3ZW8A

Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) in apo form
Total Genus 277
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
277
sequence length
725
structure length
725
Chain Sequence
b'PRGSHMAEYLRLPHSLAMIRLCNPPVNAVSPTVIREVRNGLQKAGSDHTVKAIVICGANGNFCAGADIHGFSAFTPGLALGSLVDEIQRYQKPVLAAIQGVALGGGLELALGCHYRIANAKARVGLPEVTLGILPGARGTQLLPRVVGVPVALDLITSGKYLSADEALRLGILDAVVKSDPVEEAIKFAQKIIDKPIEPRRIFNKPVPSLPNMDSVFAEAIAKVRKQYPGVLAPETCVRSIQASVKHPYEVGIKEEEKLFMYLRASGQAKALQYAFFAEKSANKWSTPSGASWKTASAQPVSSVGVLGLGTMGRGIAISFARVGISVVAVESDPKQLDAAKKIITFTLEKEASRAHQNGQASAKPKLRFSSSTKELSTVDLVVEAVFEDMNLKKKVFAELSALCKPGAFLCTNTSALNVDDIASSTDRPQLVIGTHFFSPAHVMRLLEVIPSRYSSPTTIATVMSLSKKIGKIGVVVGNCYGFVGNRMLAPYYNQGFFLLEEGSKPEDVDGVLEEFGFKMGPFRVSDLAGLDVGWKIRKGQGLTGPSLPPGTPVRKRGNSRYSPLGDMLCEAGRFGQKTGKGWYQYDKPLGRIHKPDPWLSTFLSQYREVHHIEQRTISKEEILERCLYSLINEAFRILEEGMAARPEHIDVIYLHGYGWPRHKGGPMFYAASVGLPTVLEKLQKYYRQNPDIPQLEPSDYLRRLVAQGSPPLKEWQSLAGPHGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PEROXISOMAL BIFUNCTIONAL ENZYME
publication title The Isomerase and Hydratase Reaction Mechanism of the Crotonase Active Site of the Multifunctional Enzyme (Type-1), as Deduced from Structures of Complexes with 3S-Hydroxy- Acyl-Coa.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 277
structure length 725
sequence length 725
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.50 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3zw8A03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3zw8A02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3zw8A01
1H6BA 3JQAB 4DYVA 2O2YA 1FCFA 1G1AA 1V9LA 3DDNA 5A9RA 1CDOA 4Z3DA 1E3IA 1M2WA 4DLLA 3UAGA 1Q2XA 2XF8A 3WWYA 4IDEA 3DL2A 1G0NA 3GUYA 4NFYA 3RU7A 3TRIA 5G4LA 4R1TA 1UXHA 4U6QA 3WICA 3KTIA 4LRTB 3BTSA 2YZ7A 2HMUA 1X1EA 4KDEA 1P1FA 1WWKA 4MIOA 2W2KA 4RORA 4DQUA 2G1UA 4AJJA 3IB9A 1GZ6A 3AFNA 3GFGA 2JFFA 1LRJA 1CYDA 3U4IA 1T1RA 1F0YA 3M1AA 4CQLB 3P19A 2VRCD 4IY1A 3I1JA 1Q52A 4GQAA 1Z6ZA 2O3QA 1RJWA 4XJSA 2GN8A 3IKTA 3W4JA 4OAQA 1JU9A 2GD1O 1ZK4A 2WSBA 1SBYA 4DREA 1YQDA 4GX2A 3F47A 1HRDA 2NWQA 3WLFA 4U0KA 1YS4A 4A0SA 5L7WA 5JMPA 1UDBA 1E6WA 1PQPA 1KY4A 5IZ4A 3WGZA 2I76A 3K9QO 2Q45A 4B7CA 1C0PA 2ET6A 2HUNA 3V1UA 3EAGA 1KVRA 3CH6A 4B7XA 3JQ9C 2YDYA 2PH3A 2WYUA 3GOHA 3JQFA 4ZU2A 1E6UA 3VPFA 2J3HA 3FTNA 3H3FA 1XNWA 1A71A 5KVQA 3P85A 5B37A 2CF6A 1T2FA 3WNQA 1J6UA 2YV3A 4YAGA 4YRBA 4ND4A 5LCXA 2FR8A 2HJRA 3RFXA 2EP5A 2EERA 4G2RA 5G2OA 1UDAA 4TRJA 3M6MA 5L40A 2VOEA 3BTVA 3S2EA 1KOLA 5L53A 3IUPA 5I8ZA 1V3UA 1BXGB 4BKRA 3WR5A 5IDYA 4MINA 1OMOA 2DFVA 1LDNA 4IPTA 3LAOA 5DTWA 2EW2A 1B2LA 4WUVA 1EDOA 2X6TA 3ZW9A 5G1SA 3LU1A 1E7RA 5ER6A 3F9IA 2GN9A 4XWYA 1DIGA 2JHGA 4HP8A 3WLEA 1PJHA 3OICA 5CEFA 1CQJA 4N5NA 1Z45A 4YJHA 4G81A 5G0TA 2JL1A 4ALLA 3VHRA 1B7GO 4D0SA 4JJIA 1UXGA 1CERA 4I9UA 4WPGA 4XYMA 3W6UA 2CVZA 3DBRB 2J5GA 4F6CA 3GRKA 2W4QA 4ZDFA 1DRUA 1D1TA 1VSVA 2Y1CA 4IM7A 5MGBA 4A5OA 3F5QA 4DTIA 3EK2A 1ENYA 4J7CA 1XYGA 4RPHA 2ZYGA 3IIEA 2X7HA 3B1KA 4EEXA 3ICCA 2IEDA 4E5MA 1DC6A 1TXGA 2Z1MA 1LU9A 5JXWA 1NZYA 3DBVO 4CM8A 4ZD6A 4FGSA 4FIZA 1PGOA 1XSEA 2EV9A 3RCBA 4J9VA 4EW6A 4FFNA 3O8QA 2RBEA 1HYGA 3BMQA 1LQUA 3C3XA 4RDIA 4YT8A 1YRLA 2AE1A 2ILTA 1UJMA 5C9GA 2GASA 4OYRA 3A9WA 4U19A 1HNUA 3HSKA 1HYHA 3GGPA 1PGQA 3JD2A 1LC3A 1W0CA 2Z5LA 4CMKA 3GA0A 1VJ1A 3D3EA 1SB8A 3TPCA 3NJ8A 5A9SB 4B8WA 1BDMA 3KETA 3GLMA 2FY8A 1HE3A 1HT0A 4H16A 3PVZA 3INGA 1DC5A 2BFOA 3JD1A 4E32A 3W4KA 3OETA 3QLJA 5TC4A 1E7SA 2YW9A 3FPLA 2OP1A 3IP1A 3HB5X 3EDMA 3DBLB 3ETEA 4M54A 3C7DB 2YYYA 1UR5A 2O7SA 4YJHB 1ULUA 3KM0A 4HV4A 1D1SA 1IYZA 3MFMA 3PDUA 1KVTA 5MDHA 5C37A 1ENZA 4ZU3A 2G76A 1QLHA 4ITUA 1AXGA 1W8DA 3W6ZA 1TA4A 2D2IA 5THKA 3DWFA 4PVCA 1XU9A 3BTOA 1NR7A 4BO7A 4DMLA 1KC1A 4PGFA 1IOLA 3JQBA 4XQCA 1NZYB 4RVSA 1N6FA 2WM3A 3RSIA 4PIVA 3RVDA 3WGQA 2Q4BA 3NT4A 4LK5A 4BNKA 4YWJA 1HSOA 1SG4A 4ND5A 1EFLA 4WOJA 3WGOA 4II3A 1DIRA 4BQPA 2OORA 3SVTA 1C1XA 2B4TO 3OJFA 4EBFA 4II2A 3KBOA 2HK8A 4TROA 3INTA 4W99A 2O4CA 2O3JA 4Z0PA 2OP0A 5DZSA 1ZO8A 2YHIB 3CSDA 3WWZA 3TZ3A 4JWVA 5COQA 3R9QA 6LDHA 5DCWA 2BD0A 3HJAA 3VH1A 4ZICA 4Q9NA 4YBZA 1MB4A 1XGKA 2HMTA 1ZNQO 3NDIA 3ORFA 1OOEA 2VHYA 4RF2A 1QYVA 1ZSNA 1B8UA 1IZ9A 1R15A 3DTYA 4TRNA 4YQZA 4FW8A 1HDZA 2HQ1A 4HFNA 3AOEC 4RL6A 1YJQA 1JVSA 4UEJA 2X58A 3TLFA 5G0VA 2C7VA 3IAVA 4JP3A 6ADHA 2GN4A 3A14A 3ZHXA 3T89A 1K3TA 4I8XA 3V2UA 4DC0A 3H02A 2Q1TA 1ZJZA 1ON9A 3Q6IA 3D5TA 2WD7A 3H2SA 1ENPA 2VZ9A 2Y0DA 5ITVA 2PLAA 4OMRA 3GEDA 2CFCA 3QRWA 4J4TA 1ISMA 2X4GA 3QWFA 4UVGA 3I9JA 1HF3A 2C5AA 3VC7A 2DLDA 5BR7A 1F14A 1GPDG 1HDYA 4D42A 2Y99A 3HLN1 3R3SA 3N74A 3EYWA 4GSLA 5JCJD 2ZL3A 2EGGA 2EXXA 1DJNA 1JAYA 4CLOB 5HS4A 2PZJA 3Q7HA 3GVCA 3ZNOA 1WAMA 3LDHA 4IZDA 1K6JA 3W1VA 5DF1A 3A06A 4FPXA 2Q2WA 3R6DA 1Y7OA 3HE3A 1R4MA 3WG5A 1V8BA 3WIDA 3WMWA 2CDCA 4AFNA 3E9NA 4KTTE 2CMDA 4JN6B 1ML3A 1ZW1A 3EMKA 1PTJA 3HFSA 3F1KA 2O7QA 3NYWA 2XXBA 5CG2A 1EF8A 4F46A 1PJQA 1O6ZA 2EW8A 4J16A 4JGBA 3PQEA 4CMEA 5A9TA 1J49A 1ZMOA 2B35A 3E5MA 4MVJF 4CPDA 5AQ1A 1T25A 3MOYA 2HSDA 1GCOA 4BKQA 5GZ3A 2QRKA 4KOAA 2VUTA 1DHTA 4Y6RA 4DQXA 3FR7A 2EEZA 1BG6A 4ZQGA 4ELSA 4RPJA 2ZTUA 4FFPA 2HRBA 1K6XA 