3L3SA

Crystal structure of an enoyl-coa hydrotase/isomerase family protein from silicibacter pomeroyi
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
237
structure length
231
Chain Sequence
LLGEVLSEGVLTLTLGRAPAHPLSRAMIAALHDALRRAMGDDHVHVLVIHGPGRIFCAGHDLKEIGRDEGRAFVTDLFEACSALMLDLAHCPKPTIALVEGIATAAGLQLMAACDLAYASPAARFCLPGVQNGGFTTPAVAVSRVIGRRAVTEMALTGATYDADWALAAGLINRILPEAALATHVADLAGALAARNQAPLRRGLETLNRHLELPLEQAYALATPVMVEHFM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an enoyl-CoA hydrotase/isomerase family protein from Silicibacter pomeroyi
rcsb
source organism Ruegeria pomeroyi
molecule tags Isomerase
molecule keywords Enoyl-CoA hydratase/isomerase family protein
total genus 61
structure length 231
sequence length 237
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2009-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3l3sA01
1WDLA 2FBMA 2J5II 1OD2A 3HE2A 4KNPA 1EF9A 1MJ3A 3JU1A 5JBWA 4MXIA 3QXZA 2VREA 3TLFA 4EMLA 1UYSA 4IZCA 1PIXA 3T89A 3QKAA 4QFEA 2PBPA 4NNQA 1X0UA 3ZWBA 1XNWA 2VX2A 3QREA 2D3TA 3M6MA 3Q7HA 4K29A 3TV5A 1UYVA 5JBXA 1YG8A 4Q0GA 3QK8A 4OG1A 2C8TA 1HNUA 3T8BA 5INGA 3ZW8A 5C90A 3RRVA 1SG4A 2X58A 4U0HA 1NZYB 4ASIA 4JWVA 3BPPA 3H0UA 4JCSA 5DTPA 3QXIA 4ZDBA 2CE3A 2VSUF 3RSIA 4G2RA 1WZ8A 1WDMA 1RJMA 1WDKA 5C9GA 3DORA 2J5IA 2VSSE 2VSSA 3R9QA 4U18A 4KPKA 4B3IA 3KTIA 3M6NA 4ZU2A 4U0GH 3TRRA 1XNVA 3N6RB 3TZ3A 1N6EA 2F6QA 3HRXA 2Q2XA 2ZL2A 1OD4A 2BZRA 4I42A 2PPYA 4QIIA 3TVWA 4ELXA 4KD6A 4FB8A 4LK5A 3R6HA 3K8XA 1SZOA 4B3JA 4FJWD 5DUCA 1FC7A 2J5IB 3WG5A 5INFA 4F47A 2ZL3A 3H02A 4JCRA 1N6FA 3FDUA 2GTRA 2PG8A 1NZYA 2HW5A 3T8AA 5IKLB 5MGBA 4ELWA 2X24A 3SWXA 3H0SA 4B3HA 3H0JA 3QMJA 1HZDA 2CBYA 1TG6A 3STAA 1HNOA 3HLN1 2J5SA 3BEZA 4K2NA 2WTBA 3ST9A 4MOUA 3ZWCA 2UZFA 4ELSA 2DUBA 3PE8A 5DKPA 3PGQA 3RSTA 3LAOA 3G64A 1XNYA 3H81A 3ISAA 2VSUE 3TVUA 3Q1TA 4FNDA 3R9TA 3PZKA 