQBA 3T89A 5INIA 1JVSA 4UUNA 4FC6A 1J4AA 3RAJA 1RM3A 1ADGA 5H82A 4HX5A 2CE3A 4YLHA 2J5GD 2R00C 4MOUA 3HFSA 4DA9A 3ZU2A 1M67A 3GPIA 3K6JA 1R4NA 3FWZA 3OEYA 4XB2A 4HADA 2A81A 2BH9A 2PR2A 4LW8A 3OIDA 3JQGB 1WZ8A 3VPFA 3Q2IA 3BMQA 3W6ZA 4YT4A 1ZNQO 3GVXA 4NPCA 4OQZA 2O50A 3TL2A 1HDXA 3TZ3A 3K2EA 1IY8A 3PDJA 3WFJA 2WD8A 3M2PA 1SB9A 1JTVA 3D4OA 3P19A 4OSPA 3WGYA 1EUDA 5TLSA 4FD3A 3HRXA 4IZHA 1G0OA 1MP0A 1K2WA 3DZFA 5KNLA 2H9IA 1RM5A 1LSJA 1CEQA 2GYYA 3CTMA 4ELXA 2NTNA 4NZ9A 5T5QA 4K2NA 4J3FA 1BWSA 3AOEA 4TRMA 2W2KA 3TT7A 3GG9A 1OMOA 2VHXA 3BMCB 1HE4A 4R5MA 3ZWOA 4PLCA 1M6HA 3STHA 1UDAA 1ZSNA 4S1VA 4QFEA 5THQA 3WXBA 3WX0A 1O8CA 5IAAA 1I30A 2O23A 4OXNA 4AG3A 4M86A 3PVZA 4FW8A 1KVSA 5A05A 4XX0A 4XRGA 3DAFA 2VSSF 4Z0TA 4IDBA 3B6ZA 3ZU4A 4UUMA 1DAOA 3D3WB 2B69A 3F3SA 3JQ9C 5DZSA 3ZCXA 3DR3A 1LRJA 4J2HA 1PQUA 2PKQP 1CIVA 4CJXA 2ZL3A 3QXIA 3WGHA 4IS3A 2EP5A 2DTEA 4ZRNA 4EUFA 2CVOA 2ZB3A 3C7DB 3HINA 1RJWA 2YYYA 3MTJA 5DKPA 2VTEA 3B1FA 1T2CA 2Y66A 2F1KA 3FR7A 4RVGA 4BNKA 2NVUB 1L1FA 4BO4A 2YHUA 1MJ3A 4ZD6A 3AUUA 1U8FO 4DMLA 1WPQA 3R1IA 2DBRA 2VZ0A 3W8DA 3RFTA 2F9YB 3P7MA 1DFIA 4LVCA 4DIBA 1RJNA 2PPYA 4HUJA 5IXYA 4CLEA 1JKJA 2QIOA 1E3WB 4TQGA 5JDIC 4PIVA 2C07A 2WYUA 2HKIA 4TZTA 3UKOA 1TI7A 2DPHA 2Q49A 1GQQA 1EEHA 1AXEA 1Q7GA 1HKUA 1YO6A 4MIOA 1XKQA 2HRBA 1O94A 2QG4A 1A4IA 1KIFA 3WNQA 3M6NA 3PEAA 3MEQA 1YJ8A 3H9JA 4RORA 1V3UA 4ZGWA 1ZJYA 1BXKA 1UZNA 2CVZA 3MJVA 3FWNA 1LX6A 4LVUA 4XYGA 3WG9A 4BVAA 4EGFA 3AWDA 4LK5A 1YDWA 4JVTA 2ZB8A 2YV3A 5K6AA 2UVDA 3L6OO 1E1KA 4J1TA 2J5IA 2X5KO 1UXJA 1VLLA 3LLVA 4ZJUA 2DQ4A 1IULA 3WBBA 2BI8A 2Y68A 3TZQA 1ARZA 4DREA 4RPHA 4PVDA 1EUZA 3Q11A 4E13A 2ZTMA 1BHSA 4RQTA 3VZPA 1SPXA 1YB4A 2LDXA 5C7OO 4JX8A 2F6QA 4OYRA 3T88A 2I3GA 3SC6A 2GUGA 2IZ0A 3DL2A 5G0VA 3I6QA 1AN9A 4FR5A 4KNPA 4RPKA 5AYVA 5U4QA 1Q52A 3AK4A 3RKRA 2PD4A 3D0OA 4FJWD 2QHXA 5H83A 1U4SA 1C3VA 2OGUA 3IDSA 4PLPA 2QYTA 3QWAA 4JP2A 4NIMA 3ZGYA 5IDWA 2O2SA 1HYEA 4XCVA 5C7LO 5E0NX 4L74A 2CFCA 2GZ2A 3H7AA 3AY3A 1UYVA 1UZMA 3HN7A 2IZZA 3RUDA 2PFGA 4M89A 4WNIA 1U5AA 5L9AA 3VOSA 1YJQA 2OFPA 1DC3A 3ONEA 2PZMA 4KWHA 1PR3A 1FDSA 1IYZA 4MXIA 3H5NA 4PZDA 4PG5A 3ZWMA 5L7TA 1ZSVA 4DRYA 3U9SB 2X9VA 5JE8A 3D4PA 5MDHA 4CQLB 1NXQA 3T4XA 2X0IA 3COSA 3DB2A 4UEKA 3FI9A 4GVLA 4II3A 5I7SA 5L95A 3HE2A 1O95A 4I9NA 5MGBA 1G0NA 1MG5A 1I0ZA 4MINA 3RSHA 3QREA 2Y93A 5DUFA 4E4YA 2JAHA 4WEQA 4EYEA 1R66A 3LVFO 1ULUA 3H4VA 3LT0A 3LC1O 3H02A 1GPDG 4E2ZA 4OKNA 3ASUA 1QP8A 4RDIA 3DORA 2WM3A 3DZJA 4ZQHA 1UIYA 1WMAA 3UAGA 4DLLA 1SOWA 3IC5A 4GLLA 2DFVA 3I9LA 3GAFA 3JQAD 3ZW9A 3JD3A 1XG5A 1SNYA 3LU1A 1XX4A 4JNKA 3VTZA 1Q0QA 4RVDA 2WJPA 3V1UA 2JD1A 1NNUA 1YB5A 4QSMA 5G4KB 4EITA 3VPGA 3INTA 4NBRA 3PDUA 4RDHA 4XR9A 3E82A 1UDCA 4W6ZA 4DYDA 5L4LA 2GN4A 1ISMA 3JQAA 3RQSA 3EC7A 4GSLA 