3ZW8A

Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) in apo form
Total Genus 277
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
277
sequence length
725
structure length
725
Chain Sequence
PRGSHMAEYLRLPHSLAMIRLCNPPVNAVSPTVIREVRNGLQKAGSDHTVKAIVICGANGNFCAGADIHGFSAFTPGLALGSLVDEIQRYQKPVLAAIQGVALGGGLELALGCHYRIANAKARVGLPEVTLGILPGARGTQLLPRVVGVPVALDLITSGKYLSADEALRLGILDAVVKSDPVEEAIKFAQKIIDKPIEPRRIFNKPVPSLPNMDSVFAEAIAKVRKQYPGVLAPETCVRSIQASVKHPYEVGIKEEEKLFMYLRASGQAKALQYAFFAEKSANKWSTPSGASWKTASAQPVSSVGVLGLGTMGRGIAISFARVGISVVAVESDPKQLDAAKKIITFTLEKEASRAHQNGQASAKPKLRFSSSTKELSTVDLVVEAVFEDMNLKKKVFAELSALCKPGAFLCTNTSALNVDDIASSTDRPQLVIGTHFFSPAHVMRLLEVIPSRYSSPTTIATVMSLSKKIGKIGVVVGNCYGFVGNRMLAPYYNQGFFLLEEGSKPEDVDGVLEEFGFKMGPFRVSDLAGLDVGWKIRKGQGLTGPSLPPGTPVRKRGNSRYSPLGDMLCEAGRFGQKTGKGWYQYDKPLGRIHKPDPWLSTFLSQYREVHHIEQRTISKEEILERCLYSLINEAFRILEEGMAARPEHIDVIYLHGYGWPRHKGGPMFYAASVGLPTVLEKLQKYYRQNPDIPQLEPSDYLRRLVAQGSPPLKEWQSLAGPHGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Isomerase and Hydratase Reaction Mechanism of the Crotonase Active Site of the Multifunctional Enzyme (Type-1), as Deduced from Structures of Complexes with 3S-Hydroxy- Acyl-Coa.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
molecule keywords PEROXISOMAL BIFUNCTIONAL ENZYME
total genus 277
structure length 725
sequence length 725
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.50 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3zw8A03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3zw8A02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3zw8A01
1LEHA 3FSRA 8LDHA 3I6QA 1M2WA 1O6ZA 4WLNA 3VZQA 5JY6A 4I08A 2PH3A 3ICCA 4CMEA 2Z95A 4ESOA 3H0UA 1I33A 4NDNE 3ITKA 4LVCA 4AJLA 2D0IA 3PDUA 4BGUA 4BL5A 1I3LA 3LT4A 3X2FA 3AUTA 3G79A 2CNBA 2F9IA 3DHNA 4H3VA 1OZAA 2P9CA 2D4AA 1JAYA 4KMSA 5DZSA 1UAGA 5KOIA 1FMCA 5HS6A 5A5FA 1Q51A 1Q2XA 4BGIA 3GA0A 4BV8A 1CEQA 1IPFA 4R54A 2UUOA 5G0UA 4FZWC 1D8AA 3OIGA 1GEEA 3DZFA 3EZLA 4CLRA 1MG0A 2PKRA 4DBZA 2X5OA 3W8FA 4ND5A 2BZRA 1MFPA 1UR5A 3HFSA 3CZRA 5KKCA 1HE2A 3GZNB 3EYWA 3PXXA 4R5MA 5KDRA 1V0JA 2NQTA 3TZHA 2R00C 5EQDA 2EGHA 2FSSA 1HTBA 3HLN1 1LA2A 3UH1A 1GPDG 2QHXA 5EQFA 1E77A 2PGDA 4RGBA 4WGGA 2ZYAA 1UIYA 3D3WA 1I5RA 5HS4A 3AU9A 3Q9UA 1Z45A 4MP8A 4UAGA 3NKLA 1E1MA 3T8BA 5JO0A 1KETA 1ZCJA 1P77A 1YRLA 5AOVA 3K50A 1TXGA 2CDAA 4WLEA 5GZ1A 1C1XB 3T88A 4RDHA 3UFXA 3HHPA 3RSHA 3WOHA 3TVWA 4PZEA 3OHSX 1P33A 3H0SA 3SEFA 1DUBA 4NPCA 3PJEA 3RJ9A 1PZGA 2C20A 2IEDA 4XEHA 2NU9A 1GV1A 1NHGA 3VIVA 3AFNA 4OM8A 4FFLA 4MVJP 3CTMA 4GX1A 1K32A 1DAOA 3PWKA 1RJNA 4ALKA 1E6WA 4A03A 3G3EA 2ZL0A 1FDTA 4CPDA 3JQAD 3OMLA 3UHAA 4Y9DA 4ALLA 1KVUA 4J2HA 5DN9A 2BFOA 5JAMA 3ZNQA 2P4QA 1VE9A 5BSFA 2VHYA 1NFRA 2X4GA 4M87A 2CDBA 2FPIA 2ZB4A 4XR4A 3WBBA 1QLJA 3TZ3A 1FK8A 4J9VA 4KQWA 3MFMA 3ROMA 4UUOA 5TSDA 1HRDA 5IDXA 1EMDA 4XCVA 3OJEA 3H5NA 3LLVA 4IS3A 1F14A 4YEDA 3PHLA 2DM6A 1B26A 2C5AA 2W2LA 3BMCA 2GUGA 3K92A 4PIVA 1HZDA 1TT5A 2FSVA 4WZ8B 1NAHA 1LBEA 2O4UX 4ID9A 2HJSA 3RUDA 1DHTA 2OUIA 4RL6A 3ZWYA 1O8UA 1YBVA 4OOEA 5G0VA 1FDWA 5B37A 5I9LA 4DIFA 5A9SA 4K2NA 3ZWCA 4XYEA 3P19A 2IZZA 4CM9D 1E0DA 3OA0A 4YJFB 3ZW9A 4YB8A 1C0LA 1CRWG 3L07A 4ZRNA 3WJAA 2VYNA 3KTGA 2VYND 2VWQA 5KJPA 5BNFA 2O50A 4BO9A 4Q1IA 3GZ4A 1E3LA 1LTHR 1UH5A 1WNTA 3BHJA 3D3WB 4TRNA 3AI2A 3TT7A 2EW2A 3RRVA 5C7LO 3LLSA 4P4NA 4WE3A 1YQGA 5FWNA 2G1UA 3MTGA 3IKTA 4K1LA 4YDRA 4E30A 3CSDA 1ON9A 3G49A 3Q6IA 5FYDA 3ANLA 3R3JA 4PCVA 4KTTE 3X2EA 2CUKA 1OD4A 1KERA 1U3VA 2VRCA 3Q11A 4KOAA 2DEOA 1I2ZA 1PJCA 3DMTC 4AJOA 4EUEA 3MOGA 3AI1A 4I4ZA 4Z3DA 2BH9A 4UEJA 5F1OA 1U7HA 2UZFA 1P1FA 1HDGO 1D1SA 2BRUA 5U9CA 4X54A 3OICA 4CLEA 4DL9A 1EFLA 3OIDA 3MJ4A 1ZBQA 1C1DB 3D64A 4NNJA 4N18A 4RV9A 4L75A 3ZWWA 3O03A 4FFPA 1ZK4A 1SAYA 1NPDA 5T8KA 3OQBA 4KWBA 1WDKA 1WVGA 1P1RA 3TDCA 1X15A 2Q1SA 5CPFA 4Z0TA 1N9GB 4CLHA 5JDIC 3H9QA 4Y6RA 4DBVO 3VPSA 3WGIA 3BEZA 1VJ1A 4NEKA 1R6DA 1A5ZA 3ENKA 4GPD1 3TZ6A 3HDJA 4INAA 3PJGA 4KP7A 2GERA 2OP0A 2EJWA 4BNJA 4OQYA 4OYRA 4YAIA 1TG6A 1ZSYA 3C24A 3MOYA 3TZCA 3JQ9C 3HDQA 3OFSA 3QV1A 1JDJA 4HFNA 4CUJA 2VX2A 1KEVA 3GVIA 1SEPA 4Z9XA 1GL3A 3GF7A 4Q9NA 3VH2A 5DBGA 1DIBA 4J1NA 3GFBA 4W9NC 4ZGWA 2EP5A 1HNUA 2B36A 3UCEA 5DU8A 1C1DA 5C3MA 1VKNA 5ILGA 1D1TA 2EV9A 3VDRA 4LISA 4BV9A 2ET6A 4D7AA 4BB6A 3ST7A 2D2IA 4LCEA 5INIA 3FR8A 1GZ3A 2QZ9A 3JYQA 2V6FA 2EXXA 4YJFA 1X1EA 4F47A 1I3NA 3JSAA 4D44A 4IDDA 5A06A 4BNVA 3WGGA 3WXBA 2Q2XA 4IJUA 2VT2A 5CDSA 3OQ6A 3HUDA 3PK0A 4KUEA 2BGLA 4EW6A 3PFFA 4P8RA 2BI8A 2X8LA 2Y93A 3BYZA 5C7OO 3RVDA 5ENDA 3IUSA 4CM7A 2O23A 3NTQA 3C7DB 5ILOA 4XZ3A 2ZTLA 4WLUA 1GCUA 1DC6A 1BTOA 1N9GA 1QORA 1N6DA 1O5IA 1VJTA 4Y67A 4DXHA 1QRRA 2EGGA 4ZDCA 3G1TA 4Z0HO 1X14A 4CV0A 4CM4A 3FNGA 1HKUA 4TZTA 2YDXA 4YBZA 1VC2A 2PD4A 3K8ZA 3R6DA 1Q0LA 4CV2A 4PFJA 5A1TA 4OXNA 1I32A 1PL6A 4RLSA 1DDOA 3RFXA 1YL7A 1N6EA 4N54A 3MT6A 1FDVA 3WYEA 2AEMA 4NG5A 2O48X 5JW6A 4JWVA 4I42A 1BW9A 1N1GA 4A27A 1RJWA 4J4HA 3E9MA 1DFIA 1UP4A 4JIGA 1BVRA 4RPHA 3PE8A 2HK9A 1M66A 1UZMA 3RQSA 4BB5A 2HQ1A 1OMOA 2B83A 2NU6A 4Y98A 2ZCVA 1LRLA 1VL0A 3IDSA 4C4OA 2AHRA 3DFUA 4JXKA 1BRMA 4IDAA 4GSKA 4ZU2A 1LJ8A 4JK3A 1ZXLA 5BR7A 4HKTA 4QFCA 