3L3SA

Crystal structure of an enoyl-coa hydrotase/isomerase family protein from silicibacter pomeroyi
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
237
structure length
231
Chain Sequence
LLGEVLSEGVLTLTLGRAPAHPLSRAMIAALHDALRRAMGDDHVHVLVIHGPGRIFCAGHDLKEIGRDEGRAFVTDLFEACSALMLDLAHCPKPTIALVEGIATAAGLQLMAACDLAYASPAARFCLPGVQNGGFTTPAVAVSRVIGRRAVTEMALTGATYDADWALAAGLINRILPEAALATHVADLAGALAARNQAPLRRGLETLNRHLELPLEQAYALATPVMVEHFM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an enoyl-CoA hydrotase/isomerase family protein from Silicibacter pomeroyi
rcsb
source organism Ruegeria pomeroyi
molecule tags Isomerase
molecule keywords Enoyl-CoA hydratase/isomerase family protein
total genus 61
structure length 231
sequence length 237
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2009-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3l3sA01
3M6NA 3STAA 1XX4A 1UIYA 2GTRA 3Q1TA 3T8AA 4WCZA 2ZQQA 2VSSF 3GLMA 1W2XA 2ZL2A 4JFCA 3ZWBA 3BPPA 1O8UA 3MT6A 5E0SH 4U0HA 2PBPA 4FZWC 2VSSE 4HNKA 4IZCA 3PEAA 5E0SA 4EMMA 4I52A 3U9TB 1UYSA 2VSUE 3DJAA 5JBWA 3H81A 4KWBA 2W3PA 4FNDA 3SWXA 3TT7A 3HRXA 1PJHA 4MOUA 1NZYA 2VSUF 3NJBA 3TLFA 4OG1A 3QREA 4ZDDA 5JBXA 4KD6A 4L6WA 1PIXA 5FIFA 2QQ3A 4I4ZA 2F9IB 1WDMA 3JU1A 4OLQA 4YLHA 3H02A 4GHNA 1UYTA 4OMRA 3G64A 3QK8A 4MXIA 3R6HA 2PG8A 3R9QA 1X0UA 4K3WA 2HW5A 4KNPA 1XNYA 4U19A 4JWVA 1JXZA 3SLLA 5DU6A 3TZ3A 3K8XA 5G1SA 3QWDA 2X24A 4GM2A 3TV5A 3I47A 3DORA 5DU8A 4RYFH 3T8BA 1WDLA 3H0QA 1YG8A 3RRVA 4JSBA 3V5IA 3GKBA 3RSIA 5KJPA 1N6FA 2DUBA 3KTJA 2F9YA 3Q7HA 3PE8A 4JYJA 3IB9A 3OMEA 4QIIA 2F9IA 2PPYA 3TT6A 1VRGA 3NJDA 2X58A 4U0GA 2UZFA 5DUFA 4ELWA 4ZDCA 2VSUA 1N6EA 4FNBA 4KPKA 1OD2A 2ZQRA 3OT6A 3QYRA 4RYFA 5CTBA 3Q0JA 1XNWA 3FDUA 3P85A 4NEKA 4Q0GA 3R9TA 1NZYB 5INGA 3H0JA 2ZL0A 3ISAA 2Q34A 1Q51A 5DTWA 4WYOB 2A7SA 3RSTA 2EJ5A 1Y7OA 2J5GD 1RJNA 3BEZA 5DUCA 2BZRA 5INFA 2VSSA 1FCFA 3V5EA 5DKPA 4ELXA 1J7XA 1TG6A 5C9GA 3ZW8A 3P5MA 4FJWD 3KTGA 2J5IB 1K39A 5DL1A 4LK5A 3TVWA 3P2LA 3QXIA 4HC8A 4U1AA 2A7KA 5KDRA 4FZWA 1DCIA 4Q1IA 2C8TA 4MI2A 3LKEA 2WTBA 4Z0MA 4B3IA 4G2RA 3IBBA 4K2NA 1OD4A 2Q35A 5DZKH 1HNUA 1FC7A 4ZDBA 2VSUC 2VX2A 5MGBA 1ON9A 2CBYA 1N6DA 