1H0KA 2QQ3A 1YL7A 4MDHA 4AJEA 2J5SA 2PNFA 3F1LA 3F9IA 2J5KA 1P1IA 3TZ6A 1NQ5A 2GZ3A 2NQ8A 3ZWVA 3GHYA 4BO3A 1X0UA 3N7UA 1O6ZA 1XSEA 3GNSA 4DWVA 1SG4A 3GQVA 3PZKA 3RIHA 3RUFA 1PL7A 3IS3A 5ITWA 1Y5RA 5JW6A 5L40A 3G49A 3ZWXA 2UV8A 3K73O 4XQGA 3HHPA 2J6IA 5L51A 4J4TA 4A03A 4RCNA 2G76A 3I4FA 3GMSA 1IUKA 1Y9EA 3HNPA 3RFXA 2GN6A 1EZ4A 4BNIA 5LDHA 1N6EA 3KLMX 4DTIA 4W9NA 4JYJA 2HU2A 3A9WA 4RF4A 1NX6A 2JL1A 3WGZA 2X5JO 3TNLA 4J16A 4CQMA 3WYEA 1K32A 4BNUA 4N7RA 1YBVA 1B14A 5CPFA 4EDFA 1RPNA 3GT0A 3AOEC 2OO5A 4J6FA 5IG2A 1H93A 3FD8A 1U2GA 5AQ1A 4CMCA 2PKRA 3RSIA 1CQIA 1JA9A 1YL6A 1ZMOA 2GD1O 2H6EA 1I32A 3WB9A 4NFYA 1QRRA 1YG8A 2X86A 4RF2A 4E2XA 3QWIA 5AXAA 4Q0GA 3QVOA 4M1QA 4R9RA 4GX0A 1NTOA 5JAIA 3R6HA 2ZYDA 3HJAA 3DXFA 3ITKA 2Q34A 2AG5A 2VQ3A 3E03A 2ILTA 3ROPA 3GOHA 2VZ8A 4RVFA 3WGGA 1R4NB 2JHFA 4C7KA 3S2FA 3DWFA 2BGMA 3AW9A 3GNQA 3AUAA 3IP3A 5JCXA 3QYRA 2O3JA 3ZWWA 4CV1A 3WGIA 4Y6PA 5C3MA 4TRRA 3HUDA 3SVTA 3JYLA 1R4MA 1OOEA 4WEOA 1JXZA 3HSKA 1OI7A 4BNXA 1HETA 1DC6A 1KC3A 4PLTA 5AXCA 1TT5A 5T8KC 1QKIA 1DRVA 4RZHA 3KEOA 3PRJA 4UREA 3ZHZA 3PLRA 4OLQA 2V6BA 1GAEO 1BRMA 1WLYA 4JJGA 1R12A 4YRBA 4ITUA 2EG9A 4Z9FA 3RUHA 4BO2A 3LC2O 3TOZA 4ZDDA 4JCSA 1N92A 1X1TA 4O0LA 5ER6A 4GWKA 2X5OA 2GTRA 1BXGA 2BMAA 1XWFA 1NR7A 1EUCA 1V3TA 1VRWA 3BTOA 4ND3A 1P74A 3JQBC 4YB8A 2VOJA 4R4JA 1PJBA 1M6WA 2O3RA 4JBGA 2AE2A 3ABIA 3AOGA 2CVQA 4KTTE 4D7AA 2HAEA 3GRPA 2BGKA 3C1TA 3FBGA 2FSVA 4LRSB 3LZ6A 1FJHA 5G0TA 3H81A 1C1XA 1LRKA 3AM5A 3OEWA 4CV0A 2JD0A 1FC6A 3OETA 4AJJA 5K6AC 4WOKA 3JYPA 1PJTA 2EGGA 2VWHA 2DBQA 2X22A 3TN7A 3DJAA 4WCZA 4Z3DA 3D1LA 1B15A 3H8VA 3HDQA 1HYGA 1HZJA 3JTMA 1TB4A 1MB4A 3BAZA 1WZEA 2V65A 4WASA 1PJLA 5IJZA 3NEPX 3ANMA 4I5GA 3AY6A 3PJDA 2HO5A 4ZQBA 2ZTLA 3OJOA 1UYSA 4FFPA 4B7XA 2ZQRA 3IIEA 4JROA 1LLDA 1V0JA 3C24A 4J4BA 2Y1DA 3Q9UA 3EVNA 3OF2A 5EL0A 3WIDA 4LN1A 2YFQA 3I9NA 4FQ8A 7MDHA 4IPTA 4DMMA 2BD0A 3FF4A 1N7HA 1NR1A 4F47A 4BO8A 3V5IA 3QV1A 3AM3A 3CZRA 4DQUA 2PV7A 4NBUA 1OD4A 2HK8A 4CUKA 1E3IA 3K96A 1U28A 1XQ6A 4M55A 2X1HA 1FDUA 1HT0A 4IJWA 3TJRA 1A71A 3R6DA 4DQXA 3GVPA 3E6AA 4JBHA 3I83A 4BNNA 1OBFO 4HNHA 3I52A 2AHRA 1ON3A 3KTKA 2W2LD 4U18A 4BNWA 1SO8A 5CEFA 4RCVA 2FHSA 3JQ8B 3Q3CA 3VH2A 4YT2A 2AQ8A 3N74A 1NHWA 5KJEA 1I2ZA 4XQ9A 3OQ6A 4GL4A 1KYQA 3ETEA 3KYCB 1ON9A 2VYND 4KDFA 3V2GA 3B1JA 4IQ8A 1XA0A 5U1PA 4J49A 5HS4A 4DC0A 1ML3A 2XPCA 4FFRA 3QW2A 1R0SA
chains in the Genus database with same CATH superfamily