5U4QA 1LSJA 4GL4A 4R4JA 4BMSA 3DMTC 5G4KA 2C82A 4JCRA 5CTCA 5IN5A 3RD5A 1BDBA 1R12A 4XDZA 2D5CA 4O6VA 3TT6A 5BSFA 1VL8A 4O5OA 3R1IA 3GVIA 3KVOA 3H9QA 5E0NX 1E77A 1N1GA 4YEDA 3HINA 1SZOA 1BW9B 1JVBA 1Y9AA 4W9NC 5IJZA 1QSGA 2UZFA 1DC4A 3SXPA 3HHPA 3ONFA 1Y5MA 3L9WA 4TVOA 4XGIA 2D0IA 4BO6A 1U3VA 1QYDA 2NTVA 4IDFA 4IDBA 3C1AA 4WNIA 4M55A 3MJCA 2HCTA 5CEJA 1H2HA 3U9RB 1MFPA 3IOYA 3VZPA 4J2HA 1UXIA 3TDKA 1PGNA 3I9MA 1IB6A 1FC6A 1YBMA 2BFMA 1UDCA 3EZYA 3WGIA 1UAYA 2A92A 2CE3A 2P9EA 1CJCA 1MXHA 4XYEA 2VSUF 4B4VA 1NNUA 4Z9FA 3PGJA 1DEHA 4UREA 4FDAA 3VPHA 3AU8A 4D3FA 3L77A 3OA2A 4MVJM 1N2SA 1RJNA 4UULA 5I9LA 4NMHA 1K6IA 1EY3A 1DAPA 1P31A 4BO0A 3DONA 5AYVA 1PJ2A 5JDCA 5CTBA 3QVXA 5J23A 3RC1A 2EG9A 4HX5A 3E03A 5F5NA 1E3WB 1A5ZA 3PZKA 3JD0A 4XIYA 1V3VA 2I5PO 2BFPA 3KUXA 5G4KB 5THQA 4PZDA 5KOIA 1HLDA 4BOYA 1HDOA 3HDJA 4KPKA 5DP2A 1EUZA 1UYRA 3DAPA 1MUUA 1N1EA 4MOWA 1I3MA 3RKRA 2Q2XA 5JBXA 4BMNA 2JD2A 2V6MA 1JKIA 3FSRA 3GQVA 1E5LA 4E0BA 4HFMA 3ZWCA 1Y9EA 4IDDA 3WOHA 2NACA 3U09A 2Q50A 3JYQA 3MT6A 4C7JA 3GDGA 2ZATA 1VRGA 2VN8A 3RI3A 4MP8A 1MG5A 2CUKA 1YG8A 1CF2O 1E1NA 3M6NA 1GUYA 1A9YA 4YT2A 3KYCA 4ZRNA 2CVOA 4C4OA 5A5EA 5B12A 4CM4A 4CLXA 4U7WA 4KQXA 4E13A 5KJFA 2ZB8A 3E8XA 5EQDA 3Q0JA 1U2DA 2Q1WA 3H0QA 4HNGA 3DEYX 3EY4A 2F9IA 2IZZA 2FR1A 1ZH8A 4PRLA 2VCYA 1VC2A 5DCUA 4E2ZA 4PLVA 2D5AA 1U5AA 3BMOA 1Q7BA 4D3SA 3L07A 3WFJA 5LDHA 3DHEA 5FYDA 4KTVE 3LK7A 4ALIA 4A2CA 3ZZNA 3E5RA 4ID9A 4L4XA 1OFGA 2RHCA 4EUEA 1CEQA 3TZ6A 2P9CA 1LA2A 2FP4A 4ZQHA 2H63A 4MPDA 2GZ2A 1I10A 4ALKA 4CUKA 3ANNA 3EUWA 1GDHA 3PJDA 1KBZA 1SNYA 1RM5A 1V0JA 3O4RA 1YGYA 4PCVA 4R3WA 4XGNA 1D8AA 1E1LA 3TVWA 4IXTA 1TLTA 5L4SA 1YH3A 4OXYA 2C07A 4RQUA 4EJ0A 3FF6A 4JCTA 2QG4A 4OJNA 4Q3AA 4JYLA 1YOVA 4RPKA 3KTDA 4CL3A 3D1LA 3QXIA 1KEVA 4RVFA 3O9ZA 1PR9A 3WYEA 3QWHA 2X22A 1AE1A 4PLYA 1U4OA 3ZWVA 2DT5A 3UUWA 1Q51A 4HNKA 2HMWA 2Y1GA 3BIOA 2EP7A 3JQBC 3H0JA 3KYCB 2CY0A 3TNLA 4KZPA 3U49A 1ZBQA 1E3LA 3L6EA 1ISIA 3FNGA 4GKBA 5DNAA 3ONEA 5T8KC 3NJDA 5LC1A 3AW9A 1I24A 3VPSA 2Y93A 4QEDA 3MCVA 5L3ZA 4LVUA 5HTOA 1P1JA 3TOXA 1TT5B 3ROPA 2RHRA 3I6QA 3DZIA 2P68A 2O2SA 4PLHA 1QMGA 3NX4A 1WDKA 3Q0EA 5B4TA 2J5QA 3ZV4A 5L4LA 3N6RB 1FMCA 3BMOB 5KJCA 3MOIA 4DLAA 2H9IA 4XRGA 4AJOA 4KDFA 4IIVA 4BVAA 3CINA 3OIFA 3LT2A 1TB4A 1E7WA 2NU7A 4J1TA 8ADHA 1ZKMA 3ZU5A 4D46A 4FJ1A 2QQ5A 1NQTA 5KVSA 2HMSA 2XXJA 4U18A 2WTBA 4ZDDA 2Y67A 1CIVA 2ZB3A 1DXYA 2Y1DA 3C85A 3AWDA 5DKPA 4AJHA 4AJNA 4XKJA 3OSUA 5CFZA 5DP1A 4MVJD 3WSVA 1J5PA 5T64A 1MJ3A 1P1IA 1TG6A 2ZIZA 4OM8A 1U3TA 3U3XA 1XQ6A 2V6BA 2AQKA 1H94A 2C2YA 4B3IA 3LYLA 4KWHA 2Q35A 1GQYA 1LC0A 4IS3A 5KWEA 3I4CA 2A81A 3NGLA 3GNTA 3DBHA 1Z82A 3GZNA 4INAA 5T6BA 1SEPA 2GYYA 2ZL4A 4UUOA 2O23A 5DUCA 1VKOA 2CDBA 1YB1A 4EMLA 4MJLA 1JWAB 1VLLA 4EYEA 4E12A 2P2SA 4FR5A 1ZK0A 1ZEJA 3LQFA 4BNLA 5EPOA 3WSWA 2FBMA 1Y8QB 5HBRA 2GPTA 4U1AA 5IAAA 2VSSE 2VHVA 1XCBA 4YLHA 1UZNA 4U8GA 4CR8A 2QZ9A 2VTEA 3E18A 3VH4A 1FDTA 4BMVA 4ILKA 3D64A 4CMEC 4FFMA 5JC1A 3A4VA 3AM3A 4R5MA 3Q0GA 3IDSA 5JLAA 3BHIA 4JJTA 1LX6A 4ZHSA 5GZ6A 1H5QA 1O8UA 4CLDA 3H81A 2BRUA 2IEBA 3HWRA 2YFQA 1GTMA 1NM5A 1NQOA 1D3AA 1ONPA 3DC2A 4UUPA 4R9RA 5CDTA 1FC7A 1H93A 3LZ6A 2J8ZA 3QMJA 3WQQA 4PZEA 3C24A 3DOOA 3KZVA 1SMKA 3GHHA 3KSZO 4IBOA 5ICSA 2GERA 3BTUA 1WP4A 3K73O 4KUGA 4QX6A 4YJGA 2DEOA 1P1HA 3SC4A 3DMYA 3DFZA 2QRJA 3PJEA 2FMUA 4K2NA 4Z9YA 4ZVVA 5HRUA 2QW8A 1O8CA 3B1JA 3H7AA 3GT0A 3UCFA 2GTRA 3RRVA 3UN1A 4P4GA 1UP6A 3NJBA 3D4OA 2Y1FA 3S2FA 1XNYA 2J5SA 3PZRA 5A3JA 1HDCA 5JY6A 3DBHB 1B3RA 3GHYA 4NR0A 3IBBA 2Q1SA 3KSDO 1P0CA 3C1TA 3GFBA 2W8ZA 2HAEA 4NK5A 3Q2IA 3LSYA 3DOJA 1OD2A 1R37A 4Q3EA 1PS8A 4MKZA 3L4SO 3IJRA 4I9HA 5DU8A 2D59A 2DM6A 1XWFA 1Y7TA 3UKOA 1ZZEA 2YFHA 4G5HA 3VZRA 4IDCA 3PI7A 4E3ZA 2BH9A 3H5RA 1M6WA 4BO4A 3ZNNA 5JCJA 5FIFA 5INGA 3F3SA 3WGGA 4HWKA 1GZ3A 2E4AA 2VHZA 1QYXA 1XO6A 1KEUA 4ESOA 4AJLA 1GYPA 3Q2KA 3TL3A 5DCYA 4CLEA 3OMEA 1OD4A 1DIHA 4CODB 2EJWA 3P7MA 4FGWA 3JQ8A 4RGBA 1LLDA 4R01A 4BL5A 7ADHA 4OSPA 3L3SA 2BFAA 5JDCC 5TNXA 1DFIA 3RUAA 4NNJA 4ZJUA 4NIMA 3F4BA 2O4UX 2FZWA 1LDBA 2E49A 2W98A 4WGGA 3WXBA 4LGVA 3V5EA 3RROA 1JWBB 3Q1TA 1I0ZA 1C0KA 1YQGA 3T88A 4FQ8A 3G3EA 1ON3A 4EGFA 3RUEA 3PDJA 5K6AC 3UHAA 4NFSA 4YR9A 2Q34A 5FI3A 1H6AA 2VWQA 3E9MA 2G82A 1C1DA 3AFMA 3DO5A 3ETDA 4URFA 3BF0A 1KERA 3NDJA 1VKNA 4PVDA 5JDIA 2X0NA 2Y1OA 1A27A 4EEZA 2DBVO 1EBUA 5I9MA 4I5EA 3L6DA 1PGJA 4XX0A 1SB9A 4J4BA 4GVLA 4JCSA 3PLRA 3GAFA 5G1RA 3QK8A 3D5QA 1HETA 4CMBA 1J4AA 3CXRA 5G0SA 2EWMA 3AM4A 1O95A 5TS3A 3RFVA 2GZ1A 3ETGA 1HLPA 1DIBA 1W73A 4MP6A 3NGXA 2AEJA 4OQZA 4AL4A 1HKUA 4H7PA 3MTGA 4XZ3A 2J5IA 4WE3A 4IS2A 1DFGA 3WFIA 3KXDA 1VJTA 4P4LA 1FDUA 5BNFA 4WJZA 4EJ6A 1G6KA 5IXYA 1LBEA 2BKAA 1IUKA 3DQPA 4MOUA 2EKQA 1P9LA 2AE2A 2C8TA 4JOTA 4MP3A 4NH4A 3B70A 3BMNA 2ZKLA 3LT0A 3VTFA 3CPSA 1GZ4A 4AJ2A 1H9AA 4E5KA 3EVTA 5DBIA 3BAZA 2W2KB 4OXKA 4RQTA 1GFSA 4K1LA 2Y66A 4LSWA 4CQMD 4IZIA 1P33A 5A03A 4CV3A 3R0OA 3IKVA 4RF4A 3D3WA 2EJVA 4CMHA 3WJAA 3WQSB 4DLBA 5T57A 4E4YA 4XYLA 4R9SA 1T2CA 1V35A 3JQ7A 5CEEA 4EUHA 2F00A 4U0JA 3GF7A 3PTZA 1NXQA 1UAGA 3RC7A 2UUOA 3NEPX 2OO5A 4FN4A 1WZIA 5C90A 2O3TA 3WS7A 3DORA 4EZBA 4W6ZA 4YDRA 1WPQA 3OA0A 3OF2A 4BNZA 1SEVA 4FCCA 2HJSA 