3ZW8A

Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) in apo form
Total Genus 277
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
277
sequence length
725
structure length
725
Chain Sequence
PRGSHMAEYLRLPHSLAMIRLCNPPVNAVSPTVIREVRNGLQKAGSDHTVKAIVICGANGNFCAGADIHGFSAFTPGLALGSLVDEIQRYQKPVLAAIQGVALGGGLELALGCHYRIANAKARVGLPEVTLGILPGARGTQLLPRVVGVPVALDLITSGKYLSADEALRLGILDAVVKSDPVEEAIKFAQKIIDKPIEPRRIFNKPVPSLPNMDSVFAEAIAKVRKQYPGVLAPETCVRSIQASVKHPYEVGIKEEEKLFMYLRASGQAKALQYAFFAEKSANKWSTPSGASWKTASAQPVSSVGVLGLGTMGRGIAISFARVGISVVAVESDPKQLDAAKKIITFTLEKEASRAHQNGQASAKPKLRFSSSTKELSTVDLVVEAVFEDMNLKKKVFAELSALCKPGAFLCTNTSALNVDDIASSTDRPQLVIGTHFFSPAHVMRLLEVIPSRYSSPTTIATVMSLSKKIGKIGVVVGNCYGFVGNRMLAPYYNQGFFLLEEGSKPEDVDGVLEEFGFKMGPFRVSDLAGLDVGWKIRKGQGLTGPSLPPGTPVRKRGNSRYSPLGDMLCEAGRFGQKTGKGWYQYDKPLGRIHKPDPWLSTFLSQYREVHHIEQRTISKEEILERCLYSLINEAFRILEEGMAARPEHIDVIYLHGYGWPRHKGGPMFYAASVGLPTVLEKLQKYYRQNPDIPQLEPSDYLRRLVAQGSPPLKEWQSLAGPHGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PEROXISOMAL BIFUNCTIONAL ENZYME
publication title The Isomerase and Hydratase Reaction Mechanism of the Crotonase Active Site of the Multifunctional Enzyme (Type-1), as Deduced from Structures of Complexes with 3S-Hydroxy- Acyl-Coa.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 277
structure length 725
sequence length 725
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.50 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3zw8A03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3zw8A02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3zw8A01
4WECA 1E0DA 1I2CA 2EP5A 4CQMB 2LDBA 5L4NA 4ZQHA 3LQFA 1T25A 1H9AA 2OL4A 4BVAA 2NM0A 1FC9A 3GF3A 3MCVA 2Y1EA 1T4BA 4PGFA 1PS9A 3KVOA 3EZYA 1NP3A 2JD1A 1ZNQO 4FS3A 3X2EA 4IQ8A 5F21A 2VRCA 3LC7O 1J6UA 4TVBA 1ZK2A 3KTDA 3WWYA 5G0UA 1MXHA 3UOGA 3AW9A 3BA1A 4HX5A 1Y5RA 1HZZA 3MJTA 3AOEC 1LX6A 2X0RA 3QVSA 3HE3A 3U0BA 1VKNA 3X2FA 1E1LA 1KS9A 4C7KA 4MO2A 4B4OA 4XEHA 4OLQA 3DDNA 4IQGA 4CM3A 1ONPA 5G0TA 4RDHA 4BNXA 3DAGA 2VSUC 2A92A 3ZWCA 1UXJA 2EW2A 1XEAA 1E5LA 3JQBC 4QQRA 5B1YA 1NTOA 3U62A 3GHYA 2OGUA 3PPIA 3QVXA 3UF0A 1ISIA 4PG6A 4GI2A 4LRSB 3F47A 4A0SA 3RROA 1N5DA 4M55A 2WYWA 3O03A 3DJAA 3BIOA 3ZWPA 2ZIZA 4DTIA 3MFMA 2W98A 5G0WA 3CMCO 1EUZA 3DWFA 3VH2A 1X0UA 1ISHA 3JSAA 2YDYA 1M2WA 3PWSA 4CMEC 5JAIA 1CEQA 3PLRA 4E21A 2JL1A 1DIGA 1JW9B 3E5RA 2FW2A 3DMTA 3JD4A 5INGA 5HRUA 2H1SA 5CEFA 4DRYA 1Z45A 4J16A 1BMDA 3KYDA 1N1GA 2GO1A 1PJQA 2ZJ0A 2SCUA 4UAGA 4YPOA 5JMPA 3D5QA 1DFIA 1XELA 4JP3A 4LCEA 3WGOA 3OMLA 4ELSA 5IN4A 4TSKA 4ZU3A 4I9HA 3IP3A 1TYFA 1HNUA 1YXMA 3PHIA 4TRMA 4N5MA 2PG8A 1ZK1A 1YQXA 4JLWA 4MVJP 4RZHA 4W6ZA 5CP8A 4F6LA 1VPDA 4QFEA 1E3IA 4QTZA 4Q1IA 4FJ0A 3MEQA 4BS9A 1KETA 1YB5A 4P4NA 4HC8A 3OA2A 1K0UA 4JCTA 3PIDA 1QV7A 3OMEA 4ZQBA 1ORRA 5C7IO 1ZH8A 2EP7A 2QQ3A 2VWQA 5L95A 4ZQEA 4EI2A 2Z1MA 3FSRA 4D41A 3D7LA 3VAZA 2Q50A 1XYGA 5U1PA 3H3FA 3INRA 2A81A 1NHWA 2J3JA 2F9IB 3VPSA 3GFBA 1DIRA 3ASUA 3RUFA 1PWXA 1WLYA 3M6MA 3S8MA 4QIJA 4BOYA 4CQLB 1DLIA 1XLTA 3RUDA 1NVGA 2BH9A 3PQFA 1SPXA 2HSDA 2LDXA 4TZTA 4G2RA 2J3IA 1A5ZA 3KUXA 2V7PA 1BDBA 2WD7B 4IM7A 1LLCA 4NHEA 4U0GA 3WOHA 4ZQGA 1PR3A 1ZXBA 1R4NB 4IBOA 4AJ4A 4GSLA 1IHYA 4ZU2A 4HP8A 2DUWA 3OH8A 3KETA 2PD6A 4Z9XA 3ZH2A 1PQWA 4BMNA 4I5DA 1PL8A 1IPEA 4R68A 2CD9A 1W8DA 3AY6A 3RBZA 2B36A 3GEDA 4FN8A 4L76A 3TL3A 3QYRA 3PJDA 3RJ9A 5JYEA 4GSKA 3EMKA 3PI7A 4E6PA 5CG2A 3NTRA 3B1FA 4HADA 3H0UA 3V5EA 2C29D 2AA3A 1BXGB 3OF2A 4PZDA 2AQIA 2FN7A 3U9SB 3DORA 3LLSA 3KLPX 1LDBA 4QX6A 5TX7A 1U3WA 3JD0A 3ROQA 5DOVA 1C1XB 3OIGA 5HS4A 3WMXA 3OP4A 3R0OA 5MDHA 1Q2XA 3E1KA 3EW7A 1EVZA 3F4LA 2X0IA 3F1LA 4WLOA 4JJTA 3VVBA 4J0EA 2GCGA 3WTCA 4BQRA 4CMCA 3PGJA 3RKUA 4NBRA 1SZOA 1ULUA 1PS8A 3H9JA 3ZWBA 4RLHA 4WJZA 3TZ6A 4DYVA 4DBVO 1U7TA 3NT2A 3R6HA 3EK2A 3IMFA 3H02A 4BB5A 5BNFA 2DLDA 1M6WA 5A9SA 5IXYA 5DZKH 2WE8A 3QWHA 2GR9A 2YHIB 3E9NA 4WEQA 4BO9A 2XF8A 3ZU4A 4DQXA 1ONOA 2CF6A 3GUCA 1DIHA 1R0SA 3GRPA 1V9LA 4YJFB 3WIEA 4PLVA 3ETDA 4B8ZA 5DL1A 5INIA 4Z3KA 1DAPA 1GZ3A 5EERA 4P4GA 5AXDA 1XWFA 2EEZA 4CLXA 4NJOA 3SXPA 2HMTA 3DQPA 4ASIA 1Y8QB 2OORA 1WDKA 4ZDEA 2PKQO 1EDZA 3GR6A 4GL4A 4FB5A 4J0FA 2CE3A 3TVWA 2E4AA 3PEFA 4RYFA 3AM5A 7MDHA 4MI2A 4QO8A 4IDEA 1KIFA 5HBRA 4XYEA 1GEEA 1R0KA 1JAXA 1VRWA 2C54A 1WP4A 1MFZA 1ZIDA 2NU7A 3ADPA 3M1LA 1XU7A 5J23A 1MC5A 4D42A 4WCZA 3C7CB 3M6NA 4YJHA 3V5IA 2DC1A 1ZK0A 2B35A 3GT0A 2QZZA 3FTPA 1ZSVA 3WNQA 1C0PA 3IB9A 5DP1A 5F5LA 3GH3A 1X15A 2BELA 5EJ2A 2FR8A 4N5LA 2WYVA 2FZEA 4JYLA 1PSDA 4R3WA 3DZHA 1H0KA 4OJNA 2FR0A 4BMSA 4DLBA 4I9NA 4L8KA 4ROSA 4FCCA 4JK3A 3TVUA 1KERA 1MFPA 3WQQA 1I0ZA 2XXBA 2HMUA 3ZNPA 2W3PA 1E1MA 2ZYDA 1HLPA 5I9NA 1UUFA 3TOZA 2GZ1A 1E6UA 2HUNA 3AM4A 4WOJA 4CQLA 2EG9A 3PZRA 5BR7A 1WW8A 4L8VA 2BFAA 4U7WA 1MP0A 2X4GA 4GPD1 1UZNA 3WQSB 4J9VA 3VPHA 3IUPA 4JSBA 1O94A 4LMRA 4OL9A 3JQGB 2WD7A 1HETA 4D43A 1ZEJA 5CEJA 3LKEA 2PA3A 3GPIA 1ZEMA 3QQPA 4XJTA 3VHRA 1R4NA 1T2FA 4RQTA 4AJ2A 1JLLA 2A4KA 1QKIA 3QWFA 3RKRA 4CMKA 4GM2A 3ZWYA 1Y8RA 1O89A 3D4PA 2Y0DA 4TROA 2C7VA 2AEJA 2X1HA 3O8QB 1N9GA 4DMMA 2HRBA 3UAGA 4R5MA 2UUOA 4BNFA 1WDMA 3HQ4O 3ZW8A 3PGXA 1JDJA 1P1IA 4W82A 5CPBA 3DBHA 4TMFA 