2QTZA 3IDOA 3WWPA 2QP3A 2X9GA 2QL6A 2P2DA 2EQBA 3LHSA 1D8AA 2SBTA 3NTUA 2NZYA 3QYFA 5EIFA 3WY9A 1WLSA 1XHFA 2W7TA 3Q7RA 4BFLA 4PICA 1OTHA 3H1GA 1WMBA 3H0CA 1UYTA 3HCRA 1AIPA 2ZUVA 4TS3A 2Q2XA 1NAHA 3EJWA 2O1EA 4A73A 1M1YA 1NDHA 4DIDA 4ZYLA 2ZJBA 3HA2A 3AI3A 3OBBA 1QIIA 2XNDD 1AGXA 4ODIA 5FL7D 1IQRA 1F3LA 3IULA 1PGJA 1Y42X 4KAJA 4HFMA 4NHEA 5C80A 1K8YB 3ZE1B 1E77A 1M83A 1W0CA 3OHPA 4U2GA 1ZW1A 3ECSA 4BNGA 2VTBA 4TXMA 1H1DA 1QV9A 3N28A 1JBEA 4K7JA 4R8MA 2BEJA 5DNEA 4EW1A 3VR0A 3ZE0B 1GNRA 5FH9A 2ECOA 1YQTA 4R2LA 2AV6A 2DB3A 2P69A 1RM4A 3O1JC 1IBSA 1JIXA 4FCWA 1ISIA 1E5DA 1AUVA 3C3BA 3KVVA 3IO5A 5KUTA 3QKUA 4MUFA 4Q5IA 2CMFA 4L73A 4LOAA 2O8VA 5BT9A 5J2TA 1RJ9A 3HEBA 4EHIA 1KOJA 3ZUPA 4ZI2A 1CE8A 1D7OA 2WT9A 4ZRDA 1ZJWA 2OCGA 1ZI6A 4ZVLA 3H3FA 1I2MA 4K1LA 3K0KA 5KSOA 3FZGA 3CKLA 2CXNA 5E6UA 1KYZA 3AL0C 1F2UA 2FY8A 5L3RA 2M32A 4FFOA 1J70A 3F1KA 5IHPA 3BL8A 4QJBA 4P7GA 3TT6A 2C3OA 3K9QO 1BA3A 1SQGA 2LVBA 2XR1A 4WXHA 8OHMA 1NC1A 4OCZA 3MT0A 5TMPA 2OWDA 1R64A 3CIFA 5CD1A 5KNBH 1SZJG 3KWMA 1ZRMA 2C54A 4FFDA 5EKTA 4B3XA 1KWKA 2EKDA 3Q1LA 1PJCA 3ZW7A 1ZNWA 2QTRA 5JDCA 1H8EA 3GP5A 5AW8A 3R3VA 5CJJA 4YXFA 1HQCA 1TK2A 1E2QA 3N76A 1LF5A 2QZPA 3AR6A 3C6ZA 4HLNA 4ZT4A 4JUCA 4EY4A 1C2TA 2IYYA 2VSYA 3DZBA 2KWIA 5TS2A 1EGQA 3B6JA 1PL6A 1Y9ZA 4R68A 1CJSA 4DB2A 3HR4A 1Y9DA 8LDHA 3NPAA 3KUDA 1SD2A 1GZ4A 3I45A 5F73A 3RYHA 4Y6SA 4YRAA 4KD6A 1JWAB 1X7ZB 3BK7A 1CUWA 3PDHA 3OZSA 5EFZA 3S27A 3OPYI 3UO8B 2HWYA 1V7QA 2FB9A 4WKCA 4FSXA 4XQCA 1N2ZA 4Z4GA 2PMDA 5JCJA 2ZL2A 4IJMA 1NLFA 1K68A 5GZ6A 2IP2A 1AA6A 2WW8A 1NDQA 2VR1A 1FP1D 1OAAA 2FPIA 3LY7A 2D8AA 3OUUA 4FYMA 4MIEA 4X65B 4Y9SA 1Q7EA 3MHPA 2ZREA 3IQFA 2VH1A 1C0LA 1DIGA 1XYVA 2EQAA 3NO4A 3TQQA 4WINA 4WN3A 4BAGA 1GNSA 3NHAA 2XRZA 2R4TA 5A7GA 1HFKA 2IUSA 1C7EA 1BX0A 4PG4A 3VTKA 2ZK7A 3EH2A 3VR5D 3FHTA 2O0LA 3K50A 4N40A 4ILEA 4CNBA 2ZBPA 1FCFA 2G67A 3HA7A 3B85A 5AKIA 3OURA 5CX1B 2GK4A 4BNHA 4X93A 4ZAXA 1LLUA 2HU8A 2XMDA 3CONA 3A6KA 3WIVA 1ILWA 1SG6A 1QONA 3IKMB 3AUXA 2JANA 1KVUA 4EM6A 1O87A 5KJCA 1Q44A 3L0YA 4PGMA 2PWAA 4A26A 4HGPA 1XZEA 5CPBA 3QVUA 2B25A 4EPTA 3K0FB 3AW8A 5A0VA 3WK8A 3ZQUA 4G3XA 4WXEA 1RHMA 2L42A 2C8KA 2O2XA 3I9MA 1KMIY 1JAXA 1MN6A 1WXDA 5I9NA 4ARIA 3E05A 2FSVC 3BZBA 4KMOA 5B6PA 1THTA 4LSWA 1E6CA 2A5JA 2HOQA 2IEXA 1XL1A 1G8FA 2FWAA 2CNWD 1YS6A 3LMKA 3RBVA 1KWGA 3WSTA 3QU5A 5J4KA 3IUQA 1K97A 2D1FA 4H17A 3W77A 1X7DA 5FXMA 4OAQA 2YWBA 2J45A 4CTMA 3FNFA 1LLFA 1B8UA 4TV8A 1R0LA 2I6TA 2C2HA 2JCXA 1E3SA 1WW8A 1WBJB 2NXNA 3FNRA 1KF0A 2VSUA 2ZJOA 2ZAGA 4BB5A 2BBSA 1D3AA 1EX6A 2DWOA 1DOZA 5F4BA 1I6MA 1T8PA 5G3ZA 2P4UA 1HFJA 3J7TA 2ZCJA 2DFPA 2Z4TA 3BK1A 4KPKA 2EIHA 1YH3A 3EBPA 3AUTA 5JAPA 3DBHA 3TVTA 5K0EA 4ZZ3A 2BR5A 5F2EA 3SF8A 1JTFA 4YMHA 4XWOA 4Q1AA 3H4TA 4J6EA 3RNLA 3WWYA 4N5LA 4MYRA 4RLHA 4JEHA 3PNYA 4LMAA 3RJ5A 1YJXA 1FLNA 3KLBA 4RKWA 4WLVA 4QQKA 4YHHB 1I7PA 1CUDA 1WSWA 3NH9A 4HL6A 4JMPA 3QU4A 1RYEA 5KYKA 1XMQB 3O8OB 3I73A 1KSHA 1H94A 2WIFA 1BXGB 2F1IA 3A6EA 4TL7A 3DAHA 2BM9A 2H16A 3EIFA 4JYZA 1FDOA 2VPTA 1MC5A 2IYXA 1Z5UA 2I66A 2RARA 2W2TA 3CJQA 4FLMA 4L5YA 5E7QA 4D4MA 4EEKA 3L0BA 1LBTA 