3FF6A 4U0GH 4NNQA 1EF8A 3WG5A 5FUSA 2J5SA 1YG6A 4F47A 1MJ3A 5INIA 3GF3A 1XNVA 4JOTA 5E0NX 3MOYA 3U9RB 4QIJA 5CTCA 3HE2A 4JCQA 4DI1A 1XO6A 4ELSA 1WZ8A 1HZDA 3ZW9A 4K29A 3U9SB 4L8KA 2FBMA 5C90A 2F6IA 3ZWAA 3R9SA 1TYFA 1RJMA 3M6MA 2NP9A 2J5GA 3QXZA 3ST9A 2D3TA 3TVUA 5DU4A 4RCNA 5DZKA 3H0UA 4IZBA 4JYLA 3N6RB 4WZ8B 3MYBA 3KTIA 4B3HA 3HP0A 3HINA 3PZKA 3VIVA 2Q2XA 2ZL4A 2J5II 3ZWCA 3KTKA 3TDCA 1UYVA 4EMLA 3T89A 3QKAA 1DUBA 3H0SA 2FW2A 3GF7A 3OC7A 4FB8A 1K32A 1SZOA 3LAOA 3KTHA 3IAVA 4B3JA 1EF9A 2A81A 4JCRA 3GMAA 4IZDA 2ZL3A 4ASIA 2F9YB 3KQFA 3R0OA 2J5IA 2FZSA 3T88A 5IKLB 5G1QA 1ON3A 4JJTA 4QFEA 4JCSA 5KDRB 3MFMA 4ZDEA 3TRRA 3T3WA 4ZU2A 4EMPA 4U18A 1UYRA 3BF0A 3HLN1 1FC6A 1HNOA 2CE3A 1WDKA 4FN8A 4JCTA 4JVTA 1Q52A 4ZDFA 5G1RA 4FN7A 2IEXA 5DTPA 1EY3A 1SG4A 2VREA 2DEOA 3QMJA 3PGQA 4I42A 2F6QA 3Q0GA 3L3SA 3K50A 1FC9A
chains in the Genus database with same CATH superfamily
3M6NA 2YJGA 3STAA 1XX4A 1UIYA 2GTRA 3Q1TA 3T8AA 4WCZA 2ZQQA 2VSSF 3GLMA 1W2XA 2ZL2A 4JFCA 3ZWBA 3BPPA 1O8UA 3MT6A 5E0SH 4U0HA 2PBPA 4FZWC 2VSSE 4HNKA 4IZCA 3PEAA 5E0SA 4EMMA 4I52A 3U9TB 1UYSA 2VSUE 3DJAA 5JBWA 3H81A 4KWBA 2W3PA 4FNDA 3SWXA 3TT7A 3HRXA 1PJHA 4MOUA 1NZYA 2VSUF 3BPTA 3NJBA 3TLFA 4OG1A 3QREA 4ZDDA 5JBXA 4KD6A 4L6WA 1PIXA 5FIFA 2QQ3A 4I4ZA 2F9IB 1WDMA 3JU1A 4OLQA 4YLHA 3H02A 4GHNA 1UYTA 4OMRA 3G64A 3QK8A 4MXIA 3R6HA 2PG8A 3R9QA 1X0UA 4K3WA 2HW5A 4KNPA 1XNYA 4U19A 4JWVA 1JXZA 3SLLA 5DU6A 3TZ3A 3K8XA 5G1SA 3QWDA 2X24A 4GM2A 3TV5A 3I47A 3DORA 5DU8A 4RYFH 3T8BA 1WDLA 3H0QA 1YG8A 3RRVA 4JSBA 3V5IA 3GKBA 3RSIA 5KJPA 1N6FA 2DUBA 3KTJA 2F9YA 3Q7HA 3PE8A 4JYJA 3IB9A 3OMEA 4QIIA 2F9IA 2PPYA 3TT6A 1VRGA 3NJDA 2X58A 4U0GA 2UZFA 5DUFA 4ELWA 4J2UA 4ZDCA 2VSUA 1N6EA 4FNBA 4KPKA 1OD2A 2ZQRA 3OT6A 3QYRA 4RYFA 5CTBA 3Q0JA 1XNWA 3FDUA 3P85A 4NEKA 4Q0GA 3R9TA 1NZYB 5INGA 3H0JA 2ZL0A 3ISAA 2Q34A 1Q51A 5DTWA 4WYOB 2A7SA 3RSTA 2EJ5A 1Y7OA 2J5GD 1RJNA 3BEZA 5DUCA 2BZRA 5INFA 2VSSA 1FCFA 3V5EA 5DKPA 4ELXA 1J7XA 1TG6A 5C9GA 3ZW8A 3P5MA 4FJWD 3KTGA 2J5IB 1K39A 5DL1A 4LK5A 3TVWA 3P2LA 3QXIA 4HC8A 4U1AA 2A7KA 5KDRA 4FZWA 1DCIA 4Q1IA 2C8TA 4MI2A 3LKEA 2WTBA 4Z0MA 4B3IA 4G2RA 3IBBA 4K2NA 1OD4A 2Q35A 5DZKH 1HNUA 1FC7A 4ZDBA 