4OQZA 3NTOA 1B14A 2FMUA 2YUTA 1GCUA 3VH4A 5FI5A 1DLJA 1U3UA 2NVUB 3OM9A 4BNKA 2QHXA 1VJ1A 5CDGA 3F9IA 1N2SA 1T1SA 1LDYA 3M1AA 4JCRA 1ZKMA 3LYLA 5JW6A 5A3VA 2I67A 3M2TA 4CM4B 3GNSA 1LRKA 3VVCA 2GNAA 4U19A 1N1EA 2J5RA 4ND1A 3I83A 4XWYA 1M66A 2JAPA 2ZK7A 4TQGA 3S2FA 4E30A 3V2UA 4JN6B 3WGHA 4MIOA 3H81A 2H63A 4MINA 4U1AA 4DQUA 3TWOA 1EVIA 4WLVA 5JC8A 4MKRA 1PJCA 3WGQA 4MP8A 2YHIA 4ZRNA 2UDPA 4DL9A 1XQ6A 5DU6A 3DBRA 2HK9A 3L4BC 1FMCA 3ZGYA 4YJFA 2R2GA 3FWZA 3LK7A 5T64A 1NVTA 2NUAA 1NFFA 3VPFA 1HDRA 4DPLA 1TG6A 1XNWA 4XRRA 3K2EA 3RI3A 1B2LA 4NH4A 1LSSA 4MIYA 1Y8QA 2YHUA 3W1VA 5KDRB 1B16A 5AOVA 1NQOA 4RLSA 4GGPA 3JQCA 3IUSA 1HLDA 2YZ7A 5CDSA 2HO5A 3QHAA 1RM0A 5KNLA 1EF9A 5EQFA 2PPYA 2PV7A 1Z73A 3RFXA 3JQFA 3F4BA 2QG4A 2J5II 1E1NA 3IOYA 4FNDA 3GAZA 1FC6A 3E9QA 4ZA2A 1ZBQA 3BTUA 2H6EA 5E0NX 1QMGA 4NIMA 5EPOA 1NR1A 3GNTA 3WB9A 2AE2A 3ITKA 1OZAA 3W4IA 1IPFA 3QJ5A 3NT5A 2A94A 5CHEA 3RC2A 3K92A 3HN2A 2WTBA 5DOZA 5DT9A 1EVJA 1UP4A 3JYNA 3PDUA 3WX0A 3ANLA 3AWDA 2P4HX 5G0VA 1ZFNA 4RQUA 2VZ8A 3NTQA 3B20A 4JCQA 1FDVA 4AJLA 2VSUE 4Y6PA 2FR1A 1YO6A 3AOEA 3BZUA 3CKYA 5IDYA 4M49A 3K9QO 4BO5A 4JVTA 1AGNA 4FD3A 4XQGA 3CZMA 4JXKA 2GLXA 4N54A 4U0KA 2P91A 1HZDA 4R69A 2VSSA 3H9EO 1PGPA 4PLWA 4BNYA 4LISA 1UYSA 2IXBA 1JVSA 2ZJ1A 2C5AA 1MB4A 2DBRA 1TT5B 2JFFA 3JQGA 4R1TA 5U4QA 1DC6A 5KIAA 1ADBA 1V35A 2VSUA 4BV9A 1CJCA 2RBEA 2VYNA 2I3GA 2Z5LA 4DGSA 3JQBA 3AY3A 2NU8A 2HJSA 1E7MA 3HDYA 3AU8A 1SEVA 3HFSA 3ZW9A 4MVJH 3O8QA 2I6TA 3NAQA 3VPXA 3TDKA 4IDBA 2HMWA 2EKPA 1KVQA 3DR3A 3RU9A 3HG7A 4FNBA 3BYZA 3CEAA 2GN8A 2JD2A 4HKTA 2B0JA 2CSUA 4ELXA 4CMEA 3UGKA 3GDGA 1GV1A 1WXDA 1BRMA 1PZEA 4C7JA 2Q2WA 3RVDA 5DTPA 2NVUA 2EXXA 4L74A 1EVYA 2EGGA 1YJQA 2PH3A 5A1TA 3RUIA 3RAJA 1DIBA 4TRJA 5K6AC 3R6DA 3BTVA 4ZD6A 2NWQA 4NFSA 1UYRA 5JNLA 2X23A 4GX2A 4CM4A 1EFKA 1YWGO 1WWKA 4KTTE 4XYBA 3PQDA 2CF5A 1NPYA 1HZJA 5TT0A 5A02A 5C9GA 4JYJA 5IZ4A 3QWAA 2GASA 2XAAA 1IY8A 4PLFA 4BIIA 5JBXA 1O6ZA 3I6IA 1VM6A 2XOXA 1ULSA 2VWGA 1ENPA 1FDUA 3L0DA 4FBGA 4YVFA 4CM6A 3BTSA 3CIFA 4M86A 2Q4BA 3L77A 4DMLA 1TEHA 2X0NA 3NX4A 3Q6IA 4GQAA 3MOIA 4J9UE 5IF3A 3K8XA 3DBLB 1NWCA 3RUCA 2B5WA 4UEKA 3WGYA 4XQ9A 3D5TA 1N7GA 3TZQA 1IYZA 5G4LA 5FEUA 3WFIA 3MTGA 3PEAA 1EQ2A 4O59O 3A9WA 1LQUA 4W7IA 3OEWA 5KTKA 5DF1A 4MDHA 1DIAA 2OBYA 4WNCA 1Y6JA 2AG5A 1C1DA 5DDIP 2DT5A 1JKJA 5DZSA 3WGZA 4XDYA 2PFGA 5LC1A 4EMLA 5ITWA 3R0IA 1IHXA 3GN2A 1R0LA 3QWIA 4HUJA 4PVDA 4XKJA 5H83A 4LSWA 3SC6A 5F1PA 3PWKA 4YAEA 2JCXA 3Q7HA 2ZKLA 2JHGA 3N7UA 3NEPX 1E3SA 1H93A 1GZ6A 2IYOA 5CTBA 3BAZA 3UFXA 3WMWA 4OO3A 4BNHA 1Y7TA 5INFA 4MJLA 2Q1UA 4BKQA 4R1SA 1VJTA 4BNJA 1Y9EA 4K26A 4XQCA 4BNLA 2EWMA 4RVDA 5B4TA 2C0CA 5LDHA 4B3JA 2V65A 3ZHYA 2G76A 3E82A 1GEGA 4CJXA 4RO0A 3I47A 1HDXA 2PK3A 4CR7A 1NBOA 1A72A 3MJCA 4YAIA 2PZMA 2J5GA 2E37A 3SX2A 2PZJA 4RORA 4BQPA 3ROPA 4Q3CA 3AU9A 2W2KA 3ZWAA 4IXTA 3RUAA 4K6CA 4AFNA 4I8XA 2YDXA 3KHUA 2RHCA 3EZLA 3UICA 5T5QA 3G3EA 1VKOA 3KEQA 5JE8A 4RYFH 1E92A 4XZ3A 5DBGA 3RSIA 1TT5A 4CL8A 5B12A 1C0IA 1WPQA 4AG3A 5C5IA 2Y1DA 1K89A 3C7AA 4NR0A 4ONEA 2VUUA 4DC1A 2RAFA 5KJPA 2Q2QA 4I5EA 4ALMA 2FHSA 1HE4A 4JJGA 4R4JA 2VTEA 3V5NA 4HV4A 3ANMA 4NI5A 9LDTA 5T67A 2YJZA 3G1TA 4NNQA 1NASA 3U9LA 4I5FA 4MKXA 2AEMA 2Y0EA 3P7MA 4E33A 5AQ1A 2IODA 1JKIA 4J1TA 2J3HA 5IN5A 1D3AA 5JY6A 1ISGA 2O7QA 2XPCA 3ORFA 2ZTUA 4XA8A 4E32A 4MVJM 4BNUA 2EERA 4WZ8B 1KY5A 4GWGA 6ADHA 3I23A 3GLMA 4B3IA 2B83A 3RFTA 1LJ8A 5BSFA 2CVQA 3R3JA 1YOVA 5DN9A 3KTKA 3WLFA 1I32A 1PGJA 3HN7A 3BF0A 1N6EA 2ZB4A 4L4RA 3SJUA 5C3MA 4WLUA 2VT3A 2NQTA 1Z75A 5TJHA 4PN3A 2G0TA 5E0SH 3M6IA 4A27A 4CM1A 4EJ6A 2E82A 2X58A 3PFFA 5IZCC 1JXZA 3WLEA 1NPTO 2ZL0A 3BPPA 4ND5A 3DZKA 1C0KA 4J4HA 5DCWA 3H6KA 3TDCA 1BXZA 2VHYA 3KTHA 1CIVA 1Q7BA 1K6JA 3BTOA 3JD1A 3QP9A 3JQ9C 5ENVA 3PRJA 4FC7A 1ON9A 1E5QA 1Q1NA 3U4IA 2DBVO 1XDWA 2BD0A 2PD3A 1F06A 3BMCB 3GVIA 1GQ2A 1R15A 3DBLA 2DFDA 2BI8A 4CMBA 3MT6A 3B1JA 1OFGA 3Q3CA 2OBNA 3EGOA 3KTIA 1ZJYA 1X14A 3NDIA 4ITUA 5JCJD 5KJFA 1F8GA 3DMYA 4E3ZA 1Z74A 2BGMA 4DIBA 1T1RA 3WS7A 4TKLA 1J4AA 2UZFA 4PZEA 3WFJA 1EK6A 2G5CA 1SB9A 5I7VA 1E3JA 3BMQB 3KZVA 4EUHA 3KQFA 1QSGA 4E2YA 4Z0PA 4FFRA 4DYDA 3CMMA 3F5QA 1PJHA 1PJBA 3AI2A 4UVGA 1HKUA 2J5IA 2VREA 1DJQA 2X9VA 5TF4A 1DO8A 2J5KA 1EEHA 4LGVA 3CH6A 1PJSA 2FPPA 3KSUA 3KYCB 5DBFA 2BFOA 2ZL2A 1I30A 3S55A 5G0SA 4GVXA 2CFCA 2O50A 5HTOA 1VL8A 4N7RA 2G82A 1VL0A 4R3NA 4IY1A 1KVRA 1U4SA 1J0XO 1N8KA 2BFPA 2Q1SA 1KEWA 1C14A 3PTZA 3UUWA 1T2DA 3WSVA 4BGUA 4S1VA 3ZHBA 1KVTA 4R51A 3VPGA 1YL6A 4YDRA 1VL6A 3Q9NA 3SJ7A 1UIYA 4CMIB 3GA0A 4KUGA 2D3TA 2YV3A 1SZJG 2D0IA 1VE9A 4G5HA 4II3A 4OH1A 3WJAA 3HE2A 4GWKA 1E6WA 1BVRA 1HXHA 4IJKA 5AVOA 4H3VA 3FBTA 5C7OO 4NEKA 2GSDA 1WMAA 3VDQA 2O3TA 2P9CA 2PZLA 1DDOA 4OHUA 1NXQA 3WJ7A 4FN4A 1U3VA 3RU7A 1C3VA 4YT5A 5BNIA 3MJSA 3SLGA 1WZ8A 1WZEA 2WMDA 4ND2A 4U6SA 1K39A 4QECA 1BGVA 3E6AA 4KUHA 3EUWA 4UVEA 1NAHA 3DOCA 3I9LA 1NQAO 4BGVA 2HU2A 3TJRA 4Q3NA 2PNFA 3DL2A 4NG5A 5KWEA 4N5NA 4GX0A 4A5OA 2HKIA 1LSOA 1YQGA 5G4KB 1PJ2A 1GYRA 2X5KO 3L4BA 4D3FA 3ST9A 3I1JA 1R12A 2X7HA 5IDXA 3E5MA 1GYPA 2ZQZA 5ES3A 3ITDA 4QFDA 1A27A 1LDEA 3P85A 4CUZA 3OETA 3L6EA 4Z9FA 2ZTVA 4YRAA 4P8RA 3PQEA 4B7UA 1HSOA 2PWZA 2DPGA 1CF2O 2C20A 2I5PO 3GVPA 