5F5LA 1UYSA 1PL8A 2CVQA 2X0IA 4NJMB 3PQFA 3M1AA 1PTJA 3HINA 3DFZA 3GZNA 1NR7A 3EVNA 4EI2A 3LK7A 2GZ1A 5T67A 1E6UA 3RUCA 1W6UA 1J7XA 3ZCXA 1BMDA 2WE7A 1I01A 2C07A 3OJLA 4U19A 3FNEA 3GVCA 3R6HA 4R41A 3QY9A 3RUEA 4QFDA 2WDZA 3B20A 4XQCA 1B8PA 2WTBA 2GASA 4U1AA 5IDWA 1N2SA 4O6VA 3E6AA 1LSSA 4RZHA 1XNVA 1Y8RB 2XPCA 3K5PA 3AY7A 3QIVA 3TOZA 4CM9A 1F8FA 2JFHA 4R51A 4CM6A 4DIBA 5A5EA 3QK8A 4I5DA 3S2EA 3GOHA 1G0OA 3OEWA 6ADHA 1DHRA 4PZDA 2FZEA 3R9SA 4CMKA 2ZTMA 1ADGA 3NT2A 4CM4B 4J1SA 3SVTA 4D0RA 3QKAA 1GQQA 4NFSA 1K39A 1JKFA 2VQ3A 4RDIA 1R0KA 1H5QA 3JD0A 4RLHA 1G0NA 3GG2A 4RPLA 3CH6A 1KIFA 1TEHA 4D45A 3I4CA 4BNUA 2IRWA 2E49A 3H65A 2Y67A 3K2BA 2WSBA 3Q2KA 4K9DA 1MGOA 2P4HX 4KZPA 4TKLA 2A9FA 2IYPA 1NFQA 3WG5A 4NBUA 1MC4A 2D1YA 4FSHA 4L74A 6LDHA 1ZK3A 2UYYA 3GG9A 5DTPA 4RORA 4E5KA 4EEZA 4CLRB 1I2BA 2QW8A 3GN2A 3PYLA 4U0HA 1DFHA 4PG6A 4JP2A 1WDMA 5FUSA 2ZQYA 4NU6A 3C1OA 1R4NB 3JQBC 2OP1A 3I1JA 1WZEA 3QVOA 2VSSF 5MDHA 3GDFA 4NJMA 4RQTA 4WOJA 1P1HA 1C0PA 1T26A 1PJTA 3GN1A 3LC1O 5CHEA 5CDYA 1ZSNA 2YV3A 5A4DA 1XWFA 2FMUA 1ZJZA 3FF4A 1MJ3A 1HWYA 5A3JA 5C9GA 3DBLA 1XYGA 2X0RA 4YJHA 3U09A 3JD2A 1G6KA 2R00A 1N92A 4BKRA 3TF5A 3DZJA 4O59O 3GMAA 4FJ1A 5L7WA 4MI2A 3DWFA 3P2LA 1GUFA 1F06A 5L7YA 5DF1A 1BXKA 3AU8A 3M2TA 4E2YA 2PLAA 4FJ2A 2HSDA 4MVJH 2Y1DA 5DU6A 3FI9A 1M67A 2IZ1A 1DRUA 2EIHA 4FW8A 2DTEA 2NVUB 3V8BA 3DBVO 3WTBA 4BO4A 3EGOA 2FRDA 5AXCA 5IZCA 4GLOA 2IDZA 4OH1A 1HDYA 4LRSB 4OG1A 2VSUF 1HDOA 3JQEA 5KJ1A 2QQ5A 4IXWA 3A14A 3FHLA 4IDBA 2G5CA 2CFCA 2TMDA 4CJXA 3EY4A 5L4LA 2PV7A 5TJ9A 3ADOA 1GQYA 2PA3A 3ZV6A 1D3AA 1B7GO 2VHVA 3N74A 2Z1NA 2R6JA 3WQRA 5IAAA 1XR3A 1OOEA 1UXIA 1LDMA 1U2DA 1A71A 2I6TA 3EDMA 4U0JA 1YWGO 3RASA 1EDZA 4BO5A 2GTRA 3STAA 1ULUA 4NIMA 3TLFA 2OORA 2VHZA 1A4IA 4AL4A 4AJHA 4BNXA 1SG4A 1PWZA 1ZMTA 4BGEA 1SCUA 2OO5A 4IMRA 1ID1A 3RC7A 3F3SA 5ADHA 3GAZA 5L51A 3TL2A 1PIXA 1HDXA 3ZWXA 3RBXA 4OMUA 2EG9A 3UW3A 4NFYA 1LSJA 2GSDA 1NWHA 2WEKA 4KNPA 2NV6A 4YAJA 1LRJA 1YQXA 4E21A 1U8FO 5T5QA 3VZSA 3AI3A 2B5VA 3S1LA 4E2WA 1DBVO 3JQFC 2QRJA 5F1PA 4BKUA 5HRUA 1RKXA 3NYWA 4A5OA 4F3YA 3NUGA 2YDYA 1ZO8A 1IUKA 2NU7A 5JMWA 1RM0A 1YOVB 5BNTA 4CQMB 4W9NA 4R1SA 1QV7A 2GD1O 1EVYA 1U3TA 2FZWA 3RJ5A 2LDXA 3JU1A 1ZKMA 2ZL4A 3LQFA 2XXJA 2EF1A 1ZEJA 2D8AA 3ON5A 2QG4A 4EYEA 5I8ZA 1P45A 3TVUA 1YL5A 3CMCO 4ILKA 1YE3A 4FNDA 4MVJA 4QECA 4RVSA 3AJRA 4H15A 1T1RA 1KY5A 5G4KA 1W0CA 3ZWAA 1Y5RA 2VZ8A 4WLVA 3A9WA 4A26A 3NTRA 4B7XA 2OOSA 4M54A 3NAQA 4PLTA 4PRLA 1DC4A 4I52A 5L45A 5TT0A 4XDZA 4HFJA 4OOFA 1L7EA 1XNWA 1SZOA 1V8BA 1VJ0A 2DTXA 3QWAA 4AJIA 2VWGA 1MC5A 1J6UA 4ZDFA 1O95A 3RKUA 4O1MA 3ZU2A 3LVFO 1LDBA 2VUUA 3AK4A 4UVDA 2V65A 4ZQFA 5EINA 1E7WA 4GSLA 1LDGA 3L77A 4ND4A 1QYXA 4J7XA 2AQ8A 2DC1A 3IIEA 3BTVA 3MCVA 2VYVA 1XLTA 2Q1TA 4GVXA 2CF6A 5BSGA 1HXHA 3CMMA 3UOGA 3TN7A 4NNQA 2VN8A 5A02A 2WE8A 1NVMB 1K89A 2ZB8A 4JJFA 2EERA 4AFNA 1N5DA 2Q4EA 1JTVA 2PY6A 4UUMA 3GGOA 3WGQA 2A92A 4B7CA 5JYEA 3U9TB 3KEOA 4HP8A 3GKBA 1WZIA 4LSWA 3BIOA 3HFGA 1H93A 4HX5A 2X86A 2QRKA 3PZKA 3FTNA 3DBHA 1L1FA 3W6UA 4M55A 4CLOB 3TFOA 4OXKA 1XO6A 3H8VA 3WLEA 5TNXA 5EERA 3H02A 2GYYA 1R12A 1ENZA 1Y7OA 3BMQB 3RAJA 1JLLA 3DJAA 3EVTA 1ENYA 4R3WA 4U18A 3PLNA 3COSA 4FGWA 1DC3A 1CDOA 1WLYA 1ZK2A 1X7HA 3GK3A 3GY0A 4GMFA 4MJLA 4R3NA 3ETGA 1UXKA 3D4NA 4FOSA 1B16A 1S7CA 2OHXA 1TI7A 5IFLA 4FB8A 3KSUA 3NTOA 1R16A 2DUWA 4IINA 3M6IA 1NVTA 3WYBA 4HV4A 3WMWA 2J3KA 3O8QB 4XGIA 3KV3O 4PG8A 5A9SB 1NPTO 1ZH8A 3VTZA 4B4UA 3WNQA 5JBIA 2Y1EA 2X24A 4ALJA 2GN6A 3I9KA 4J7CA 3VOSA 3H81A 1MFZA 2O3RA 4CQMA 2Q50A 4TZKA 2P5UA 3PEAA 1JXZA 1PS0A 1H2BA 1DJNA 3G64A 2X58A 3PHJA 2RH8A 3DMYA 2HRBA 3D5QA 2J5RA 4BQPA 4Q39A 2ZTVA 1AHIA 1OI7A 2GR9A 2ZQZA 5JC1A 4F46A 3DHEA 4N5MA 4FS3A 3NJBA 3FBTA 2DTDA 1EUZA 1K0UA 2WD7B 4JFCA 2UAGA 1T25A 1E1NA 4Q3BA 2J5IA 2P9EA 1KOLA 3EK2A 3JV7A 5A9TA 2HMTA 1LRKA 4L0QA 4FFMA 4TRJA 5JDCC 2Q1WA 3WDSA 1EVJA 1MA0A 1VPDA 1B3RA 3R0IA 1XNYA 3KTJA 2F1KA 3IAHA 2IZ0A 5KVSA 3IS3A 4DLBA 1V35A 3GH3A 5JBXA 3RI3A 3GUCA 2Y99A 4WCFB 4DI1A 1WMBA 5LC1A 1E92A 4K6CA 1QLHA 3ZHXA 3OM9A 4BNWA 5A04A 1D7OA 4MKRA 4CLOA 4BMVA 4R1UA 3UCFA 3F6YA 4RQUA 1QKIA 4FC7A 1TA4A 4MOWA 2FR8A 4MVJD 4J3FA 1BXGB 2ZL2A 4EMLA 1YONA 1NAIA 1DRWA 1JWBB 4XIYA 1RPNA 4YT4A 3A28A 4K29A 4RF5A 2Q49A 4ZICA 2DFVA 1QV6A 1B14A 2YHUA 3DZKA 3PHIA 4CM1A 1PZFA 3LU1A 1UUFA 3RC1A 3DR3A 4DQUA 1W2XA 1N8KA 5JCJA 8ADHA 2CSUA 3ITDA 5JSFA 3A1NA 3G1UA 3QREA 1XU7A 5B4TA 4FR5A 3NGLA 1HEUA 3HQ4O 3E48A 1KEPA 5CEEA 2X6TA 2C5EA 1DC5A 3U4DA 3V5NA 1EE9A 5CDGA 1MLDA 1YB1A 3I4FA 1EF9A 3GPDG 3KVOA 4XKJA 1GD1O 5I7FA 5KJFA 3WR5A 3FNFA 3VVBA 2I66A 2VT3A 3HN7A 3WWYA 1UYRA 3ST9A 3INGA 4ZDBA 5CEFA 2RHCA 4E2ZA 3DBLB 1T4DA 1ZK1A 2A4KA 3H9UA 3DTYA 3L6DA 4A10A 2ZIZA 2BI7A 3VZRA 4FN8A 2X5KO 4KWHA 5COQA 4CMIB 3JQ7A 1X13A 5IKLB 3RUIA 3OIFA 4EJ6A 5JNLA 1EY3A 1EQ2A 4JYLA 2FPPA 4BO2A 3V5EA 5JFOA 1PZEA 2LDBA 2IEBA 3PIIA 4I9UA 4G5HA 4E13A 1E3SA 3C1AA 3H3FA 3JQ8B 3IAVA 3T8AA 3H3JA 4IGEA 5K9ZA 1HE5A 2H5LA 2X23A 3DBRB 2VSUE 3WG9A 1Q1NA 5GY7A 4KUGA 2JFFA 1U4OA 5AXBA 2PGJA 1YB4A 2DKNA 2G17A 3C7CB 4DWVA 2EWMA 2ZATA 5ER9A 3CZMA 1U4SA 3B1JA 3KEQA 2TMGA 1E3WA 4IJKA 3ZU5A 2I3GA 3NGXA 4B79A 1MG5A 3ZZNA 3P5MA 3MOIA 1A9YA 2H9IA 1WMAA 3P2OA 4R68A 