4NEKA 4EMMA 3HP0A 3GF3A 1J7XA 3HINA 5INIA 2ZQRA 4HNKA 4L6WA 4GHNA 2J5GA 1PJHA 5FUSA 1FC6A 3Q0GA 4YLHA 4KWBA 3IB9A 4ZDEA 4MI2A 3GF7A 4Z0MA 4JYLA 3BF0A 3R9SA 1O8UA 3OMEA 1VRGA 2VSUA 1TYFA 1Q52A 2FZSA 5E0NX 3NJDA 5KDRA 3VIVA 2F6IA 4QIJA 2FW2A 3TT7A 1DUBA 3H0QA 2QQ3A 3OC7A 1UYTA 2VSUC 2ZL0A 3NJBA 2F9IA 4OLQA 3V5EA 3P5MA 2EJ5A 2Q35A 4FN7A 3KTKA 3GKBA 3P2LA 1RJNA 3KTHA 4WCZA 4EMPA 5DL1A 3R0OA 1Y7OA 4HC8A 3FF6A 1FC9A 5DU8A 3GLMA 5DZKH 3MYBA 3OT6A 4Q1IA 5DTWA 5G1RA 3MT6A 4FNBA 1N6DA 5G1QA 5DU4A 2F9YA 4JVTA 1EY3A 1XX4A 5KJPA 1K32A 3U9TB 1W2XA 3LKEA 4IZDA 1UIYA 4FZWA 4U19A 3K50A 5DUFA 3KTGA 1K39A 3KQFA 5CTCA 3QYRA 5KDRB 3MOYA 4JJTA 3TDCA 4L8KA 2IEXA 2ZQQA 2VSSF 4U0GA 4OMRA 2DEOA 3IBBA 2Q34A 1UYRA 1EF8A 4FZWC 1DCIA 3U9RB 2F9YB 1Q51A 4JCTA 3QWDA 4WZ8B 3I47A 3PEAA 4I52A 3GMAA 4IZBA 4WYOB 4U1AA 4FN8A 4ZDCA 4RCNA 1ON9A 3TT6A 4K3WA 3Q0JA 2NP9A 2W3PA 1YG6A 2F9IB 5DZKA 5FIFA 5G1SA 4JOTA 4JYJA 3DJAA 4I4ZA 3T88A 1FCFA 3KTJA 4RYFH 5E0SA 1ON3A 5DU6A 4RYFA 5E0SH 4JCQA 3L3SA 3ZWAA 4DI1A 5CTBA 3V5IA 3IAVA 3MFMA 3P85A 2A7SA 2A7KA 3SLLA 4JFCA 1XO6A 1JXZA 2ZL4A 2J5GD 2A81A 4ZDFA 3ZW9A 3T3WA 4JSBA 3U9SB 4ZDDA 4GM2A
chains in the Genus database with same CATH superfamily
1WDLA 2FBMA 2J5II 1OD2A 3HE2A 4KNPA 1EF9A 1MJ3A 3JU1A 5JBWA 4MXIA 3QXZA 2VREA 3TLFA 4EMLA 1UYSA 4IZCA 1PIXA 3T89A 3QKAA 4QFEA 2PBPA 4NNQA 1X0UA 3ZWBA 1XNWA 2VX2A 3QREA 2D3TA 3M6MA 3Q7HA 4K29A 3TV5A 1UYVA 5JBXA 1YG8A 4Q0GA 3QK8A 4OG1A 2C8TA 1HNUA 3T8BA 5INGA 3ZW8A 5C90A 3RRVA 1SG4A 2X58A 4U0HA 1NZYB 4ASIA 4JWVA 3BPPA 3H0UA 4JCSA 5DTPA 3QXIA 4ZDBA 2CE3A 2VSUF 3RSIA 4G2RA 1WZ8A 1WDMA 1RJMA 1WDKA 5C9GA 3DORA 2J5IA 2VSSE 2VSSA 3R9QA 4U18A 4KPKA 5HUQA 4B3IA 3KTIA 3M6NA 4ZU2A 4U0GH 3TRRA 1XNVA 3N6RB 3TZ3A 1N6EA 2F6QA 3HRXA 2Q2XA 2ZL2A 1OD4A 2BZRA 4I42A 2PPYA 4QIIA 3TVWA 4ELXA 4KD6A 4FB8A 4LK5A 3R6HA 3K8XA 1SZOA 4B3JA 4FJWD 5DUCA 1FC7A 2J5IB 3WG5A 5INFA 