4WCZA 3B20A 3JYOA 4BUCA 4FNDA 1QYWA 4XQGA 3NJ4A 1Q7GA 3PHJA 3NUGA 3KLMX 5INIA 3FR8A 3HG7A 1PZFA 2FWMX 2B69A 1KIFA 4DPMA 4MKRA 1D4FA 1LSSA 1I3NA 2Y1EA 3H2ZA 3H9JA 1DLJA 3EW7A 4GGPA 4ELXA 2DUUA 3P2LA 3CZRA 4TRMA 3I9NA 3O26A 3QQPA 5IDQA 1B14A 2VNAA 4FC6A 5T5QA 4YAIA 2B5WA 2PTGA 1UYSA 4N5LA 5CDSA 2YHUA 2BELA 4J0FA 1E7QA 1SCUA 3MJEA 5BSEA 3FD8A 4BNYA 4RVUA 4IUYA 3QHAA 3IMFA 4ROSA 2DBZA 3H5AA 1LQTA 3GMDA 3I83A 5DDIP 4FOOA 1TI7A 4DI1A 4U6SA 2WDZA 5U9CA 5F5LA 4J4HA 3AY3A 4YPOA 4OOFA 3PFFA 1LXCA 2BI7A 1W6UA 2RH4A 5A06A 1YB4A 4R51A 5KJ1A 4BKOA 2O48X 2J3KA 2Q4EA 1EDZA 2C20A 3JQGA 5EERA 3PWSA 3AUAA 1NFQA 4DXHA 2PKRA 1N7GA 3JD4A 3HE2A 1IPEA 4BO8A 4M87A 3JQEA 1Y81A 1JAXA 4A26A 3KTKA 3MOGA 3KYDA 1U2GA 1HE2A 4B8ZA 5DU4A 3TVUA 5TRTA 2A7SA 2CDAA 3HP0A 2C54A 2Q2QA 3GEMA 4R5HA 3U9TB 1ZCJA 1MC5A 1U4SA 3GG9A 3GPIA 2IEXA 2TMDA 3G79A 1CETA 3K30A 1ZIDA 4NQZA 1HDXA 1D7OA 5JAZA 4EDFA 3ZH2A 1P77A 3GEGA 3T8BA 4A73A 4CM8B 4BV9A 4GGOA 3OQ6A 1K2WA 2AXQA 3CEAA 4BNNA 2B37A 2D3TA 1C0IA 1L7EA 2C5EA 2OOSA 3I9OA 4RVHA 4QFDA 3UGKA 3O8QB 1Q0QA 3BMQB 1WMAA 4WLFA 4TRRA 3WMXA 1UUFA 4UVIA 1S6YA 2B0JA 3PPIA 1KETA 3LT4A 2WYVA 5TQVA 1HEUA 1KEPA 2OZPA 4I42A 4I9NA 1OZAA 1ISJA 2VUSA 3DXFA 3IQDB 4K9DA 2NSDA 1EUDA 3KSUA 2ZCUA 3ZNQA 2RIRA 3GDFA 4BNMA 9LDBA 5IF3A 4IIUA 5IZCC 2P4HX 2ZQYA 5G1QA 2PZLA 3HZZA 1HL3A 3ZWMA 2VT3A 2Q3EA 2D4AA 1V3TA 3QA9A 2YY7A 1DLIA 3JQAD 4JP2A 4MI2A 2UV8A 3E48A 4XR9A 2JFHA 5FEUA 5JO0A 4XGKA 8LDHA 2F6IA 1JKFA 5ADHA 4J3FA 2GUGA 2OXIA 2E82A 2V6GA 1GU7A 1SOVA 2VYND 2Y05A 1XR3A 3U62A 3TT7A 1YL5A 2X8LA 2W2LD 3GR6A 3ENKA 3GDOA 3VVBA 1XX4A 2IRWA 2HK9A 3RASA 1GAEO 5CG1A 2B83A 4JCOA 4WNCA 1TYFA 2XAAA 4DMMA 4M1QA 2OFPA 1SAYA 1O0SA 5FWNA 5TX7A 4P38A 5KDRA 4YQYA 3TFOA 3VIVA 3MZ0A 1NFFA 2YV1A 1C1XB 2HKIA 4RLSA 1UZMA 4BNVA 3QV1A 3L6OO 1YG6A 2BGKA 4Y6PA 1IHYA 3DZJA 1IY8A 1GYQA 3CUKA 3R6HA 1HE4A 3WYBA 3ZU4A 4CUJA 4QIJA 1EVJA 4JROA 4MKXA 1EVZA 1GQQA 2CBYA 4S1VA 1VE9A 5FF9A 3ZHBA 2NUAA 1JDJA 5CP8A 1HYEA 2ZQRA 3BMCA 3BHMA 4TKMA 3QY9A 4XCVA 1L1FA 2DPHA 4GSKA 1T26A 1R0LA 3MJ4A 3O03A 3S1LA 1NFRA 4R1SA 5F1KA 4E30A 2GSDA 5F1OA 2J6IA 3H3JA 1JA9A 2VUUA 1Q1NA 5A05A 3DJAA 3Q11A 3DAGA 3GLQA 3ZCXA 4Q3BA 4RYFH 4YAJA 1T2EA 3QE3A 1GUZA 1DRVA 4L73A 3RBXA 5L7TA 2WD7B 2GZ3A 2YUTA 4CLRA 5KTKA 3IL2A 1HNOA 2VSUA 3PEAA 4F47A 2ZJ0A 3KHUA 5BNTA 3OMLA 2ZYAA 3GC6A 4D3DA 3K6JA 2DKNA 2DQ4A 1RWBA 1X15A 2HU2A 2J5KA 4K28A 2AQIA 3PK0A 3ZHYA 4IQ0A 4RPGA 4BO9A 1M67A 1SC6A 4Q3DA 5ILOA 3R9SA 1BRMA 4B79A 3PRJA 1T24A 4DIBA 2LDBA 5COBA 4J9UE 4R54A 5JSFA 4W4TA 2FOIA 4ZDCA 3UFXA 5KDRB 3V8BA 3ZHZA 2C59A 2QX7A 2YQ4A 4AJIA 3U4DA 2QRLA 2R00A 3JQFC 3QWAA 4UEKA 4XRRA 4CMCA 1BTOA 3NAQA 1T4BA 3IS3A 1ADCA 1Q0LA 1R4MB 4OH1A 3DB2A 1UP4A 3VDQA 4IDGA 2NU8A 1LDEA 4E21A 2E48A 3PYLA 4KD6A 1AHHA 1EZ4A 4JJGA 4QFCA 4QTZA 3SBOA 1KVUA 2PD4A 1BHSA 1NAHA 2VSSA 4Q0GA 3B6ZA 3HDYA 4PLFA 2CNBA 5G0UA 3RJ9A 3BMCB 1FDVA 2HO5A 3EZLA 1WNTA 5DBGA 3PGXA 4NHEA 3NRCA 2JAPA 3AOGA 2ZB7A 4MVJP 3ZN2A 1U9JA 4XDYA 2PZMA 2IXAA 2WD8A 1HWYA 3NT5A 2Q49A 3V2HA 2GGSA 1J7XA 2SCUA 2PBPA 4NZ9A 3TV5A 4QFEA 1RJMA 2DTEA 1I30A 3DZGA 2PKQP 3OT6A 1PJ3A 4LMRA 1CRWG 2O3UA 1XA0A 1GCUA 3KLPX 2E6UX 2D1YA 3LLSA 3AK4A 5LDGA 1DPGA 1ZMTA 3ZI0A 3H6KA 5EIOA 1WVGA 4W7IA 2R6JA 4Z6KA 1U3WA 2GLXA 2QZZA 4ELWA 1UXJA 1I36A 3SX2A 2VRCA 3OJEA 4KP7A 3FI9A 1C14A 3E9QA 3GH3A 4U5QA 5JO9A 2IXBA 3FHLA 1PL6A 1A9ZA 3CZMA 5A3VA 2QIOA 4CR7A 4WK6A 4JBGA 1M66A 1H6DA 4ZDBA 1PZGA 4WEOA 3VPGA 4MVJH 2AQ8A 5U1PA 4GAEA 4IMPA 5T67A 2NVUA 1P0FA 3UCXA 3VKUA 1P44A 2AG8A 1NVTA 2OGUA 4TZTA 4CMJA 1R66A 4BO3A 3S8MA 1H2BA 4HUJA 3QWIA 1WLYA 2Y0CA 4GX0A 4IDAA 1GV1A 4ALMA 3ZGYA 1O89A 3Q1LA 4KUHA 4EITA 1ZXLA 1BXKA 3IJPA 1W2XA 2A7KA 2DBRA 1JTVA 3CMCO 4K29A 3RBZA 1ONOA 3I3OA 7MDHA 3EC7A 1O9BA 1DHRA 3WG9A 4J7UA 4IZBA 2FPPA 4OMUA 3AY7A 1Y8RA 5AVOA 3WBBA 4RVDA 3Q9NA 3KTJA 3QKAA 4S3MA 4AJKA 2VWHA 1XU7A 4N7RA 3JCZA 4RVGA 1UXKA 2PK3A 2IZ0A 2QYTA 4KMSA 4Z9XA 4IQ8A 4CMIA 5C3MA 5IKLB 2Q99A 1DJQA 1X0UA 4CQMA 1XELA 2UAGA 4CMGA 4RCVA 4JYJA 2DVMA 4K3WA 2H1SA 1YDWA 1ZSYA 4IMRA 4NK4A 4OLQA 4IJWA 4D43A 2BI8A 4H3VA 5JS6A 1LNQA 2JCYA 3UOGA 1X1TA 1GL3A 4QUKA 4RO0A 5TT1A 4FN8A 3JYNA 5JNLA 2AA3A 4MVJE 2WEKA 4OKNA 1E1KA 1OBFO 4UEOA 3BYZA 1QG6A 5TSDA 5CAEA 1PJSA 3EHEA 2PGDA 4LMPA 2JJYA 4FFLA 4C7KA 3ANMA 4CM4B 4B3JA 1MV8A 2P91A 4AG3A 2NV6A 2RCYA 4WLEA 3WGYA 1NWHA 4O0LA 4I5DA 3WDSA 4G65A 2F9IB 5TLSA 2A94A 4FNBA 4OOEA 3ZWOA 1LUAA 2WWRA 1LLCA 4HFJA 1YO6A 4UVHA 5ES3A 5IG2A 1HZZA 3KTGA 1T2AA 3A28A 4ND1A 4UAGA 3OP4A 2DC1A 1LTHR 2ZB4A 3ZWYA 3L4BA 5ICMA 4QO7A 3T3WA 4XYBA 3MEQA 3KEOA 3TZHA 4CV1A 1WW8A 4DBVO 4IJUA 3ITKA 5KKAA 1Z7EA 3HN2A 3GMSA 4LCEA 4ONEA 5EINA 1H6CA 1PGPA 1B8VA 3MJSA 5K0ZA 1JXZA 1NQ5A 3FPCA 3ENNA 3S55A 1B26A 3OIGA 2HLPA 4XQEA 3K5PA 1ADFA 1PS9A 1PL8A 2X5KO 5JC8A 4O59O 4CV0A 1LJ8A 5L51A 1YOVB 1N9GA 1XG5A 2HMVA 4PG5A 5C7OO 1AHIA 1VJ0A 3GVPA 1Z7BA 1UIYA 3RUFA 1GV0A 2PH5A 2VSUE 4GLOA 3I9KA 3PLNA 1S7CA 2BHLA 1YL7A 5TT0A 4BGUA 1A7KA 1PX0A 2DUWA 2POQX 1I3LA 4R16A 2JHFA 3KB6A 4YRAA 1ZEMA 4L4RA 2LDXA 3WTBA 4IINA 3PEFA 3ST9A 4I08A 1DBVO 3OECA 4LW8A 2VT2A 1E3SA 3INRA 3Q3CA 1P1RA 4YJFA 1PU2A 3LF1A 4BNGA 5CDUA 1ISHA 4LN1A 4UVEA 1QXSA 4L74A 4WEQA 3GRPA 4E33A 4A03A 4BGIA 3G64A 