5EIOA 1YXMA 2D59A 1XU9A 2GN9A 3BTOA 3D7LA 3PGXA 3KETA 2PK3A 2CDCA 4MIEA 4QUKA 5G4KB 3AOEC 3FRJA 3ZHBA 4RPGA 2WD7A 3SBOA 3F4LA 5AXDA 1X0UA 1Y9AA 2J5IB 4BUCA 3B1KA 2O3UA 5KWEA 4OLQA 1MUUA 5FFFA 2WYVA 5B12A 4Q3EA 2HMUA 4NBVA 4UVGA 1VSVA 2BFMA 1YB5A 3DQPA 4Y8VA 3VAZA 1DO8A 2W98A 1AE1A 1K6JA 4MIYA 2F6IA 5BQFA 3SC6A 4RPKA 4WLOA 3RWBA 4YJGA 1EK6A 2FW2A 5DBFA 1RWBA 1FDUA 2Q46A 5FIFA 3RBZA 3BMCB 1NFFA 1GFSA 2PGLA 2JHFA 2X0NA 3QWBA 3RSTA 4ZVVA 4FFRA 3ETDA 3EAGA 3GDOA 1YO6A 3JQ6A 3RCBA 3UAGA 4MVJE 3A4VA 4IQGA 3A06A 4IIVA 1ONNA 3GVXA 1IB6A 3VPHA 5TJHA 5JY1A 4OSOA 4J9UE 2J5KA 3ONDA 1QYCA 3F5SA 4CM8A 4TROA 2E48A 2VUSA 3Q9NA 2YFHA 1IE3A 2BLLA 4J0FA 3U9LA 5DTWA 3FBGA 1LLDA 3AM5A 3AWDA 4XWYA 1LXCA 3L4SO 4E31A 5MGBA 1NXQA 2EKQA 3L4BC 4QX6A 2JFGA 4OAQA 1B15A 4HXYA 5JDIA 1YS4A 3HG7A 5LDGA 4EUHA 1R4MB 3U49A 3DHYA 3L4BA 3KHUA 1PWXA 4QT0A 2VREA 4URFA 2GF2A 3PJDA 1GV0A 2AMFA 3IC5A 3D3EA 4WCFC 1CQJA 1BDBA 1OFGA 3PPIA 2ILTA 2IXBA 1UZLA 4M49A 5A3VA 4CQLB 3JQCA 4YYZA 4Q3NA 5DNAA 4ASIA 4CMJA 4PLPA 4DYVA 1P31A 2HDHA 4J6FA 3KOUA 3AW9A 3VZPA 1EK5A 4JCRA 3GVHA 1DLIA 1U9JA 3RIHA 1IYZA 1GQ2A 4FB5A 4L4SA 1A72A 2AA3A 5L3ZA 1VSUA 5CDTA 3E03A 2R2GA 3ADPA 4S1VA 4FPXA 2J5II 4G81A 1Z74A 2ZYGA 3LF2A 3TPCA 3AM4A 2F6QA 4ROSA 3U9RB 2W2LD 5DKPA 2AQHA 2JD2A 4QIJA 4WEQA 1QMGA 1BHSA 2DT5A 3BAZA 3IOYA 4J4TA 5EESA 2ZL3A 5G4LA 4YJGB 2Y1CA 1NYTA 3NJ4A 3JD4A 4QXMA 4EGFA 2X0JA 3P7MA 4D46A 1RM4A 1W4ZA 3UKOA 4BMSA 4GGOA 5LCXA 3E82A 3S8MA 3LC7O 1N6FA 1E7RA 1ISMA 2YV2A 4CV3A 2NVBA 4AJKA 1EBUA 2NTVA 3ZV3A 3PRJA 5ENVA 3IQDB 3V2GA 4GWGA 3E18A 3CKYA 4BO3A 4R9RA 1T2DA 5L40A 1MX3A 4OGWA 4B7UA 4MOUA 1JQBA 5JE8A 3NJ8A 4YT2A 3QWFA 3T4XA 4JX8A 1E7MA 1UZNA 4JQCA 5TIIA 3H2SA 2YQ5A 1HSZA 3H6KA 3I3OA 3LDHA 1KVTA 2Q45A 1YG8A 4NU5A 4RVHA 1ENOA 3NEPX 2QZZA 4YAEA 4BO8A 5COAA 2GZ3A 4UVHA 5C90A 1HF3A 1HYHA 3INRA 4ELWA 2BF7A 3BXXA 4DMLA 5KCZA 1ZVMA 4FCCA 2W90A 4ALNA 3DEYX 4M86A 4P4LA 2PPYA 4YT8A 1YJ8A 1UDBA 1Q7BA 2Q3EA 2GCGA 3BMNB 2FY8A 2GZ2A 1P3DA 2HCTA 3UN1A 3KSZO 4K26A 4R9SA 5LDHA 1EF8A 4ZQGA 4YJHB 3UGKA 4QIIA 4DPMA 4ZRMA 2ZQQA 4CV1A 4J16A 4WEOA 3SWXA 4BO6A 2XF8A 3OBBA 3HJAA 3GC6A 4HFRA 4JNKA 2PTGA 4AICA 4I8XA 4QQRA 3PDJA 1H9BA 2FR1A 4U8GA 1GUZA 2BHLA 1E1KA 1IHXA 4ZA2A 5L4SA 1DCIA 4JSBA 5E0SH 4E5YA 1LLQA 2UUPA 1P1KA 5JO9A 3U9SB 3MJCA 2PZMA 3TSCA 3VVCA 3DZIA 1JKJA 4BNTA 2QX7A 1DFGA 1HDRA 4NMHA 5JC8A 3KZVA 2JAHA 3E5MA 1NHWA 1MP0A 1J49A 1LDEA 3HE2A 4HWKA 4IDCA 1HLPA 4JLWA 4CMGA 4CR7A 3O4RA 4EMPA 3INTA 2SCUA 3NX4A 1WP4A 2DQ4A 4U6SA 3ANNA 1G1AA 4XIJA 3GVPA 2J3HA 3PI7A 5KDRB 1I3KA 2AXQA 2B0JA 4MVJF 1IY8A 1PJ2A 4OMRA 4YPOA 4O0LA 3QQPA 1GADO 2ZB3A 5KNLA 1LSOA 4QTZA 1X7GA 1P1JA 3PGQA 4NBWA 2NTNA 1IHYA 2XOXA 2C0CA 4XJTA 5T64A 3EMKA 1MXHA 3ZU3A 2V6BA 2BMAA 2IXAA 4E0BA 1PGJA 3T4EA 1FJHA 4BKPA 4Z3KA 3R9QA 3DTTA 5I7SA 4J1QA 3ORFA 4ZHSA 2NUAA 2X1HA 4Z0MA 4M8SA 2G82A 1AXEA 4D3FA 3E5RA 4W99A 4XD2A 5CDUA 5IZ4A 2VZ0A 3Q0JA 1XQ6A 4HC8A 1Z73A 3Q0EA 4TWRA 2A35A 2OMEA 4MDHA 1FC7A 3CXRA 3D5TA 3RD5A 2O7SA 4RO0A 3H5RA 1Y81A 1Y8RA 3FNHA 4JCOA 4DQXA 1PGOA 1GU7A 4L8VA 4J2OA 3GHYA 3QVTA 1I36A 1AGNA 4WOKA 4ZQBA 5EJ2A 2ZB7A 1U3UA 2IEXA 2WWRA 1NP3A 3RFTA 2O7QA 1JWAB 3WJ7A 4JCQA 4BNFA 2PD6A 4J7UA 2FR0A 1ISFA 4LW8A 1U28A 3C85A 1E5LA 1CETA 2Y0EA 1V3UA 1F0YA 4RJTA 2C2XA 4DQVA 4EDFA 5CFZA 4MKXA 2A7SA 3TOXA 1DAPA 5ITVA 1K3TA 1VL6A 1H6CA 3GMSA 3K8XA 2BGMA 4WECA 4NH4A 3TZQA 4JCTA 3IKVA 3GRPA 5DCYA 1PJBA 1SOVA 1DLJA 3UCXA 4AJ2A 3WWZA 5KVVA 1XELA 2VCYA 3GNTA 3ZH2A 2BKAA 1BW9B 3SJUA 4L6WA 3U5TA 3PWSA 4LGVA 5IXSA 4MP6A 4MVJI 5I7VA 2ZKLA 2J5GA 3JCZA 4N5NA 4XDYA 2HMWA 3OJFA 4IDFA 4QO7A 3AOGA 3ZWVA 1KS9A 4Y6PA 5KJEA 2X9GA 3ROQA 3H4VA 4MIOA 4L4RA 1PJLA 5JLAA 3WS7A 2AG5A 3RBVA 4E2XA 4RYFH 3KYBA 4S3MA 1RYEA 3ZHZA 2I99A 1H9AA 2OZPA 3EZYA 3PTZA 2AQKA 4LVUA 4R01A 2P68A 4U5QA 3ZW8A 5JAIA 3MEQA 4JGBA 1YVEI 4MKZA 4I5GA 5H83A 5ER6A 4BHTA 5T8KC 2FPGA 4U6QA 3NT5A 3MWEB 1X1TA 4GKVA 4Z6KA 5DU4A 2VYVD 1ZNQO 1XG5A 2CF5A 4YWJA 3ZNOA 4NQZA 5A05A 1SOWA 2A7KA 3KYCA 2FOIA 3NDRA 1QSGA 3JYPA 4P38A 2FWMX 3PZBA 1YGYA 3ETEA 4GMGA 1GYPA 3WSWA 4BKQA 3DAGA 4IJVA 3P85A 3JYLA 2YYYA 1B8VA 1LDYA 2YFQA 3TL3A 3E9NA 1YJQA 2P9GA 4IS2A 1HSOA 3O8QA 4CM8B 3DBRA 1ZEMA 1XA0A 1TB4A 1O8CA 1MXFA 1PJQA 2ZCUA 4UVIA 5TGDA 1WDLA 1E3JA 3HE3A 3MJSA 4IXTA 5JPIA 5H81A 2GNAA 2HMVA 4UUNA 2A81A 4NK4A 5AXAA 4NI5A 2YHIB 4IQ8A 3KTIA 1E1LA 1YOVA 3EUWA 5K6AC 5TS3A 3QP9A 4QSMA 2Q34A 3DO5A 3VTFA 1R15A 4BNLA 1PS9A 3LAOA 3OT6A 3KUXA 2C2YA 1Z7EA 2E82A 4H7PA 3U0BA 1ISIA 4Z9YA 4CMHA 5F1KA 4XJSA 3O9ZA 1Q52A 2PZLA 1D4FA 1GR0A 3JQGA 1GYRA 3W4KA 1P0CA 3K31A 1Z75A 1U1IA 4E6PA 3RSIA 4EJMA 3SXPA 1T1SA 4QO8A 4W7HA 4JJIA 1VRWA 3DZGA 1GEGA 2HJRA 7MDHA 5JAZA 1MB4A 5COBA 2JKVA 3B6ZA 5JAQA 3DB2A 1K2WA 2BFPA 4J49A 1RYDA 3WIEA 1B8UA 4IMPA 5E0SA 3PQEA 4K6FA 3RKRA 1I0ZA 3CE6A 1F8GA 4NR0A 3OH8A 4RVGA 3Q2IA 1FDSA 4IZDA 1VI2A 4Y6SA 5TF4A 4CMEC 3L6EA 9LDBA 3PYMA 4YTEA 1SB8A 1B2LA 4FZWA 1E6EA 4BNNA 3EW7A 5IN4A 2YUTA 1WWKA 1R0SA 1TT5B 2FBMA 3QSGA 1H6DA 3R0OA 3GNSA 4CMCA 1R0LA 4B3HA 2HKIA 2GGSA 2Y05A 3ICPA 5JS6A 5A9RA 1GCOA 1NQAO 2RAFA 3CIFA 4KDFA 3TFQA 1J0XO 5L95A 1DRVA 1EVZA 3QRWA 1ONPA 4JYJA 5G0WA 1CERA 2J5SA 2NTJA 2VWPA 3HN2A 3VH1A 3MWDB 1Y6JA 3VKUA 4FFOA 1KC3A 