2VSUC 2VX2A 5MGBA 1ON9A 2CBYA 4HDTA 1N6DA 3FF6A 4U0GH 4NNQA 1EF8A 3WG5A 5FUSA 2J5SA 1YG6A 4F47A 1MJ3A 5INIA 3GF3A 1XNVA 4JOTA 5E0NX 3MOYA 3U9RB 4QIJA 5CTCA 3HE2A 4JCQA 4DI1A 1XO6A 4ELSA 1WZ8A 1HZDA 3ZW9A 4K29A 3U9SB 4L8KA 2FBMA 5C90A 2F6IA 3ZWAA 3R9SA 1TYFA 1RJMA 3M6MA 2NP9A 2J5GA 3QXZA 3ST9A 2D3TA 3TVUA 5DU4A 4RCNA 5DZKA 3H0UA 4IZBA 4NARA 4JYLA 3N6RB 4WZ8B 3MYBA 3KTIA 4B3HA 5HUQA 3HP0A 3HINA 3PZKA 3VIVA 2Q2XA 2ZL4A 2J5II 3ZWCA 3KTKA 3TDCA 1UYVA 4EMLA 3T89A 3QKAA 1DUBA 3H0SA 2FW2A 3GF7A 3OC7A 4FB8A 1K32A 1SZOA 3LAOA 3KTHA 3IAVA 4B3JA 1EF9A 2A81A 4JCRA 3GMAA 4IZDA 2ZL3A 4ASIA 2F9YB 3KQFA 3R0OA 2J5IA 2FZSA 3T88A 5IKLB 5G1QA 1ON3A 4JJTA 4QFEA 4JCSA 5KDRB 3MFMA 4ZDEA 3TRRA 3T3WA 4ZU2A 4EMPA 4U18A 1UYRA 3BF0A 3HLN1 1FC6A 1HNOA 2CE3A 1WDKA 4FN8A 4JCTA 4JVTA 1Q52A 4ZDFA 5G1RA 4FN7A 2IEXA 5DTPA 1EY3A 1SG4A 2VREA 2DEOA 3QMJA 3PGQA 4I42A 2F6QA 3Q0GA 3L3SA 3K50A 1FC9A
chains in the Genus database with same CATH topology
3M6NA 2YJGA 3STAA 1XX4A 1UIYA 2GTRA 3Q1TA 3T8AA 4WCZA 2ZQQA 2VSSF 3GLMA 1W2XA 2ZL2A 4JFCA 3ZWBA 3BPPA 1O8UA 3MT6A 5E0SH 4U0HA 2PBPA 4FZWC 2VSSE 4HNKA 4IZCA 3PEAA 5E0SA 4EMMA 4I52A 3U9TB 1UYSA 2VSUE 3DJAA 5JBWA 3H81A 4KWBA 2W3PA 4FNDA 3SWXA 3TT7A 3HRXA 1PJHA 4MOUA 1NZYA 2VSUF 3BPTA 3NJBA 3TLFA 4OG1A 3QREA 4ZDDA 5JBXA 4KD6A 4L6WA 1PIXA 5FIFA 2QQ3A 4I4ZA 2F9IB 1WDMA 3JU1A 4OLQA 4YLHA 3H02A 4GHNA 1UYTA 4OMRA 3G64A 3QK8A 4MXIA 3R6HA 2PG8A 3R9QA 1X0UA 4K3WA 2HW5A 4KNPA 1XNYA 4U19A 4JWVA 1JXZA 3SLLA 5DU6A 3TZ3A 3K8XA 5G1SA 3QWDA 2X24A 4GM2A 3TV5A 3I47A 3DORA 5DU8A 4RYFH 3T8BA 1WDLA 3H0QA 1YG8A 3RRVA 4JSBA 3V5IA 3GKBA 3RSIA 5KJPA 1N6FA 2DUBA 3KTJA 2F9YA 3Q7HA 3PE8A 4JYJA 3IB9A 3OMEA 4QIIA 2F9IA 2PPYA 3TT6A 1VRGA 3NJDA 2X58A 4U0GA 2UZFA 5DUFA 4ELWA 4J2UA 4ZDCA 2VSUA 1N6EA 4FNBA 4KPKA 1OD2A 2ZQRA 3OT6A 3QYRA 4RYFA 5CTBA 3Q0JA 1XNWA 3FDUA 3P85A 4NEKA 4Q0GA 3R9TA 1NZYB 5INGA 3H0JA 2ZL0A 3ISAA 2Q34A 1Q51A 5DTWA 4WYOB 2A7SA 3RSTA 2EJ5A 1Y7OA 2J5GD 1RJNA 3BEZA 5DUCA 2BZRA 5INFA 2VSSA 1FCFA 3V5EA 5DKPA 4ELXA 1J7XA 1TG6A 5C9GA 3ZW8A 3P5MA 4FJWD 3KTGA 2J5IB 1K39A 5DL1A 4LK5A 3TVWA 3P2LA 3QXIA 4HC8A 4U1AA 2A7KA 5KDRA 4FZWA 1DCIA 4Q1IA 2C8TA 4MI2A 3LKEA 2WTBA 4Z0MA 4B3IA 4G2RA 