4F47A 2ZL3A 3H02A 4JCRA 1N6FA 3FDUA 2GTRA 2PG8A 1NZYA 2HW5A 3T8AA 5IKLB 5MGBA 2YJGA 4ELWA 2X24A 3SWXA 3H0SA 4B3HA 3H0JA 3QMJA 1HZDA 2CBYA 1TG6A 3STAA 1HNOA 3HLN1 2J5SA 3BEZA 4K2NA 2WTBA 3ST9A 4MOUA 3BPTA 3ZWCA 2UZFA 4ELSA 2DUBA 3PE8A 5DKPA 3PGQA 3RSTA 3LAOA 3G64A 1XNYA 3H81A 3ISAA 2VSUE 3TVUA 3Q1TA 4FNDA 3R9TA 3PZKA 4NEKA 4EMMA 3HP0A 3GF3A 1J7XA 3HINA 5INIA 2ZQRA 4HNKA 4L6WA 4GHNA 2J5GA 1PJHA 5FUSA 1FC6A 3Q0GA 4YLHA 4KWBA 3IB9A 4ZDEA 4MI2A 3GF7A 4Z0MA 4JYLA 3BF0A 3R9SA 1O8UA 3OMEA 1VRGA 2VSUA 1TYFA 1Q52A 2FZSA 5E0NX 3NJDA 5KDRA 3VIVA 2F6IA 4QIJA 2FW2A 3TT7A 1DUBA 3H0QA 2QQ3A 3OC7A 1UYTA 2VSUC 2ZL0A 3NJBA 2F9IA 4OLQA 3V5EA 3P5MA 2EJ5A 2Q35A 4FN7A 3KTKA 3GKBA 3P2LA 1RJNA 3KTHA 4WCZA 4HDTA 4EMPA 5DL1A 3R0OA 1Y7OA 4HC8A 3FF6A 1FC9A 5DU8A 3GLMA 5DZKH 3MYBA 3OT6A 4Q1IA 5DTWA 5G1RA 3MT6A 4FNBA 1N6DA 5G1QA 5DU4A 2F9YA 4JVTA 1EY3A 1XX4A 5KJPA 1K32A 3U9TB 1W2XA 3LKEA 4IZDA 4NARA 1UIYA 4FZWA 4U19A 3K50A 5DUFA 3KTGA 1K39A 3KQFA 5CTCA 3QYRA 5KDRB 3MOYA 4JJTA 3TDCA 4L8KA 2IEXA 2ZQQA 2VSSF 4U0GA 4OMRA 2DEOA 3IBBA 2Q34A 1UYRA 1EF8A 4FZWC 1DCIA 3U9RB 2F9YB 1Q51A 4JCTA 3QWDA 4WZ8B 3I47A 3PEAA 4I52A 3GMAA 4IZBA 4WYOB 4U1AA 4FN8A 4ZDCA 4RCNA 1ON9A 3TT6A 4K3WA 3Q0JA 2NP9A 2W3PA 1YG6A 2F9IB 5DZKA 5FIFA 5G1SA 4JOTA 4JYJA 3DJAA 4I4ZA 3T88A 1FCFA 3KTJA 4RYFH 5E0SA 1ON3A 5DU6A 4RYFA 5E0SH 4JCQA 3L3SA 3ZWAA 4DI1A 5CTBA 3V5IA 3IAVA 3MFMA 3P85A 2A7SA 2A7KA 3SLLA 4JFCA 1XO6A 1JXZA 2ZL4A 2J5GD 2A81A 4ZDFA 4J2UA 3ZW9A 3T3WA 4JSBA 3U9SB 4ZDDA 4GM2A
chains in the Genus database with same CATH topology
1WDLA 2FBMA 2J5II 1OD2A 3HE2A 4KNPA 1EF9A 1MJ3A 3JU1A 5JBWA 4MXIA 3QXZA 2VREA 3TLFA 4EMLA 1UYSA 4IZCA 1PIXA 3T89A 3QKAA 4QFEA 2PBPA 4NNQA 1X0UA 3ZWBA 1XNWA 2VX2A 3QREA 2D3TA 3M6MA 3Q7HA 4K29A 3TV5A 1UYVA 5JBXA 1YG8A 4Q0GA 3QK8A 4OG1A 2C8TA 1HNUA 3T8BA 5INGA 3ZW8A 5C90A 3RRVA 1SG4A 2X58A 4U0HA 1NZYB 4ASIA 4JWVA 3BPPA 3H0UA 