2QYSA 3FR7A 2YJZA 1PQPA 3V2UA 2DLDA 3C8MA 1WXDA 4O5OA 3BHIA 1HDZA 3GEGA 2G76A 2JL1A 5HBRA 3QVXA 3DBHB 5JDCA 1JAXA 4KPKA 2WYUA 2VRBA 3TT6A 1OD2A 1LLUA 3JYOA 2E4AA 3U62A 5L53A 4NFHA 1UP6A 3DDNA 1UAYA 4XRRA 3K30A 1QYDA 3FTPA 1A27A 4JBIA 3I9NA 1RM5A 4XQGA 3NRCA 1XIVA 3ZHYA 4BQRA 2HRZA 4KTVE 3UF0A 4CM3A 1KEWA 5KVCA 3T3WA 4BNZA 2W8ZA 3AY6A 1VL8A 4D3DA 3MJVA 1UYVA 1T4BA 4GQAA 4CLXA 1H6AA 1O9BA 4GX5A 3GR6A 3QWIA 4PG7A 5GZ3A 3QXZA 4NK5A 4RCVA 1ML3A 1U7TA 2I67A 1H6BA 4WLFA 5DULA 2PBPA 3IB9A 3E9QA 3TRIA 2V7PA 3UUWA 2Q4BA 3KTKA 5BSEA 3KLPX 3H9JA 3WBFA 2I5PO 4NBRA 5BSHA 2Q99A 4AJ4A 4WKGA 2O3QA 1K5HA 5AVOA 5JCJD 3SLLA 2I76A 5BNIA 1QXSA 2DU8A 3RFVA 1PIWA 3QYRA 1CWUA 2Y68A 2C7GA 2VSUA 1KVSA 1N1EA 3RU7A 4FFNA 2C29D 3DONA 1IL0A 1BDMA 3QMJA 4OQZA 4TRMA 3DC2A 2FZSA 2HAEA 4TMFA 1NX6A 3I9OA 3Q3CA 4XGKA 4FD3A 4DREA 1PL7A 3KYDB 3RUAA 2NQ8A 3FCOA 5ES3A 1ADBA 2H63A 4RPJA 5JMPA 4IDGA 3SLGA 1VKOA 1Q7CA 3GEDA 1A9ZA 3K6JA 3WFJA 4PN3A 5CTBA 4XR9A 4EZBA 5C7IO 3PP8A 1PJSA 2Q2VA 5G1SA 4GBJA 1P9LA 4FDAA 3FPCA 3LF1A 3AY3A 2XAAA 2Q2WA 3W8DA 2DBZA 5A03A 5JCXA 1F17A 1MV8A 4FN7A 1E7QA 1A7KA 3L9WA 1HE4A 1W73A 2W4QA 1ON3A 4MXIA 1YKFA 3M1LA 1HYGA 4I5EA 2CMDA 3I9MA 4YRAA 3WGHA 3JQDA 4GWKA 3TJRA 3M6NA 4NJOA 1BVUA 1N7HA 3H0QA 3H2ZA 1GY8A 4H16A 2Q35A 4BO0A 3JD1A 2Y0DA 5U4QA 1Z7BA 1UJMA 1XX4A 3VH4A 3ZNNA 3FF6A 4EMMA 3ZWMA 2C8TA 3D1LA 1XQ1A 2WD8A 1M76A 2C82A 3V1UA 1LC0A 3ZV5A 4LK5A 4BNYA 1TLTA 1GDHA 1LLCA 4MPDA 1GYQA 4G2NA 1R4MA 1M75A 3HDYA 3BA1A 4GVLA 4IGFA 1GZ6A 2EKPA 3QWHA 5IDQA 4L73A 3KYCB 1HLDA 1CYDA 1B0AA 3I23A 4N7RA 5DDIP 4XB1A 3IL2A 3LKEA 3N6RB 4LMPA 3LT0A 2JD1A 4J1TA 1BG6A 5THKA 4F45A 1JVBA 1EE2A 1Y5MA 4W4TA 3PLRA 4UUPA 5I7EA 3IP1A 4CMBA 2DPGA 1S6YA 3H7AA 4JOTA 3QVWA 2P5YA 4M89A 2PD3A 3QVSA 4YAKA 3WNVA 4Q0GA 3ZWPA 3VH3A 4OKNA 3L9XA 3PGJA 5B4VA 1F12A 3PQDA 1PJ3A 4AG3A 3T7EA 3IUPA 3DORA 3LT1A 3JD3A 4IZBA 4ITUA 2JCVA 2RHRA 2B4TO 2YY7A 2UV8A 4GAEA 4WUVA 4GX2A 3RU9A 3ZN2A 3ZNPA 3BPPA 1B3BA 2PZKA 3VC7A 1PGPA 3BTSA 2ZQRA 2EW8A 4BKOA 1E3WB 2Y1OA 4WNCA 2CVZA 1QP8A 3I5MA 3ISAA 1ZUD1 1NWCA 4E5PA 2ZJ0A 5EN4A 2PWZA 4MP3A 5K0ZA 2F9YA 3SLKA 1YG6A 1OC4A 3W8EA 4R4JA 1PZHA 5L7TA 1PGQA 1KEUA 1SNYA 5G0TA 3FWNA 2VRCD 3RUFA 5KKAA 2YV1A 1JVSA 5AYVA 3ULKA 3WQQA 4LMRA 4DC1A 2DVMA 4BIIA 1RJMA 3S55A 2HU2A 1Q7GA 2ZJ1A 4ZJUA 3JQFA 1NQOA 5DBIA 3K9QO 3GF4A 3QA9A 1X0VA 4YXFA 3ZGYA 1LC3A 4JBHA 2PNFA 3F46A 1PSDA 3G0OA 4OSPA 5I8WA 1AUPA 3TZKA 4IIUA 4YQYA 1DPGA 1UXGA 1WW8A 4AJJA 2WMDA 3B70A 1UDCA 1LNQA 2YZ7A 3AFMA 2Y0CA 4OHUA 4B8WA 2QQ3A 1UXJA 4E5NA 2GLXA 1PR3A 2PKQP 4B3IA 2WJPA 4M1QA 3WX0A 5ICSA 1N7GA 3M2PA 4BS9A 4TSKA 3JQBA 1DJQA 3DOJA 1I24A 3KXDA 4NBTA 4DTIA 1SZJG 3I83A 2PKQO 2EP7A 3LZ6A 3JQ9A 3DAFA 4XB2A 5KJ6A 3MZ0A 3O26A 1LUAA 3TDKA 5KVQA 4F6LA 3GEMA 4B4WA 3KBOA 1C0KA 4FJWD 2NU8A 2A94A 2AG8A 4TKMA 2OL4A 4PVCA 3WB9A 2PZJA 3GDGA 4FBGA 4ZDDA 1TVEA 1ADCA 2NNLD 2PG8A 4Z9FA 3OF2A 2WM3A 1EVIA 5FI5A 1J4AA 1FC6A 3FWZA 1UDAA 3DOOA 5DP2A 3WGZA 1A4UA 3U3XA 3IJPA 1DEHA 1R66A 2W3PA 1HZZA 1GAEO 4XRGA 2FN7A 1KVQA 1ISJA 2HK7A 2Y66A 3R3SA 4D0SA 3WMXA 2JCXA 3ENNA 1P74A 2XXBA 5IDYA 3JTMA 2DUUA 2NVUA 1QYWA 3MYBA 1I3MA 1Y8QB 3CEAA 3P5SA 1IPEA 1W8DA 3U4HA 2CE3A 1I2CA 4K28A 2B5WA 3PJFA 4L76A 5CPBA 3O38A 3WICA 1VRGA 1VM6A 2EHDA 3GHHA 4YVFA 1XSEA 3AUSA 3QLJA 2H1SA 2O3TA 4FJ0A 5TX7A 4A0SA 4CL8A 1E3IA 1YDWA 4IBOA 1P44A 5DZKA 3T7CA 4OXYA 5KTKA 3BF0A 2HMSA 3IBBA 2GDZA 5JBWA 1NQ5A 5G1RA 3S2GA 1IZ9A 2YQ4A 2B35A 2B4RO 1SPXA 3S2FA 4BO7A 1ZJYA 1M6HA 5DP1A 4DUPA 3VKVA 2Q1UA 2QYTA 1IULA 4CQMD 1YDEA 2I3AA 4CM5A 4FOOA 4L4XA 5THQA 1JN0A 5FF9A 4EITA 2VHWA 4J0EA 3HP0A 2O3SA 2J3IA 1HNOA 1Y1PA 3ONFA 3H5AA 1T2EA 3I6IA 5IN5A 4CQLA 5DOVA 1KC1A 1NZYA 3BMQA 2BFAA 4B3JA 1Z82A 2VSSA 4NZ9A 3T89A 3GNQA 2C7VA 4CR6A 4DC0A 3GLMA 2DUBA 5DOZA 3QW2A 3PYXA 3ROKA 1V3TA 4LK3A 1ZSVA 3WGYA 4E32A 4GL4A 2Y1GA 1YH3A 5U1PA 4W7IA 4I5FA 4IQ0A 3B1FA 2AEJA 1J5PA 1BXGA 1OC2A 3ASUA 1C1XA 5EPOA 3QHAA 4QFEA 3F1KA 5T6BA 4R5HA 1ONOA 4FC6A 5C37A 3ZWNA 3FDUA 3BMOB 3RC2A 4YLHA 3PHHA 3PWZA 1WAMA 5B1YA 5DZKH 2D5CA 3V1YA 2IYOA 4I1IA 2VTEA 2QIOA 2POQX 4IJWA 2AQIA 4E3ZA 4GKBA 1X0XA 4EBFA 4IY1A 2PR2A 2X7HA 3OECA 3GUYA 1LQUA 4HUJA 3OC7A 3F47A 3MTJA 4E4YA 1NPYA 1NVGA 3KM0A 4BO1A 2B69A 3HB4X 2RH4A 1QG6A 4AJNA 3VPFA 3GF3A 5IXYA 5DCWA 2V6MA 1LX6A 1NNUA 5TLSA 4ELSA 3OP4A 2NLOA 2Z5LA 1PQWA 4J43A 4L9RA 4IPTA 2BGKA 3H9EO 1ZK0A 1BGVA 5L9AA 4JCSA 1HYEA 1PJ4A 4PLVA 5CP8A 2C59A 2CD9A 4RYFA 4DLLA 3STHA 3OJ0A 3K2EA 3PZRA 4PG4A 3HB5X 5B4UA 4GM2A 1T2CA 1IOLA 4IZIA 1P1IA 4DIOA 3OETA 5TC4A 5E0NX 2PFGA 4OL9A 3TNLA 1ISGA 1HDCA 4BGVA 1E7SA 3C1TA 2UVDA 4YJDA 5IZCC 1M6WA 1JU9A 1SMKA 1U3WA 2VNSA 4TQGA 4XQ9A 4B4VA 1FXSA 3LC2O 3OA2A 4LN1A 4UEKA 5DCUA 5H82A 3WTCA 4EEXA 4HNKA 2W2KA 4JN6B 3IJRA 5FI3A 2HK8A 5JYDA 2AEFA 2HLPA 4EUFA 4Z0PA 5F21A 3KTHA 3ONEA 4A2CA 4AJ1A 1GPJA 1ULSA 3GT0A 1FCFA 3PHGA 2HW5A 4QEDA 1ISHA 4OO3A 3ZU4A 4A73A 2X9NA 4UVEA 2E6UX 4YA6A 3JQ8A 3RUHA 1NTOA 4MO2A 1HE3A 3QE3A 4PRKA 4WCZA 4DGSA 1NZYB 1EFKA 1YL6A 4Q3CA 1DXYA 4RZIA 5F5NA 3LSYA 3NJDA 4Q3DA 3PIDA 1PX0A 3I52A 3Q7HA 4DVJA 1JA9A 3DMTA 1XKQA 3UICA 2F9IB 4D43A 1EQUA 1ZXBA 2J8ZA 4RF3A 5HWSA 1IZ0A 1O89A 3ZWOA 1DIAA 2D3TA 2OXIA 4WASA 3GQVA 4LRTB 4Q3AA 3H0JA 3BZUA 