4JGBA 5TLSA 1NHGA 4BO1A 4QFCA 2HCTA 5CPFA 3IS3A 1DC4A 2FBMA 4FFPA 3BMOA 4Z3DA 3ZZNA 1RJMA 2GTRA 1MXFA 1PZGA 3DXFA 4NZ9A 1Y5MA 4XIJA 4WASA 4WPGA 5KVSA 3D64A 2X86A 4PG5A 1DPGA 4NBTA 2QZ9A 4Q0GA 5A3JA 1KY4A 4ALIA 4KZPA 1B8UA 3I9KA 4B4UA 1HRDA 2VRCD 1LUAA 1E3LA 4GMGA 3BMCA 4CV1A 1O8CA 2PZKA 1WZIA 3FCOA 3PFWO 4CMHA 3KTJA 4J7CA 4BV8A 3AUAA 3ZU3A 1VC2A 1W0CA 4K3WA 1B0AA 1Y1PA 4IPTA 2RH8A 4BNZA 4TRRA 3SBOA 3PYXA 2HRZA 5IXSA 4CQMA 4J1NA 5ER9A 2I99A 1NFRA 1NM5A 1OI7A 2WD8A 3OHSX 3T7EA 3UCEA 4B79A 3A28A 2C5EA 3INGA 3IQDB 4KWHA 4LSMA 1OBFO 3ROMA 3OEYA 3RUHA 3W6ZA 1LRJA 4GKVA 5JSFA 3LZ6A 1FJHA 2D59A 3GMSA 3JQ7B 3TLFA 3FR8A 4K28A 2NU6A 3GGGA 3TSCA 3DZBA 4L0QA 3KBOA 1E1KA 3I5MA 3I3OA 3KLMX 3QSGA 1YBAA 4O5OA 4DPMA 3G17A 4YT4A 5BSEA 4XYMA 1OC4A 3UH1A 2A7KA 2PLAA 3S1LA 4HFNA 4NFHA 1IUKA 1GADO 3KYCA 1EQUA 2GN4A 4RPKA 5AXBA 3ROKA 2GRAA 4ZN6A 4JCSA 2VT2A 4J4TA 1UP7A 1G6KA 3ON5A 1RM4A 4WYOB 5GZ3A 3PJFA 2GN9A 1PGQA 2BHLA 3H5AA 3KOUA 4RVHA 1TLTA 3P2LA 1KYQA 1HTBA 3TZ3A 4XDZA 4CLHA 2EV9A 4OG1A 4DVJA 3Q0JA 3BXXA 3PHHA 2Q1TA 2OXIA 4CMIA 4E13A 2ZB8A 1SC6A 2GDZA 5JDIC 4J2OA 5K6AA 1G1AA 4FJ2A 3NDJA 4BO4A 4ZICA 1M67A 1K32A 2Y68A 9LDBA 2Y66A 3P2YA 1R37A 2VQ3A 4CODB 4E5NA 2CUKA 3DZIA 3QVTA 1R4MB 2YQ5A 4A26A 2AMFA 4ZQFA 3RC1A 3LC1O 4AJPA 2F9YB 1Z82A 1P1RA 1QYXA 4QUKA 5THQA 2QX7A 4HNGA 3UVEA 2HJRA 1Q7CA 5JDCC 3I52A 4MPDA 4MVJD 4MVJF 2DU8A 8ADHA 3F46A 4RDIA 3PE8A 3ADOA 3DOJA 1DOHA 1ZSYA 3ANNA 4RGBA 4GBJA 4J43A 4AJIA 2CDCA 1MG0A 2R00C 3N58A 4RV9A 5KKAA 3IBBA 4K29A 4AJ1A 4RF3A 1HT0A 2Y1CA 3AUTA 3EAGA 1I3KA 2OUIA 1ON3A 2FOIA 1F0YA 4CM5A 5G4KA 2BGKA 3I9NA 3S2GA 5B4VA 1A9ZA 2YV1A 4HXYA 1WAMA 3WBFA 1UDAA 3ZV4A 1MX3A 1LXCA 4MP6A 4E4YA 3DONA 1YGYA 2AQ8A 1X1EA 3D3EA 5A5EA 2DM6A 1QRRA 3C3XA 3WXBA 2JD0A 1J5PA 3JQAD 1YG6A 3RUEA 3P5MA 3IJRA 4D79A 1P33A 2BKAA 3GVXA 4J4BA 3R9TA 5EINA 4B7CA 1P0CA 4CLRB 2FZSA 5MGBA 3U49A 1KOLA 4KMSA 4J3FA 3Q2KA 5KCZA 2F9IA 4ND4A 4KDFA 4IXWA 4BL5A 3ST7A 1OOEA 1Q0QA 4ND3A 1GZ4A 3QVOA 3ICCA 1UXHA 4Q3BA 4GVLA 4LN1A 3UKOA 3Q1TA 4XR4A 4TKMA 1I24A 2X24A 2NP9A 2B37A 3GF4A 4FW8A 3C1TA 2O2YA 3ZN2A 2EKLA 4MXIA 1X7GA 3C1AA 1GY8A 2FPIA 4GKBA 3ZV5A 5L45A 3QXIA 2CDBA 5BSGA 1W6UA 3W8EA 3H0JA 4R16A 3OICA 3Q9UA 4OGWA 1U5AA 2W2LA 3ZU2A 3IDSA 4BO6A 2X22A 2Q99A 2J5SA 1YQDA 3WYCA 4AJOA 2V6FA 4YJDA 4YACA 4HNHA 4YEDA 1NZYB 3ENKA 4Y8VA 1H6AA 2AG8A 4XJSA 4E5MA 1YKFA 1JKFA 4XR9A 3FHLA 1R6DA 1UP6A 3K31A 4J49A 1B26A 4FN7A 1P0FA 1Q0LA 1EF8A 1AHHA 3P19A 2WEKA 3PWZA 1BXGA 4I5GA 3VZRA 1E3WB 3VDRA 4F46A 2VNAA 3L6DA 3T89A 4U0HA 1ZUD1 1GUYA 3S2IA 2X5JO 2W4QA 4ALJA 1HWYA 1ADGA 2QW8A 3T4EA 4EMMA 1HYGA 2WM3A 1C1XA 4YRDA 4ZJUA 5JBIA 3ZNNA 4W9NC 2WSBA 3JQ6A 1DUBA 3RQSA 2GZ2A 2PGDA 4H16A 1PL7A 4PLYA 4JBIA 3GAFA 3TZCA 1LDNA 5T8KC 4A03A 4D3DA 4FQ8A 4U18A 4E2WA 5CDTA 1VSUA 4XCVA 4B8WA 3QRWA 3V1TC 3BEZA 4BKPA 4ZDBA 2UYYA 1ENZA 1GFSA 5TRTA 3BHJA 4HFRA 2P9GA 5ER6A 1WVGA 4RF2A 2OZPA 4GH5A 3V2HA 5I8ZA 1CYDA 3ONFA 2E6UX 2UV8A 5G1RA 2IEBA 1GR0A 1P77A 4FGSA 3T7CA 5L4SA 2VOJA 3PP8A 1Z7BA 3F6YA 3NGXA 3GDOA 1I3LA 3AY7A 3LT1A 2Y0CA 3STAA 2Q49A 2X9GA 4Y67A 1XKQA 1AUPA 4MOWA 1A4UA 5IZCA 1T2CA 3QLJA 1PZFA 1YG8A 3W4JA 4NBWA 3ETEA 1GQYA 3DOOA 2YV2A 4YJGB 1O9BA 1TVEA 4GGOA 3HINA 2IZ1A 1SG4A 2UAGA 5A9RA 4L9RA 3SC4A 3UXYA 5COBA 2VZ0A 3JQ9A 4JCOA 3L9XA 4BGEA 2O3RA 4K2NA 3GPDG 3IJPA 2BMAA 4R41A 5GMOA 5EL0A 4N18A 3ZWOA 4DIOA 5IAAA 1JTVA 3H3JA 1ZO8A 1E7RA 4OQYA 4FOSA 2Y99A 3W4KA 3GC6A 3LT4A 1H2BA 4JJIA 4GLOA 3LF1A 1A71A 2EW8A 4NK4A 4GHNA 2PGLA 2Q46A 3IP1A 4AJKA 5F1KA 4D7AA 1XHLA 2D8AA 4Y9DA 2Q4EA 4JWVA 1T26A 3LSYA 1FDTA 5AXAA 3QMJA 2DUUA 2ZL4A 2IXAA 1ISMA 1ML3A 4XB2A 4I9UA 2GF2A 3QVWA 1P9LA 1PEDA 3FBGA 3GF7A 4ID9A 3C85A 2C7GA 4NK5A 2VWHA 2DBZA 4WNIA 1JU9A 1QYDA 3GZ4A 3GVHA 3ZHXA 2CZCA 3H9GA 4GMFA 3QK8A 1G0NA 1PJ3A 4UREA 4WOKA 3C8MA 3V1YA 3L3SA 1BDMA 1V0JA 2RH4A 1P3DA 3QE3A 4J91A 4NMHA 2W90A 3WYEA 5JYDA 1PWZA 3FNEA 4MVJG 5DULA 4E5KA 4NJMB 4CMGA 1QG6A 3WTBA 3OC7A 3ZI0A 4IZIA 2Q2VA 1HDYA 2RHRA 3HDHA 4BNNA 3MJEA 4IMPA 5IKLB 1E3EA 1NZYA 5F5NA 3QREA 4I1IA 4WLNA 2IZZA 3H5RA 1K3TA 1BW9B 3H2SA 4EYEA 4HY3A 1XA0A 2UVDA 3AFMA 5AYVA 3FNFA 3PLNA 3JCZA 1MG5A 3KB6A 3WG5A 1DJNA 3JYLA 1FC7A 5BQFA 4M87A 3HRXA 1E3WA 3AM3A 3NUGA 2ZL3A 1LTHR 3G79A 6LDHA 1DEHA 3D3WB 3KXDA 1T24A 3LC2O 3LT2A 2F6QA 4MOUA 4YB8A 4K1LA 4BNVA 1PJ4A 3VTFA 4IDFA 4U0GH 4PLGA 3WBBA 2NTVA 3Q0GA 4E2ZA 1CWUA 2NU9A 1F14A 2G17A 1HNOA 1W2XA 1ZJZA 4OXNA 4FFOA 3HSKA 3DAFA 1O8UA 2HDHA 5JMWA 3U09A 2G1UA 4EJ0A 2V6GA 4ALNA 1DC3A 3ZWVA 1GYQA 4JP2A 1DCIA 3BHMA 4KPKA 3JTMA 2B5VA 1GDHA 3G49A 4BO8A 1DAOA 4A2CA 3WIDA 1ENYA 4IDCA 5DUCA 1U8FO 2VYVA 2NVBA 2FY8A 4MVJI 4OSOA 4P38A 3JYQA 1EDOA 1G0OA 3EDMA 4AJHA 5JXWA 5KJCA 4FOOA 1TB4A 4E0BA 1SMKA 4LK5A 4XD2A 1M6HA 3D4OA 4BO7A 4LRTB 4FB8A 1YL5A 5HM8A 5JC1A 4FFNA 1J49A 4BNMA 3VZQA 2BLLA 2AQKA 2UUPA 3FWNA 4KUEA 4FGWA 4YJGA 4WLFA 4BGIA 2PR2A 4CV3A 4QO7A 4ZDFA 4AJNA 2IEXA 2F1KA 3FDUA 4EMPA 3TFQA 4Q3EA 3L6OO 4CM8B 5C37A 1TA4A 1RJWA 1Y81A 3W8FA 3DAPA 1OD4A 1YB4A 4O63O 2Z95A 2BZRA 2VUTA 5KOIA 1B7GO 1TI7A 3PGQA 3E9MA 5B37A 1LRLA 4Q9NA 4Q3AA 4CLOB 2QQ5A 3D1LA 1I3MA 2Y67A 3HWRA 5K0ZA 2I76A 3IAHA 4PG8A 3U9TB 3ULKA 3CINA 4P4LA 2I65A 1PQPA 1MJ3A 1UAGA 4WEOA 3Q1LA 3VZSA 