3IBBA 4K2NA 1OD4A 2Q35A 5DZKH 1HNUA 1FC7A 4ZDBA 2VSUC 2VX2A 5MGBA 1ON9A 2CBYA 4HDTA 1N6DA 3FF6A 4U0GH 4NNQA 1EF8A 3WG5A 5FUSA 2J5SA 1YG6A 4F47A 1MJ3A 5INIA 3GF3A 1XNVA 4JOTA 5E0NX 3MOYA 3U9RB 4QIJA 5CTCA 3HE2A 4JCQA 4DI1A 1XO6A 4ELSA 1WZ8A 1HZDA 3ZW9A 4K29A 3U9SB 4L8KA 2FBMA 5C90A 2F6IA 3ZWAA 3R9SA 1TYFA 1RJMA 3M6MA 2NP9A 2J5GA 3QXZA 3ST9A 2D3TA 3TVUA 5DU4A 4RCNA 5DZKA 3H0UA 4IZBA 4NARA 4JYLA 3N6RB 4WZ8B 3MYBA 3KTIA 4B3HA 5HUQA 3HP0A 3HINA 3PZKA 3VIVA 2Q2XA 2ZL4A 2J5II 3ZWCA 3KTKA 3TDCA 1UYVA 4EMLA 3T89A 3QKAA 1DUBA 3H0SA 2FW2A 3GF7A 3OC7A 4FB8A 1K32A 1SZOA 3LAOA 3KTHA 3IAVA 4B3JA 1EF9A 2A81A 4JCRA 3GMAA 4IZDA 2ZL3A 4ASIA 2F9YB 3KQFA 3R0OA 2J5IA 2FZSA 3T88A 5IKLB 5G1QA 1ON3A 4JJTA 4QFEA 4JCSA 5KDRB 3MFMA 4ZDEA 3TRRA 3T3WA 4ZU2A 4EMPA 4U18A 1UYRA 3BF0A 3HLN1 1FC6A 1HNOA 2CE3A 1WDKA 4FN8A 4JCTA 4JVTA 1Q52A 4ZDFA 5G1RA 4FN7A 2IEXA 5DTPA 1EY3A 1SG4A 2VREA 2DEOA 3QMJA 3PGQA 4I42A 2F6QA 3Q0GA 3L3SA 3K50A 1FC9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M6N A;  3STA A;  1XX4 A;  1UIY A;  2GTR A;  3Q1T A;  3T8A A;  4WCZ A;  2ZQQ A;  2VSS F;  3GLM A;  1W2X A;  2ZL2 A;  4JFC A;  3ZWB A;  3BPP A;  1O8U A;  3MT6 A;  5E0S H;  4U0H A;  2PBP A;  4FZW C;  2VSS E;  4HNK A;  4IZC A;  3PEA A;  5E0S A;  4EMM A;  4I52 A;  3U9T B;  1UYS A;  2VSU E;  3DJA A;  5JBW A;  3H81 A;  4KWB A;  2W3P A;  4FND A;  3SWX A;  3TT7 A;  3HRX A;  1PJH A;  4MOU A;  1NZY A;  2VSU F;  3NJB A;  3TLF A;  4OG1 A;  3QRE A;  4ZDD A;  5JBX A;  4KD6 A;  4L6W A;  1PIX A;  5FIF A;  2QQ3 A;  4I4Z A;  2F9I B;  1WDM A;  3JU1 A;  4OLQ A;  4YLH A;  3H02 A;  4GHN A;  1UYT A;  4OMR A;  3G64 A;  3QK8 A;  4MXI A;  3R6H A;  2PG8 A;  3R9Q A;  1X0U A;  4K3W A;  2HW5 A;  4KNP A;  1XNY A;  4U19 A;  4JWV A;  1JXZ A;  3SLL A;  5DU6 A;  3TZ3 A;  3K8X A;  5G1S A;  3QWD A;  2X24 A;  4GM2 A;  3TV5 A;  3I47 A;  3DOR A;  5DU8 A;  4RYF H;  3T8B A;  1WDL A;  3H0Q A;  1YG8 A;  3RRV A;  4JSB A;  3V5I A;  3GKB A;  3RSI A;  5KJP A;  1N6F A;  2DUB A;  3KTJ A;  2F9Y A;  3Q7H A;  3PE8 A;  4JYJ A;  3IB9 A;  3OME A;  4QII A;  2F9I A;  2PPY A;  3TT6 A;  1VRG A;  3NJD A;  2X58 A;  4U0G A;  2UZF A;  5DUF A;  4ELW A;  4ZDC A;  2VSU A;  1N6E A;  