4P98A 5GP1A 4EOGA 3U4GA 1EB9A 5LYJB 4LYHA 2M6LA 4INJA 4C0JA 1Y1SA 3T7JA 4J7CA 1NATA 3CB4A 5IN4A 3FCOA 5IS2A 1EVYA 3QU2A 5L3VA 1FXWA 4AY2A 1CEEA 3M5WA 2C99A 3T12A 4C03A 1OC4A 3BHMA 1SKQA 1Y7IA 2PGJA 1XMOB 4L8KA 3FVWA 2YHIA 3WLOA 5EWMA 5J5VA 3U3DA 4IAOA 4LGMA 3V4RA 4J03A 4K29A 2YWRA 2CN1A 2UZ1B 2NWQA 3EOZA 2JGDB 1GP2A 3G1UA 4JLMA 2UZ3A 1Z15A 4F46A 3D64A 2HTEA 2X0RA 3Q0JA 5D01A 3M4XA 3WWDA 1RJGA 2RHRA 3V5NA 3LW7A 3GLRA 3KPWA 2DH6A 3L93A 4FYWA 1FXSA 3W5HA 3WIEA 5KYWB 1M8PA 2VJAA 5BORA 1QP0A 3A6JA 3UBMA 1EG2A 2AW5A 1YAHA 2D13A 5A9SB 1PK8A 2RE8A 5ALJA 3B13B 3Q41A 2NG1A 4MROA 1T8YA 1S2DA 3PGJA 4REQB 4PC2A 4DB4A 3P45A 2WB4A 2Q7OE 1ZJJA 3H3JA 1C50A 1YQWA 3GQBA 3IPXA 4LDZA 2PR7A 5KWJA 1ONSA 4UFNA 1NKVA 4IXDA 4NS1A 3ZVRA 1BN7A 3LCJA 4X95A 1DEOA 2XKJE 1C9JA 1FS4A 3O83A 3I8SA 5JS7A 1E94E 2TMGA 1L4NA 1OREA 3JD2A 4PV7A 3FVRA 5AVVA 1YMUA 2J59A 5AXBA 5FA8A 3VPXA 4YQFA 4QOJA 3LECA 1SIUA 1OC2A 3ED1A 4ZVTA 5HBGA 3EGXB 5E7IA 3AF5A 4BE9A 1GTRA 3P9IA 3LUKA 3ZOZA 5CFPA 4GXTA 4XGIA 2GZRA 4FYVA 2VHVA 1RWNA 2JAWA 2UVPB 2WDZA 3NRCA 4O4JF 4JCCA 3OLQA 5TQ2A 3CE6A 1FU7A 1BWRA 2P90A 4Q4AA 1RLUA 2WMNB 3USES 3NYQA 5E3JA 4AKSA 1H1LB 1QHGA 4E12A 2HSJA 2K4MA 1A2KC 4Y7CA 2XMCA 1XMXA 2V54A 3NTOA 3WYNA 5LU9A 3NG1A 3FR8A 3BCRA 3L4SO 4QWMA 1F38A 2FRVA 2YJ6A 3IPYA 2HIGA 3UWOA 3I1YA 4A1FA 1G4AE 5U9CA 3V97A 4DLKA 1IZ9A 1Z0UA 1ZC3A 3QFFA 4FFLA 4F72A 1NBAA 2ZCUA 3M6FA 2G9RA 1J5XA 1IPEA 4MEJA 3IUYA 2V55B 1RVDA 4IR7A 1T43A 2C2YA 4QU0A 3U9TA 1HDEA 1NBME 4K6CA 4DT1A 4P3PA 3FTNA 2FSUA 2IOFK 4YJHA 5EXEA 1MJHA 5JDCC 1EP1B 3T61A 4Q16A 4M3NA 2WYWA 1CIJA 1E7RA 1SHLA 2ST1A 3CLUC 3L7BA 1VLMA 1VYUA 2FZCA 2VHZA 3CISA 3G2QA 4OHRA 3TXYA 3C6YA 4HNQA 4RL6A 2BPOA 2FF5A 4YXWD 1HNZB 4Y1RB 3JQ7B 4Q3OA 1U7ZA 2QKYA 1T1SA 3WZ2A 4DMUB 5TMEA 3PRHA 3SQXA 2OXRA 3IHLA 5H81A 3IVXA 5CAEA 2E5FA 5SY6A 3FWKA 5DO9A 3FGZA 1WVMA 5FA6A 2QTMA 1Z7WA 3LA8A 1ZL2A 2FQQA 1DQNA 5BSWA 2J5XA 4UDNA 1DTWB 1HLDA 4MQ5A 2XUAA 3P4YA 5JZBA 1A7AA 4YWHA 4CW7A 5DM2A 3MK31 3DFMA 4F0JA 5KNBA 4IKPA 4XW2A 1Z88A 4H15A 4K9LA 1X7XA 3D7RA 5HF8A 5JXIA 4HAYA 4PO1A 3ISTA 1LY1A 1RXSA 1L4YA 2HV8A 3VC3A 1DXYA 2WKQA 1N6NA 4JD5A 2Z1MA 1L5KA 3AR2A 4F86A 4RZ3A 2PG3A 3W3AD 4KI7A 2V97A 3T7TA 4Q1CA 3MFMA 3K16A 1WP9A 3H19A 1KSGA 3RV3A 4EFLA 4EVIA 1ZN8A 5J9FA 4CKEA 2FPMA 5A6SA 3W5SA 3IP1A 5JXHA 4RVSA 1Q0RA 4A10A 4ZJZA 2UZ4A 1JAYA 1RXCA 3EGVA 4MVJA 6REQA 1N77A 4WLNA 4DLTA 4MYUA 3MAJA 3ABQB 2R2AA 1GUYA 3VPSA 3NAGA 4S1NA 4ES6A 3ENKA 5AK6A 4MJLA 3E15A 3KB1A 3NT4A 4PC7A 4UDXX 3L6CA 4FMDF 1WVIA 3TLEA 4ZCSA 4ZGGA 2NO7A 1M2OB 1GSIA 4IW3B 4V39A 4UJ3A 1E9CA 3HU3A 1BXZA 3QEJA 2W98A 2R66A 3F6YA 4HWGA 1P7CA 1X14A 4MKXA 1NUHA 4MV7A 4O4LB 4EMUA 4EY5A 5JAZA 2J0SA 2JIPA 4R98A 3ILHA 2W70A 1ZMTA 1SXJA 2G04A 2W0MA 4DYVA 2ZLBA 2ZRQA 4EHKA 1O95D 4RIHA 