3HJAA 5F1OA 5TT1A 5COQA 3P5SA 4YQYA 4WE3A 2VYND 4PVCA 3RBVA 2X9NA 3RRVA 2FZWA 1XX4A 4CM9A 2NTJA 2DAPA 3G0OA 4U0JA 5DKPA 3K30A 2EJWA 3JQDA 1H2HA 1PQUA 2H9IA 3K50A 4XX0A 4J7UA 1J7XA 2O3UA 1ISFA 1K5HA 4KDEA 4XIYA 5CFZA 1NR7A 1PIXA 1KEUA 5U9CA 1SOVA 1HDCA 2EJVA 1I3NA 1PL6A 3MTJA 1XNVA 3TN7A 2JFHA 5ICSA 1JWBB 5ENDA 2I66A 1PGOA 4E12A 1LLUA 3R3SA 1RM5A 3C7DB 4NJMA 5KJEA 3L07A 5JDIA 3DO5A 2NNLD 3EVTA 2ZCUA 4XRGA 3QXZA 1DRWA 3WGIA 1E7WA 3FPLA 1X1TA 4UVDA 2HMSA 4YAKA 3QIVA 1AE1A 1BW9A 2GN6A 4MKZA 1X13A 4EW6A 1FK8A 3GMAA 4JX8A 1YONA 1C0LA 5JDCA 1D1TA 2I9PA 1UR5A 1ZZEA 4J1QA 2ZQQA 4KP7A 4BKOA 1FF9A 4S3MA 4BKRA 4WGGA 2DPHA 2WJPA 3RC9A 3K2BA 1X7DA 5AXCA 2R00A 1NQTA 1KVSA 5DU8A 3KYDB 2EKQA 2IE0A 2C59A 1JWAB 2CVZA 3VKUA 2VTDA 1S7CA 3ISAA 2VHXA 4WCFC 3FNGA 3TZHA 5ADHA 1WNTA 4IIVA 2NADA 3H9QA 2YY7A 4JROA 3DB2A 3GGOA 3OJEA 1KEPA 3H5NA 4XYLA 3JYPA 4TVOA 3FTNA 3TRRA 1L7EA 2O3JA 2V6BA 4CLEA 4KQWA 3DTTA 3H8VA 4F45A 4U6QA 1ADFA 3OFSA 3RCBA 1B8VA 2P5UA 4ZHSA 4RCVA 5TQVA 5KDRA 1AHIA 1JN0A 1QYVA 2Y1GA 4NPCA 4LCJA 4OM8A 1QR6A 3QW2A 4LW8A 5L40A 4ZDDA 2EGHA 4EDFA 3SLLA 4DWVA 4KQXA 3T3WA 1SBYA 1QXSA 2YQ4A 3CPSA 4YBZA 3C1OA 3P2OA 2VZ9A 1HL3A 3SEFA 2ILTA 1UDBA 2CNBA 4BO0A 1F12A 4PLZA 4BNGA 5IDWA 5DCYA 3DBVO 3LU1A 3OBBA 3U5TA 2PGJA 4B4VA 5JAZA 1GUFA 1Y9AA 2XXJA 3DFZA 3JQAB 1XO6A 5TSDA 4CM8A 1I10A 1QORA 4XGNA 3DZGA 1DFGA 2J5GD 4JIGA 3WQRA 5JS6A 3GKBA 2DTDA 1D4FA 4KWBA 3OJ0A 4W99A 3V8BA 2DQ4A 4NU6A 2VHZA 4E31A 3GQVA 2WYUA 1DRVA 1PR9A 4URFA 4YAJA 3U4HA 4CLOA 2EHDA 1LA2A 1HYEA 1YRLA 3PJEA 4R54A 5KJ1A 4R5HA 2B69A 2PD4A 2D5CA 3IIEA 4FC6A 1XNYA 4R1UA 1ARZA 4R01A 1VI2A 4QXMA 5L7WA 3TPCA 4I52A 1F8FA 5G1QA 2R6JA 1HE3A 2B4RO 2JAHA 1DC5A 4M89A 2Q2XA 2C82A 5L4LA 4L4SA 3GDFA 5KVVA 2D1YA 3JD3A 1DFHA 4DUPA 2F6IA 4CUKA 4GX5A 5A04A 3OJFA 2QYSA 4F6CA 2YYYA 2VN8A 1U9JA 4X54A 1BXKA 4W9NA 1DRUA 4QSMA 3WDSA 3BMNB 5L53A 1ZMTA 4IMRA 4UUNA 1YDEA 1BWSA 4IJVA 3WGTA 3W8DA 4PFJA 4RF4A 4UULA 1ISJA 2POQX 4PCVA 4J90A 5T8KA 4EUEA 3RJ5A 3CSDA 5LCXA 2B4QA 2VCYA 3V1UA 3ZNOA 5COAA 3DHEA 2AXQA 2NLOA 1I33A 1JQBA 3QY9A 3WWZA 4BNWA 5A9SB 2Y1OA 4BB6A 3H0QA 5A5FA 4FZWC 1P45A 1H6BA 3OA0A 3ICPA 3PHGA 1V3TA 4INAA 4JFCA 3ZNQA 5G1SA 3LAOA 3A14A 4CR6A 4ALKA 5L51A 2NV6A 2GD1O 1U3TA 3WICA 2OMEA 4R9SA 2ZTMA 1ZK4A 3K8ZA 4RZIA 3O38A 4FJWD 4QEDA 3B70A 1RKXA 3FI9A 3G1UA 4UEOA 4TWRA 5EESA 4DXHA 2E49A 3LT0A 3K5PA 1CETA 3HNPA 4MVJE 5H82A 3LLVA 3HP0A 1GU7A 2JFGA 4YCAA 3SWXA 1GD1O 3WSWA 4YTEA 1PIWA 1RM3A 2EJ5A 3W6UA 4DA9A 3GGPA 5I8WA 3T88A 1BTOA 4YJHB 1LSUA 5JFOA 4BO2A 3Q2IA 4IDDA 4YT2A 4MVJA 1JA9A 3KYBA 1E77A 1HE2A 1UZLA 5H81A 1XG5A 3JV7A 5L7YA 4WKGA 3IAVA 4KD6A 5HA5A 5I7FA 4DLAA 2A7SA 3E48A 5FWNA 4H7PA 4JBHA 3ZCXA 1D7OA 4O1MA 2HQ1A 3UW3A 1EUDA 1I2BA 4XGIA 4A73A 3O26A 1NPDA 1ONNA 1RPNA 4HFJA 3STHA 3TZKA 5FUSA 3QA9A 3EVNA 4YRBA 4UVHA 2FWMX 2GPTA 2P5YA 2Q3EA 3GHHA 1WMBA 1O0SA 4IS2A 4LK3A 4QIIA 4O6VA 4JJFA 5BNTA 3D4NA 3GFGA 5KKCA 1IE3A 2AW5A 1YB1A 3GEGA 1IZ0A 3UN1A 2A35A 1YBMA 3LDHA 1GL3A 4CV2A 1FDWA 3BMQA 4ESOA 3GN1A 3JQAA 1HSZA 3NYWA 5DNAA 1VRGA 2ZTLA 2BFMA 4RJTA 3KSDO 5KVCA 1GCOA 2V6MA 3VH1A 4G81A 1PGNA 3T4XA 1B8PA 2OO5A 4NU5A 2PKQP 3F1KA 3OQ6A 1E6EA 4FIZA 4RVSA 1Y8RB 2VNSA 1U8XX 1P1FA 5EMHA 4DC0A 5CG1A 4HWKA 2BRUA 1JAYA 1N9GB 2WE7A 3TL2A 1Q52A 1MUUA 2AEFA 4IZCA 4LMPA 5FFFA 2ZYAA 3COSA 1U5CA 2Y05A 1UYVA 1NFQA 3DBHB 3LVFO 1XCBA 2P9EA 3KO8A 4YYZA 4IJWA 4L75A 1F17A 1IB6A 1ZK3A 3PDJA 4AJEA 5ILOA 1X7HA 4P22A 2P4QA 2B4TO 4BHTA 1P44A 4CMAA 3VZPA 5IG2A 3AFNA 1UYTA 2X6TA 2GYYA 5JCXA 2VUSA 3I9OA 1T2AA 4MIEA 4JQCA 2PBPA 3JU1A 2O48X 8LDHA 1O95A 1UDCA 1YL7A 2H5LA 4OOFA 3ETGA 4OMUA 4RPLA 4ELWA 4PLTA 3PZKA 1EUCA 5GZ1A 1SB8A 5IFLA 4WCFB 3NRCA 5G2OA 1ID1A 4II2A 3BMNA 4E2XA 4XYGA 4XB1A 3NJDA 4EJMA 1P1HA 2Q35A 1QYWA 4JBGA 1R16A 4I4ZA 1LLDA 5ICMA 1N7HA 4GLLA 3KM0A 4IS3A 2FP4A 1GQQA 4IGFA 4YA6A 4EGFA 3NV9A 2E48A 4D45A 1HYHA 1YJ8A 3PYLA 1LC3A 3PJGA 3RIHA 1M76A 3OT6A 3D0OA 3E8XA 3H65A 3DBRB 3Q0EA 3PYMA 4NBVA 1K6IA 3MJ4A 3BHIA 2J5QA 4PRKA 2NQ8A 2O7SA 2OHXA 3GK3A 3VKVA 2HW5A 4RPGA 3HLN1 1U1IA 3OIDA 3FN4A 3IC5A 1A4IA 1KC1A 3ZV3A 1L7DA 4IJUA 4IQ0A 1OC2A 1XIVA 3DZFA 1CQIA 4TZKA 4ZDCA 1P1KA 3DC2A 4CMJA 3I4CA 2D5AA 4YXFA 5CAEA 4WK6A 2QIOA 3K6JA 2VWPA 5LDGA 3ZWWA 4JOTA 1I01A 1NYTA 3DHNA 2GGSA 4Q39A 1LEHA 1GPJA 1I8TA 4U8GA 2J3KA 4G2NA 2PH5A 4CQMD 2CBYA 3V2GA 1E7QA 2NACA 5EN4A 3TT7A 1HDGO 1MV8A 5CTCA 3WG9A 1B3RA 3NKLA 3RBXA 4OXKA 3ZV6A 3VTZA 2GZ3A 4A7PA 5A05A 3R9QA 3H4VA 1FDSA 5KJ6A 3ENNA 3EY4A 3PZBA 3INTA 4DQVA 1UJMA 3GRKA 4DBZA 4E5PA 3M2PA 5TGDA 1W73A 4IDAA 3HFGA 1EBFA 4YLHA 1EE9A 3GG2A 1PS0A 1Q0HA 2AE1A 3EC7A 3WNVA 1L1FA 3TV5A 1U2DA 1IL0A 3CUKA 1NX6A 1EE2A 3OJOA 4RVUA 1NQ5A 5CEEA 1MA0A 2C2XA 4EEXA 1GAEO 5A06A 4NFYA 4EBFA 3JQ7A 1XU9A 3WR5A 4A10A 1GPDG 5T6BA 3DFUA 4G65A 5BSHA 5E0SA 3MOGA 3MOYA 5JO0A 1H6CA 1PTJA 1NWHA 1ZVMA 4C4OA 5A9TA 5THKA 3HADA 3OQBA 2J6IA 2DUBA 5A4DA 4DI1A 3AJRA 2JJYA 3OJLA 4OOEA 2CVOA 1RYDA 1N92A 1CQJA 1OAAA 4KWIA 1MGOA 2BGLA 3JQ8B 4PLHA 1V8BA 2DBQA 2TMGA 3KSZO 4GX1A 5C90A 2X8LA 2RIRA 1E7YA 4J6FA 3DTYA 2YW9A 3WYBA 1GTMA 1ADCA 4YWJA 5JLAA 3HUDA 4D0RA 1WDLA 3PHLA 4DLLA 2C07A 5GZ6A 2IYPA 4WCFA 4WUVA 1R4MA 4B4WA 5HWSA 4AL4A 1VJ0A 1FXSA 4FJ1A 5L7TA 1NNUA 2F9YA 