4FNB A;  4KPK A;  1OD2 A;  2ZQR A;  3OT6 A;  3QYR A;  4RYF A;  5CTB A;  3Q0J A;  1XNW A;  3FDU A;  3P85 A;  4NEK A;  4Q0G A;  3R9T A;  1NZY B;  5ING A;  3H0J A;  2ZL0 A;  3ISA A;  2Q34 A;  1Q51 A;  5DTW A;  4WYO B;  2A7S A;  3RST A;  2EJ5 A;  1Y7O A;  2J5G D;  1RJN A;  3BEZ A;  5DUC A;  2BZR A;  5INF A;  2VSS A;  1FCF A;  3V5E A;  5DKP A;  4ELX A;  1J7X A;  1TG6 A;  5C9G A;  3ZW8 A;  3P5M A;  4FJW D;  3KTG A;  2J5I B;  1K39 A;  5DL1 A;  4LK5 A;  3TVW A;  3P2L A;  3QXI A;  4HC8 A;  4U1A A;  2A7K A;  5KDR A;  4FZW A;  1DCI A;  4Q1I A;  2C8T A;  4MI2 A;  3LKE A;  2WTB A;  4Z0M A;  4B3I A;  4G2R A;  3IBB A;  4K2N A;  1OD4 A;  2Q35 A;  5DZK H;  1HNU A;  1FC7 A;  4ZDB A;  2VSU C;  2VX2 A;  5MGB A;  1ON9 A;  2CBY A;  1N6D A;  3FF6 A;  4U0G H;  4NNQ A;  1EF8 A;  3WG5 A;  5FUS A;  2J5S A;  1YG6 A;  4F47 A;  1MJ3 A;  5INI A;  3GF3 A;  1XNV A;  4JOT A;  5E0N X;  3MOY A;  3U9R B;  4QIJ A;  5CTC A;  3HE2 A;  4JCQ A;  4DI1 A;  1XO6 A;  4ELS A;  1WZ8 A;  1HZD A;  3ZW9 A;  4K29 A;  3U9S B;  4L8K A;  2FBM A;  5C90 A;  2F6I A;  3ZWA A;  3R9S A;  1TYF A;  1RJM A;  3M6M A;  2NP9 A;  2J5G A;  3QXZ A;  3ST9 A;  2D3T A;  3TVU A;  5DU4 A;  4RCN A;  5DZK A;  3H0U A;  4IZB A;  4JYL A;  3N6R B;  4WZ8 B;  3MYB A;  3KTI A;  4B3H A;  3HP0 A;  3HIN A;  3PZK A;  3VIV A;  2Q2X A;  2ZL4 A;  2J5I I;  3ZWC A;  3KTK A;  3TDC A;  1UYV A;  4EML A;  3T89 A;  3QKA A;  1DUB A;  3H0S A;  2FW2 A;  3GF7 A;  3OC7 A;  4FB8 A;  1K32 A;  1SZO A;  3LAO A;  3KTH A;  3IAV A;  4B3J A;  1EF9 A;  2A81 A;  4JCR A;  3GMA A;  4IZD A;  2ZL3 A;  4ASI A;  2F9Y B;  3KQF A;  3R0O A;  2J5I A;  2FZS A;  3T88 A;  5IKL B;  5G1Q A;  1ON3 A;  4JJT A;  4QFE A;  4JCS A;  5KDR B;  3MFM A;  4ZDE A;  3TRR A;  3T3W A;  4ZU2 A;  4EMP A;  4U18 A;  1UYR A;  3BF0 A;  3HLN 1;  1FC6 A;  1HNO A;  2CE3 A;  1WDK A;  4FN8 A;  4JCT A;  4JVT A;  1Q52 A;  4ZDF A;  5G1R A;  4FN7 A;  2IEX A;  5DTP A;  1EY3 A;  1SG4 A;  2VRE A;  2DEO A;  3QMJ A;  3PGQ A;  4I42 A;  2F6Q A;  3Q0G A;  3L3S A;  3K50 A;  1FC9 A; 
#chains in the Genus database with same CATH topology