4JCSA 5DTPA 3QXIA 4ZDBA 2CE3A 2VSUF 3RSIA 4G2RA 1WZ8A 1WDMA 1RJMA 1WDKA 5C9GA 3DORA 2J5IA 2VSSE 2VSSA 3R9QA 4U18A 4KPKA 5HUQA 4B3IA 3KTIA 3M6NA 4ZU2A 4U0GH 3TRRA 1XNVA 3N6RB 3TZ3A 1N6EA 2F6QA 3HRXA 2Q2XA 2ZL2A 1OD4A 2BZRA 4I42A 2PPYA 4QIIA 3TVWA 4ELXA 4KD6A 4FB8A 4LK5A 3R6HA 3K8XA 1SZOA 4B3JA 4FJWD 5DUCA 1FC7A 2J5IB 3WG5A 5INFA 4F47A 2ZL3A 3H02A 4JCRA 1N6FA 3FDUA 2GTRA 2PG8A 1NZYA 2HW5A 3T8AA 5IKLB 5MGBA 2YJGA 4ELWA 2X24A 3SWXA 3H0SA 4B3HA 3H0JA 3QMJA 1HZDA 2CBYA 1TG6A 3STAA 1HNOA 3HLN1 2J5SA 3BEZA 4K2NA 2WTBA 3ST9A 4MOUA 3BPTA 3ZWCA 2UZFA 4ELSA 2DUBA 3PE8A 5DKPA 3PGQA 3RSTA 3LAOA 3G64A 1XNYA 3H81A 3ISAA 2VSUE 3TVUA 3Q1TA 4FNDA 3R9TA 3PZKA 4NEKA 4EMMA 3HP0A 3GF3A 1J7XA 3HINA 5INIA 2ZQRA 4HNKA 4L6WA 4GHNA 2J5GA 1PJHA 5FUSA 1FC6A 3Q0GA 4YLHA 4KWBA 3IB9A 4ZDEA 4MI2A 3GF7A 4Z0MA 4JYLA 3BF0A 3R9SA 1O8UA 3OMEA 1VRGA 2VSUA 1TYFA 1Q52A 2FZSA 5E0NX 3NJDA 5KDRA 3VIVA 2F6IA 4QIJA 2FW2A 3TT7A 1DUBA 3H0QA 2QQ3A 3OC7A 1UYTA 2VSUC 2ZL0A 3NJBA 2F9IA 4OLQA 3V5EA 3P5MA 2EJ5A 2Q35A 4FN7A 3KTKA 3GKBA 3P2LA 1RJNA 3KTHA 4WCZA 4HDTA 4EMPA 5DL1A 3R0OA 1Y7OA 4HC8A 3FF6A 1FC9A 5DU8A 3GLMA 5DZKH 3MYBA 3OT6A 4Q1IA 5DTWA 5G1RA 3MT6A 4FNBA 1N6DA 5G1QA 5DU4A 2F9YA 4JVTA 1EY3A 1XX4A 5KJPA 1K32A 3U9TB 1W2XA 3LKEA 4IZDA 4NARA 1UIYA 4FZWA 4U19A 3K50A 5DUFA 3KTGA 1K39A 3KQFA 5CTCA 3QYRA 5KDRB 3MOYA 4JJTA 3TDCA 4L8KA 2IEXA 2ZQQA 2VSSF 4U0GA 4OMRA 2DEOA 3IBBA 2Q34A 1UYRA 1EF8A 4FZWC 1DCIA 3U9RB 2F9YB 1Q51A 4JCTA 3QWDA 4WZ8B 3I47A 3PEAA 4I52A 3GMAA 4IZBA 4WYOB 4U1AA 4FN8A 4ZDCA 4RCNA 1ON9A 3TT6A 4K3WA 3Q0JA 2NP9A 2W3PA 1YG6A 2F9IB 5DZKA 5FIFA 5G1SA 4JOTA 4JYJA 3DJAA 4I4ZA 3T88A 1FCFA 3KTJA 4RYFH 5E0SA 1ON3A 5DU6A 4RYFA 5E0SH 4JCQA 3L3SA 3ZWAA 4DI1A 5CTBA 3V5IA 3IAVA 3MFMA 3P85A 2A7SA 2A7KA 3SLLA 4JFCA 1XO6A 1JXZA 2ZL4A 2J5GD 2A81A 4ZDFA 4J2UA 3ZW9A 3T3WA 4JSBA 3U9SB 4ZDDA 4GM2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WDL