1O0SA 1R37A 3NV9A 1LSUA 4KUHA 4YACA 4DPKA 2I9PA 5J23A 1SO8A 1BXZA 1EBFA 3PEFA 2P2SA 4II3A 1KYQA 5CAEA 3W4IA 4BNMA 4CLDA 4HADA 1A7AA 1EDOA 4MVJG 2CBYA 1XHLA 3HSKA 4PGFA 4LSMA 3JQAA 3I47A 3D4PA 1AHHA 1SEVA 5CG1A 4P4GA 2IODA 3GFGA 1XGKA 3SC4A 1NBOA 4ND1A 1E7YA 4FNBA 1VLLA 4BNIA 3KQFA 3BTUA 4R69A 4TVOA 4XYBA 1KBZA 3AUUA 4DA9A 4XYLA 3MJTA 1I8TA 4CR8A 5DUCA 3WQSB 4XGNA 5TRTA 3HADA 3GRKA 4OIMA 1LDNA 4IUYA 4JP3A 4L8KA 1H2HA 2DBQA 2VSUC 2EEZA 5I9MA 4ONEA 2CY0A 3QJ5A 1EUDA 4C7KA 1WZ8A 4XYMA 1YBAA 1FC9A 5CTCA 3DL2A 4IZCA 4JVTA 4WPGA 2NADA 2UDPA 7ADHA 1O94A 2DFDA 2VOEA 3NT4A 4XA8A 1JKIA 5G1QA 4KD6A 1TT7A 3F9IA 3VHRA 2X9VA 3ZV4A 2VTDA 2CVOA 2J5QA 4PLYA 1NQTA 4YQZA 3OSUA 3VPXA 4RF4A 1GTMA 3CUKA 4I9NA 1TYFA 5EL0A 2O2YA 2WYWA 2DBRA 1UYTA 3JQAB 5GZ6A 2RCYA 4FN4A 4AVYA 1PR9A 4J4BA 1LU9A 1SC6A 2NM0A 3R1IA 4CODB 5JXWA 3GMDA 1DSSG 4WNIA 4PLZA 4U0GH 1SB9A 3KO8A 1Q0HA 2J3JA 5INFA 3WSVA 1V9LA 1DOHA 1ZIDA 1R4NA 5EMHA 2NP9A 4CMAA 4PLFA 2YW9A 1ZW1A 1ADFA 4LCJA 4YRDA 3W4JA 4CL3A 4N5LA 5CEJA 3LYLA 1CF2O 3ANMA 2BD0A 3V5IA 1I10A 2GN8A 5KJCA 1AN9A 1HZJA 2B37A 3CPSA 1WPQA 2J6IA 4ZU3A 4ELXA 3JQ7B 4BVAA 1PS8A 1T24A 5I9NA 2J5GD 4HY3A 3DXFA 3ASVA 3E8XA 1Y9EA 2AE2A 2G0TA 3HZZA 4E12A 4JROA 3QWDA 1XEAA 4WK6A 3D4OA 3F1LA 4G65A 1ZFNA 4DYDA 3R9TA 2JHGA 2IE0A 2VHXA 4I9HA 1T2FA 3BHMA 4MVJM 2GPTA 2JD0A 1DB3A 4PZCA 5G0SA 3GAFA 3Q1TA 4ND2A 2GN4A 4AJPA 4YRBA 5HA5A 3OQ1A 3ZWBA 3KRTA 1XCBA 1H0KA 3JYNA 3EC7A 4U7WA 4GGPA 1DIGA 1ZMOA 2NACA 3OJOA 4J91A 4WJZA 2I65A 3SX2A 2BELA 1SBYA 2D5AA 1AXGA 4PLWA 4GLLA 2GRAA 1NR1A 3QXIA 3F5QA 1NASA 3KSDO 4ALMA 1LI4A 1Y8QA 3N58A 2YHIA 5DL1A 5DT9A 2VWHA 2F00A 3L6OO 4ZQHA 3UVEA 2P91A 3Q0GA 2GO1A 4RCNA 4G2RA 3U4CA 3V2HA 2FP4A 3FN4A 3PFWO 4XYGA 3I9JA 4GX0A 3LT2A 2VNAA 4PLGA 1FF9A 4R1NA 3W6ZA 1K6IA 4JJGA 4D3SA 4RVUA 2VUTA 5L4NA 5F3RA 2C54A 3K96A 1UXHA 5ICMA 2PH5A 3DZBA 4F6CA 5HM8A 2E37A 2NVWA 3I9LA 2DBVO 4TVBA 2ZK7A 5TT1A 3OEYA 3JQGB 2AE1A 1GZ4A 4UREA 2DPHA 3ZDFA 3WGTA 1QYVA 4O63O 4WCDA 2VSSE 3C7AA 3ROPA 4A7PA 5T57A 1ZZEA 4UEOA 3G17A 1E5QA 3HNPA 4ZQEA 5KIAA 4HNHA 4RF2A 3PVZA 1ENPA 4HFMA 3NDJA 2O2SA 2JAPA 4HBGA 2V6GA 4C7JA 4BNHA 4D41A 3HWRA 3WIDA 5IF3A 1YBMA 1U5AA 3SJ7A 2JJYA 5K6AA 4D42A 4JJTA 3V1TC 4PG5A 4OJNA 4IDEA 4IM7A 1RM3A 3W1VA 4JBGA 2F9YB 3TQHA 5IJZA 5CG2A 1H94A 1ORRA 1U2GA 4CUZA 3TV5A 5AQ1A 4XQEA 1T2AA 4XX0A 4ZDEA 1OBFO 1CQIA 4YR9A 9LDTA 3TRRA 3GGPA 3CINA 5FEUA 1KVRA 1GUYA 1E3EA 2B4QA 1PQUA 1EEHA 4D79A 3KLMX 3ZI0A 4FQ8A 1Z6ZA 4BOYA 3KB6A 1C0IA 2RIRA 3K73O 4DMMA 1I30A 4U0GA 4WYOB 3GPIA 1C14A 1NM5A 2AW5A 4PVDA 3E1KA 5TQVA 3FD8A 1PU2A 2OFPA 1EUCA 3RC9A 3U4IA 1JW9B 1CJCA 1V3VA 1L7DA 2ZYDA 3FPLA 2O3JA 3DOCA 4YAGA 1Y7TA 3HRXA 3WLFA 4W6ZA 2Y1FA 4NHEA 2JCYA 3NDIA 4W82A 5G2OA 3WYCA 4E5MA 2CZCA 4B4OA 1EZ4A 1UP7A 2RBEA 4KDEA 2X5JO 1PEDA 1KY4A 4ZD6A 3M6MA 3P2YA 3IP3A 2QRLA 1PJHA 4DPLA 4FGSA 2H6EA 3OMEA 2VZ9A 4KQXA 2EJVA 1XDWA 5INGA 1U8XX 3HDHA 5GMOA 1ARZA 3S2IA 4J90A 4P22A 4GH5A 3DZHA 3N7UA 4MINA 3BMOA 4DRYA 3H9GA 4TRRA 3GLQA 4ALIA 1BWSA 4FIZA 1PGNA 4B8ZA 2O4CA 4DLAA 3ABIA 1DIRA 3L0DA 4BNGA 2OGUA 1K6XA 2NWQA 4CUKA 4II2A 3DAPA 2NSDA 2EKLA 2X22A 3EHEA 4RVFA 5BT9A 4E33A 4PLCA 1HT0A 4R1TA 3AOEA 1LQTA 1QR6A 3KTDA 1HL3A 4BMNA 4YCAA 4YT5A 1C3VA 4GHNA 3GGGA 1DIHA 2FHSA 4ZN6A 4R16A 2VOJA 1Q0QA 3IMFA 4HNGA 3C3XA 3D0OA 2ZTUA 4AJEA 4RVDA 5HTOA 1OAAA 4ND3A 3VPGA 3VDQA 3F4BA 2HO5A 3Q1LA 1U5CA 4WCFA 3RROA 1HETA 1YQDA 2W2KB 3WGOA 2EJ5A 4IZHA 3L3SA 2OBYA 4PLHA 1V6AA 4CMIA 5ITWA 1P0FA 3AM3A 4OKIA 4BNKA 2DAPA 3BMNA 4GI2A 4U0KA 2OBNA 5IG2A 4UULA 3MJEA 3WFIA 1X7DA 4KWIA 3TWOA 4EJ0A 5DUFA 3UXYA 5C5IA 2Q2QA 4K3WA 1BSVA 3KYDA 2Z1MA 2HUNA 3AUAA 1CIVA
chains in the Genus database with same CATH superfamily
1JHVA 1OILA 2P79A 3FSRA 4DB4A 1NW6A 3OIYA 3TKAA 2VNIA 3I6QA 3PICA 4WLNA 3FDZB 4PHTA 2R97A 3RRNA 4EELA 5CD1A 1OGJA 3F6RA 4I8DA 2V03A 1MOSA 3M5WA 4ZYTA 1I33A 3LWBA 3ITKA 4LVCA 4NDNE 4TT3A 1FP6A 5BMOA 4C05A 4PGGA 3G79A 3H2JA 1P2TA 5HZGA 3G0IA 1A5TA 1OZAA 4Q3OA 1JU3A 3QBVA 4A8JB 2RAPA 2V96A 3TG8A 2N42A 5DZSA 4KMSA 1MRNA 3LW7A 1YTUA 4O08A 5DHTA 4Q6WA 4TYNA 1BFDA 5EC8A 3LGAA 4M1SA 2FHPA 1Q51A 3DZCA 4BV8A 4NOLA 1CEQA 5DBEX 1IN5A 1IPFA 4R54A 4BQFA 3B2NA 2I3ZA 1W25A 1D8AA 3W5AA 3STUA 3OJCA 4KO1S 3L7KA 4Z2YA 3EZLA 3LHDA 1AGXA 4CLRA 2PUWA 3EA0A 3NM5A 2ZAGA 1INLA 1USWA 1UR5A 1BEUB 1NBMA 3CZRA 3PXAA 4ER0A 1EJ6A 2C2KA 1NKTA 1D0SA 2Y1WA 4PYIA 2BFWA 2X4DA 2RHGB 5KNDD 5LZ9A 2EGHA 4RTRA 1RQ2A 1WCXA 1Z56C 3Q6NA 4PZLA 2FPPB 2FEAA 2PSJA 2QHXA 2W58A 3L8GA 2PGDA 4WGGA 5HE8A 2ZYAA 2XB2A 3I04A 1UIYA 1I5RA 3FKSD 4UAGA 5HS4A 1Z45A 1SCDA 2DMRA 1Z0UA 3LCMA 2OA0A 2V0CA 3L7CA 4WFIA 3V1KA 5CCEA 3AUFA 3TOSA 5GZ1A 2C83A 2O5CA 4MJXA 3FHOA 4RDHA 1RYNA 1XMSA 3MK31 5EIEA 3TVWA 3KXLA 3JX9A 2DWQA 5CFQA 3R40A 3O3CA 1ZVKA 4NPCA 4IZOA 1ZG3A 1DWQA 2NU9A 5GVSA 1QAOA 4HZUB 5IARA 4KBYA 3Q88A 4GX1A 1DAOA 3PWKA 1TTQB 2D2XA 2X3FA 1E6WA 3GLTA 4A03A 4ZMSA 2C7PA 1JHZA 2GEDA 3ZIAA 3OMLA 4F5YA 4CHGA 1ABEA 1CZOA 4ALLA 1WKVA 4FBLA 1AC5A 2CJWB 4G0ZA 5K0TA 5ESDA 3I12A 1KVUA 4HB3A 5SY6A 4GPTA 2FZVA 4QLBA 3VYVA 1SVIA 3F7TA 4NVRA 5BSFA 3T3PB 1R4ZA 4L2IA 2X4GA 2IEYA 2FP3A 3CX4A 3PUVA 2ZB4A 4KXMA 3TZ3A 4F6RA 1QLJA 4J9VA 5LD2B 3L7LA 4E5SA 2XNKA 3ROMA 1KPIA 1EM6A 2JS7A 