 3M6N A;  2YJG A;  3STA A;  1XX4 A;  1UIY A;  2GTR A;  3Q1T A;  3T8A A;  4WCZ A;  2ZQQ A;  2VSS F;  3GLM A;  1W2X A;  2ZL2 A;  4JFC A;  3ZWB A;  3BPP A;  1O8U A;  3MT6 A;  5E0S H;  4U0H A;  2PBP A;  4FZW C;  2VSS E;  4HNK A;  4IZC A;  3PEA A;  5E0S A;  4EMM A;  4I52 A;  3U9T B;  1UYS A;  2VSU E;  3DJA A;  5JBW A;  3H81 A;  4KWB A;  2W3P A;  4FND A;  3SWX A;  3TT7 A;  3HRX A;  1PJH A;  4MOU A;  1NZY A;  2VSU F;  3BPT A;  3NJB A;  3TLF A;  4OG1 A;  3QRE A;  4ZDD A;  5JBX A;  4KD6 A;  4L6W A;  1PIX A;  5FIF A;  2QQ3 A;  4I4Z A;  2F9I B;  1WDM A;  3JU1 A;  4OLQ A;  4YLH A;  3H02 A;  4GHN A;  1UYT A;  4OMR A;  3G64 A;  3QK8 A;  4MXI A;  3R6H A;  2PG8 A;  3R9Q A;  1X0U A;  4K3W A;  2HW5 A;  4KNP A;  1XNY A;  4U19 A;  4JWV A;  1JXZ A;  3SLL A;  5DU6 A;  3TZ3 A;  3K8X A;  5G1S A;  3QWD A;  2X24 A;  4GM2 A;  3TV5 A;  3I47 A;  3DOR A;  5DU8 A;  4RYF H;  3T8B A;  1WDL A;  3H0Q A;  1YG8 A;  3RRV A;  4JSB A;  3V5I A;  3GKB A;  3RSI A;  5KJP A;  1N6F A;  2DUB A;  3KTJ A;  2F9Y A;  3Q7H A;  3PE8 A;  4JYJ A;  3IB9 A;  3OME A;  4QII A;  2F9I A;  2PPY A;  3TT6 A;  1VRG A;  3NJD A;  2X58 A;  4U0G A;  2UZF A;  5DUF A;  4ELW A;  4J2U A;  4ZDC A;  2VSU A;  1N6E A;  4FNB A;  4KPK A;  1OD2 A;  2ZQR A;  3OT6 A;  3QYR A;  4RYF A;  5CTB A;  3Q0J A;  1XNW A;  3FDU A;  3P85 A;  4NEK A;  4Q0G A;  3R9T A;  1NZY B;  5ING A;  3H0J A;  2ZL0 A;  3ISA A;  2Q34 A;  1Q51 A;  5DTW A;  4WYO B;  2A7S A;  3RST A;  2EJ5 A;  1Y7O A;  2J5G D;  1RJN A;  3BEZ A;  5DUC A;  2BZR A;  5INF A;  2VSS A;  1FCF A;  3V5E A;  5DKP A;  4ELX A;  1J7X A;  1TG6 A;  5C9G A;  3ZW8 A;  3P5M A;  4FJW D;  3KTG A;  2J5I B;  1K39 A;  5DL1 A;  4LK5 A;  3TVW A;  3P2L A;  3QXI A;  4HC8 A;  4U1A A;  2A7K A;  5KDR A;  4FZW A;  1DCI A;  4Q1I A;  2C8T A;  4MI2 A;  3LKE A;  2WTB A;  4Z0M A;  4B3I A;  4G2R A;  3IBB A;  4K2N A;  1OD4 A;  2Q35 A;  5DZK H;  1HNU A;  1FC7 A;  4ZDB A;  2VSU C;  2VX2 A;  5MGB A;  1ON9 A;  2CBY A;  4HDT A;  1N6D A;  3FF6 A;  4U0G H;  4NNQ A;  1EF8 A;  3WG5 A;  5FUS A;  2J5S A;  1YG6 A;  4F47 A;  1MJ3 A;  5INI A;  3GF3 A;  1XNV A;  4JOT A;  5E0N X;  3MOY A;  3U9R B;  4QIJ A;  5CTC A;  3HE2 A;  4JCQ A;  4DI1 A;  1XO6 A;  4ELS A;  1WZ8 A;  1HZD A;  3ZW9 A;  4K29 A;  3U9S B;  4L8K A;  2FBM A;  5C90 A;  2F6I