3KEOA 1DBVO 4EITA 3GMDA 2FSVA 4LVCA 1UXGA 4LVUA 4M8SA 4HFMA 4H15A 5DBIA 4ZGWA 1CDOA 3TNLA 4CM7A 3VC7A 3NJBA 1DHRA 1LLQA 4RVGA 4F47A 2HLPA 3DMTC 5GY7A 1LSJA 5JAMA 2AQHA 1LDGA 2O23A 2Q45A 1KBZA 4ILKA 4M1QA 1KC3A 2OP1A 3PXXA 5I7SA 2HK7A 3UHAA 3GUYA 3JYOA 1AXEA 1W4ZA 2OP0A 4OIMA 4PRLA 5IJZA 1T4DA 2CY0A 4D46A 3S2EA 3NJ8A 1AXGA 1SOWA 4CPDA 5ITVA 3QKAA 3R1IA 1XSEA 4OKIA 1R66A 3VH3A 1Y7OA 4IDGA 3U3XA 4PIVA 1C1DB 2P2SA 1GV0A 1GUZA 2A9FA 3H0SA 3H7AA 3NGLA 3K73O 1OD2A 1ZMOA 3O9ZA 1HEUA 5HS6A 3U9RB 4ZRMA 4F3YA 1V6AA 2P68A 3AI3A 2W2LD 3FD8A 4YQZA 3RWBA 4CLRA 1Z7EA 4UEJA 2ZATA 1PU2A 1X0XA 4W4TA 3CXRA 4YR9A 4CLDA 3GOHA 3GY0A 3GNQA 4L73A 4Z0HO 5FIFA 4ZVVA 4RPJA 1Z6ZA 3GZNB 2FSSA 3NJ4A 4JNKA 4CV0A 1UXIA 2X0JA 1UAYA 1K6XA 3AOGA 1AN9A 1SCUA 3IKVA 3ZU5A 1EK5A 1QLJA 1S6YA 1LU9A 4EEZA 4K9DA 1A7KA 2JCYA 4E5YA 2VSSE 4B3HA 1EY3A 1PX0A 1QP8A 1H5QA 2GERA 2JHFA 5IDQA 3H2ZA 1HE5A 1BG6A 5DP2A 3AUUA 1B3BA 2ZB7A 2ZB3A 2VHVA 1JVBA 2W2KB 4NDNE 5L3ZA 5DUFA 2IRWA 4IZBA 1XR3A 1ZXLA 2Y93A 2RCYA 4BNIA 3SVTA 4I42A 4Y6SA 2PY6A 2QRJA 3N74A 3PVZA 4NNJA 1YH3A 5C7LO 5JAQA 3PHJA 1BSVA 3CE6A 2ZYGA 1LQTA 3TQHA 3MYBA 3EYWA 5FF9A 3I4FA 1PZHA 3CZRA 7ADHA 3I6QA 4OSPA 2HAEA 4PZCA 4FFLA 1OMOA 4Z0MA 1EFLA 2YFQA 5CDUA 4FZWA 2PKRA 2X5OA 3LF2A 3O4RA 2VHWA 3AK4A 3PIIA 4Z0TA 3ASVA 2DTEA 2TMDA 5EQDA 3FF4A 5I9MA 3MWEB 2O4CA 4DIFA 1ZCJA 4FPXA 4K6FA 3FF6A 3T8AA 3JQ8A 1NAIA 2O3QA 1M75A 4YAGA 4IINA 1T2EA 3F5SA 3A1NA 1DHTA 3VIVA 3GEMA 1HF3A 1I36A 1YOVB 3NT4A 1A7AA 2O4UX 2DFVA 2IEDA 3RSHA 1QYCA 2YFHA 4KTVE 1DB3A 1N6DA 3PK0A 4KNPA 4WCDA 3E18A 3QWBA 4IIUA 3KV3O 3QV1A 3B6ZA 2IDZA 2JKVA 5JO9A 3TF5A 5F3RA 1P74A 1SEPA 3OIFA 1D8AA 1SO8A 1YVEI 3FR7A 5JY1A 4PG4A 4WLEA 4FSHA 1UH5A 4D3SA 4OMRA 3ZWXA 1DSSG 3L4SO 1TXGA 3ONEA 3H9UA 3JQEA 1IOLA 1SAYA 1VLLA 3FPCA 3MWDB 4IZDA 1UXKA 1IZ9A 2HK8A 2OFPA 4Z6KA 5I9LA 1MLDA 4DREA 5DTWA 1FCFA 2QRLA 4OAQA 1Q51A 3Q11A 5TS3A 3HB4X 4RF5A 1ENOA 3JD2A 3VOSA 2FPGA 3ZDFA 4UUPA 5EIOA 2ZCVA 1EZ4A 1BVUA 3I9JA 4J1SA 2I3AA 3NDRA 1U2GA 3EHEA 2DTXA 2VSSF 3DHYA 5DCUA 1NVMB 4BKUA 5DZKA 4I08A 4PLCA 2VOEA 4OKNA 3DEYX 2DEOA 3QWDA 4HNKA 2AHRA 2O3SA 2VSUF 4RPHA 1V3UA 5ILGA 1VSVA 1XQ1A 3HZZA 2J5IB 1MC4A 3KRTA 4EZBA 2DVMA 1EBUA 2J8ZA 2WWRA 3E03A 1HDOA 3I9MA 1RJNA 3R9SA 1YS4A 1YDWA 5TJ9A 3RSTA 2NSDA 4RVFA 4XGKA 1KVUA 1B15A 4NBUA 3ZHZA 4RCNA 4HBGA 3ZWMA 3OSUA 3RD5A 4CUJA 2NVWA 5JCJA 2Z1NA 5B4UA 1LC0A 4J2HA 2Y1FA 3GZNA 3HDJA 3F3SA 1A9YA 1LNQA 5I7EA 3T8BA 3N6RB 4PG7A 4OXYA 4UUOA 1Q7GA 3RFVA 1XGKA 1H6DA 1PJTA 3GG9A 3TFOA 1U28A 3B1KA 1I5RA 5JBWA 3ABIA 4PLPA 4DPKA 3UCFA 5KVQA 4U5QA 4IUYA 2GUGA 2Q1WA 3ONDA 5K9ZA 1N6FA 1LBEA 4Z9YA 5BT9A 1U7HA 2ZQYA 5FYDA 2ET6A 2DKNA 4QT0A 1K2WA 5T57A 1BHSA 1YE3A 2C8TA 4J7XA 1QLHA 2BF7A 3TRIA 5A03A 4EUFA 4D44A 3GLQA 1YBVA 4BO3A 3K96A 3FRJA 4BMVA 4FR5A 4RL6A 3U4DA 3OECA 2BI7A 2O2SA 4KOAA 4W7HA 3U4CA 5TC4A 2EF1A 3AI1A 1CRWG 2VYVD 2QRKA 3D3WA 2CMDA 3HB5X 5L9AA 5TIIA 4Q3DA 5TNXA 3OQ1A 1O5IA 2PTGA 1I2ZA 1QV6A 2OOSA 1DXYA 3GVCA 1ZSNA 3HDQA 1EMDA 1CERA 4UVIA 3TT6A 4AJJA 1HDZA 4R1NA 2FRDA 1TT7A 3HHPA 3CTMA 4OYRA 5CDYA 3A4VA 4L6WA 4O0LA 3RASA 2CDAA 4BUCA 3MJVA 3WGGA 1RWBA 2Q34A 2JCVA 3UCXA 1V3VA 3IKTA 3L9WA 2ZQRA 4IGEA 4FFMA 1LI4A 3SLKA 2HMVA 1UZMA 2IZ0A 3IL2A 3BMOB 2D2IA 4NQZA 1H94A 1P31A 1IULA 2C2YA 3TOXA 2D4AA 5JPIA 2WDZA 4GAEA 4XQEA 3ZWNA 4M54A 4IZHA 4CL3A 4YT8A 1SNYA 5DU4A 2NTNA 2QYTA 4AICA 3MZ0A 1U4OA 2VRBA 4R9RA 1H9BA 4B7XA 5FI3A 1E7SA 3FNHA 1RYEA 4Y98A 4ALLA 3RC7A 4CR8A 3KTGA 4MP3A 1LDMA 3DZJA 1PJLA 3G64A 1X0VA 2EIHA 4FDAA 4UUMA 3AUSA 4AVYA 1ZW1A 4CM9D 2F00A 3A06A 1KEVA 4BNTA 3C24A 4Y6RA 1D1SA 4L4XA 2W8ZA 4TRNA 3JQFC 2VX2A 1P1JA 4D0SA
chains in the Genus database with same CATH superfamily
2GPAA 2CE2X 1I2CA 2X8BA 3A9CA 3FJYA 1CZLA 2DT8A 1OU4A 3LQFA 4QQFA 2PM8A 2IVFA 4G0NA 1TM4E 1X1DA 5CX1B 3ZBUA 1E1YA 4S12A 4BV2A 2OL4A 3CR7A 1NQVA 4JQYA 1U7WA 1N8NA 3N0WA 4MJXA 3GF3A 3DMNA 4U2GA 5FRDA 3ZBTA 3MCVA 2Y1EA 3KVVA 1JG4A 4LI3X 1BKYA 1L3BA 5HOEA 2D5BA 4Z99A 5TDHA 1JQJC 4GGMX 1AA9A 1YVUA 2JD1A 3NXSA 4GBGA 1UDWA 4CKEB 3AINA 3G9XA 2Z2YA 5JCOA 2R7MA 4K46A 1TYEB 1W59A 3WWYA 1GRNA 1HQKA 1MXHA 1T9KA 4L7QA 4CGZA 4TKUB 2QE7D 1HYBA 1Y5RA 2ZDGA 4E1AA 1N3YA 2CJXA 1HZZA 4C5AA 5JU6A 4HLCA 1LX6A 1Y6GA 3QVSA 2C2ZA 4G0WA 2J9ZB 4EMTA 1J8QA 1VKNA 2ZYSA 4W5NA 2QD5A 4MO2A 4XEHA 2OCGA 4QAQA 2YFYA 3DDNA 4IQGA 3J7TA 4GDFA 2X41A 3WQHA 2C8LA 1J2EA 1UPTA 4I4TA 3SN6A 4DSUA 2VSUC 2P5TB 1PZXA 1BD3A 3H4MA 4FMCB 3AG6A 5HMLA 5AW0A 1GAXA 3V6LA 1XEAA 1OZHA 3UXMA 1FP1D 1V96A 3OHPA 3OQVA 4PC3A 1JIKA 3GRVA 3F7NA 3GHYA 4JODA 1QWSA 2QJFA 3DVAB 3GL9A 1SC3A 2BCJQ 4A36A 2O8BA 3B5IA 5DLDA 3UF0A 2Z6UA 4RNCA 3C3KA 2ZREA 5JH7B 4GI2A 3OZEA 1JEOA 1VBKA 5EJ8A 4A0SA 3DQQA 4ZU1X 3RROA 1QFSA 3E22A 2G67A 3EZ9A 1JHYA 1G291 1YCGA 2CYBA 3DPUA 1XF9A 2LRHA 3MMZA 5KDLA 3SQNA 3Q85A 1DBQA 1SC1A 3VH2A 1GPMA 2ZUUA 3B12A 4JMLA 3PWSA 1M2WA 4OYYA 1RXSA 3N9IA 1CEQA 4Q1VA 5JAIA 4DR5B 3PLRA 5GONF 1Z2EA 3O8OA 3E5RA 4UAUA 4YAWA 1ZCZA 3DMTA 2GN0A 1UKZA 3SDZA 4W5QA 1R5OA 4AU1A 3MSCA 5DH9A 3ZIDA 2R7NA 1CS0B 4XH9B 4ZAFA 2BUBA 2PN1A 3JWEA 1Z45A 2FFJA 4DVGA 1U0BB 1R74A 1BMDA 4UAGA 1N1GA 1W88B 1PJQA 1YB2A 3E3OA 3ISJA 3JX9A 5E2AA 1XELA 4E94A 2OFXA 1E94E 4LCEA 5CJJA 3WGOA 3O2QB 