1F12A 1P45A 3GNQA 4E5PA 4Z3KA 2CZCA 4QIIA 4HADA 2DPGA 5C7LO 1A72A 1GYRA 3FF4A 4ZQFA 4ND3A 1HSZA 2H6EA 3H4VA 5BQFA 3M2PA 1P3DA 3OBBA 4HY3A 1ISFA 2B4RO 5CDGA 3DZHA 2OBYA 4RJTA 3RC2A 1N5DA 1Q0HA 5E0SA 5EMHA 1BXZA 5A5FA 4FC7A 3QJ5A 1EUCA 1WMBA 2G0TA 5ILGA 5KJ6A 1V6AA 2C29D 3NTQA 2G17A 4XIJA 4AJ1A 2D8AA 2VOJA 3NV9A 4BB5A 4FN7A 4Z0TA 3C7AA 1ZK1A 4PLZA 1PWXA 1PZEA 3RKUA 2IYPA 5F1PA 2ZQZA 4YJDA 4YTEA 3ZWWA 1YL6A 3WB9A 4A10A 1NWCA 2IDZA 2C0CA 1XDWA 4PFJA 4EI2A 2X5OA 4PLTA 3TFQA 1ZVMA 3TOZA 3T8AA 2BF7A 3JQAA 2ZQQA 2NLOA 4GLLA 2Q2VA 3PZBA 1UZLA 4L8VA 1VM6A 4NBVA 4UVDA 5JCXA 1Q7CA 2EF1A 3QSGA 2B5VA 4L0QA 4WASA 2X9VA 4YJFB 4M49A 2ZJ1A 3GZNB 2NTNA 1KVQA 2VYNA 5DT9A 3RC9A 1YKFA 3X2EA 1N6DA 2QQ3A 2R00C 4XJTA 3ZV3A 4GVXA 5CHEA 2W2LA 4L76A 3HADA 5EQFA 1B0AA 4B4OA 3V2GA 1A4IA 3LC2O 5K9ZA 3D4NA 2PD6A 3AOEA 4RZHA 3C1OA 4P4NA 4YAEA 4CQLA 2X5JO 4WOKA 3H8VA 1A7AA 4ZA2A 4D0RA 2FSVA 5FUSA 3AUUA 3FNEA 1T4DA 1EE2A 3OJLA 3D0OA 5KVVA 1IE3A 4CL8A 1U3UA 3JQCA 4J91A 2PR2A 4J6FA 1NPTO 2J5RA 3A1NA 2Z1NA 2HW5A 3ADOA 1XLTA 3LKEA 1MA0A 4JX8A 4W7HA 4O1MA 4HC8A 3GG2A 5DUFA 2A4KA 3AU9A 1OAAA 3ZU2A 1GY8A 3UICA 1SOWA 4E2XA 1QORA 2EKPA 5JYEA 5TF4A 2OMEA 2VZ0A 1L7DA 4K26A 1VSUA 2NADA 3QW2A 2J5II 3GUCA 4YJGB 4I5GA 4GMGA 5L45A 3GNSA 3QVTA 2YQ5A 1KVSA 5FFFA 4BNIA 1U8FO 4KWBA 5DTPA 4BNXA 2OUIA 4WKGA 3KO8A 1CQIA 2BLLA 3CKYA 2X9GA 3GK3A 3N58A 2F1KA 3I5MA 1PJTA 3I4FA 4JBIA 3QREA 3ZWXA 5AXBA 2FSSA 5BSHA 4L8KA 3SC6A 2VYVD 4D41A 5JBWA 3DHYA 3ZWAA 1JW9B 4ZQEA 3U4HA 1X7HA 1BXGA 1LDGA 3I9LA 5BNIA 3DAFA 4GHNA 1I01A 1IPFA 3LT1A 5L95A 4PZCA 1PZHA 4KWIA 4BNJA 2C2XA 4CM9D 3FCOA 4E31A 2PV7A 3JQDA 4K6FA 2B4QA 4KUEA 2G5CA 2VNSA 2B36A 2VZ8A 1QV6A 3OEWA 4XD2A 1X0VA 3DMTA 3SLGA 1DC3A 3ULKA 1Z75A 5DN9A 3JQ8B 1RPNA 1C0LA 5A4DA 1QP8A 1RM3A 2VWGA 5AXCA 3DBRA 5AOVA 5HWSA 5I8WA 3PWZA 4K6CA 4IXWA 2WE7A 2NM0A 5C5IA 1DAOA 2I99A 2CF5A 3ROKA 4PLPA 1ULSA 4YACA 4W9NA 1O94A 3RSHA 3VH3A 2X24A 2PA3A 2ZTMA 3CE6A 4NU5A 5E0SH 1LDYA 2HK7A 3D4PA 4DGSA 3R0IA 5I7SA 2BGMA 1B8PA 4DA9A 1NR1A 2A35A 5TJ9A 2NP9A 1E3EA 3BEZA 1XEAA 4FZWA 3ZW8A 1N8KA 2GNAA 4XQ9A 1KC3A 4E5YA 4L6WA 1NASA 3OQ1A 4FJ0A 1C1DB 1Z74A 3HNPA 1H0KA 3KRTA 4EJMA 3QXZA 2X0RA 4BV8A 2WE8A 3JQ6A 1RYEA 3P5SA 4DVJA 4NJOA 2JAHA 1LDMA 3ZV6A 4Z0MA 1X14A 2EIHA 1JQBA 1X13A 5HM8A 3VDRA 1EMDA 4R1NA 1YXMA 5A9SA 1DIAA 4CJXA 5GMOA 2X86A 1WZ8A 3K92A 3ASUA 1LLQA 4FD3A 4FB5A 5JPIA 2NQ8A 2NU6A 3H9EO 4ND2A 4DRYA 4TMFA 1N92A 2YJZA 5GZ1A 3KEQA 3DBLA 2BMAA 4YAKA 2QYSA 4NI5A 4FB8A 2J5IB 1MC4A 1UH5A 3C7CB 3TQHA 2W90A 5KKCA 4FBGA 1MFZA 1GEEA 1Y1PA 3NT2A 4DIFA 5A04A 2NVBA 4LRSB 2Z95A 3GKBA 3L4BC 4BGVA 3BMNB 3V5NA 1EK6A 1DCIA 1K0UA 4LK3A 4JVTA 1EE9A 4HKTA 5I7FA 4MIEA 3SEFA 2I67A 4HXYA 3PJGA 1T2DA 4KNPA 2GDZA 4CLHA 4DYDA 1AUPA 2GF2A 3AUTA 4OKIA 3TN7A 1FF9A 3PIDA 1X7GA 4Y67A 1QYCA 1U5CA 1XQ1A 3F1LA 1H9BA 3WIEA 2PGLA 4BNWA 1T1SA 1XIVA 2NNLD 4P8RA 4YA6A 2O50A 4JIGA 4OG1A 1B15A 3D3WB 4RYFA 1VL6A 4NFHA 4EMPA 1PS0A 2HRZA 4JCQA 3DZBA 3JQ7B 4RLHA 3GGGA 3AM5A 1IULA 1E92A 1R4NA 2VWPA 3I23A 3L9XA 3S2IA 3G17A 5ER9A 5EN4A 5CPFA 1BWSA 1MP0A 4J2OA 4PG6A 2FPIA 1A4UA 3OEYA 1YWGO 4L9RA 4GI2A 3WX0A 4ZDEA 2AMFA 3BXXA 5AXAA 1R6DA 3UW3A 2YHIA 4U0GA 1B3BA 3TDCA 3E1KA 5KCZA 3PHGA 4HFRA 3RUHA 2EJ5A 3G1UA 2QHXA 1I32A 2X23A 3N7UA 3GMAA 1VPDA 4W82A 2WMDA 4NNQA 3RQSA 4JSBA 1E6EA 1K89A 2Y68A 2DBQA 1PIWA 3ANLA 4JK3A 1KYQA 1TVEA 1U8XX 2ZL0A 4WYOB 1DDOA 4UUMA 3RFTA 1EQ2A 1NQAO 4PN3A 4ZGWA 2VX2A 3MYBA 3SJUA 5KVCA 4BQRA 4XB2A 3ICPA 4CM5A 1K32A 1AGNA 1E7MA 1NYTA 1OC4A 4IZHA 4AJPA 5KJPA 1G0OA 3NTRA 1N6EA 1ARZA 2JCVA 4M8SA 4B4WA 3PHIA 1F17A 4DL9A 2TMGA 4JNKA 3KTHA 3CTMA 1I2ZA 3H65A 3VAZA 3TZKA 2CSUA 3WNVA 4MVJI 4BB6A 3OJ0A 1QR6A 4P22A 1GD1O 3HQ4O 1Y6JA 4J49A 3ADPA 3SWXA 4RF3A 1XNVA 3SJ7A 1K5HA 3T4XA 5IFLA 4YCAA 3WQRA 4M86A 3PYMA 2Y0EA 1NHWA 5IDXA 1RYDA 1GR0A 1EQUA 2HDHA 1GUFA 3V1YA 1R4NB 3JQGB 4OSOA 1MG0A 5T8KA 3QWBA 1I33A 4BIIA 1NVGA 4JBHA 5BT9A 1NP3A 4CLOA 2DAPA 2OHXA 1NPDA 1X7DA 3BZUA 3PQFA 5JMWA 1AN9A 5DBFA 4F6LA 3KYDB 5H81A 1DO8A 3R3JA 1KY5A 1SO8A 1RKXA 3GY0A 3X2FA 1LSUA 1GPJA 1HE5A 2I6TA 3B1FA 3M1LA 3M6IA 3H0SA 4M89A 2FN7A 2NTJA 2WJPA 4RPLA 2FRDA 5L9AA 4RCNA 5EJ2A 4AICA 1WXDA 1BVRA 3PIIA 4BKUA 1ZSVA 3LVFO 3LF2A 3ZWBA 4MVJA 5JAQA 3WGHA 1HXHA 4A7PA 3K50A 4Y8VA 3P2YA 4GBJA 5A02A 5B1YA 2F9YA 4YB8A 1DB3A 3ROMA 3DTTA 4RF5A 3WBFA 3ASVA 1WZEA 3QP9A 1BMDA 3S2GA 1MLDA 4WCDA 3GN1A 1P74A 1HDRA 4F45A 1PR3A 3ST7A 1BGVA 1OI7A 4JLWA 5DL1A 3NKLA 2UDPA 1ZK2A 4Q39A 1EF9A 1FJHA 3TL2A 2UVDA 4CM6A 1RM4A 1ADBA 1W4ZA 3WJ7A 3G0OA 3ZWPA 4DWVA 3DR3A 4Q1IA 1YQXA 3VH2A 4JXKA 3DHNA 4QECA 5HA5A 3PP8A 3K96A 4D44A 4QSMA 1GEGA 3STHA 4PG4A 1HTBA 5IN4A 3FTPA 4R68A 1PL7A 1Z73A 2PGJA 4QT0A 1F8GA 4AVYA 4D7AA 5KIAA 1EVYA 1I8TA 3W4IA 1BW9A 4J43A 4R69A 1WDLA 1I2CA 1MX3A 4NBRA 3FDUA 3K2EA 1LLUA 4FJ2A 1SPXA 2GRAA 4BGEA 2UYYA 3FN4A 4GH5A 1VL0A 1U28A 3Q9UA 4RV9A 2I3GA 5EESA 4EMMA 2V65A 1I2BA 5TJHA 3QIVA 3L0DA 2UUPA 1C3VA 1KS9A 1AXEA 1EBFA 2R2GA 3LC7O 4N54A 4RDHA 5ENVA 5JDIC 3STAA 2DTXA 5GY7A 3ITDA 2O3RA 4NBUA 4Z0HO 1PQUA 3P2OA 4IGFA 4TVBA 4MDHA 1YB5A 4ZRMA 4WCFA 2F9YB 1PQWA 5B4UA 3PGQA 2BGLA 3EVNA 2FHSA 2EGHA 1MXFA 4U0GH 1YDEA 2GCGA 1VI2A 2FPGA 1JN0A 3R9TA 3NTOA 1QLJA 4JJFA 4L75A 2OBNA 