A;  3ZWA A;  3R9S A;  1TYF A;  1RJM A;  3M6M A;  2NP9 A;  2J5G A;  3QXZ A;  3ST9 A;  2D3T A;  3TVU A;  5DU4 A;  4RCN A;  5DZK A;  3H0U A;  4IZB A;  4NAR A;  4JYL A;  3N6R B;  4WZ8 B;  3MYB A;  3KTI A;  4B3H A;  5HUQ A;  3HP0 A;  3HIN A;  3PZK A;  3VIV A;  2Q2X A;  2ZL4 A;  2J5I I;  3ZWC A;  3KTK A;  3TDC A;  1UYV A;  4EML A;  3T89 A;  3QKA A;  1DUB A;  3H0S A;  2FW2 A;  3GF7 A;  3OC7 A;  4FB8 A;  1K32 A;  1SZO A;  3LAO A;  3KTH A;  3IAV A;  4B3J A;  1EF9 A;  2A81 A;  4JCR A;  3GMA A;  4IZD A;  2ZL3 A;  4ASI A;  2F9Y B;  3KQF A;  3R0O A;  2J5I A;  2FZS A;  3T88 A;  5IKL B;  5G1Q A;  1ON3 A;  4JJT A;  4QFE A;  4JCS A;  5KDR B;  3MFM A;  4ZDE A;  3TRR A;  3T3W A;  4ZU2 A;  4EMP A;  4U18 A;  1UYR A;  3BF0 A;  3HLN 1;  1FC6 A;  1HNO A;  2CE3 A;  1WDK A;  4FN8 A;  4JCT A;  4JVT A;  1Q52 A;  4ZDF A;  5G1R A;  4FN7 A;  2IEX A;  5DTP A;  1EY3 A;  1SG4 A;  2VRE A;  2DEO A;  3QMJ A;  3PGQ A;  4I42 A;  2F6Q A;  3Q0G A;  3L3S A;  3K50 A;  1FC9 A; 
#chains in the Genus database with same CATH homology
 3M6N A;  2YJG A;  3STA A;  1XX4 A;  1UIY A;  2GTR A;  3Q1T A;  3T8A A;  4WCZ A;  2ZQQ A;  2VSS F;  3GLM A;  1W2X A;  2ZL2 A;  4JFC A;  3ZWB A;  3BPP A;  1O8U A;  3MT6 A;  5E0S H;  4U0H A;  2PBP A;  4FZW C;  2VSS E;  4HNK A;  4IZC A;  3PEA A;  5E0S A;  4EMM A;  4I52 A;  3U9T B;  1UYS A;  2VSU E;  3DJA A;  5JBW A;  3H81 A;  4KWB A;  2W3P A;  4FND A;  3SWX A;  3TT7 A;  3HRX A;  1PJH A;  4MOU A;  1NZY A;  2VSU F;  3BPT A;  3NJB A;  3TLF A;  4OG1 A;  3QRE A;  4ZDD A;  5JBX A;  4KD6 A;  4L6W A;  1PIX A;  5FIF A;  2QQ3 A;  4I4Z A;  2F9I B;  1WDM A;  3JU1 A;  4OLQ A;  4YLH A;  3H02 A;  4GHN A;  1UYT A;  4OMR A;  3G64 A;  3QK8 A;  4MXI A;  3R6H A;  2PG8 A;  3R9Q A;  1X0U A;  4K3W A;  2HW5 A;  4KNP A;  1XNY A;  4U19 A;  4JWV A;  1JXZ A;  3SLL A;  5DU6 A;  3TZ3 A;  3K8X A;  5G1S A;  3QWD A;  2X24 A;  4GM2 A;  3TV5 A;  3I47 A;  3DOR A;  5DU8 A;  4RYF H;  3T8B A;  1WDL A;  3H0Q A;  1YG8 A;  3RRV A;  4JSB A;  3V5I A;  3GKB A;  3RSI A;  5KJP A;  1N6F A;  2DUB A;  3KTJ A;  2F9Y A;  3Q7H A;  3PE8 A;  4JYJ A;  3IB9 A;  3OME A;  4QII A;  2F9I A;  2PPY A;  3TT6 A;  1VRG A;  3NJD A;  2X58 A;  4U0G