4ELSA 4CT5A 1VGRA 1REQB 3IP3A 1DWPA 1HNUA 1TYFA 3IQEA 4TRMA 2A78A 3HNRA 3HTXA 3PT5A 5F9FA 2ONCA 1KSGA 1VPDA 4XWOA 1GPH1 1V5IA 1E3IA 2YR0A 4X6UA 3ZWKA 2ZS7A 3HY6A 1RI3A 4HHEA 1YB5A 2B9EA 3TE6A 2I1VB 2P69A 5EE5B 2Z9BA 3WHLA 3PIDA 2IQIA 4OQQA 4Q01A 4ZQBA 4DJTA 5C7IO 5FAKA 3HXQA 4AD8A 5IJXA 3VPDA 4X9XA 1VLZA 4RYLA 2Z1MA 4HQ0A 4NY1A 3HZRA 1N6PA 2E5WA 3D7LA 3KAJA 5EQJB 3H5VA 4BQSA 1XYGA 1KKLA 3PNPA 4RC9A 1N36B 3INRA 1F2UB 1IMOA 2FGKA 5IUJC 3DXZA 2CKDA 1DQNA 1DIRA 3N2KB 1SCIA 2NMVA 1PWXA 2X8WA 3CPHA 3P4YA 2A67A 4OA5A 1E79A 1S1CA 4V39A 4BOYA 2AN3A 3QSYA 1I4EB 2OV8A 3Q88A 3PQFA 3IEIA 5EJGA 2BSAA 2HSDA 2LDXA 4HDRA 1OREA 1A50B 1CX9B 1Y3IA 3KUDA 2C42A 5LOVA 5C3UA 1A5ZA 1D03A 2XR1A 5BVGB 3HKDA 2WD7B 621PA 1EJ6A 1P4GA 1E8NA 1HURA 4YRLA 4TLLB 1UIMA 1QOZA 1XJ5A 3F6RA 1PR3A 3IE2A 1W9MA 1R4NB 1ZXBA 3TMKA 2W2VA 4GUDA 4IBOA 5BN4B 2OC4A 4GSLA 3VJRA 1AV6A 4GYWA 2M32A 4ARVA 5ITSA 2ZZMA 1OXVA 1W4RA 2ILVA 3CF4G 2DUWA 4CCWA 4FHGA 2X14A 3F6CA 3ND5A 1YFLA 3ZZUA 2BMJA 1TYZA 1JH9A 1GKUB 1BKSB 3FZQA 2IDJA 1RJGA 2B36A 3GEDA 2NOAA 1EINA 4LK2A 1C9NA 3G82C 3THYA 5HRAA 2H07A 4YUXA 3QYRA 1KNQA 5AKGA 4GSKA 3ICWA 2BY4A 5SYMA 3W9UA 5AW4A 3R9KA 1N5MA 1T5BA 2Z98A 4JNCA 3LKZA 4TL8A 4Y2TA 3EQ8A 3K9CA 4FFWA 3OJXA 4PZDA 5LP1A 2C77A 4M1YA 1CHDA 3HUUA 2FN7A 3LBHA 3WZMA 2R1TA 2FXIA 1RS0A 2XUJA 3ROQA 4OQMA 2CLDX 3ROZA 4NXMB 5BSKA 3D6NB 4UXHA 4ERNA 1N32B 1ZU4A 1RWOA 4RTJA 4KRGA 2WNHA 2OYRA 4ACAA 4WUTA 1IJKA 5HS4A 1X1AA 5MDHA 2PUHA 3COWA 1HC7A 1MAUA 1JYFA 1EI9A 5KSOA 3JQQA 4J0EA 3KYIB 5TV2A 3VVBA 4BQRA 1SZPA 5C35A 1JL3A 2Q9AA 3PD7A 4NBRA 1NN5A 5CBPA 3DE3X 1GAWA 4RLHA 1NE7A 3O4FA 3TZ6A 2FEOA 4P0TA 2PX6A 4NQRA 3R6HA 3H02A 2V8BA 4BB5A 5DGXA 4EX7A 1NNI1 4AMVA 3T9CA 3A3OA 5D3ZA 4B4DA 4B6EA 4CF3A 5IXYA 2C31A 2BEVA 1CJUC 2FN9A 5ICCA 3BBPA 1EP1B 4QFMA 2W4MA 4B3DA 2CF6A 5FXMA 4PLVA 3ETDA 3S99A 3AKEA 4B8ZA 5JWRA 3P45A 5JZVA 1DAPA 4CTJA 3F73A 5DL1A 1XWFA 4J0JA 1CUYA 3ID6C 4L72A 3QU2A 2Y9ZA 1KIAA 2OWDA 2Q5HA 1CY4A 1B43A 3O3OB 2BR4A 3PXDA 4ZDEA 1LF5A 2RJ3A 1ULZA 3AEUA 4KAFA 2PAFA 2GYWA 3GR6A 4XWWA 4JH0A 2W6CX 4YJ3B 3B2EA 4FB5A 2ODEA 1DOZA 1OD6A 1AB6A 1W4CA 2BFWA 4QUIA 7AT1A 5IH3A 3AM5A 4QO8A 5HUJA 3S40A 1UK9A 5KNBH 1OZGA 2EYQA 3CLUD 5GP1A 3R3HA 1VRWA 1WP4A 1NBHA 2Q1YA 3D0QA 4ZMSA 1XU7A 5ALVA 2JFWA 2JAWA 2O6HA 4MDYA 1C5KA 5KOYA 1J1UA 4B44A 1YULA 4P4SA 4EPVA 1ZK0A 1K4MA 3IPYA 3SZRA 5DP1A 1YMVA 3GH3A 5F5LA 4BVFA 1WUTA 3H8JA 1Z4KA 1C9JA 3EG9A 2Q5LA 2FR8A 4R9NA 4MWZA 4NMXB 3SAJA 5HZHA 4JL5A 1YTUA 1X1QA 4PCUA 2B8NA 3IV9A 1GR1A 4OFXA 1AQYA 3IPCA 4B73A 2QT0A 4BMSA 3WMRA 1XCLA 1M5TA 4XAQA 3VGJA 4ROSA 4FCCA 5JCPA 5CA0F 1RBYA 5C31A 2WHPB 1E1MA 4B3GA 2GZ1A 5LA6F 2P2NA 2EG9A 5YASA 5I01A 1VG1A 2W2TA 2X3YA 1DV2A 3WQSB 5HJ5A 1UZNA 2X0DA 3GRZA 1TQDA 3DF9A 3IUPA 4HPWA 4ZO7A 4B1FA 4LMRA 4UD2A 4P84A 1UMBB 1C7FA 4PYQA 2Q29A 5CEJA 3LUHA 3OU2A 1ZEMA 1NUHA 1Z4QA 4PGHA 4XJTA 5LP6C 3VHRA 3VTKA 4ZZ0A 5GGYA 2IUTA 5BWLA 3QEOA 3EGCA 4CMKA 1QKIA 1RXCA 3QWFA 2NU8B 1Y8RA 2WTEA 4BMXA 1O89A 1UFVA 3D4PA 3DWEX 4G5YA 5CFQA 1O0BA 4TROA 1P7YA 2AEJA 3NTXA 3O8QB 4X71A 1N9GA 1VIDA 2HRBA 1OY1A 2AFHE 2GBPA 1MAHA 2IKQA 3ODPA 2UUOA 4JELA 1WSAA 4R5MA 4MR8B 4RPIA 4REMA 2R84A 2RC6A 2VPTA 4MI1A 1JDJA 4URUR 4W82A 2BKEA 5LYJA 3SSMA 3UHOA 3NTOA 1LS1A 1B14A 3H7IA 2FMUA 3KV1A 3GLTA 3AEKB 3RFFA 1ECCA 3OCJA 2H5EA 3NALA 1GCUA 4UTNA 4JI4B 2E6KA 4XVCA 4RJJA 1DLJA 4PONA 4EY6A 1FFHA 3WGKA 2V0NA 1M83A 1TYAE 3FHCB 1G5QA 1N2SA 2AX3A 3EIEA 3VSEA 4J76A 3D4IA 3M1AA 4CKBA 4NABA 1ILWA 3DKIA 3LYLA 4RKQA 3KJEA 3FHJA 1VI6A 4LUCA 2BKXA 5DHQA 5REQA 5A3VA 4AYTA 4HNAA 3M2TA 1J56A 1UDXA 1FFWA 5AKJA 1LRKA 2IIPA 4DDMA 4EJSA 4UBOA 4YMGA 2GXQA 4RL4A 2J5RA 2QX9A 3LVRE 2L42A 4Y30A 2A1UB 1M66A 2QRMA 2ZK7A 4TQGA 4BE7B 4EG0A 1G4AE 2CXXA 3V2UA 2XZLA 3EEFA 1T5TA 5EUBA 4MINA 4BX9A 1ZD9A 4MZXA 1I7SB 5FH9A 4BFVA 1PNRA 4OHCA 4WLVA 2VAVA 1VXRA 5TY0A 2IOQA 5CXQA 2RKBA 4MKRA 4O4JB 3ANXA 3MJFA 3H05A 5LNK1 4OFBA 4AO7A 2IEYA 3F4KA 3H0KA 3NWJA 4JUFA 4YCJA 5CIQA 2QRUA 2FMIA 3EFHA 4HYQA 4QJIA 2HK9A 2A7XA 2FPKA 3FHTA 3FWZA 4LJRA 3IV6A 2NUAA 2IL1A 1V7ZA 4YRMA 5IULC 1F2TB 1M74A 1NFFA 1NKVA 5K3FB 3VR3A 2HX1A 4U2CA 4M1ZA 3CC8A 1H3NA 3K2EA 3L0OA 1D4OA 1LPNA 1PLKA 2AF3C 3VGPA 1YZKA 1E6KA 1XZLA 2ABWA 3A6KA 1Y33E 3C8HA 3W1VA 2I7VA 1B16A 4FYIA 1QYRA 3FHOA 4OM7A 4ON9A 3JQCA 2HPHA 1J07A 2YZ7A 3QHAA 5IVKA 3DKVA 1M33A 1MJGM 1QQTA 2B34A 3NOVA 5EQFA 2PPYA 1U8CB 1E0SA 2PV7A 3SHQA 3RFXA 1HK7A 3HJHA 4PCAA 3L4JA 3NASA 1FYFA 2IUYA 2O2ZA 2VPPA 2VDPB 3HKBB 1N2CA 3H1AA 1QTRA 4KPFC 3ZK8A 1CVLA 2WFMA 4YP1A 2GF9A 1C8BA 2H6EA 5E0NX 4LF5B 4NIMA 5K6TA 3R5HA 2QM3A 3VO9A 1H69A 2AE2A 3OPYB 1QUEA 1AZTA 1SJ9A 4EUSA 4Q7QA 3JATB 4M9SA 5B58C 5CHEA 3CVUA 4UU0A 1UQRA 3K92A 1UPFA 2E87A 1GG2A 3AJEA 6YASA 3AR9A 3LQ1A 1TKAA 3JYNA 4RK0A 5DE3A 9MHTA 4LPKA 3AWDA 3ZJUA 1IQRA 3GYGA 4WACA 4RM3A 5IYZA 1N2XA 3FVQA 3ZCRA 2OHJA 2FR1A 1RCTE 3CKYA 1YO6A 2VTKA 4OAOA 4KGZA 4DNXA 1AO0A 1AGNA 1U9YA 4ICIA 4XQGA 2FA9A 3CBQA 1NM5C 1BA2A 3K32A 4FI3F 3RWMB 1HZDA 2Q3JA 3H9EO 1PGPA 3V1KA 3LL7A 4PLWA 4Q3LA 4L15A 4BNYA 5GQSA 2UZAA 1ZESA 4YLEA 1AKVA 1MB4A 1QZZA 1TT5B 2H2HA 1MJNA 5U4QA 1RHJA 1ADBA 2FTKE 1WO8A 1NDHA 2AN4A 4RWEA 1TE2A 5CNKA 1M34B 1XTUA 2HA6A 3KJIA 2Z5LA 3MRSA 4DKJA 3FTFA 