1EVIA 1W7AA 2TS1A 1YC2A 3BCHA 5JTUA 1S8OA 1UUFA 2HBRA 2JGFA 3P9KA 1KK1A 2AOWA 1ISGA 1OIVA 1A9XB 1H2WA 2L2QA 3D2BA 3L01A 3OZEA 3PQ5A 4WY5A 2XZPA 1F3OA 3IL2A 3WQHA 2PH7A 3PEVA 6NULA 5HQ3A 4AD8A 4GPD1 1NM5A 3GLUA 1Z29A 3R9KA 4F5YA 1ZIDA 2ZDHA 1E5TA 3VUEA 1VL2A 3U9TB 1L3CA 4EARA 3Q5DA 4OD0A 2Q4RA 5JAQA 2BFEA 5EWJB 2GQ0A 5DSZA 2V5UA 3TD2A 1NTRA 1TFUA 4UTVA 2H7YA 1UM8A 1T9HA 2R8XA 5JV5A 2V6GA 3ZH2A 2IZ6A 3OFJA 4KLCA 2UZ0A 1GWNA 5CFLA 1SOMA 4DUYB 3FMOB 3WB0A 3U40A 1ODTC 1VSBA 1L5MA 5I5GA 4DRXA 3F5FA 1HK7A 1WV1A 4GOLD 3ZY4A 3D02A 1XALA 3IYLW 4HRXA 4M83A 4Y98A 5CH5A 1D4OA 4ZEOA 4ALKA 1DMRA 4E14A 3DMRA 3SG0A 2XCOA 1RIFA 3VH3A 1SPBS 3DWEX 1SVLA 1HYQA 4ZVVA 5LD2B 4GKKB 2Q5QA 1R0KA 1N36B 4S0XA 2WIBA 5EMHA 3IJRA 3SM3A 4PE5B 4JDUA 1FFYA 2XYQA 4MI3A 4UPEA 1RRPA 4HQFA 5ETJA 1YHZA 2PUTA 1FVOA 1GGKA 3GLVA 3HYRA 4JENA 3TAHA 5JJKA 1Z7BA 4S12A 3FMVA 3CXRA 3AKEA 4KQ2A 4M1SA 5JNWA 2D00A 4AIRA 4QNMA 4B43A 5B6JA 1GADO 1G8JA 3FFTA 3TINA 1CS0B 3D4LA 1M2HA 2V5AA 2HM7A 1P0CA 3EWIA 3EVDA 4NYIR 3RBXA 4EG0A 1NULA 3DMDA 4OL0A 1H3NA 4Z1MD 3SEZA 5FTKA 1PGQA 1TQ8A 1PQYA 1XQ9A 1JJVA 4HZGA 3VX4A 4DC9A 1W73A 1OWOA 2FZVA 4EG6A 1PTJA 2GZHA 1NW3A 2XNJA 1Z22A 1P75A 2HA7A 1DSSG 1YR8A 1E2JA 2PJRA 3NDPA 3AIOA 4AUMA 2JFPA 1KI6A 3L04A 2F9LA 3F4LA 3WDKA 4MQFB 4LF5B 4MRNA 2HRCA 3KELA 2DFLA 3C3MA 5CNIA 3BTVA 4NEHB 5TEWA 3SIRA 1ILEA 3WAJA 2ZS9A 3E23A 3U4QB 2Z6VA 4I55A 5K6TA 1K0FA 3C1OA 2BYTA 4NNJA 1ENZA 2RG1A 4IUDS 2A30A 1SIOA 2VOEA 2PL5A 1CB7A 1N6OA 5G2OA 1KQ3A 5L8VA 4ZDBA 2GBPA 1ZGGA 3Q88A 3RS7A 1K6EA 3N2EA 4NQZA 1NV9A 3B1VA 3KE8A 3P97A 4QFDA 5TX7A 1E9SA 4MR9B 1FDVA 4EJ2A 1BHQ1 3JVIA 4YTEA 5JY6A 1AO0A 2NUPA 2QE6A 1Z4NA 3C6BA 3PGVA 4LCJA 3SMVA 1KS9A 3EF3A 4PG6A 4IJQA 4U2EA 5BYBA 5KKAA 5DTMA 3VO1A 3O38A 1RXEA 3P9PA 4J2TA 2X8AA 1W30A 4QU9A 5E95A 2REBA 4BGUA 3I1IA 4AY5A 4ZYZA 5CDFE 1NW8A 1RHRA 5FNVB 1P0FA 1TLFA 3P0FA 3KTDA 4D6YA 1U0RA 4HCJA 2FHPA 4W99A 2WAMA 2FSPA 5JHGB 4N48A 5L3QB 2IS2A 3IDQA 3NC1C 2XUKA 4OFWA 1GTL1 4WYOB 4CIDA 1CQPA 3GEDA 4RJ2A 2P1RA 4W6QA 2V7VA 3K92A 4B3BA 4RTSA 3FPHA 4FZJA 1H6AA 4C6HA 2AI3A 2VHCA 3A4IA 2XZOA 3WK4A 5GOTA 4CMGA 4KDCA 2XRYA 3GARA 4LECA 2FCAA 3IT3A 1E2EA 3TXXA 1F8GA 3ACCA 4BO5A 5FDFA 5K01A 1QFMA 1M2KA 5DU2A 1SUCA 1Z13A 1EEXB 5A1TA 3R40A 3HBNA 5JNTA 3CFYA 3QUQA 4DUGA 1YD7A 1L8AA 3LUCA 5H9VA 2G9UA 2NU8B 4TVSA 3QPCA 3ST9A 5D3KA 3RC2A 3BE6A 3P9QA 2WAAA 3AF3A 2AI1A 4Y2YA 5AJXA 3EGOA 2DHEA 3I2YX 3SXJA 4Q3LA 1A1VA 1GPWB 5IARA 4F38A 4UJ5A 4CLXA 3G2JA 4MS4B 3T6KA 3MTQA 4HDSA 1T2UA 3F47A 2NNLD 3AH8A 3DE1X 3AERA 5A9TA 1T4DA 4TMTA 1M2FA 2W6MA 3Q9NA 4M36A 3CS3A 4PS1A 1FDWA 5TRTA 2VFAA 2OFWA 2D62A 4CEIA 5HOQA 3GLGE 1FC9A 4D4JA 1B76A 4AM8A 4JC0A 2SCUA 4PLYA 5ECYA 3D8SA 3F5SA 5LP6B 3EXHA 3VRHA 2ZIZA 3A3PA 3KB2A 4W5QA 4HZUB 2B5WA 3TS1A 4AS1A 4KMMA 