5EJGA 2NSJA 3OJEA 4XSHA 1F38A 2XRYA 3JZFA 1M6NA 5BOSA 2F6RA 2AOUB 3H5NA 4JGGA 1F14A 1YR9A 2J9RA 1ATIA 4P3XA 2UUBB 1HZDA 3AEZA 3O8OA 1SCUB 4ID9A 1LBEA 2JIBA 2AC2A 1Y48E 2NP6A 2FWRA 5A2QA 2OUIA 2XNHA 3NHBA 1O8UA 2JAUA 4M36A 2AC4A 4OOEA 5KTRA 4IUDS 3U3JA 2HZ7A 4PYJA 4K2NA 2C5LA 4YBRA 1SVLA 1USKA 4DOMA 3OA0A 4RTMA 2QTNA 3UUEA 1EEXB 1XCMA 1C0LA 1CRWG 2HCRA 4S1NA 2WM8A 4YB8A 2P6PA 1WVIA 4ZRNA 3WJAA 1V6SA 4XM2A 5HMMA 5BNFA 3VR6H 4EQ6A 4HQ6A 4LBWA 3RSSA 4YAUA 1E3LA 3BHJA 1Z47A 2FPUA 1PNOA 1SCBA 4JJ6A 5K3AA 1LPSA 3B1YA 2JFVA 4EG3A 2C2BA 1WKCA 2W6PA 4HAVA 4W9RA 2R9VA 2EBHX 2J0SA 2I1WA 4QODA 4WKOA 5CNMA 3V4VB 2NV2B 2BKEA 1N5IA 4FX5A 1ON9A 1T2UA 2FU5C 3G49A 5JZSA 5FYDA 4HEJA 3ANLA 2HA0A 5B6IA 1HLFA 6PFKA 3DE2X 1R18A 3HJRA 3Q8XB 1RAIA 3IELA 1XEXA 5EUQB 5ECDA 2VRCA 3TUJC 3HCDA 3CZ5A 4KWCA 4G3XA 4EUEA 3DJYA 3MOGA 3WP0A 5FH9A 5AKZA 4ZZ2A 4NQRA 1LH0A 1OXKB 4UMDA 5F1OA 4GXQA 4AROA 2FOLA 2IPXA 2YWJA 4JYMA 1NULA 3WKDA 1ILEA 1HDGO 2QRZA 4UBOA 2BRUA 5U9CA 2O8FA 2NZUG 2CJWA 2H8KA 4R2JA 4KFUA 4E3WA 3LVQE 5DEIA 2ZT7A 3KKMA 4L0DA 1QNLA 4LJ8A 4N18A 4RV9A 2E4XA 4L75A 5E6UB 5H4HA 3ZWWA 3O03A 2NSHA 1ZK4A 1NPDA 2GEJA 4GZMA 1S02A 1XRJA 2V9CA 1FW6A 1D5CA 5LIPA 2ZBFA 5I5EA 4KWBA 1WDKA 1YR2A 1NNLA 1P0MA 3TDCA 1AD2A 1NUUA 3HBFA 4Y9RA 4ZYXA 4DR1B 4TYQA 4MS4B 2R5FA 2WPDA 2XGGA 3H9QA 2Y77A 1NXVA 3FCCA 1TMGE 3HWSA 3ILYA 4GS5A 4L9SA 4MVYA 1XJQA 5CVCA 3NCTA 4D98A 2PUFA 3OZRA 1VMKA 2DERA 3SS9X 3R4VA 4LDNA 5B1DA 1UADA 3HDJA 2DUBA 1N0IA 4YMGA 4KP7A 1WR8A 2A67A 2OP0A 3D6MA 4P5PA 1F5SA 4KPFC 2D7JA 4ZMBA 2HQRA 2YNMC 4FT4A 4MRMA 4DCPA 1E2KA 4YRTA 1OJLA 1FQKA 4HFNA 4CUJA 2QVZX 2VX2A 3T5GA 4LVOA 1GL3A 1K92A 3F8WA 3EOBI 5FL7D 3VNBA 1FUEA 2V45A 1EB9A 3G9QA 4TV9F 1KAMA 1Z06A 4YUYA 3RS2A 1T8PA 4W9NC 2PXCA 1Z38A 4NNPA 3TOVA 1YVUA 2ZE6A 1HNUA 1O0BA 3UAWA 4HEA6 4Q4CA 4E07A 4JASB 1D1TA 3VDRA 2ET6A 3BA6A 2GAFA 5AW0A 1V4NA 4D7AA 1S3IA 2RG7A 3UM9A 4CCYA 3N7TA 3L0ZA 1FTSA 1ZINA 1NE2A 4KFTA 4S1PA 2A7QA 1UMCA 5HZHA 1RMYA 1BDJA 2G71A 2G8LA 2MR6A 2R5NA 3PA8A 3C3EA 4YJFA 5B36A 3M4JA 5JJLA 4F47A 4U7PB 5EJFA 2QE6A 2GILA 3JSAA 1OROA 3OZIA 4N40A 2FWBA 3PSAA 4WK4B 5BR8B 1YDFA 4N76A 3PXUA 3WGGA 4D5EA 5CDSA 4RZSA 3TM4A 4G1MB 4K9KA 2QA5A 3HUDA 3P27A 2BGLA 2C1EA 2HREA 2R7NA 3L7YA 1UFKA 3UMJA 4CYMA 1R9MA 3PFFA 5EZYA 2BI8A 2Y93A 1L4YA 3AO0B 5HFAA 2VP2A 1BDIA 3FUXA 2QE7A 1WCIB 5ENDA 4LFAB 2AFIA 2O23A 3BG5A 4KMMA 5LP6A 1U3CA 2C00A 1OREA 4QUHA 2A9KA 5ILOA 1T4CA 5DYWA 2JLUA 4XZ3A 2G5PA 1LTKA 1N5RA 1P62B 1U8ZA 2DRIA 2F4NA 2ZTLA 4MCJA 4YMVA 3EWAA 4M7WA 1DC6A 3QX9A 4EPWA 2Z08A 2GARA 2OSBA 3QZUA 4YGXB 4ENVA 5ADVA 2Q5FA 1N2XA 2AOTA 1FQWA 1U1FA 2X2EA 1CBUA 3DXXA 5BOVA 2WSSD 4B6JA 5HQ3A 1AQJA 3ESCA 5ALPA 4N3NA 1JHPA 2NZ2A 3QYJA 2JGKA 2QAIA 4H6VA 4PTLA 4I3HA 1LB1B 4NYMR 4F21A 1E0KA 3AEKA 3OLZA 2DG2A 1O77A 2CK3D 3W2TA 3U7HB 2ECOA 5JBNA 4AMUA 2WSLA 4C0QC 1BHQ1 1JDUA 2QN1A 1Q0LA 1U7ZA 3BD6A 3RHFA 4AF7A 2PL3A 4FQ5A 4GI7A 3PNSA 1Y6FA 4UCWA 4MLZA 4IICA 2E4WA 4H6PA 2PT5A 3OPXA 4ENRA 1OH5A 3FOCA 1XDGA 3KD3A 2WT9A 2I1VB 1FDVA 4RFSA 3LLCA 2AEMA 4AWXA 3E22A 2EFEB 1TJNA 1TCCA 1N1GA 3RYCB 3FSEA 2FVYA 1ETHA 1UP4A 3EEIA 2DT8A 3DMPA 3ILSA 4GGMX 4JIGA 5ECWA 4EWLA 3PE8A 2HFKA 1F8XA 1ZIPA 2E4VA 1NN3A 1QGED 2BP7A 5FLYA 1QIKA 4D8YA 5MFPA 5LVAA 2YVKA 3LA6A 1G8MA 2JNWA 4XJXA 1MEEA 2E4ZA 1E20A 1WXIA 3KUDA 2BPOA 1L4HA 2FZKA 4C4OA 1BRMA 2H7VA 4IH9A 1VLZA 4ZU2A 1TF5A 4WJLA 2ANBA 2PZAA 4ZHQB 3H4IA 4L8WB 3FFXA 4QUDA 3HABA 3L92A 1D2CA 1BE0A 1IG0A 4NJMB 1I6MA 4I5IA 4MW6A 1TZJA 2CCJA 3M1AA 3THYA 2ZJZA 3EXG1 3OX3A 3GZNA 4JI2B 4EI2A 4YUVA 3ANXA 2OV3A 1GLGA 1J7XA 2JIDA 1DQSA 2WHXA 4X90A 2C4TA 2HV9A 1FDRA 4OQPA 4K86A 3R6HA 3NDPA 3GP8A 4QFDA 2ODPA 2VP6A 1JDBB 4BLTA 1JFFB 2VDVE 3K9BA 4XQCA 4A6PA 4A8HA 3HO6A 2BMFA 5BV7A 4DV0B 4Q4JA 3D3JA 3QIVA 3IBSA 4YMSA 4HDMA 3TR5A 4CM9A 4DMUB 4IYJA 2OVBA 1ORHA 1R88A 3H1PA 3S2EA 3M8KA 1WHTA 3OEWA 4UNRA 2I91A 1DHRA 4BE7B 1BGXT 4PZDA 1PVVA 5KHAA 3R9SA 3NT2A 5HEKA 3WYNA 4D9EA 1CUYA 4LSZA 2NUTB 3QKAA 4NFSA 4FEGA 4LQLA 4QRDA 1OB2A 1GA1A 4RDIA 3REQA 3TRHA 2DCUA 1PT7A 3V1NA 4B34A 4DKXA 1KI6A 5K6TA 1G0NA 3GG2A 2YWCA 1S2MA 1KIFA 4ZEMA 3ER6A 1RCUA 2B5OA 3H18A 2FUKA 1PLKA 1BCRB 1VPLA 3O1HB 5HDBB 1S4MA 3H65A 4P86A 3UMMA 1A77A 2WSBA 2YWXA 2AFIB 4KXLA 1VL2A 4CF6A 5FIUA 1MC4A 2O2XA 3CNHA 5SYMA 2Y9MB 1E58A 4FSHA 3BRSA 2L82A 4IGAA 5F1YA 3PC3A 1T1EA 421PA 1AZSC 5ULLA 4DN6A 4AECA 5GOZA 4MWTA 2VDKB 2AR9A 4IKOA 4RORA 4AIIA 5DTPA 1K1EA 4KE6A 4YXWD 1RRCA 1DS6A 4QYIB 2WUVA 2H1FA 3DE7X 1A9RA 1BVHA 5FUSA 4HLDA 4H9GA 4NZMA 1NOIA 2GKSA 2XMPA 3EF3A 2RHLA 1MJFA 5BNIA 4BFXA 4QOIA 3ZHRA 4CU2A 2F1JA 2RK6A 4HMQA 5MDHA 5IAEA 4NE9A 2VVTA 1A5SB 4NJMA 1KJ9A 1QX3A 2DEUA 3KDPA 4AKEA 4WOJA 4OX9B 4X8HA 1XYVA 3MGCA 5TV2A 3QU5A 1RZUA 2VK4A 3MD0A 4R2WA 4ZYLA 1QF6A 1OH6A 3AHGA 3VYWA 3FB4A 5FFMA 1RRVA 2FMUA 1ZJZA 3EWSA 2XB9A 2O19A 4KPUB 5BV0A 3P97A 3LUDA 4DT1A 1XYGA 1IN8A 2X0RA 3U09A 1QAQA 2WTEA 1O94D 2DWUA 1KYZA 4O59O 2D3WA 2PG3A 1T8TA 4L5CA 4OHKA 4EABA 4MI2A 2I4NA 3WISA 1GUFA 1Y89A 2H18A 1N6LA 4RV5A 5FWXA 5L7YA 1BXKA 3G8DA 4Q01A 2FI1A 3A2NA 3JTEA 4FJ2A 4LY0A 1ZS9A 3HJHA 4MVJH 2YYZA 2IZ1A 3FI9A 3V8BA 4DRXB 2OBLA 3L7OA 5FUXA 1ZGAA 4G0WA 3EGOA 1EFVA 1K8YB 2AJDA 2IDZA 3TK1A 5JFTA 2AHOA 