4W5HA 1WUHS 1VG9B 4QFBA 1OPRA 4OJQA 2C9CA 3IT2A 4QHTA 3AHJA 1SEVA 3N07A 3UJNA 3FYHA 3RIYA 3IAM6 4AMUA 4MWBA 2I6TA 4XD7A 3GXOA 4C88A 4HQKA 3VPXA 1FXUA 2IYXA 1BXRB 1CTQA 1P80A 1ORVA 2EKPA 3G2NA 5K8UA 1QGAA 1Q12A 1PYOA 2CXTA 3WP0A 5JZBA 3VU1A 1PKXA 4KQ2A 3WA6A 4ZOQI 2V7UA 3CEAA 2W6ID 1JR6A 3IUYA 4EF6A 2HLNA 1BRMA 1EJ2A 2A5DA 3ZGOA 1RC8A 3RVDA 4DEVA 1KYZA 1YZHA 2F90A 3WKDA 1XDBA 2EGGA 1OYOA 4P53A 3OUTA 1D4ZA 2O8EA 3GFPA 8ABPA 3UV7A 1RBZA 1W0KA 5LZ5A 5FBVB 2GHIA 1J20A 2FMHA 2YJ6A 3V33A 4NFSA 4C0HA 2DERA 2OZLB 1T34A 3RF7A 2EZ4A 5JNLA 2X23A 6AT1A 4ECEA 4DA7A 1I6LA 3JSXA 5DSTA 5TVKA 3HO1A 3BB3A 2GTIA 3ZKAA 2XMGA 4AKEA 2VXBA 5A02A 3QOFA 1AKEA 1KAGA 3EH1A 4RZ2A 5GONB 4R2MA 2GASA 4WK2B 1I6WA 2GM4A 2XAAA 3EQ9A 4GM0A 1IY8A 1JMYA 2AOWA 3E7DA 3HU3A 3T6KA 1O6ZA 3DCJA 4CM6A 4XVUA 2VWGA 3QE4A 4KIWA 4MK4A 1B6TA 2ZUFA 3R5JA 4IG4A 1J33A 3VM6A 1WTAA 2JVJA 4PNHA 4DMLA 1TEHA 2BONA 3NX4A 4LMBA 2IBTA 1LJLA 3MOIA 4OQFA 2JHAA 1NWCA 4RKYA 2HNKA 2B5WA 5GVRA 2BSXA 4RK5A 1PV2A 3QV2A 3TM4A 4AYWA 1N7GA 3H13A 3QBEA 1IYZA 1KR5A 2H52A 5DRYA 5G4LA 1E4YA 3VOTA 4B6QA 3HI6A 3CLTD 2DB3A 1DIAA 4LBZA 3GGCA 4CEHB 2I7XA 1TTTA 3JZDA 1ZUNB 3NYQA 1C1DA 5AOCA 4ZVUA 1DOAA 4EL5A 3STYA 4EB3A 3R0IA 5H83A 5ABPA 5CBKA 3ABZA 2WF7A 4LSWA 5C32A 2J0QA 4IGKA 3SC6A 4EB0A 4YAEA 5A71A 1N34B 3Q7HA 4JB3A 4B81A 2C78A 3N7UA 3W6PA 2IPXA 1E3SA 3CKKA 4M0UA 4LOKA 1H93A 1GKYA 4TMTA 3ZDZB 1BGWA 4ZCSA 4X97A 2P7HA 3WMWA 1XZIA 3FCUB 3KQUA 2Z56A 3CRZA 4EW2A 2FPPB 1TAGA 1T3SA 3MTIA 3OMWA 2VTBA 2XQFA 1ZL0A 1ANKA 2Q1UA 3HYLA 4KXFB 4IFBA 2JGIA 2HB6A 4TQUS 3QLUA 1XMVA 1A2QA 5LQCA 2EWMA 1AS3A 2C0CA 3KC2A 2JKYA 4MICA 2OKCA 3GAMA 3GX1A 1X77A 3CZ5A 1CUBA 2G76A 3IO3A 1JR3E 2J9RA 1E2IA 1QE0A 3LUFA 4OREX 4CEJA 4B75A 1UMKA 1MZPA 2FWIA 3AF3A 1KJIA 4U2DA 3VYRB 4GP6A 5ALLA 4OBWA 3W2TA 3MJCA 4YAIA 1C2TA 2J5GA 4TT3D 3SX2A 1RXEA 3PC3A 3ZUGA 4BQPA 3ROPA 1JGTA 1FFYA 3G9ZA 1K6EA 2EZTA 1G5HA 2VSQA 2WJ3A 4I8XA 2YDXA 4RHFA 2RHCA 1UPAA 4F1JA 4YMVA 4RY9A 1E6CA 1GUBA 4Q9LA 5FI1B 4RYFH 1VA5A 2ZJ6A 4F5WA 4RD6A 4K5QA 2Q7OE 4CL8A 1FJGB 4N47A 3OKPA 3B9BA 3SLRA 5CR9A 2Q3BA 4LY6A 2EJCA 3G7NA 4ONEA 4Q00A 4DC1A 2AC2A 4DLZA 3FLAA 1U04A 5KJPA 2Q2QA 5TQ0B 3J7AC 2WUEA 5GGXA 3PNVA 3SZGA 4O1IA 1X7YB 2P7IA 1CB0A 3P2JA 4C0SA 1Z2AA 3KOYA 9LDTA 3F9RA 2YJZA 3G1TA 3TSYA 3W7VA 3FWYA 4CIVA 1NASA 4GNKA 1VJDA 3U9LA 5EPUA 4MKXA 1IQUA 1HNWB 3DTVD 3LP8A 2PQ2A 2H7YA 2BP7A 3BH6A 3N59A 4HMQA 3QHQA 3MWEA 3K5HA 3MGKA 5AQ1A 4TZ6A 4AY3A 5BW8A 421PA 3EXFA 4QNMA 1Z29A 5GV8A 5IN5A 3IEUA 4PSAA 1ISGA 5BQPA 4PSKA 1MAVA 1NW9B 4F11A 2IV2X 4W5JA 3D6JA 2PSSA 3GJ4A 4XIIA 6ADHA 4WZAA 3VNQA 2QX6A 1XDDA 1LJ8A 5BSFA 2YL2A 1V48A 5DN9A 4QVIA 4FXPA 3WLFA 3HB0A 5AK6A 1SA0B 4PF1A 5JLJA 4LYFA 3RB8A 2QN9A 1E58A 4M9ZA 1Y98A 2JA2A 1JSCA 5CA1B 1ZAKA 1U2SA 2GXSA 4Q82A 2VT3A 3G1WA 5C3MA 1FUUA 3NUZA 2NQTA 1OJ7A 3FDJA 3UC9A 1L7QA 5F9HA 3BWVA 2P6MA 3GPCA 5LZ2A 4NU0A 5FIUA 1QHNA 3RS3A 3M6IA 2B4YA 2LBPA 2E82A 3A2LA 2DR3A 4KN6A 1VE5A 3BPPA 2R6DA 2C9BA 4ND5A 3DZKA 3HWSA 4J4HA 3UXEA 1UC9A 3TDCA 3P9QA 5M29A 3NH6A 1N57A 1K6JA 3PNSA 4M98A 5AUOB 3LX8A 1M8KA 1QK4A 3AFOA 1HNZB 1Z13A 1BOFA 4G85A 1A7JA 3U4IA 1XDWA 3RHSA 2IJGX 3PKIA 2E2WA 4J8PA 3GVIA 3MLBA 1BVYF 1GQ2A 1R15A 3DBLA 4E5DA 2DFDA 3RS7A 1YA4A 4CMBA 1T15A 3MT6A 3VPCA 2YJNA 2OLJA 2RCNA 4CEIB 1E89A 2QD4A 3V8RA 3Q3CA 1OFGA 3B1JA 4OVKA 2PKCA 1ZM9A 3WISA 2JIPA 4ITUA 1DUVG 1JJ7A 2I80A 1C3LA 2ZT8A 3GB9A 3REQA 3S68A 1T1RA 3ESDA 3WS7A 4TKLA 3F0TA 4X1IA 1XTBA 1LX7A 4QYXA 4BN0A 1KY2A 2D2VA 4ETNA 3UJ9A 2G5CA 3RAFC 4BWVA 3HU1A 4MV3A 3AR2A 2NU6B 3C74A 5EXSA 2PMFA 3KQFA 1G8PA 4DYDA 4RPCA 3Q7IA 1OFTA 2IYZA 2JGLA 3HR4A 4FWBA 4I46A 1PJHA 3GDHA 5J9FA 1RWPA 1F1JA 1VFNA 1U3DA 4G0MA 2YOGA 4MO9A 1P1BA 1M0TA 2YC4C 5FUXA 1L7XA 2BFOA 3OU6A 3PQ8A 2AFIA 4DCUA 3CQ9A 2ZL2A 1E32A 2OGWA 3S55A 4GVXA 1YKGA 2BGJA 3VR1A 1VL8A 4EG1A 2H4ZA 3EULA 3HB9A 1QKKA 3QYPA 4TMZA 2YCLA 4Q9DA 5D3MA 5K1ZA 4A92A 1J0XO 1KARA 1N8KA 2JFYA 1KEWA 1ZIYA 2AOVA 2QTGA 1TZ2A 3NHUA 3P2IA 4HSEA 4I4CA 4S1VA 1KVTA 2HPAA 2Q8PA 4R51A 3BDVA 3ZWDA 1GGJA 4KQFA 4N8DA 2F1RA 4RA9A 3SBXA 1VL6A 1RHMA 5GWXA 1OTXA 2MSLA 1E1QD 1N2EA 3DWIA 4D8TA 1UMCB 4ZDWA 4YV7A 4KUGA 4G5HA 4KXMA 4OH1A 5LD2B 5IEJA 3PDHA 4OI1A 1E6WA 3WLNA 3NDBB 3VNUA 2FE4A 1BHJA 3NVAA 4H3VA 4RFVA 4EG3A 3KKQA 4GRDA 3FBTA 4DWJA 5C7OO 4XE5A 3VDQA 3TNDA 2O3TA 4YRKA 4I8IA 1A9XB 1VJGA 3I42A 3IQGX 1WB9A 3TR5A 1LZLA 1TAQA 2R85A 1DDOA 2FJ0A 3NATA 1T3HA 4V3CA 5BOSA 5EUMA 4Z49A 1ZCFA 4ZMRA 5AR1A 1FNDA 4RHCA 3SLGA 3ZDRA 4KX5A 1RWMA 1WB5A 3LY9A 1KQFA 2QMZA 3LBYA 1BGVA 1VLQA 3K9HA 4NDAA 4ENTA 4N9QA 3LLUA 2IYYA 4QREA 1R8SA 2VDQB 5IKOA 2X6QA 4EFLA 2ZM6B 2QTHA 3QITA 3CLKA 3BRQA 3CF0A 4KJXA 4NG5A 4PHTA 5FULA 3V4ZA 2RI1A 4A5OA 1QIDA 1PWYE 4JD5A 5KOHA 4DF3A 3TXYA 5JHHB 2GLTA 2B3TA 3EJWA 4ZYUA 3Q8LA 4KKXB 3V48A 4H7DA 4O2LA 4URYR 3OQPA 3BILA 3OEED 3ST9A 2NSJA 2PX5A 3Q0IA 4P0QB 1KFKB 4GZMA 5CDFA 1ISRA 3HZOA 1CUZA 4RE5A 5K51A 3LT5A 4H1TA 5ES3A 4I3HA 3ITDA 4DV4B 4YCLA 1MBZA 3L40A 4BFYA 5K0EA 5EKTA 2J3DA 3P85A 3ABQB 4RHEA 3R7AA 3VR5H 4IKOA 2V7WA 1Y1TA 3WB1A 1RQXA 5E1OA 3TUZC 1GXSB 2QXUA 2I5PO 2FPWA 4ZV7A 1NHGA 4BO1A 3PL1A 2OCIA 3PU6A 5AMXA 2BBSA 2HCTA 4OHOA 1Z6GA 2ZRBA 4UBKA 4FFPA 1IG0A 4BZPA 4EG4A 2QTNA 