4KP7A 2RAVA 3JQEA 4IIEA 2YIMA 1Q7BA 4IDNA 2BH2A 2NTYC 5LYYA 3OU2A 2HREA 4KXLA 5L7WA 3HJRA 3B1KA 1OD6A 3FFBA 1I4OA 1RAAA 4TL6A 3GA7A 1KY4A 2P27A 3MCUA 1NQAO 1PFGA 4UCXA 4YP9A 1S8FA 3URMA 1X7GA 2GN8A 3PXDA 5CBPA 3QFRA 1UDRA 1VP9A 3LQRA 3D54D 2EWVA 1J33A 1CLUA 1MGOA 3VA7A 3HGMA 3CX6A 4PYNA 1IZ8A 3G3EA 4XSHA 3FWHA 3JQRA 3GIWA 2EFCB 3MZ0A 2HRRA 3GEIA 3OAAA 4AO6A 4H7HA 5BMVA 3IT0A 3G8BA 2LW7A 2BKAA 4PYJA 5AW3A 1V8PA 2CLIB 3PR3A 4JBWA 5DLPA 3AONB 2JBAA 3JASA 5DUCA 4DW8A 4ETWA 1JR4A 4ZKDA 3TAXA 3E9QA 3WIUA 5I9LA 2FLKA 4HHEA 4MMYB 3PPXA 1JEYB 4CZ2A 3K15A 4LZWA 3WXBA 4KH1A 3U7RA 2XUFA 3DAPA 4BQRA 4L76A 1VHWA 2O2IA 4OJTA 2FAXA 4COOA 3AKZA 3ZGZA 1ORRA 3V00A 4IGAA 4I8IA 5DCYA 2VHEA 3ICEA 5DZKH 1EINA 1QORA 5BYAA 1TQ4A 2ZI9A 2J9GA 1DP4A 3H16A 2OGZA 2Y71A 3OT4A 1VJ0A 4DI1A 5H3LA 1R5NA 2Q0QA 5KKCA 1ZMBA 4HDRB 1NM5C 3PSHA 4IHJA 3L7JA 3RS3A 3NT2A 3B51X 4G5GA 1L7MA 2A4MA 1EWYA 1KZGB 1Y7LA 2RAFA 3IUEA 2F8LA 2WKPA 1V35A 3LHFA 4X3OA 1UKAA 5CXUA 2NSHA 2YJGA 3I5AA 2AMVA 4DANA 8ADHA 4M1EA 3I05A 1QX3A 3MJCA 1BFDA 3BKWA 4JN6B 4LTMA 4L7VA 4F93B 1VJGA 1ZRNA 1U81A 1NBWB 4KBFA 3TVUA 3DV9A 4HTFB 2PX5A 3CH4B 3C48A 3KAQA 4O2AA 5IPFA 3I47A 2JVJA 1SUSA 3F8TA 16PKA 1K7EB 3HB5X 5AJYA 2C9ZA 1VKOA 3F2IA 2O3TA 1WB5A 5FPHA 2GZMA 4JZKA 3LKEA 2J6BA 2CLOB 1U0HC 4R8KA 4P3KA 2OOKA 4WQMA 1DBWA 4XJVA 3UV3A 4B6GA 3KQTA 4BGEA 4D9JA 2DERA 4O5OA 4BX3A 3EYWA 5CT5A 3NEAA 4OMRA 5CB6A 1BE8A 2C94A 3B1WA 4HNAB 2P8SA 2FP4A 1BX1A 3LY9A 3RRFA 3RVQA 1Z5PA 4JB2A 2H9AA 1VE1A 2CUTA 4TKUB 1JA1A 4E6EA 4GOMD 5I9IA 1XELA 1JE1A 2H17A 4M1YA 1JH9A 1CEYA 4WVLA 1X13A 4A8JA 4LQ4A 3LF2A 3B1ZA 3UN1A 1OU0A 1SBIA 1TDJA 4KQ6A 1DQSA 4PZ0A 5A71A 1IQUA 1NUSA 1FQJA 2VA9A 3A1EA 4PYMA 3X3HA 4EJSC 5BV2P 4W5NA 3EZ2A 2QR5A 3ZDCA 1Y9JA 5H0IA 5E4TA 2VP3A 2AC7A 4ZQEA 3SXUB 3OTHA 2H29A 3DNPA 5BUSA 1E3WA 5HWSA 4JBNA 3PXCX 1PTJC 3B9RA 3VR4D 1DELA 1W581 4EH1A 1K7XB 3ZCSA 1Z6AA 4N6OA 4KPFC 1DQZA 1SZOA 3BQ9A 4FQ7A 1M8GA 3QTBA 4ZOLF 1B0AA 2NV0A 1L7PA 1R8JA 1V8DA 2PH1A 5TDHA 1N3YA 3GRAA 5D87A 3VTAA 1JLKA 2O8FB 1YKSA 2HBZA 1Q91A 1A9OA 1PDOA 1P6QA 4IDFA 2I7XA 3S2GA 4MARA 4BJ6A 2CE2X 1NASA 5K09A 1L4MA 2OZPA 3ORQA 3RRBA 4YJGB 4DXAA 4Z7QB 1HXHA 4RTMA 5ED0A 1OBHA 1BH6A 3H9GA 4OYLA 1SQSA 1UJ4A 3DZKA 1OXBB 4YCJA 3E2IA 3G0IA 4FOSA 4UVEA 1D5WA 1M34A 2HPHA 3CO5A 4E15A 2HMTA 4RABA 1U8YA 3VZCA 4LFBB 3RVDA 1G6KA 1ZNZA 4MSUA 5MN5A 4MGZR 1IAQA 2IZ5A 1EDBA 1K3FA 3IQDB 3HCNA 3RSCA 2D1SA 5CLIA 3OTWA 2QMUA 5IC6A 3A2NA 3V8MA 4DJAA 1H4TA 5JQGB 1YL5A 3TRRA 5F64A 1JG2A 5K6RA 2GTPA 2VCHA 3C6XA 5ULLA 1XP8A 4XKJA 1SQFA 4YNBA 2C1XA 4C4SA 4DZTA 5BN3A 1YDMA 4KX5A 3TD6A 4HQLA 1N7GA 1V95A 1W4CA 1Y7TA 3G8DA 4Q7LA 1XF1A 4YECA 1YI1A 5I48A 1T3TA 4KHZA 4TLDA 5E6RB 4CIXA 3GPCA 3TXAA 2X8WA 5A5DA 5HFJA 4Q21A 3T3MB 2XE7A 4FHGA 4A4DA 3OFSA 3RASA 3DJFA 