4PRKA 4CV2A 3VTZA 3OFSA 3AUSA 4GWGA 3TZCA 2BZRA 2GN6A 3VPXA 1E3WA 2P9GA 4OQYA 3TZQA 3FRJA 4IJKA 2VQ3A 4WECA 4CUZA 1HZJA 3ZU3A 3VVCA 4A27A 2PKQO 4FSHA 3FBGA 3GPDG 3RIHA 1YE3A 3K31A 3TJRA 4H15A 3ZNPA 4L4SA 4NBTA 1U7TA 3UCEA 4CM7A 4EUFA 4F3YA 3H9GA 5ITWA 4B7UA 4IGEA 1NPYA 2JKVA 3RUDA 2IYOA 2X0JA 4DPLA 5FI5A 2I3AA 4DUPA 3C8MA 3K8XA 2AG5A 1ZJYA 4FZWC 1X0XA 4E5NA 3UH1A 1GQ2A 1NHGA 1ADGA 3HB4X 3HDQA 3V5IA 1JKJA 3JU1A 1FXSA 3DFUA 3MTJA 1R0KA 2ZYDA 4YT5A 4CLRB 4FFOA 4CM3A 3F4LA 1M75A 2CVQA 3O38A 3PWKA 5CDYA 1F8FA 4QXMA 2FW2A 4WCFB 3HRXA 3I6IA 2DU8A 2WYWA 4PLCA 1K39A 4J90A 2DFDA 3U9SB 1ISGA 3VZSA 3WTCA 1M76A 4BNFA 1PWZA 3ZDFA 4OIMA 3GF4A 4O63O 3DZKA 4Y6SA 4TZKA 5DU6A 2PFGA 3FNHA 4GPD1 2IODA 3DOCA 5TGDA 3JD3A 3HN7A 3UF0A 4BO5A 3G49A 5JFOA 3FWZA 1HDGO 2VYVA 2ZK7A 4BS9A 4DC1A 2FZSA 1VRWA 2H5LA 5JW6A 1PEDA 4NBWA 2A9FA 4TSKA 4PLWA 1QRRA 3CIFA 1EEHA 2GO1A 2GR9A 3D7LA 4FOSA 4KQWA 3RBVA 4E6PA 1YVEI 2IZ1A 3F6YA 5K6AA 2J5GD 4GMFA 4Q3NA 2PZKA 1ONNA 3PJFA 4YYZA 3HDHA 4CM9A 3AI1A 5INFA 2VSSF 1EFKA 2AEMA 1U1IA 3RJ5A 3AI3A 3OH8A 1XKQA 2DTDA 4I52A 2J3IA 1DOHA 1R16A 2X0IA 3HFGA 3GGOA 3AY6A 1BVUA 4QO8A 3WYCA 4N5MA 1FDSA 3F5SA 5L7YA 1Y5RA 3E6AA 3KV3O 1PIXA 1E1MA 1E7YA 1DSSG 5JBIA 4OXNA 3JQ9A 1B16A 1TT5A 1U7HA 5DOVA 1CWUA 3U9LA 1M6HA 1UYTA 4NU6A 5JYDA 2XPCA 1BSVA 3GVXA 2JD0A 3QVWA 1ZUD1 2PWZA 4XB1A 3TRRA 4J7XA 1DUBA 4AJEA 3MJTA 3MJVA 4PLGA 2I9PA 4BNHA 1YONA 4AJ4A 5DZKA 3RSTA 2P5UA 1NX6A 4FFRA 2PG8A 2XOXA 1ID1A 3ON5A 4OHUA 3IAHA 3QVSA 2FZEA 4OL9A 2O3SA 3CMMA 1IZ0A 4WLUA 1I3KA 4BKPA 3TF5A 2VHXA 4MXIA 1OC2A 3OHSX 5JY1A 2NVUB 3RWBA 3I52A 3QWDA 2IE0A 3U5TA 2E37A 2PPYA 3VOSA 2OL4A 4ALNA 4GWKA 3PYXA 4R3NA 2VTDA 1E3JA 1LEHA 1QV7A 3H9UA 4XEHA 4OO3A 4G2NA 2AHRA 3H5NA 4PG7A 3P5MA 1TEHA 3K8ZA 1PJLA 4BHTA 1PJCA 4HNHA 2I65A 5C7IO 4Y98A 2VRBA 1FDWA 1IHXA 3GN2A 4LVCA 4Y9DA 3BHJA 1QKIA 1Y8RB 2PNFA 3OM9A 4N18A 3TSCA 3ZV5A 3JYLA 3FNFA 1F06A 3K2BA 1YBAA 4ZN6A 4CMIB 3KQFA 4TQGA 3W8EA 3AI2A 3OQBA 1MGOA 4NPCA 4CQMB 1N7HA 3KYBA 3QVOA 1PSDA 1UP7A 4CMAA 4MVJG 3AJRA 5G0WA 2C7GA 3ONDA 5AXDA 5H82A 2PD3A 4BNUA 1EK5A 5L4NA 3ISAA 1ORRA 4U0HA 3UVEA 5KNLA 1Y8QA 2NVWA 3BPPA 4XR4A 4X54A 3RU9A 5JAMA 4OGWA 1E5QA 3PHLA 5IXSA 2I66A 1O5IA 4NJMA 2X1HA 4WZ8B 5DOZA 2V7PA 4FJWD 2NQTA 3E82A 4B4UA 1J0XO 3DZFA 3T4EA 4DBZA 3SLLA 4NDNE 4ZQBA 2VHWA 2JCXA 2V6FA 1SZJG 4RZIA 4D79A 4MIYA 2P5YA 3WGTA 3GVHA 5B4VA 1FC9A 4LCJA 1LI4A 1EVIA 2AW5A 4WLNA 1NTOA 2F6QA 4IJVA 3HUDA 2RH8A 2YV2A 2PY6A 3PQDA 5KJEA 5I7EA 5IDWA 1UYVA 3UXYA 3PHHA 4QQRA 4GX5A 3G1TA 2ZL2A 4YVFA 5TIIA 4IZCA 4E2WA 3ROQA 3T7CA 4GM2A 3LLVA 4J0EA 2YDXA 3GF3A 5F21A 2AQHA 4YXFA 2X9NA 4J1SA 2CD9A 1NVMB 3MWDB 5JAIA 3OIDA 4YT4A 4NEKA 2ZCVA 4I4ZA 1ZXBA 4I5FA 2VREA 5H83A 3KOUA 1LRLA 3RUCA 1PJ4A 4JQCA 1XHLA 3RUIA 2EHDA 1LSOA 4DPKA 1YJ8A 2JFGA 3FWNA 3F46A 2FR0A 4TWRA 3FBTA 3IUSA 4GX1A 4HBGA 4XYGA 4DIOA 4Q3CA 1N9GB 2ZTVA 3IC5A 1GADO 5DULA 4NJMB 2VSUC 1NAIA 1YBVA 3SLKA 1KEWA 4LSMA 4IQGA 3ABIA 2JD1A 1TT7A 5I9NA 4WLOA 5I7VA 4R1UA 1JLLA 4LISA 4WCFC 4J1QA 1RM0A 3BA1A 4R41A 3U0BA 3NDRA 5DZKH 3M2TA 3VKVA 3MWEB 5IZCA 5HS6A 4ASIA 3JSAA 2Q1UA 2J3JA 1E0DA 1WDMA 3TWOA 3V1TC 1P1KA 3JTMA 9LDTA 5BSGA 1I5RA 4E2YA 2AEFA 4CM1A 3H0UA 3RAJA 2P4QA 1DRWA 3GZ4A 3IP3A 3COSA 4BNTA 3I47A 3LC1O 4BO1A 5A1TA 1IL0A 2Q46A 1DFHA 4I1IA 1NBOA 4BO2A 3JYPA 3W8DA 4J1NA 4ALJA 3PE8A 4XA8A 2RAFA 3OC7A 3U4CA 4TKLA 4B3HA 1FK8A 4FS3A 1ENOA 2NU9A 4UUNA 5CPBA 3PXXA 3GAZA 4GKVA 4NG5A 4MO2A 2ZTLA 3EGOA 3VZQA 5F3RA 3QYRA 3ZWNA 3OJOA 1LRKA 4CR6A 3PFWO 1ZK3A 2W3PA 4DQVA 2EKLA 3T7EA 4YRDA 3W8FA 5COAA 4PG8A 3JV7A 5JE8A 1PJBA 1R0SA 1HZDA 4WLVA 4D45A 5EL0A 2DUBA 5ENDA 4JFCA 1ZFNA
chains in the Genus database with same CATH superfamily
3B60A 1H6BA 1FFEA 3KPUA 3C3JA 2IF0A 1BCRB 4MGKR 2GZAA 1G1AA 2Q3MA 1M74A 4G56A 4QGGA 2ZUCA 2YJ3A 4Z3DA 3KVRA 4XVRA 3WWYA 1U0TA 1R8SA 1G0NA 5EEGA 5C46F 4DV4B 4R1TA 4S0ZA 1DQSA 2DYKA 2FPMA 3HSSA 1VGQA 5ANRB 1QGED 1P80A 1SVLA 2F2TA 4DHEA 2RG1A 1G3RA 4ML3A 1TQ4A 3QELA 4G0UA 3E15A 4ZARA 3GFGA 1D0VA 2P1ZA 1L8OA 1EK0A 1CYDA 3M5CA 2XYGA 1DEKA 1GL9B 4QAQA 2WU4A 3K0AB 4LEIA 3GYBA 3RU2A 4IY1A 2C8VA 2C95A 1FU8A 4RY0A 4KXNA 3SQMA 1Z6ZA 2O3QA 3H6GA 4HWOA 4C14A 1TK9A 4Q1DA 4DLZA 2X9QA 3TINA 4EL0A 4XJSA 1S2NA 2GN8A 3BSFA 1RHUA 4CKBB 4L0CA 1KYYA 4JQYA 2GD1O 4BP9A 1SCQA 1G3IA 2QTCA 2REQB 3IA2A 5K3CA 2V3CC 3Q10A 4WSOA 4GOKA 2ODNA 4TMZA 1CNEA 1MOSA 4UHJA 1GIAA 5JMPA 3EVGA 2AX3A 1AG9A 3BICA 2HQSA 4JZKA 3S28A 4I4TA 2ONYA 3K5WA 2IP1A 5IVDA 2HUNA 2IKQA 2VRWA 3N0XA 2AH5A 2VNHA 3EAGA 4HBZA 5FPPA 3HGMA 3RYIB 4N76A 2YDYA 4LJLA 2WYUA 4XCXA 2AG0A 3UWOA 3L1VA 2FUCA 1GT91 3EVAA 1UOOA 3ZGOA 1E6UA 4DMKA 4MW1A 2CEKA 1VHQA 1Z18A 2FQXA 4NX2A 1CQIB 4EF5A 4LF8B 5KVQA 3EMBA 1XZAA 5B37A 1QRDA 4F9FA 3P85A 2JJQA 1DWPA 2CF6A 1OFVA 1T2FA 2YV3A 3LH5A 4YRBA 1FSPA 1WZUA 2FR8A 3N39C 2HNAA 4KQJA 1KEZA 4G2RA 3OQIA 4X44A 5EJ4A 1O9HA 4TRJA 1R5BA 2VOEA 4QARA 2TS1A 3LO8A 3RFCA 3S2EA 3SN6A 3LA6A 2A58A 4KR6A 1WMDA 3AKEA 4JQOA 1YT5A 5I8ZA 4QTYA 1J1ZA 5L53A 3HZRA 2XF2A 5KYWB 1BXGB 5EWJB 3ZDEA 1WUYA 3GFSA 5AK4A 5IDYA 2XGMA 1PDVA 1OMOA 2DFVA 1LDNA 5IANA 3IBGA 5F52A 1IHOA 1PJRA 2PKYX 2AOXA 3E35A 5DBEX 3BBPA 3F6EX 2HWYA 1E7RA 2W6OA 3L7OA 4P83A 4MI3A 2ACVA 5AOAA 1FZTA 