4C0JA 1JYFA 4QUEA 5CK4A 2QQ5A 5AHOA 5ITZB 1J06A 3UAOA 2G5CA 1JG4A 1MB9A 1XZKA 2CFCA 3G5MA 4YP7A 1I1OA 3EY4A 3NATA 4MRNA 4OYYA 5JVDB 3ADOA 2VKQA 1GGNA 4J0KA 4L50A 1VHTA 5KTOA 2CL5A 3LUHA 4LXIA 5D7NA 5CBPB 1IY0A 3UJ6A 3N74A 3K70B 2R6JA 5F9HA 1Z6XA 2WQZA 3OZCA 2H4JA 4G37A 1UJ6A 1NYLA 2I4MA 2XNDD 1ND5A 1OOEA 1UXIA 3O4VA 3T5PA 1U1GA 4EVQA 4EY8A 1U2DA 2FPMA 3DTNA 1VIVA 3B13B 1NUTA 3V3KA 1J24A 4AXBA 2O5RA 3PX7A 1SULA 4M37A 1E1CA 2OHIA 1XMXA 5CLQA 4QOGA 2RONA 1JQ5A 1S1CA 3K71B 5FOXA 4LWQA 4HRAA 2YH2A 4FVTA 3DOHA 3SNKA 5JISA 4HQKA 2OO5A 1ID1A 4G8BA 4LRWA 4MULA 4U2FA 3VNQA 5L51A 2PUGA 3D6JA 2X77A 2WJIA 2HRRA 4HAWA 5IPFA 3ZWXA 5FBVB 5LM3A 3AHDA 4M1MA 1TF2A 4YAJA 5TPWA 4X5OA 4E1VA 1PJ8A 4E21A 4ISBA 4A82A 5T5QA 2B5VA 3S1LA 3U2QA 4O0MA 4H31A 1ZM9A 5ELLA 5JZOA 2XTZA 4RX1A 3JQFC 2QRJA 1TCUA 3LY8A 5F1PA 4BKUA 1DQYA 2NPFA 4YRSA 2JGDB 2ZE8A 2XT6A 4OLAA 5DPMA 4F3YA 2ZWVA 2H5JA 4AIRA 5GINE 2VZEA 3GJYA 3H2HA 1GNRA 3HP1A 5BNTA 4W9NA 3GCWA 4QUBA 5CW1A 3DNMA 3DOEA 3BWBA 3KXPA 4EB6A 1UOQA 2JRLA 1X1RA 2LDXA 3CQ9A 2GFIA 1EK1A 4WN3A 2VPIA 1A2QA 2D8AA 5LBTA 3QMMA 1Z62A 3S1SA 4RETA 1TO6A 1V4VA 3TVUA 2QRUA 1JQAA 4L4YA 3QGMA 5LZ4A 3C5WP 3AJRA 4H15A 2HHHB 2JARA 4RCZA 1OVGA 1W0CA 3ZWAA 3MTBA 4R2IA 4KBFA 4LYDA 4A26A 3CRMA 2WV7A 4MGKR 4M54A 2FE4A 3IDZA 2OZKA 4JP1A 3W9SA 4PRLA 4I52A 2YRXA 2ECKA 5TT0A 2FGJA 4KN8A 3UXMA 1JQ3A 3H5TA 4JH0A 2QDKA 4JSYA 3EWNA 3N3BC 1V8BA 1JDSA 4NZNA 1CRQA 4TTAA 1M1UA 1NXXA 1XTJA 2DTXA 2V3VA 2VWGA 1ICIA 5JR3A 5LLDA 2Q9UA 1J6UA 1D6MA 5ECGC 4XCQA 1GN8A 1O95A 3BE5A 3KXIA 1PR6A 5B7GA 3OZGA 1HE8B 3BVPA 2AN1A 1N7JA 1LDBA 4O2BB 2ACKA 4KDCA 3FMGA 3GYBA 3HC7A 4UVDA 2V65A 1RLMA 2FJUA 5EINA 1Z28A 1ZI9A 4ND4A 1Y7LA 3L77A 1EXDA 2DQSA 1QYXA 3L05A 4J7XA 1UM9A 3FGZA 5DNUA 2QG6A 2KM1A 4PGHA 3BTVA 1WCIA 2I4IA 1FY2A 1XLTA 2VYVA 4GVXA 4ZEWA 3SHOA 2E5WA 4C6HA 3HO1A 5DYGA 2EZUA 4NNQA 1L7OA 1QC5A 3F7NA 1L2TA 3TN7A 5DCLA 3QLEA 5IT4A 2GA8A 1NVMB 4XPIB 1K89A 1T3GA 2ZXEA 3PV0A 4W5WA 4UUMA 4JBYA 5A3RA 1CS0A 5F3DA 2A92A 2JFBA 4EKIA 3KVYA 1H0RA 1SGWA 1YZFA 2G40A 2VDUE 3KEOA 3TE6A 4C7OB 4C9BA 2DR2A 2IFTA 5JZBA 4A0GA 3PQ2A 3HYLA 5TGTA 1OKKA 2IVZA 1XD9A 2QRKA 3B78A 4RQAA 2A6PA 3FTNA 4HPJB 4AZ0A 1QRAA 1RVV1 2JIQA 4OSEA 3ZYZA 1N8TA 3H8VA 3EPJA 4TTVA 3KKOA 2HJHA 5EERA 1YQWA 4ENWA 1ZGBA 2EL7A 4L8GA 4YJKA 5KNBA 1FP2A 2WK1A 1FW8A 3ZQUA 3JXEA 3ENZA 1KJ8A 4H4EA 5J4KA 1ENYA 5HRAA 2IF2A 4V03A 3PLNA 1DUIA 1C3EA 2H4XA 2XTAA 3ZQ6A 4MXDA 1ZIOA 2Z9BA 5H02A 4GMFA 1CDOA 1WLYA 3GY0A 4MUFA 4RIIA 1NZYA 2VP0A 3PDCA 3CSSA 2QTHA 4BBAA 3ETGA 1DARA 2YS6A 1UXKA 1FUIA 3D4NA 1B16A 2OHXA 4LC0A 1DL5A 1TI7A 2OYSA 2QXTA 1M1YA 4MLPA 4DJJA 5HIKA 3NTOA 2XB4A 4IINA 3HJGA 3M6IA 3OE1A 3STXA 5HKKD 2SKDA 3KV3O 3M1YA 3NM6B 3TD9A 2J85A 1OAOC 5F7JA 3WNQA 2Y1EA 4D4HA 4F9TA 5JXGA 1KZ4A 2P78A 3I9KA 4BXOA 1DBWA 1TUBA 1Y3FE 1JAHA 4GNRA 4TS9A 1YZYA 4ON9A 1R8JA 1CS0B 3KKZA 3V9AA 4DWOA 3PEAA 2PRSA 1PS0A 1RWQA 2HT6A 3G64A 4C0KA 2XYGA 3DYVA 3G02A 2VK2A 2BBOA 3DMYA 3ZQKA 4BP9A 4JODA 1QH8A 3R7FA 3G2LA 4QDUA 2ZTVA 1FB5A 1NQUA 2GR9A 4Q66C 3S8YA 3VV2A 2QQEA 1XAHA 5C9ZA 1ZL2A 2OLKA 4Q4LA 1XEFA 1SOMA 3DDUA 2FSVC 2WMNB 3DHEA 4JXJA 2WIFA 4FS3A 4N5MA 1KZHA 9ABPA 2YXPX 1FFXA 1K0UA 4P5DA 4BB9A 1WCWA 3D6VA 1G16A 1P75A 3FUCA 3IJ5A 2J5IA 2ZSHA 2P9EA 3BFJA 3EIHA 2FQ1A 1Q0PA 3EK2A 5K09A 3TDMA 3X1WA 5BWBA 1TM1E 3W5BA 2VJDA 2Q1WA 4ZV9A 3A05A 4W1SA 1EVJA 5KU1A 1VPDA 3G0CA 5KNBD 3I45A 3DP7A 2JGRA 4Q4AB 5K0GA 3JWGA 2F1KA 3IAHA 1ECGA 5KVSA 1QHGA 2ZE5A 2C8KA 4BQSA 3OEED 3AR2A 2QJTA 2F3UA 4ZDIA 3BIXA 5ALTA 3OM9A 1W4BA 4BNWA 3DNPA 3LYAA 5CFOA 1T5DX 4TUYA 3IBFA 4JLVA 4YX9A 4I14A 2A86A 2ZL2A 4PYMA 1NAIA 2QR3A 2ZIGA 4XWTA 1GSOA 3L8CA 3NCHA 3LVRE 1ORWA 2NT4A 3IP5A 4ZICA 5BN3B 2FZCA 1ZQ9A 4ZIRB 5CTAA 3PHIA 2WTAA 4PICA 1PZFA 2ZRJA 2IP2A 4PAMA 4QOHA 2FMTA 2VQEB 3DGEC 4JHXA 1DPFA 2JFUA 3VKHA 2Y9ZA 2UZ0A 5JNTA 4O8ZA 5JS8A 3I1FA 3ZDZB 5B4TA 4DFDA 2PSSA 4QAQA 3VDNB 4RJJA 1KMHA 5U4XA 2C5EA 1DC5A 1RQXA 3C6KA 3U4DA 4TXJA 4W5OA 3QNUA 5CDGA 5KYXA 4D9MA 5IKPA 1L7XA 1YB1A 2WWIA 3I4FA 5FTMA 3BRWA 4G41A 3Q0TA 2CGEA 3DE4X 5KJFA 2GXQA 4JXXA 4KIJA 4R8RA 1H2AS 2IF0A 2VHTA 1KP3A 3HN7A 3VVBA 3WWYA 3AM1A 2OZEA 1UYRA 2XWQA 2D62A 3V4SA 4Y9SA 2P69A 1FVFA 4DNPA 4ZDBA 5EMJA 1OBHA 1V95A 4F2PA 1GPBA 2ZUTA 3DBLB 3PVSA 1T4DA 5J4YA 2ZUWA 2QMZA 2A4KA 2K87A 3NWBA 5KDLA 4QVIA 1NJFA 3DTYA 1FYXA 3P2JA 5ILQA 3DAYA 1UF9A 2VDWB 2ZRFA 4OD0A 3ZUPA 1X1AA 3R6WA 3F90A 5COQA 1EQAA 4CMIB 5IKLB 3RUIA 4DSZA 2FN3A 4EJ6A 3OLWA 1EQ2A 3N2GB 1QG2A 1NRJB 2AI2A 4CG1A 2HDOA 4EA6A 1LBTA 3RHSA 1Q14A 3T8AA 4TVKA 3P2EA 5J4VA 3LX8A 3AB3A 4ENQA 1HE5A 2X23A 2VSUE 1Q1NA 2ZBRA 5GY7A 3B7PA 3CRNA 2CEKA 1U4OA 2JFFA 1EESA 2DKNA 4MITA 3KFVA 3H1TA 3CZMA 1T43A 1U4SA 3B1JA 3ZU5A 3P0RA 3ZDDA 2B8TA 4B79A 1EM8B 2IHNA 2FRXA 5I4KA 2CHUA 5C31A 1JLSA 3RF6A 3P5MA 5I7WA 3G9TA 3C3AA 4JMPA 4UD2A 3MS7A 2ZR0A 3NHKA 3PUIA 5IX8A 2HXSA 2D59A 1MTZA 1XU9A 2GN9A 3VR2D 3N59A 2H2GA 3AB8A 1PK9A 4H3KB 3CGWA 3AOEC 2WD7A 3AIIA 3SBOA 3EXHC 3W3AD 3PB3A 2J5IB 3B1KA 2F3TA 2O3UA 1HYBA 1YR1A 2GLUA 1WQ4A 2WYVA 1MX9A 4XOUA 1I0LA 1VSBA 2WUWE 5YASA 3OM8A 2ZJYA 2VCEA 3LHKA 1VSVA 3F3MA 4RTQA 2HHJA 2NYAA 1Y0BA 3BCRA 1G5RA 4EKYA 5K8CA 2HR1A 3S27A 2JI7A 3NBFA 3VAZA 1WRBA 2C3YA 4QUGA 4W7SA 