3FZNA 2FB9A 1VI5A 2ISSD 3ZZNA 2P2ZA 4BVEA 1V6CA 2GTRA 1PZGA 1UK7A 4MUFA 3TCXB 1M6VA 3H1FA 2E18A 2R8PA 1O4VA 2WNIA 1C3JA 3QI7A 4UFNA 3KKPA 4POOA 5SZIA 4PG5A 2R48A 3SYMA 1JHXA 4KFTA 4NBTA 3HRHA 5A3JA 2FPIB 2BDUA 2GKOA 4KZPA 2VRCD 1LUAA 1E3LA 2ZRPA 3RYIB 4HPXB 3BMCA 1O8CA 2JEOA 2AOTB 1CUUA 1I14A 3PFWO 4IHJB 1G9TA 3ZHVA 4CG0A 3FZGA 5D01A 1BN7A 1VC2A 2EGUA 2R9VA 1H2XA 4UAVA 3SBOA 3PYXA 3G0IA 4R8VA 1YVRA 4HMPA 1PD0A 3R9XB 1BIFA 1GAQA 3OHSX 5KYUA 2COKA 3ROMA 3INGA 1OBFO 1LRJA 3HCCA 3LZ6A 2VDOB 2WFLA 1L8LA 4EYSA 4L3OA 1H8HA 3M82A 1OXSC 3TSCA 3DDZX 1G20E 4QOHA 4FYWA 5EFOA 3LUCA 1E1KA 4GF5A 3I3OA 5HF9A 4DPMA 1YBAA 5CB4B 2HWKA 4WXYB 1QGUA 3M4JA 2I62A 3MELA 1KI3A 3QUCA 4MUJA 1G42A 5ALQA 1O0CA 2BHTA 5KBYA 5EE3A 4HFNA 4NEHB 1T1EA 1GPKA 3DE6X 2NO9A 3SFTA 1IUKA 1OFUA 2AJDA 1EQUA 2GN4A 4RPKA 5A5GA 2GRAA 2Q2NA 4J4TA 4PX2A 3C41J 1ZBDA 1G3MA 5GZ3A 1TAUA 1Z6PA 3R0XA 2XF2A 2JGDA 2VDRB 3CGGA 4I9FA 2GN9A 3QK7A 3DZDA 1UJ4A 1PGQA 3A04A 1EXMA 4C03A 4RVHA 3ED1A 1UFKA 1TLTA 3LNCA 1KYQA 3G7UA 4XDZA 3E81A 4M6WB 4OCZA 1IONA 1KZ1A 1MPTA 2PSDA 3V4OA 4PWYA 1CYEA 4OI0A 3FKQA 3PFHA 2ZWPA 3SXUB 1YFJA 2OXIA 3SLLA 4E07A 4W5OA 3EEOA 4FJ2A 2ZSIA 1DO2A 4ZICA 2VJDA 1K32A 3BB4A 3MWKA 3EGVA 1R37A 2VQ3A 3MJDA 5IAGA 3KE9A 1J00A 2DFPA 4GP9A 3DZIA 2DCMA 2YQ5A 4A26A 1AZWA 4CODB 2WJVA 1FUYB 2JIQA 1Z82A 1N1DA 1Q6ZA 1SBHA 1JKMA 3GEBA 4FIDA 4QUKA 4QDTA 3OCWA 3SR4A 5GINE 2HJRA 1UBUS 2IC5A 4MPDA 4MVJD 1C7EA 2DU8A 3HU2A 4ZK6A 8ADHA 5F2OA 1V45E 3K4PA 3FNIA 3VR2D 3ANNA 4AJ9A 5KX5F 3UFBA 4J43A 4AJIA 1U5BA 3E2MA 1R5JA 3GJYA 3OE7D 4L8FA 4ZALA 3QF4B 3IBBA 4K29A 4WINA 1GNSA 2P2DA 2Q8QA 3AUTA 2A9QA 3NBQA 5BURA 4UE3S 3DNPA 4TTTS 2CLHB 5HGXA 4BWYA 2XUOA 1V8DA 4DRXA 1XDZA 2XUIA 3QPCA 2GHTA 1A9ZA 2YV1A 4MR9B 3PFBA 3TIVA 3LCMA 4V0KA 2VHQA 4IH9A 2JLUA 2J9GA 2OQRA 3H1EA 1SK9A 1UDAA 2ZUTA 4QUBA 3DONA 3C6XA 3DCYA 5EWMA 2HZ7A 3RVQA 3ZVKA 5HZKA 4RZXA 1X1EA 3L0CA 5TE9A 4I5IA 2GTPA 2YXDA 1J5PA 3F6EX 1B4DA 3ITEA 4FE4A 3ZDCA 1Z33A 5A0FA 4MWGA 2OV1A 4B74A 3OI7A 4J4BA 2DSTA 4OJTA 4K9QA 4NNOA 2TECE 4IMIB 2FZSA 1RWKA 5KQPA 5MGBA 1B8NA 3KXPA 3NANA 1RACA 3U49A 4ENWA 4KMSA 4J3FA 1XMOB 3Q2KA 3D0RA 5AICA 4E1BA 4IXWA 4EI9A 3PEWA 2GEVA 3C87A 1XMJA 4ND3A 4EA8A 3IQIX 3UT5B 3I5YA 2JEZA 2ODPA 3AVXA 4QHSA 4B87A 3R41A 2HSJA 3LX4A 3HY4A 1I24A 2EL9A 5CW1A 2OAP1 1I1QB 3C1TA 1DG1G 2EKLA 1C7IA 1X7GA 1JFFA 1GY8A 2ZSFA 3C1AA 2GT1A 5U4XA 1LPBB 1W6UA 2QTWB 2QXYA 4OGWA 1X7XB 2JGNA 4R16A 5IHXA 3MS4A 3J80A 2D54A 4QM6A 3RJMA 1RHQA 1IZZA 4PQFA 4QVGA 2J07A 4NLLA 5CB8A 4DA4A 3WYCA 3G0BA 4YJDA 4YEDA 4HNHA 4Y8VA 3EQ2A 4XJSA 3JAMA 5F5XA 3KKKA 4CG2A 3T1YB 3X1KA 3FHLA 3W05A 1VRVA 3U7QA 5BYBA 3A7EA 3RSOA 5FBZA 3CTPA 2NUTA 4AKTA 3FYUA 4DCJA 4LSGA 4OQLA 1B26A 4EYGA 1NZJA 3BWYA 3T1HB 1TUIA 4JI0B 1Q0LA 1RAEA 3IBTA 3P19A 2VKQA 1UBOS 1CNFA 1JG1A 2CLSA 2IEAA 2WEKA 4JHLA 5LQNA 2YN4A 5EE0A 3VZRA 2A1TS 4YGYA 2SKDA 3FLEA 3TRKA 3WIVA 1SULA 3OT4A 3QTLA 3NR2A 3UMJA 4P3NA 1GUYA 2VSFA 3OZSA 4ALJA 2QW8A 2WJGA 4OLBA 1DDIA 1C1XA 4M1KA 4W9NC 1FMJA 1C0EA 4K9OA 2NN3C 1DC7A 3GJ5A 3L7DA 3JQ6A 4PM4A 4HJRA 4IO1A 4QPPA 5DSXA 3LS2A 2G63A 3GWZA 1DQPA 5H7XA 3VO1A 3TX2A 3O2SB 5HIJA 1J24A 4P5EA 1EFVA 4D3DA 1AHNA 1YRHA 1UC8A 3R4CA 4PHCA 4FQ8A 2FW0A 4A03A 2C9DA 2O2CA 4XCVA 1A2KC 1GGHA 1QGDA 1PLJA 1ZVQA 3V1TC 3BEZA 4BKPA 5BSUA 2RI6A 2ZBUA 1ENZA 1GFSA 2RGUA 1NSYA 1O6BA 3D8HA 4MEAA 1V8FA 2P9GA 1EX1A 2ZWVA 3NJRA 2PZ8A 1NDQA 2QUZA 4RF2A 5CHYA 4A8JC 3NDPA 4X63A 1GTVA 2Z5VA 5FUMA 3FTQA 1P77A 4GHWA 5L4SA 2OBFA 4JZKA 5IVIA 2EBHX 4AY4A 5MGNA 2F8SA 3GUHA 8ATCA 1ST3A 3LT1A 4RSMA 2Y0CA 2QW0X 2IZ7A 3AB3A 4EO7A 3STAA 1KSJA 4INOA 1T29A 4LXXA 4Y67A 1MJHA 3RDPA 2H7XA 1AUPA 3SZ3A 1MVNA 5IBQA 5K3DA 2VT7A 1QU2A 4UUBA 5E38A 1W36D 4H77A 4NBWA 1SQGA 5DXAA 4B33A 4GGOA 4DM7A 3EN0A 4I3GA 4D8UA 5A9RA 3KT8A 5COBA 2VZ0A 5BO5A 3JQ9A 3KKZA 1G5IA 3L9XA 3LD9A 4TUYF 4K2NA 1SVOA 3EEQA 5IF9A 3H1GA 1IXYA 1CHNA 1CZKA 1CEEA 2HWYA 1Z4JA 3MILA 2BMAA 2R5FA 2XNDD 1NURA 4WV3A 3KZKA 5TQ2B 2PMEA 2PUEA 1W581 1XXLA 4DIEA 2Z09A 4FGUA 5EXDA 1Y0BA 5BWBA 1E7RA 4D4IA 1SXJE 1ZA1A 3D3KA 3W4KA 3BRCA 4CETA 3QF7A 2QL9A 1JA1A 3BQMB 1Z6AA 1TM1E 3KFXA 2J3MA 3SJBA 4AJKA 3JR7A 1N0VC 4GXRA 1FTSA 5A7HA 1DUIA 2D8AA 1KF0A 4Y9DA 4B4UA 4IZOA 4Z3OA 1QU3A 4P93A 1WTCA 2HZBA 3H75A 1L1RA 4G0XA 1XL1A 4NMLA 2DUUA 1T4MA 5ALDA 2ONZA 2JIRA 2IV7A 3L1JA 3CLUC 4MYDA 5M34A 4MYUA 2H08A 3I05A 3IE1A 3RRMA 5M2QA 4M1MA 5AI8A 2P1RA 1N4DA 1OX4B 5DM70 1W9HA 2PYDA 2ANBA 2DBZA 4HCJA 2WSMA 2FMKA 1QYDA 4G5QA 1UXOA 3D2BA 1KYTA 3H9GA 1L5GB 4S04A 3AESA 2GKSA 3SF0A 3O8CA 1FP6A 4EQ6B 3JVDA 1BDMA 1V0JA 3MINB 4YI5A 4D9IA 2AVNA 1Z7YA 2EQAA 2QP3A 4JOCA 3TDNA 2XGOA 3L79A 2D62A 3QH4A 3HEBA 1F51E 4J91A 4NMHA 4OMCA 2PGNA 2XZDA 5C8YA 3WYEA 1H2WA 2PEYA 1KDRA 3PXAA 4QL3A 3TLKA 2MHCA 2CXPA 3I5AA 3Q6NA 1QG6A 4L0MA 4HLUC 3ZI0A 3W3AA 4C7MA 2BRUC 2CLEB 3HL0A 1HGXA 2Q2VA 1IN7A 2PGIA 3G13A 5JJ5A 4BNNA 2G36A 4RBNA 2W4IA 3LM8A 5ALTA 3H5OA 3KR2A 1E3EA 1XZFA 4GR5A 3C5HA 2O8FA 1M1XB 3EAQA 1E2BA 1O54A 2IZZA 3CEJA 4IEEA 3A36A 2GCEA 2GBLC 1CP2A 5IVDA 3RUPA 3KQPA 5AYVA 1GCGA 2WIBA 3CX3A 4BTEA 2WJ6A 4LBWA 1ZICA 1MG5A 4B3SB 4DR4B 1ATZA 2H1CA 1C7JA 3N6VA 1PZNA 1DIOB 3K70B 1DJNA 3JYLA 3K9NA 2XQKA 3L06A 1FC7A 1WCWA 3MW8A 4CKCB 2H2GA<