1ZC3A 4I9GA 5ALDA 4XWYA 2GN9A 4YI5A 1DIGA 3SZGA 1N3BA 3WP1B 3FAKA 2HJHA 3DW3X 1S9DA 2WM9B 1EIZA 5LIPA 1U7XA 2H9YA 2VSFA 2WTNA 1Q1BA 4HS4A 5CEFA 2CKMA 1CQJA 4US0R 2W22A 3BSSA 4HG2A 3M6XA 2QQGA 3VHLB 4ALLA 2VHUA 1D1QA 1B7GO 1JDUA 4D9FA 5KYYB 4TYMA 2TECE 1DV1A 5LA6B 1CERA 7GPBA 4WPGA 5FXMA 2ZJFA 2CVZA 2OTCA 1U0NA 1QHSA 3QX3A 1QR2A 1XVLA 1YDGA 3F5QA 4GWLA 3DGEC 1NJ8A 1QWOA 3RRBA 4J7CA 2KBFA 3ZD8A 2ZYGA 1ZN7A 4V24A 3B1KA 3ICCA 2IEDA 1X9GA 2Z1MA 1XVAA 1LU9A 4P80A 3C3AA 5G02A 1KI7A 2PT6A 1IN5A 1FCJA 1NLFA 1A98A 1QGUA 2BVNA 1YE5A 2FFQA 4CM8A 5LKAA 1PKEA 4FGSA 4GFDA 1PGOA 3RCBA 1CW2B 2ASVA 5BSVA 2UKDA 1FMTA 2RBEA 1LQUA 1DJPA 2LIVA 3C3XA 1Z8FA 2ZUUA 3QU2A 5E7IA 5IBQA 2GBIA 1UJMA 3WLTA 3GRZA 2H08A 4EF6A 1WXFA 3M3DA 3MG9A 1PGQA 1ZLYA 2OFXA 1CQPA 1D7AA 1W0CA 2Z5LA 3H7IA 3O4VA 2C8KA 4N3GA 3TRFA 1U63A 4L78A 1SB8A 5BXQC 3HUUA 3A4YA 3HDTA 4MR9B 3TPCA 1BDMA 1CIJA 1W30A 2FY8A 4Q1FA 3M33A 3TNJA 1L0BA 3PVZA 4UMFA 1HY3A 1KOFA 4K9QA 3QLJA 4LDRA 1M2EA 5IPFA 3IP1A 2R86A 3VNVA 1TZ2A 3NH6A 3RSZA 5LMCA 1L3IA 3SYTA 1A5SB 4M54A 5EY5B 3A4IA 5B6IA 1RQLA 2BE7A 3R7BA 2QW1A 1FX0B 2O7SA 4EJSC 1RQXA 2ZSAA 5IC6A 5CVDA 5DEIA 1HFWA 2RJOA 4QIHA 2FUG1 1D1SA 5HQJA 1A9QA 1XMVA 3PDUA 4DQLA 5J2UA 1IUNA 4UPEA 3F74A 1EGMB 3NCHA 5H70A 4Y9TA 3A6FA 2Q07A 1Z34A 5JZ9A 4CNBA 3W6ZA 2QTTA 2V96A 2PIDA 4KXMA 2AZXA 4PVCA 3T7AA 3BTOA 1NR7A 1P3Y1 1ZVVA 4JYBA 1XCJA 2DZDA 4PGFA 5D1HA 2A5GA 2ST1A 4J75A 5GGYA 1Z4NA 3JQBA 3U13A 1B8NA 2Z2KA 1OFIA 2H5EA 2FI1A 1IBRA 1T4CA 3NT4A 3IPRA 3DCJA 4GDMA 4NL4H 4Q93A 4YWJA 4LK5A 4YPFA 1G8SA 1I5EA 4ND5A 3WLLA 3P9QA 4KHPB 5AWFC 1SG4A 3SM9A 4II3A 3WGOA 4C4RA 2F8LA 3GJ8A 2OORA 3EE6A 1AURA 2O8FA 3KC2A 2FW6A 2XVMA 4AKIA 5TVGA 3TLZA 3INTA 4DRXA 2O4CA 4ZTZB 4KHZA 2OP0A 5DZSA 5CA0F 3CSDA 3WWZA 2OBFA 2WJAA 5COQA 6LDHA 1GG2A 5GADl 1UBFA 4RMGA 1JA0A 2EJTA 3HVHA 3FUTA 2CMKA 2ZROA 3JU3A 4KMMA 3DT9A 1X2EA 4DCUA 1KR2A 1NUTA 1SHJA 5CLJA 3SI7A 1ZNQO 2BJWA 2C83A 2ECKA 5BSRA 1W0JA 4NEGA 2VHYA 1QYVA 2VF7A 4R2IA 4I8DA 1P17A 2N0SA 1X80B 4G2TA 4UMDA 4BE7B 5MFZA 3RC8A 2HQ1A 1Z0DA 1N2EA 2ZANA 3AOEC 1JVSA 1EFRD 2HEIA 5D3MB 3UGQA 1QKJA 2W4IA 2FSVC 2AV6A 4A2WA 4MQEB 3BRWD 1GR1A 1QGYA 3A14A 3T89A 5MN5A 2DH6A 4ZQIA 3H02A 4JZYA 2XLCA 1ZJZA 1L5KA 4BVFA 2BZGA 2WKRA 3F7NA 5L3RA 5HGXA 3EEOA 1U7DA 4UU0A 5HZKA 2RI0A 2PLAA 1FTYA 3QUTA 1AKMA 4YRTA 3ND8A 2CFCA 3QRWA 4J4TA 4DW8A 4YCNA 3DKKA 1XLTC 2RGDA 3ZGVA 1UBTS 2F8TA 1V11B 2D7CA 1HF3A 3ZUPA 2AKAB 1QQAA 4MI1A 5BR7A 4D42A 2Y99A 2VXCA 3IOCA 3GLSA 2G9RA 2VJNA 3EYWA 1M0TA 3COPA 3EG9B 4GSLA 4LQ4A 5SV2A 3AR9A 1Q77A 2OHHA 4Z4GA 3D3KA 2ZYTX 4CLOB 3C3YA 3RR2A 1KO8A 3OURA 1UPAA 3ZNOA 2Z4RA 1WAMA 3UY4A 5CFRA 2F48A 1KGDA 2C4UA 1HPLA 3A58B 3NALA 4GPTA 2GT1A 3T7SA 3A06A 3PXEA 4FPXA 3W1VA 2HJ9A 4IZDA 1XTKA 3P8ZA 3V8EA 1V8BA 1EIWA 3BCRA 3C6ZA 4F9GA 2CMDA 1D9XA 1KSHA 5JCPA 3BAFA 2OLEA 2CLSA 4JR2A 4JN6B 4OB8A 4PC3A 1S3GA 6AT1A 3EMKA 3SR4A 4TL9A 1N75A 3PNLA 4JI3B 3TZLA 3HFSA 2I3BA 3SBDA 5FOUA 2QSYA 4ZI5A 2XXBA 5CG2A 3AG5A 2C4TA 2IS1A 4WDRA 5DXFA 4XPIB 3B9BA 1O6ZA 4N5HX 4B31A 1II9A 1M7BA 4JGBA 2IYYA 4PZ9A 1T1GA 1RLIA 4RABA 3PG5A 1J49A 2BGIA 2PZEA 4A0HA 4DDMA 1FP7A 1ZMOA 3I09A 4A6DA 2O57A 4CPDA 1Q0RA 4AC9A 4V3BA 4ZAFA 4NV0A 3GUUA 2JCSA 2JLVA 1ATIA 1G8GA 1JR4A 1SBIA 1K08A 3WO1A 4X71A 3HP4A 2GAIA 4YK7A 1J39A 2VUTA 2AT1A 3CTVA 4AP5A 2BFNA 2ECOA 4DQXA 4WZAA 5G40A 3ZX5A 5I7OA 4ZQGA 2D5LA 3TCNA 1IM8A 5GWXA 4FFPA 3R3WA 4FCWA 1QK4A 3WLOA 1SRRA 1UOEA 2R6AA 4BMSA 1ETUA 3QBDA 2QNRA 3SU8A 3PEWA 2CZGA 3VHXA 5BSFA 1P72A 2Y9MB 4TS1A 5AVUA 2JDIA 3EFOB 3PGMA 3GVIA 1Z25A 2O1XA 2V3WA 1O95D 5E0NX 2C96A 5LUAA 1U2PA 3EODA 5D3KA 3IIJA 1K5PA 2GHTA 3ZY6A 3HINA 1J25A 2A9QA 4NXNB 3V8RA 2EX1A 3E4DA 1Y5MA 2W0SA 4GICA 5EJGA 1OLSA 2GPYA 2HNBA 2C03A 2NUTA 2AFRA 5GQSA 9ABPA 1C2YA 3R0XA 4IDFA 1JPUA 1UDXA 4J2TA 3CNQS 1AXRA 4IX1A 4AG5A 4ZAXA 3T52A 3VR1A 3MJCA 1CRLA 1P73A 2JFVA 4OMFG 1ETHA 2WIBA 5CB4A 4NVRA 1KDTA 1MBZA 3A27A 1IB6A 1RHKA 3ISTA 4PICA 1UDCA 2O5RA 1KQFA 3K71B 3J7AC 1FC6A 4WNAB 3V32A 5A5GA 1TYDE 4UEWA 4UHBA 2WICA 3ZD9A 2P9EA 1TYCA 5AUQA 2AMYA 5I5GA 2H29A 2PEYA 3FM9A 4BQSA 4OK6A 2AUNA 4ZODA 3U61B 3L77A 4KJXA 2QVLA 4MVJM 1QNFA 1TCCA 2PBLA 4X7BA 5HXAA 3AGQA 2MSKA 3KR0A 3OHPA 4NMHA 2G1JA 3K1AA 4CN8A 1WETA 1VBMA 4BO0A 3B48A 1OCEA 5CTBA 2HRQA 1S7GA 3QVXA 2WDPA 3RRFA 4DSOA 1PNRA 3U81A 3VFDA 4HX5A 2OV3A 4HH0A 5E2AA 1E3WB 3LOUA 4P82A 4XIYA 3USZA 1FJGB 1Q44A 3R74A 3WA6A 1QVAA 1RI1A 2JGLA 1KQGA 4AJ9A 2DB3A 1SURA 4PZDA 1XEFA 3QG5A 1Y3BE 4NNPA 2WT8A 4D8XA 3MTBA 5DP2A 5E6SA 1DG9A 1EUZA 2RKWA 2MHCA 4M1YA 4XUDA 4MOWA 2XCQA 1QFMA 3MBOA 4OGKA 5AW6A 1UYRA 4FW9A 2Q2XA 3PXDA 4Y6GB 3AEUB 1JKIA 1L4FA 3GQVA 5JALA 3NC4A 2GVDC 4YRJA 4HFMA 3ZWCA 3BXFA 3T7KA 4FSDA 1QWSA 2OZLB 3WOHA 5IKMA 2Q50A 3GO4A 1RC8A 1VRGA 1LI5A 4N8SA 1EB8A 3C6BA 4GVPA 4XIFA 3VR5H 1H65A 1L7VC 2CUKA 1JZTA 1E1NA 3EXEA 4BTLA 4HGQA 1JHXA 1IRIA 1TK2A 1UMCB 3DMDA 3MCWA 4C4OA 1BOFA 1E1QD 1XWIA 4OI1A 1Q6YA 1H22A 1XK7A 2Q9AA 2QJWA 3WFZA 4CLXA 4KQXA 1M54A 2G06A 2KLBA 3NTXA 5KJFA 1AZTA 2ZB8A 1M2GA 2O2ZA 2M2IA 3CF0A 3E8XA 3HPQA 5EQDA 4RD4A 3M4XA 3IR6A 4HNGA 4M8LA 1II8A 1K7CA 5E1BA 3VO2A 2CFIA 4PS1A 2F9IA 1JR2A 2B8EA 3EGIA 5LSAA 1DAKA 1KMHB 4EFMA 2NZ2A 2VCYA 5I5EA 3CRRA 4KAAA 