3L8FA 1SKAA 4FI3C 1ZVJA 4H08A 2E82A 4FR0A 4JKOA 1BG6A 4N1AA 1QE3A 1QQBA 3TR6A 3IMFA 3QBTA 4F7DA 2WU1A 5KVAA 3O9ZA 4GLOA 3ZY5A 4IZBA 3O9MA 1JDBC 2F3UA 3K1TA 2ECQA 4JJFA 2FTKE 1YJBA 2I6FA 3O1HB 3DDWA 4NEKA 2NAPA 3MWEB 2FUG6 5H16A 3L8EA 5AW5A 1WCWA 3EXEB 3OZIA 3Q5EA 4IO1A 3VR6A 1G4UR 1NPDA 3GA0A 3ZV5A 3EXIB 4GPEA 1DAFA 4R3NA 3FCCA 3C97A 4ACAA 1GGEA 4OI4A 2H8KA 3C8HA 4R0VA 2DFKB 4TV9B 4E5YA 3DVAA 3GUCA 5DU8A 4C5AA 3SEAA 4RK5A 3HVHA 3TZKA 3V8VA 1KAQA 4B4DA 1L7EA 4BHTA 4MPJA 1JSXA 3N39C 1QGYA 3FB1A 4X0EA 1KJWA 3H5LA 3BB1A 4Q01A 1S3SA 4N8SA 1RKXA 2FN9A 3MWJA 3NHJA 4LJ7A 4UXJA 4W4TA 4WT7A 5DN9A 3E9CA 4EAAA 4U2CA 1KEPA 4KMSA 3ADPA 1Y4ZA 4L4SA 3CTVA 1INLA 2HJVA 4KO2S 5AH0A 1TA4A 2ZBVA 3N75A 3DEKA 2A0UA 2JFFA 1X6VA 1R4MB 2LKCA 5G4KA 3N8IA 4YLGA 1R5JA 3RS5A 1I80A 2WT8A 2YDXA 3SQNA 2O8EB 1XRJA 2QLNA 5MGNA 2EHJA 4FEEA 4KAXA 1WEKA 4OKIA 4W8GA 3G6WA 1RI3A 5A3RA 3OT1A 3P9RA 4KOAA 3LRPA 4JJ7A 1GHTA 1C8BA 3QFTA 2ZXEA 2IUTA 4D41A 1JTEA 1E6WA 5HIIA 4LJ6A 3TGWA 4B85A 3M9XA 1E9BA 1O96B 5L3SA 1G38A 2W2QA 1NP3A 3IBTA 3ZHYA 2C59A 3S7ZA 3GLGB 3TKAA 2BONA 3QE2A 3RVKA 2E5WA 1CCWA 1XCGB 3ER6A 4YDRA 3D8TA 1XNVA 5E1OA 2B6HA 4C0LA 2VYQA 3D6MA 3LTNC 3ENNA 2Y0PA 3PA6A 4LV5B 3RUIA 2X2PA 3K1JA 3JQFA 1R18A 1O6BA 4UCFA 4TXJA 5JLAA 4WLOA 4CMAA 2R6HA 4U8HA 3E70C 3GT7A 3GGGA 2R8OA 4FIZA 1YRAA 4I4CA 5JO9A 2NO1A 5J63A 4RVOA 3MT9A 4BMDA 1OT5A 4RTQA 3AEQB 4AU1A 1KEKA 4PCVA 2ODBA 3G9UA 1E66A 4YUWA 5JYEA 2PMKA 1HTTA 4BX2A 5HCNA 5I8ZA 1PT9A 3COYA 1N5IA 1KBQA 3V42A 2VNHA 1P4HA 3BSYA 3KSUA 4I66A 5FTMA 3S0JA 4OAPA 1DAKA 4WZAE 4PBTA 5GMOA 3U3RA 4B45A 5HM8A 1A88A 1NQTA 4MV1A 3S2EA 1RKQA 1BVHA 4C7VA 4F92B 1WSBA 5HCUA 1OY1A 1AOXA 1ZGAA 2V4ZA 3DDSA 1ZSYA 3PF9A 4QGHA 3K0BA 4YMSA 5PNTA 4FTWA 2C7OA 1MDBA 4RTJA 1MA0A 4ETMA 4EPXA 2NUBA 1OLUB 3FDXA 2JA2A 1YTLA 1P7WA 4G5RA 4YMWA 5DZKA 4YAGA 1S5PA 3AI7A 4LXGA 1Z2OX 3BE8A 3F73A 1UBCA 3Q9SA 4JLPA 4GEGA 4JLWA 3F7NA 2I55A 4BQOA 1XB2A 2J9ZB 2X58A 1Z5GA 1G8PA 3AKYA 3GFRA 3LW8A 2OR3A 1NXWA 2QQGA 5D8DA 3FFXA 5AVZA 1Q12A 4IOLA 4MAMA 4OF4A 4BLVA 1O77A 1RHQA 2OL4A 3BOSA 5AKHA 4L9RA 1NN0A 4K9KA 1RRFA 1RRMA 2QN6A 1UIRA 4A8JC 1CZLA 1ZESA 3E9NA 4I9FA 2ICAA 4LHVA 3CIOA 4UVDA 5JNRA 5KCZA 1K6JA 2RHDA 3VNSA 2UUBB 4ZYWA 2QNBA 1NNLA 3C3XA 1ISPA 5I45A 3GNLA 1WDLA 4JJIA 3EJ6A 1P9OA 2CL7X 2XE8A 3ON5A 4S2EA 1KYIA 2WJYA 1CVLA 3P27A 4EF6A 5CITA 5E0SA 3SLLA 4Q3AA 4JJTA 3TNDA 3THRA 2MOKA 1CFJA 2MTBA 1S2NA 1KQGA 5FRDA 2HK9A 3AU8A 1CEXA 3LBIA 1QCZA 2YJ4A 4JDPA 1TKCA 2EKZA 2YXNA 4Q9LA 2FZSA 2DKOA 4FOOA 5AVQA 1EF9A 4LKOA 4UVGA 1FFHA 3TOXA 4UUPA 2BEVB 3IE1A 3DLTA 2YJ3A 1W93A 3EG9A 5H3CA 1T5DX 4A91A 3NRBA 4H3VA 3OUTA 3BK2A 4CI9A 3M4NA 3RAEC 2FSIA 4JJKA 1XXHE 3DPIA 2ZL0A 2IS1A 4RL4A 2FWMX 3T06B 1U98A 1LS6A 4BNMA 1IHDA 1N6LA 4B83A 2ZB4A 4JHLA 1Q51A 3FOZA 