1FXUA 1O54A 4RPKA 4FP9A 3RWBA 2D4HA 1QBGA 3LV8A 5B3KA 4IHJB 1W7AA 3TDNA 3QXJA 3RBZA 5CLHA 2DWPA 3LRXA 2DFPA 1J07A 1L4UA 1HQYE 2YJNA 4RMNA 2REQA 4DABA 1RSZA 3QWBA 3VPDA 1C4OA 1FFYA 3EAGA 3N5KA 4DCTA 4UPEA 3DEHA 5JY1A 1QHFA 3GVXA 3VPHA 2C4KA 4MWGA 1JHQA 3QNWA 1X9IA 1M0WA 4G56A 3E9YA 2E48A 4HDAA 5AVJA 4JI7B 1ZD1A 2BLLA 5TARA 2J9FA 4BAGA 4B71A 1LLDA 4YAFA 3EGEA 4DR3B 4XWYA 1T0BA 1LXCA 1UC9A 1JG3A 3K16A 1NXQA 2C9DA 1L1RA 1QQBA 3LFUA 2JAXA 3AR6A 4QASA 3LSTA 1B15A 1J0CA 3LPCA 1YS4A 4FYPA 1XMPA 3HKCA 3UAZA 3W7VA 1OX4B 1UOPA 4R7GA 3KHUA 2D1RA 4O1IA 2GNPA 1LJUA 2VREA 1CR2A 5E6RA 4Z54A 3IAVA 4DSAA 1TCAA 3IPXA 4B45A 2E5FA 4WERA 1Y33E 4AK9A 4KO2S 3ZZUA 1CCWA 3AEQB 5LQRA 1VI5A 1PSWA 1QTNA 5F12A 2CBXA 1L5VA 3PPIA 2J0EA 1P6UA 1W93A 1AS3A 3BGWA 4XIGS 3UZUA 1WEKA 1AGRA 4N5DA 4YYZA 1ONBA 1SPBS 2RHBA 1XRQA 4BVGA 5A7FA 1S2LA 2J7PD 3KOXA 4ASIA 3OTOB 2F9FA 2HDHA 4J6FA 1SU7A 3KOUA 3F3KA 2IEIA 2I03A 4FNAA 1JMYA 1DLIA 2B6NA 3FPEA 3U39A 2DR3A 5MHTA 2VAWA 1NZYB 4L4SA 2RAUA 4NESA 5KDOA 3TLCA 4OQQA 5L3ZA 1GP2A 2WM9B 2C94A 4H59A 2R2GA 3CLTD 4S1VA 3BT7A 2AJCA 2B25A 1Z74A 3QELA 5ELMA 1E2LA 2PUJA 4ROSA 3R9XB 1E3TA 1Z18A 3U9RB 3RAEC 2EFCB 3IMEA 3QOYA 1QMGA 4MAMA 5DI3A 3BAZA 1KO7A 4J4TA 5KNCD 4QIJA 5ICFA 4MI1A 3OAAD 2Y1CA 3IHTA 3NJ4A 1NLUA 4MARA 2XEXA 4QXMA 3A6LA 5JCOC 4K88A 4PPNA 3VC2A 1A8UA 2H1VA 3PNLA 2ATIA 4XDHA 3DT9A 2ORYA 3E82A 5LCXA 1OKKD 1ISMA 3S1AB 2YV2A 4JY7A 3CEMA 5EYPA 4AJKA 5AW9A 2NTEA 1YS1X 3RTAA 3E3AA 4UFOA 5ENVA 3A9RA 3ASYA 3AHFA 2FK8A 5BR4A 3V2GA 3CPEA 4GWGA 1TW3A 3CKYA 3I01A 4BO3A 2Q6VA 2BM8A 3FHTA 4B3RB 2YZGA 1MX3A 2VR1A 3F7MA 3MHTA 4M76B 1NC3A 2R85A 5JS7A 5SZIA 1G5HA 2VDQB 3U3MA 4RC9A 1BKSB 4R9NA 4JQCA 5KOHA 3I3OA 2QTFA 5EJAA 2Q45A 4BFUA 3BGDA 4JJEA 4BO8A 1M6YA 3NEPX 2AR0A 1C3XA 2GZ3A 2XE4A 4JC4A 1YJ5A 4AY2A 4M60A 2AUMA 3GW8A 5I7RA 3ELYA 1MB2A 4NSNA 4KPUA 3SF8A 5KCZA 1LNSA 1Z36A 2ATCA 2R751 1YR6A 1PLJA 3DEYX 4C43A 1Q74A 5HZMA 3G2JA 3SQWA 2PPYA 4YT8A 1I2MA 4Y0AA 1UDBA 1Q7BA 2IUYA 3NP7A 2HCTA 1P3DA 4UPDA 2H4YA 2VBFA 4G86A 4Q02A 1NUSA 4K26A 4MV0A 4R9SA 1ZRHA 3QU4A 4MKHA 4YJHB 3UGKA 4TYYA 2Q9CA 3N2KA 4J16A 3WLMA 3JU3A 3V1MA 3W5IA 1KDPA 3QLUC 4JLAA 3O94A 1EKXA 3D5EA 1CUSA 1QV9A 4N6OA 4JNKA 4DMFA 1Q0TA 1RLTA 2X76A 1K98A 3T7TA 3E9RA 4EO7A 2UYQA 1H9BA 3R23A 5I47A 1XP8A 3K6SB 2J5BA 4IW3B 1AQLA 4OLFA 3IT1A 4BFLA 4JYZA 1AVTA 1DT5A 1R00A 3ZYCA 2QAGA 4D96A 5ENZA 2HBYA 1DCIA 5CFRA 2HSEA 4JSBA 1QQ6A 1N5OX 2H1WA 2UUPA 3KEMA 3HNOA 2E2WA 4O2BF 1HNXB 1FL9A 1NSTA 2Y1KA 2WNSA 2QX7A 3FYSA 4EMSA 1ISPA 1MP0A 3P9XA 1WNFA 4BLQA 1HLPA 4JLWA 4R1MA 4AQ7A 4NPAA 5IH3A 2HHLA 3T1TA 3THWA 2BHRA 4KLAA 4CR7A 1GRQA 2I4RA 3A4TA 3FKQA 3KOWA 3RGWS 2QL5A 4GBMA 3WLOA 4DA7A 5BQ5A 4TSRA 5T4FA 2GZHA 3ANYB 3VHXA 4U6SA 5AVWA 2YJ3A 1OI2A 1I3KA 4WBSA 4MVJF 1N9ZA 5EY5B 1PJ2A 3A32A 3ZE6A 1OD6A 2G0AA 4FR0A 3QQPA 1GADO 2ZB3A 3LGSA 4QTZA 5AHXA 5KNLA 2IHKA 1MZPA 3M9XA 1GILA 4JLNA 1JSZA 4EBBA 1M0EA 4NBWA 3KT6A 3FJOA 3SKYA 2NSLA 3E1SA 3IIIA 1VMEA 4I4TF 3S40A 4PBSA 3TBKA 4X91A 3NWEA 4PU0A 1PNQA 2IXAA 1GQFA 4PM4A 3T4EA 4BKPA 3BULA 4ZVSA 3R9QA 4A0HA 1U0BB 1WU8A 1O58A 3H99A 1N0WA 1AXEA 2VPYA 4FOTA 4QYWA 3TIXB 1TQHA 2XW6A 4YCSA 5AUOB 1M1NA 1TM7E 3BAFA 3RSLA 3TBFA 2QLJA 4TM8A 3IQZA 3KPUA 2QSUA 3LL7A 3B8EA 4H6WA 3V7WA 1Z73A 2A88A 4TWRA 3ZI7A 5BN4A 1XTQA 4MDHA 4Q21A 3D5TA 2PRJA 4U6NA 3ZDBA 2WJ6A 1VKHA 1NXTA 1UEJA 1Y81A 3E3MA 3F5DA 4JCOA 2LZ0A 3NBZC 1PGOA 4PTYA 3T5DA 3IAXA 2RGUA 2VP5A 4ZI7F 5LXTB 4E11A 1RADA 4L8VA 3DEAA 3M1IA 2Z8XA 5BN5B 4MKGA 1XEXB 2PLFA 2QX4A 1SBQA 5DT2A 6AT1A 2XKBA 1YA6A 5C46F 4EKDA 2ZB7A 3CB2A 4CFSA 3F2VA 1NXPA 3NWJA 3O3OB 1GUDA 4J7UA 2FR0A 2ORWA 1L8AA 1V8DA 1SQGA 4XM1A 5AESA 2IS1A 4G0MA 3FLAA 4EMBA 1CS4C 2QQFA 4TLBA 3TX6A 1F0YA 2G80A 3IXQA 2K4MA 1JG1A 3BHNA 5KNDA 3S99A 2IVFA 1K3TA 2C2GA 1TM4E 2VO1A 2ZE7A 3B3GA 3GJZA 1H6CA 3LY5A 3MT9A 3QX7A 4GU5A 4M98A 1X38A 4YH1A 1Z8DA 3SYMA 2QL7A 2BGMA 3TZQA 4L8YA 2VJAA 4V0MA 1W5EA 3AMVA 2JB9A 4AJ2A 1I3OA 4EB3A 2VCYA 4L6WA 3HNRA 1G17A 1MO5A 1DXQA 3PWSA 2XDAA 5AVSA 5CVJA 4MP6A 1B4DA 1T0JB 4RW0A 4WZZA 4MVJI 5CIQA 1SKBA 1D2HA 4N5NA 3KR9A 2HMWA 4QO7A 1NQWA 3KQPA 1N7IA 1ZLYA 1AU9A 4ZCMA 4TWBA 2V9ZA 4DJ5X 3ROQA 2WT4A 3DE0X 1JIXA 3W6PA 4MYRA 4QQFA 5AM0A 3EZYA 3QUSA 3QFFA 3PTZA 3EIFA 4C01A 4X65B 3FSGD 3KZOA 1R0BA 2O2EA 3MEQA 2PX3A 3ECCA 1X77A 3EFOA 4MKZA 3DKVA 4R2HA 5H83A 4F9FA 3HCBA 1UBEA 5E4TA 1GLNA 1E8DA 4HDOB 4BHTA 5HVNA 3FMOB 1KOFA 2QD2A 4QYIA 3NT5A 4GM4A 4Z6KA 5DU4A 5A4FS 3EIOA 3A6JA 2YWHA 4B85A 1ZNQO 3VVMA 3ZNOA 4E09A 2MSNA 3PHCA 3RAFC 3L8YA 2WWYA 3K05A 1X1QA 2H17A 1FRVA 2PLNA 4K9QA 4DRXA 1TTPB 4RD3A 1JDBC 1RWXA 1OJ7A 2VAMA 4IJVA 3CURA 3C5HA 1CEXA 1T1JA 1LDYA 4XQ0A 2XQVA 1J0AA 2HCBA 3K72B 3E9NA 1YJQA 4KOEC 2E21A 2XXAA 4IS2A 4RZ2A 3H3XA 1CR6A 1NC1A 2GHRA 1ZGZA 3O8QA 5GV7A 3L0BA 3PXDA 2PZEA 4LF7B 3G2IA 1ZEMA 1TB4A 3FTQA 3ZR4B 1MZVA 4NCAA 1WMDA 4BQQA 4CWAA 2XIQA 1E3JA 4X71A 2SHKA 3X1YA 4G1CA 3EIWA 5LIRA 2CFRA 5H81A 2OAGA 1T8SA 3HU5A 1G3RA 5J2TF 1X7ZA 1VBMA 3KPYA 3SZ3A 2RFLA 4OXRA 2Q28A 2ZRKA 1MR3F 4DC9A 1CP2A 2R8ZA 1FTNA 4QTUB 1REQB 3D4IA 4NI5A 1RQLA 2HO4A 3OZWA 4CF5A 1Z3IX 2EYQA 4K0RA 1P19A 1ZOLA 4C2TA 3R5HA 2ZRDA 1E1LA 1XDZA 4BVKA 1V47A 4L07A 5EUBA 5K6AC 2BKUA 3C39A 4V2UA 3QXCA