5I01A 4A92A 3BMOA 4BZPA 3UV7A 3WFJA 4UOQA 5LDHA 3TR5A 4KTVE 5BV8A 1FXUA 2FU5C 2ZJAA 3F6CA 1C29B 2XEXA 5G41A 4A2CA 3E5RA 3BWEA 3FTDA 3K9GA 1RP7A 4EAQA 4XCQA 3VI4B 5C53B 3QEMA 2HX1A 3BERA 4LDNA 5EXDA 1CEQA 3BXOA 3UWSA 4YV1A 3GUZA 3ESBA 3KWLA 1C4WA 1LA2A 4RANA 3TGLA 1E6MA 4HGOA 4C01A 1I10A 4CI0B 3UB2A 2IXTA 4NZOA 4AROA 1KBZA 4IWXA 1SNYA 2Z2XA 2P2CA 3O4RA 1KI4A 3PFBA 3H99A 1TX4B 3NHRA 3E9YA 2R8EA 5KINB 3REGA 4IXTA 1KKLA 1HQCA 1W1IA 2P9HA 1FRZA 1TLTA 2BKVA 1VLVA 2C07A 2D8MA 2R9VA 4IDOA 5L4SA 2Y9PB 3IVCA 3RYHA 2AN3A 4NFLA 3KTDA 4BDTA 1ACJA 2GD0A 1KEVA 3MTQA 3NW9A 4XE5A 2G9NA 1JG1A 1DBRA 3U40A 3VKFA 4YMVA 3IJ5A 3VPDA 1D5CA 2BMFA 2C0QA 1UQUA 3DO6A 3CU5A 3ACDA 1XHEA 2IHVA 3LNTA 4NABA 4K3UA 4MEJA 3THXB 3SFTA 1OLUA 2BDTA 2HMWA 3FGNA 4J3NA 2QX8A 1TQDA 2UZ0A 3JQBC 3H0JA 1XP8A 1HLFA 2CY0A 4WV3A 1G5QA 1GU1A 1A2BA 1JDTA 1E3LA 1QOPB 4GKBA 1MHPA 3R4CA 3NJDA 3ONEA 3KBBA 1J8FA 5LC1A 1MAUA 4BCBA 1OZFA 4XWOA 5HTOA 1GTSA 4DMFA 4LVUA 1JE0A 1DUSA 3ROPA 2OORC 2FWJA 2OAGA 4RA9B 3C5EA 2VO1A 3PF9A 5CLHA 3CVVA 1NW9B 1L8QA 3D6JA 1G6HA 2FPWA 4O25A 1FXWF 4DS3A 1WDKA 1D9ZA 4X0EA 2XA2A 5KNCH 3KCQA 5L4LA 3V7UA 3N6RB 3EULA 3G2OA 1FMCA 4M83A 4Z1MD 2QBYA 5NLLA 4YRGA 3EOAI 4QWWA 4R8LA 1UIMA 2H9IA 2HHHB 5DYNA 3R9IA 4BVAA 4Z4EA 2SICE 3G2NA 1TB4A 5SYMA 4J1TA 2VKTA 4X94A 1W93A 4Y6OA 2FP4B 3CZAA 3OFJA 1J8YF 5KVSA 2OE2A 4LZWA 3PR2B 4PZLA 1ITZA 5IKEA 2C4MA 2ZBGA 2FK7A 5KDOA 5HP4A 4ZDDA 4AUKA 5BOSB 4L85A 1JF8A 1DXYA 3QOFA 2Q9UA 3T3MB 3EH2A 2ZRFA 2C3YA 3AUFA 1ZJ4A 4AJHA 4OHZA 5FTKA 3OSUA 5AW9A 1ID8A 3NZEA 5JWHA 1J2EA 2COKA 2OB1A 5IT9A 2X19A 2ZJ4A 2R66A 3VR0A 4WADA 5DP1A 3DXXA 3ZIAD 4Z2YA 3CF6R 4XVCA 3DNFA 1E3TA 5T64A 3L4JA 3FJ1A 3TE7A 3A04A 4OX9B 5DTIA 4YJ3F 1XCLA 2BUCA 1JSLA 3L93A 1WQ3A 2V6BA 3LYLA 1IZYA 4RHFA 3JR7A 1BE6A 1EEXB 2B4KA 2GD6A 3IEIA 3OFKA 1II0A 1GQYA 1LC0A 4TLCA 4DSUA 2Q35A 1Y9ZA 1V9SA 4QATA 3C3WA 3JYHA 1DCTA 1Y9DA 1M2NA 2C99A 1NOKA 1Z82A 2H57A 5T6BA 3DW1X 1SEPA 5A62A 2DKFA 1GO2A 2M32A 1U2RA 4UUOA 5DUCA 4X1KA 4QJ4A 5I4BA 1YQQA 4EDHA 1I1OA 3MJRA 2NO0A 3WKAA 4E12A 1U28C 3KSMA 1EVQA 1N9ZA 4RPIA 5MHTA 4AKHA 1PDOA 3JAMA 3V1NA 3WSWA 5IVKA 5HBRA 4JI7B 4G0MA 4BN4A 4U1AA 5IAAA 2VSSE 2VHVA 2OPHA 3BM5A 3F8SA 3SKXA 4K9RA 4C5AA 4HVAA 2A6PA 4YLHA 1UZNA 3ZKAA 1J8QA 3O5AA 3OY2A 4MYSA 4B73A 5LXTB 1E6LA 3E18A 4OQXA 3AVYA 2QVGA 1O54A 1BKYA 5DW0A 5JC1A 4CEHB 4CEJB 3A4VA 2NPOA 1OXVA 3AM3A 2ZE6A 3IDSA 4MWGA 2Z2YA 4ZC1A 3Q0GA 2Q2OA 4EIWA 5GZ6A 2W83A 3H81A 1PZNA 3EIHA 3MCUA 3PL1A 3RSLA 2X5NA 1GTMA 4N40A 3RIGA 3D7SA 3IUNA 1NMXA 4WAUA 1VIYA 4I3HA 1XLWA 4R9RA 4C2BA 5CDTA 2BZ0A 3SHOA 2R6ZA 2F1HA 4GOND 4E5VA 3OD5A 3DOOA 4ZYUA 5GGXA 2VDOB 4RADA 3TS1A 3AR6A 1SMKA 3K9FC 1H2ZA 5ICSA 4V2UA 3BTUA 3ZU6A 3PQ6A 3AR4A 4R1MA 4MRVA 3VV3A 3VO9A 3PJEA 1FYVA 3A3KA 4RVCA 4EHNA 1RABA 3NC1C 4QOJA 3QFHA 4Z9YA 4ZVVA 2NOAA 1EFRA 5EHGA 5HRUA 1HC7A 5ULLA 2GTRA 2GILA 3UN1A 3O2NA 1ILEA 1BO6A 1AKEA 2JPDA 3AGPA 3BRWA 3HLKA 3T5AA 4RTLA 3ONNA 3FG9A 1N5LA 4GRIA 1P9WA 4RK6A 1B3RA 2UZ3A 4FBMA 3PKIA 4OBWA 3DDCA 3A6KA 4LX0A 1P0CA 5HMLA 2PNJA 3PNOA 3E0QA 1Z8NA 1B74A 4PYKA 3V97A 4H1WA 1KMCA 2HAEA 1VBKA 3EQ6A 1H4VB 2HSWA 3OCVA 2ZR9A 3W5UA 3VGJA 4DDWA 3GLFB 1R37A 1CHNA 1H8HD 4MKZA 2CHFA 3MQFA 3RYTC 4KRFA 4GU5A 1LW7A 4NHOA 3KT0A 3C2QA 4QPZA 1S01A 4QEZA 4LYJA 4G5HA 1QV9A 2QVBA 4IDCA 3MD9A 5T4FA 2BH9A 2BI4A 2ISQA 3R20A 4BO4A 3W9SA 3ZNNA 1SXJD 4O3FA 5FIFA 1W19A 2OGTA 2GWHA 3WGGA 1GZ3A 2JAXA 2QN8A 3DBOB 1JMVA 3S0JA 2FPLA 1JLLB 1QYXA 3HCEA 1CD5A 4P7FA 3MJHA 2YUIA 2XNHA 2XHEA 3EDYA 1PNQA 2FB9A 3Q2KA 4IL5A 3UMGA 5KVAA 1AH2A 4CLEA 2NN3C 3CW8X 4PBSA 1DIHA 1YQTA 1T29A 4RGBA 2Z04A 4DG5A 2JC3A 2Z4SA 1SA0A 4R01A 4DOMA 3GA7A 1WL8A 1F6BA 7ADHA 1UQTA 2ZRCA 3L3SA 4YJKA 2PXHA 4UNRA 3LG2A 3E9CA 4NNJA 4ZJUA 3EGDA 2PQ0A 4C87A 2FZWA 1DEXA 2E49A 1QH8B 2ZAGA 3H2YA 4UKDA 3V5EA 4FOLA 1DOZA 4LGVA 3T34A 3WHIA 1UC5B 2RMKA 2P3LA 3ILXA 1S3IA 1A8SA 5TGTA 3ZDXB 4DIEA 4F5YA 1PTKA 5JBNA 5D51S 1M8PA 1TMYA 1V5FA 3Q1KA 3U5ZB 1QQ6A 1XD2A 1V8PA 1FW6A 4LMAA 1E2EA 4AYWA 3EWNA 4EPYA 1X74A 1N7JA 5EXPA 5K6AC 1W36D 2Q34A 1JEAA 2YOHA 1NJ6A 3OE5A 3E9MA 3ETDA 4URFA 1ZGJA 2ZSDA 4D9GA 2V0NA 5CX1A 1KERA 2HH9A 1WEKA 2J0UA 5JDIA 4TYQA 2VJDA 2Y1OA 3GLUA 4K6GA 4BFXA 1SQ5A 4V0MA 4DEYA 4E1BA 3GLGB 5I9MA 3VKWA 3PC6A 4I5EA 1PGJA 4TTPA 1AKUA 1SB9A 2ZS7A 3TTYA 3IVXA 4F56A 2WAMA 4JCSA 3ZDCA 3PLRA 1NXPA 5LP6B 1GRQA 3C3MA 3CRW1 2QAIA 3K9WA 4P86A 2QTVB 1OXTA 1PQ4A 5L6LB 2CXSA 3CXRA 2EWMA 4ZPXA 1O95A 2LKDA 5G0SA 3RFVA 2GZ1A 5LJIA 3LXMA 1HLPA 1TVCA 4JXJA 1V1MB 5DMHA 1M6VB 2JIOA 2CV2A 4JQSA 3TMYA 3TMAA 2GAFA 3WFIA 3HCOA 1FRFS 2FK8A 5AJTA 1OI3A 2AVDA 2HT1A 1D03A 4WJZA 4LJSA 1LBEA 4LNUA 5IXYA 4R7ZA 3DQPA 4FN5A 3DEHA 2EKQA 4DDHA 1WJGA 1XMIA 1P9LA 3KWMA 4JOTA 2PX6A 3A4MA 4G86A 2ZKLA 3KZKA 2Q6OA 3VTFA 1GZ4A 1WCYA 4KGDA 2O9JA 3PCXA 2EWVA 3FZYA 1NUPA 4E5KA 4IVRA 3R41A 2ZRGA 1GFSA 4LSWA 2A9VA 2Y66A 2MCFA 1G63A 5A03A 3ADCA 1X92A 1JQDA 3EPLA 1FTQA 1NVUQ 3GJ7A 1G55A 4H6XA 4RVNA 1U8YA 4RF4A 1BX0A 1Z47A 1W29A 2EJVA 1DIOB 2WF7A 3D3WA 4RA6B 3W9YA 3FYUB 1N2HA 1E2IA 1ECJA 1T2CA 4N41A 3TLGA 4QZVA 2F00A 2VTVA 4DCJA 4E3WA 2GLTA 4DMCA 1NXQA 1T0IA 1OBCA 4KR0A 3ZHUA 1N5KA 4F4JA 3LP5A 2YWFA 1RYNA 3IBSA 3RG8A 3IAXA 2J0SA 4C4TA 1WZIA 3TGWA 2O3TA 