3TLAA 2ZBEA 4LKRA 4UZSA 4D80A 3N3AC 4Z2AA 4L4YA 2VBCA 4C7MA 4KO3S 3X2SA 4E4RA 3NATA 3UJDA 4C4PA 1N1GA 1JWBB 5EJ4A 4IMIB 1MJ5A 1ZWKA 5IMSA 4EUSA 2BN4A 3G7UA 2FEAA 5CVUA 3IXQA 1N6RA 4OQYA 4Q39A 2ZWAA 5ALOA 3U3XA 4QUHA 3VDNB 3ZBUA 4F12A 2A4KA 2NU6B 1A8HA 2Y1GA 2ZI4A 3KJNA 2E5LB 4TSRA 2CCJA 1KO7A 3PEWA 3RTEA 2AZMA 3K2IA 4ZT7A 2X2OA 2V8BA 3C3AA 1FYWA 1TQ6A 2CSUA 2XD4A 4F91B 1CUCA 2VJDA 5F78A 3KQPA 2X0EA 4BTLA 4EKYA 2X2FA 3TJMA 3HCEA 4C0WA 3HCFA 1WDTA 2ZSDA 3IO3A 2QD2A 1YONA 5CJPA 3A3NA 3PGMA 4KDEA 1PS9A 2H1SA 2OG2A 2WG2A 4FNAA 3EAQA 3P5MA 1I5EA 1HG1A 3AJAA 3T1YB 4FYJA 2I6XA 2ADFA 1TMYA 1EBFA 2JFVA 3KTAA 4IS2A 3TTSA 2QMEA 1D04A 3O31A 1SKUA 4LNHA 1ZW6A 1DC4A 3R7FA 1GVHA 2PYZA 4ZOAA 4MVJP 2Q9CA 3C4VA 2ERXA 3H87A 3KQSA 3L4EA 3PE6A 2JJQA 4HP8A 1T25A 4HTAA 3ZLUA 3QZUA 3RHFA 5I7AA 4D9MA 1YZFA 1AG9A 1LC3A 4CMEA 4OXXA 5AKKA 3O26A 1PE0A 5G0SA 3PT9A 1S1MA 2IODA 3AF0A 1ZOPA 2J7KA 1I3NA 5LR6A 3T95A 3LJKA 3BA6A 1JFSA 2CLMB 2VEOA 3IKTA 3OVMA 3G2LA 3GXBA 3ANTA 3LUBA 3WGNA 2CV1A 1QYWA 3BHIA 3LYLA 5LXTB 3BICA 4A2CA 2CD7A 2CEKA 1F14A 1Z2AA 2JGJA 3B1XA 3KYDB 4RUKA 3T9CA 4KGVA 3WI7A 5BYKA 1NZYA 5IBPA 3G17A 2VRCD 2ADOA 1H2RS 1KU6A 3Q7TA 2J41A 3A37A 2ZS8A 4JOCA 5FO1A 3W2EA 1CY8A 2CY0A 2OHGA 2QUKA 3DOJA 2BEUA 4AI6A 4W1PA 4ENWA 1CY1A 3R3WA 5EPEA 2VQSA 4M9UA 3V4SA 2O7NA 4PN3A 1FUIA 4DJDC 1GAJA 3SC4A 1EGAA 1TAQA 1WPRA 1GARA 1Q14A 2DLCX 1BCSB 1G5PA 4MRSA 4Y1GA 3GLQA 4O2LA 3SS7X 4D8XA 1TYFA 5FPPA 4JI7B 3W5UA 3AP2A 2C84A 3ISVA 1POWA 2FCRA 4KUEA 4M37A 4M1OA 1UKBA 4N5HX 1BC5A 1UMBA 4U2DA 5C8XA 4KVAA 1BA2A 1P4JA 4GWGA 4UUQA 5KB3A 1RXVA 2P0AA 4R41A 4BX8A 5JZVA 2HI0A 3BWCA 5EMLA 5L4NA 1XV5A 4BNZA 3QSGA 3KOWA 1JG4A 3VAYA 5AI9A 3W6UA 2QUAA 4HLUC 3DDHA 1WVGA 3R3JA 4J90A 4P4UA 1F20A 4UNSA 5BQ5A 4KWTA 1N5DA 2P2ZA 2PCLA 4EGQA 5K8TA 3KV1A 2IELA 4FYIA 4PHFA 2D5AA 3KB8A 1UJMA 1QQ7A 4BUCA 2IYAA 1RXYA 2P79A 2QMHA 1VG0B 4B32A 1QYDA 4QQNA 1KJJA 2QENA 1NN1A 1K88A 1YXMA 4E1AA 2JI8A 4F8JA 5B2FA 4JBIA 3V80A 1KH2A 2Y0DA 4RANA 3JQFC 4RHTA 2YC4C 4NATA 2LIVA 2ZIXB 3L9WA 2XKBA 1NQXA 3TE7A 1IN1A 1GPLA 4FD2A 2XOKD 3OF3A 3NOVA 2Q1YA 4NENA 3PUJA 2FWPA 3KQOA 5BQ3A 4DC1A 1P2VA 4XVHA 2MYNA 3EA5A 3UMRA 1Q3KA 4TT8A 1GT6A 1S4MA 1NJ2A 2R8YA 3QEMB 5GJWC 3T9AA 1NLZA 4KXYA 4AMBA 3WMFA 1YOVB 4WX2B 1U0NA 2VDQB 1D6NA 1K7SN 1AKWA 1S7CA 1QG6A 3TW8B 1D1PA 1XGKA 1CDEA 1ZM7A 2B3TA 3CWZA 2P2GA 1JGTA 3DZGA 3EFOB 3OFNA 4BAUA 4C89A 4RD2A 3KEFA 1T3SA 4RYFH 4LQCA 4JV5B 3V2HA 2HY7A 2F59A 4HKTA 4H1HA 3T1QA 1I1OA 2BGLA 2ZP1A 1IPHA 2PQMA 2X3YA 2YWFA 4G1BA 1N4AA 4AZ0A 5CCXA 4LWOA 4EHAA 5KWEA 3DHEA 1RWBA 4BKPA 1HA3A 3RC1A 4NKRA 3H0KA 2O3UA 4F60A 2H2DA 2IXAA 3VSCA 2ZEJA 3AFNA 1C4XA 1T3LA 2UZIR 3MAAC 4HDOB 4LZAA 2UYYA 1XMJA 2YVKA 3L0SA 5FOXA 1X7ZA 3IDZA 3M0EA 3WK7A 3I9V6 1YDGA 2FRDA 1JF8A 3GEHA 1E3TA 1SJ9A<