A;  2UZF A;  5DUF A;  4ELW A;  4J2U A;  4ZDC A;  2VSU A;  1N6E A;  4FNB A;  4KPK A;  1OD2 A;  2ZQR A;  3OT6 A;  3QYR A;  4RYF A;  5CTB A;  3Q0J A;  1XNW A;  3FDU A;  3P85 A;  4NEK A;  4Q0G A;  3R9T A;  1NZY B;  5ING A;  3H0J A;  2ZL0 A;  3ISA A;  2Q34 A;  1Q51 A;  5DTW A;  4WYO B;  2A7S A;  3RST A;  2EJ5 A;  1Y7O A;  2J5G D;  1RJN A;  3BEZ A;  5DUC A;  2BZR A;  5INF A;  2VSS A;  1FCF A;  3V5E A;  5DKP A;  4ELX A;  1J7X A;  1TG6 A;  5C9G A;  3ZW8 A;  3P5M A;  4FJW D;  3KTG A;  2J5I B;  1K39 A;  5DL1 A;  4LK5 A;  3TVW A;  3P2L A;  3QXI A;  4HC8 A;  4U1A A;  2A7K A;  5KDR A;  4FZW A;  1DCI A;  4Q1I A;  2C8T A;  4MI2 A;  3LKE A;  2WTB A;  4Z0M A;  4B3I A;  4G2R A;  3IBB A;  4K2N A;  1OD4 A;  2Q35 A;  5DZK H;  1HNU A;  1FC7 A;  4ZDB A;  2VSU C;  2VX2 A;  5MGB A;  1ON9 A;  2CBY A;  4HDT A;  1N6D A;  3FF6 A;  4U0G H;  4NNQ A;  1EF8 A;  3WG5 A;  5FUS A;  2J5S A;  1YG6 A;  4F47 A;  1MJ3 A;  5INI A;  3GF3 A;  1XNV A;  4JOT A;  5E0N X;  3MOY A;  3U9R B;  4QIJ A;  5CTC A;  3HE2 A;  4JCQ A;  4DI1 A;  1XO6 A;  4ELS A;  1WZ8 A;  1HZD A;  3ZW9 A;  4K29 A;  3U9S B;  4L8K A;  2FBM A;  5C90 A;  2F6I A;  3ZWA A;  3R9S A;  1TYF A;  1RJM A;  3M6M A;  2NP9 A;  2J5G A;  3QXZ A;  3ST9 A;  2D3T A;  3TVU A;  5DU4 A;  4RCN A;  5DZK A;  3H0U A;  4IZB A;  4NAR A;  4JYL A;  3N6R B;  4WZ8 B;  3MYB A;  3KTI A;  4B3H A;  5HUQ A;  3HP0 A;  3HIN A;  3PZK A;  3VIV A;  2Q2X A;  2ZL4 A;  2J5I I;  3ZWC A;  3KTK A;  3TDC A;  1UYV A;  4EML A;  3T89 A;  3QKA A;  1DUB A;  3H0S A;  2FW2 A;  3GF7 A;  3OC7 A;  4FB8 A;  1K32 A;  1SZO A;  3LAO A;  3KTH A;  3IAV A;  4B3J A;  1EF9 A;  2A81 A;  4JCR A;  3GMA A;  4IZD A;  2ZL3 A;  4ASI A;  2F9Y B;  3KQF A;  3R0O A;  2J5I A;  2FZS A;  3T88 A;  5IKL B;  5G1Q A;  1ON3 A;  4JJT A;  4QFE A;  4JCS A;  5KDR B;  3MFM A;  4ZDE A;  3TRR A;  3T3W A;  4ZU2 A;  4EMP A;  4U18 A;  1UYR A;  3BF0 A;  3HLN 1;  1FC6 A;  1HNO A;  2CE3 A;  1WDK A;  4FN8 A;  4JCT A;  4JVT A;  1Q52 A;  4ZDF A;  5G1R A;  4FN7 A;  2IEX A;  5DTP A;  1EY3 A;  1SG4 A;  2VRE A;  2DEO A;  3QMJ A;  3PGQ A;  4I42 A;  2F6Q A;  3Q0G A;  3L3S A;  3K50 A;  1FC9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...