3WS7A 1J2TA 4IV5A 1P1BA 4P08A 2DFNA 2NUPA 5DEOA 2EQAA 3V8VA 1L3CA 1I7LA 2B7LA 3HJGA 1HMYA 5M29A 1MKYA 3JYOA 2JK1A 2WHXA 2PKCA 3VO8A 4YECA 5LBUA 3IERA 4Z4HA 1QYWA 1VL5A 2R84A 3CPHA 1UPUA 2B1IA 4AZ0A 1ZZGA 2CD7A 5CYGA 1SIBE 1Z4IA 3AESA 4UHHA 3CSSA 3WRYC 1C9DB 1PZFA 3ANSA 3QG1A 1S3SA 1C1HA 1BE1A 1R3DA 1J7KA 1LSSA 1I3NA 1I14A 2Y1EA 4M0DA 3A3NA 3TTXA 3CZRA 1NVDA 3G2LA 3O26A 4TRMA 4FSXA 1LF0A 1PI3A 5IHPA 1B14A 4G23A 2R85A 1YNSA 4BATA 4D9BA 4YAIA 4Y2JA 3RWOA 4N5LA 1BMTA 1X38A 2YHUA 4BLOA 1RWXA 3FSEA 4J0FA 2VDUE 3DJYA 3MJEA 2AMVA 5KI6A 3FD8A 3UQYS 4WKPA 3N7AA 2AZMA 1GAQA 1RLOA 4IUYA 3BE6A 3WBJA 1FQKA 2JLQA 4C43A 3FVTA 3GMDA 1DCFA 1QHHB 1SULA 2AOTA 3EGXB 5IM4F 5KO2A 5LQRA 5U9CA 1VLHA 5H3CA 2XYPA 5FB3A 1LXCA 3D8SA 4BXOA 2BI7A 2RH4A 1NF2A 2HO4A 2XMBA 4QUGA 4R51A 2QXUA 5HJ2A 1WY5A 1SUIA 3CO5A 1JT9A 1AKVA 2J3KA 4IHQA 1E2LA 1EDZA 1IMOA 1XCOA 2C20A 2OCDA 4RD3A 2WUEA 1UJBA 4FMBB 4JT4A 2IEIA 1NFQA 3LUAA 1N7GA 2JGIA 1VLZA 2F1JA 3OX3A 2H7VA 3WGJA 3IEKA 4M87A 1J9EA 4R40A 4A26A 1T1JA 3ORHA 1HYQA 3MOGA 3U1BA 4B8ZA 1PHPA 2MINB 3O2QB 4OX9Y 4P2GA 1U0FA 3HP0A 1Z6AA 2IVFA 2Q2QA 5BQPA 3I6ZA 3GEMA 2F1IA 4H17A 4CFYA 4QLAA 1MC5A 1STOA 1U4SA 5BYKA 3HBNA 4Y1RB 5AVVA 2XE6A 3C8DA 2IEXA 1MIHA 3CEJA 1IK6A 2X3YA 3K30A 3ZZUA 1ZIDA 4PQYA 4XGRA 3G7NA 1QE3A 3G5LA 4B6GA 3L8HA 4MUKA 1DS6A 5BXYA 5C9ZA 1RXIA 3D2BA 2G0NA 2EZUA 2FFAA 4FE3A 3HU3A 4BV9A 1H2AS 4G1FA 4MV7A 2R6CA 3OPYA 1BYIA 4MLDA 3Q98A 3KJXA 1L7EA 3GQBA 2OOSA 5JHGB 3I9OA 5JH7B 1H9CA 3UGKA 4QFDA 3O8QB 3BMQB 4WLFA 2RGNA 4TRRA 2G70A 4UVIA 2OCGA 1E5VA 2Z9CA 5DPMA 1S6YA 4DM3A 3G89A 3LT4A 3EVZA 2WYVA 2AK3A 1KEPA 4YROA 2OZPA 3N0TA 1KYVA 3FCAA 3LBHA 3N6XA 2FFRA 1OLOA 2WIDA 4HWRA 4OHRA 3DXFA 3ER6A 4K9DA 4PGMA 4D4LA 1GGEA 2JGDA 1JG3A 4Q37A 4UW9A 5J2TA 3UPUA 2ZCUA 2A8YA 3FGOA 4Z1MA 4DB2A 3HZHA 1GHTA 3TL6A 2FZCA 4YC7A 3DO8A 1SXIA 3HYSA 4H3SA 4ER0A 5IF3A 3WLNA 4KI0A 2N75A 4XSGA 2YY5A 1D4ZA 3RJZA 4WN9B 2AX4A 1QBKC 1P7PA 1DZIA 2VXYA 2YIJA 1RAIA 4JOQA 5FV7A 3HZZA 4EL5A 2VT3A 2VQDA 3LL4A 1F0NA 1JLSA 1I6MA 2BBOA 1E2FA 2HREA 3BCSA 3QZUA 4YMLA 1CYEA 3E48A 2H0AA 2O8EA 3AO0B 2HN9A 4BN5A 1E8MA 1MDBA 1X39A 3LYUA 3MN1A 4JYMA 3BXGA 2PJZA 4KK4A 3DE3X 1KP3A 1L5ZA 2HYDA 3JTEA 4Q6WA 4GI7A 1GU7A 4POOA 3OP1A 1X8JA 5TY0A 4RH1A 1SUBA 5F7JA 1XTPA 1N1MA 3T7RA 4ZEVA 3UKJA 3BGIA 1RQRA 1YL5A 3X1JA 2RGRA 4WXYB 3GDOA 5F78A 1TTHA 1OLXA 2ZFUA 3JVEA 1UBLS 2YASA 3NKVA 3PFNA 2ZJBA 4YMIA 5TMBA 3THWB 3HSYA 1GAEO 4KW7A 5ADUS 1Y7LA 5CG1A 4G8DA 3A9CA 4Q21A 2ZSJA 1Y7PA 4WNCA 1E4EA 1NMSA 5AOBA 5FBKA 1LBQA 1NF8A 5BN4B 3EZNA 3HABA 4UDNA 4A82A 5ESWA 5TX7A 1AHNA 1MH9A 5KDRA 2G5GX 4YQYA 3TFOA 3VIVA 2GOYA 2X7JA 3ZHOA 1YB2A 1C1XB 2P2DA 5B3JA 4RLSA 2W70A 2OECA 1EGVB 3GBPA 1Q15A 1IHYA 1ZOLA 4BFYA 4QC2A 5T3YA 1G5IA 3CUKA 3X1DA 4HVCA 4JA2A 4CUJA 5PNTA 1EUDB 2O7RA 2ZYUX 3ZR4B 2E4YA 4MKXA 4JVMA 4AZTA 4ARUA 4YHHB 1GQQA 2JGKA 4GOJA 1YCDA 2DJ5A 1VE9A 1QZTA 3ZHBA 1VLJA 2FW1A 2NUAA 1ZRNA 3G8AA 2QTZA 1RWVA 5A7HA 5JJCA 4GKJB 3THYB 2W2MA 3BMCA 2ZQRA 4KVFA 1NLUA 2G67A 3G0DA 4TKMA 2I22A 3DPIA 3T9CA 4S24A 3DNPA 1T26A 1R0LA 3O03A 1VKZA 3OFNA 5DWDA 1GZDA 2PKWA 3S1LA 3QNWA 4ISCA 4EUEA 5DGDA 1CF9A 3QNMA 4E30A 2AR9A 4H7EA 1GG8A 3LY9A 4W1SA 1HR0B 4EMUA 5ES4B 1QFZA 4GUDA 1NJ5A 5BR8B 1XKXA 2I6SA 2IZ7A 1PG2A 3C5VA 3ORRA 4L3VA 4Q3BA 7REQB 1VRCA 4RYFH 2XDWA 5GJVC 1T2EA 2PUVA 3QE3A 3RSGA 5JS2A 4R1OA 3GFFA 2YUTA 2PRZA 2PGAA 4NEHB 4FHCA 2Q9BA 4FNMA 5J4VA 4EABA 2VSUA 1Z2AA 1CF4A 3FJYA 3FNIA 4URWR 2CLKB 2V5AA 2ZYAA 4D3DA 3K6JA 1Q21A 2DKNA 4YQEA 2HU2A 1XCPA 2ZYWX 3OLXA 3QU7A 4IQ0A 2ZJ7A 3LHSA 2Z3ZA 4M36A 1M67A 1S2LA 2XSZD 2BGRA 5HFAA 1BRMA 3CZ9A 1T24A 3VR2A 1X7YA 3U9SA 3AQIA 1XTQA 4YCJA 2LDBA 5JSFA 4MLZA 2P3OA 3DB1A 3UFXA 3RVBA 3KEGA 4J0HA 4C0SA 1T5DX 3V8BA 2XXAB 3AUKA 3K70B 2QX7A 4RJ2A 5K3EA 2HGZA 2V4MA 2IYWA 3U4DA 2ODTX 1C8LA 1Y6ZA 1E1RA 3JQFC 5ESXA 4BJ6A 4CMCA 1BTOA 3ED1A 1T4BA 2H4WA 2HQOA 2QTBA 2JK0A 3IS3A 5AHWA 3UWKA 5B3AA 1A76A 4MQFA 4OH1A 4OPMA 3R7AA 4IDGA 3CNLA 1RCFA 3HHEA 1H8HA 1Y6QA 3PYLA 4A0QA 1AHHA 1Y48E 4QTZA 4BMDA 4DEVA 3LRTA 3K4QA 1VYTA 2MSLA 4GIBA 4N0DA 4D9JA 2VSSA 4KGVA 4YRKA 3AX6A 3OCCA 3T38A 4PLFA 5CXUA 1T9ZA 2QL7A 2B82A 5IS2A 4C0JA 1SXJA 5DGTA 1WXHA 3EZLA 1BU8A 1WNTA 1AQIA 4AG6A 4Q9DA 4XEUA 1US8B 4NHEA 2ZUFA 3MGBA 3HA2A 1ON9A 5FNZA 3B85A 4Y0VA 4YP5A 3C7TA 3Q3IA 3TVYA 3WAKA 4PAQA 4TKZA 4M8KA 1VKRA 1SQGA 2IXAA 2Q49A 1LFAA 2FJUA 1V3QE 2GGSA 5AKZA 3HO8A 4MJXA 4YCBA 2BM0A 4BFTA 3VBEA 1YE8A 3ZHRA 5P8WA 3O8RA 4X97A 5HM6A 1PJ3A 4TTVA 2ZRAA 1S8AA 2O3UA 3GFRA 3HH8A 3ITNA 1F8YA 1FFAA 3O4GA 4WZZA 3T5MA 1DPGA 2FFHA 5TGZA 2NVOA 5E6UA 4ZZIA 1A9PA 2E18A 5EE1A 1WVGA 3RV4A 4A9AA 4OA8A 5F35A 1QDUA 2HBQA 4NZNA 3DPUA 4XVHA 1UXJA 5DHPA 3SX2A 2VRCA 4O33A 4WOCA 4EKGA 1C14A 3FHLA 1I4OA 2D06A 1QHNA 2GFHA 3PNPA 1JEJA 1WCWA 1U6KA 2G1PA 2IZ5A 3KFVA 4RXUA 5IC4A 4LDZA 5EJ9A 1RLJA 2O06A 4ZOAA 3B36A 2XT0A 3D81A 4UE2A 3VPGA 4Z9BA 3MYRA 3EOZA 4UQLA 4BYMA 3S8YA 3KFLA 4IMPA 3E3NA 3LKVA 5T67A 2H2GA 2NU8B 3NNNA 3QBVA 2NZYA 2O2CA 2YHAA 2PMBA 2V7EA 2VK8A 3VKUA 1P44A 1AZWA 2AG8A 5K3AA 1KDVA 2OGUA 4OLHA 2YICA 1H2BA 2CZQA 2H0RA 4RFSB 4HUJA 4URXR 1JSXA 4DXAA 4IDAA 5ALPA 3NHKA 1COWD 3Q1LA 4KUHA 4MWSA 1ZXLA 4HC4A 5J63A 1G9XA 4DV1B 5JAUA 1BHO1 2A7KA 2CE2