A;  2FBM A;  2J5I I;  1OD2 A;  3HE2 A;  4KNP A;  1EF9 A;  1MJ3 A;  3JU1 A;  5JBW A;  4MXI A;  3QXZ A;  2VRE A;  3TLF A;  4EML A;  1UYS A;  4IZC A;  1PIX A;  3T89 A;  3QKA A;  4QFE A;  2PBP A;  4NNQ A;  1X0U A;  3ZWB A;  1XNW A;  2VX2 A;  3QRE A;  2D3T A;  3M6M A;  3Q7H A;  4K29 A;  3TV5 A;  1UYV A;  5JBX A;  1YG8 A;  4Q0G A;  3QK8 A;  4OG1 A;  2C8T A;  1HNU A;  3T8B A;  5ING A;  3ZW8 A;  5C90 A;  3RRV A;  1SG4 A;  2X58 A;  4U0H A;  1NZY B;  4ASI A;  4JWV A;  3BPP A;  3H0U A;  4JCS A;  5DTP A;  3QXI A;  4ZDB A;  2CE3 A;  2VSU F;  3RSI A;  4G2R A;  1WZ8 A;  1WDM A;  1RJM A;  1WDK A;  5C9G A;  3DOR A;  2J5I A;  2VSS E;  2VSS A;  3R9Q A;  4U18 A;  4KPK A;  4B3I A;  3KTI A;  3M6N A;  4ZU2 A;  4U0G H;  3TRR A;  1XNV A;  3N6R B;  3TZ3 A;  1N6E A;  2F6Q A;  3HRX A;  2Q2X A;  2ZL2 A;  1OD4 A;  2BZR A;  4I42 A;  2PPY A;  4QII A;  3TVW A;  4ELX A;  4KD6 A;  4FB8 A;  4LK5 A;  3R6H A;  3K8X A;  1SZO A;  4B3J A;  4FJW D;  5DUC A;  1FC7 A;  2J5I B;  3WG5 A;  5INF A;  4F47 A;  2ZL3 A;  3H02 A;  4JCR A;  1N6F A;  3FDU A;  2GTR A;  2PG8 A;  1NZY A;  2HW5 A;  3T8A A;  5IKL B;  5MGB A;  4ELW A;  2X24 A;  3SWX A;  3H0S A;  4B3H A;  3H0J A;  3QMJ A;  1HZD A;  2CBY A;  1TG6 A;  3STA A;  1HNO A;  3HLN 1;  2J5S A;  3BEZ A;  4K2N A;  2WTB A;  3ST9 A;  4MOU A;  3ZWC A;  2UZF A;  4ELS A;  2DUB A;  3PE8 A;  5DKP A;  3PGQ A;  3RST A;  3LAO A;  3G64 A;  1XNY A;  3H81 A;  3ISA A;  2VSU E;  3TVU A;  3Q1T A;  4FND A;  3R9T A;  3PZK A;  4NEK A;  4EMM A;  3HP0 A;  3GF3 A;  1J7X A;  3HIN A;  5INI A;  2ZQR A;  4HNK A;  4L6W A;  4GHN A;  2J5G A;  1PJH A;  5FUS A;  1FC6 A;  3Q0G A;  4YLH A;  4KWB A;  3IB9 A;  4ZDE A;  4MI2 A;  3GF7 A;  4Z0M A;  4JYL A;  3BF0 A;  3R9S A;  1O8U A;  3OME A;  1VRG A;  2VSU A;  1TYF A;  1Q52 A;  2FZS A;  5E0N X;  3NJD A;  5KDR A;  3VIV A;  2F6I A;  4QIJ A;  2FW2 A;  3TT7 A;  1DUB A;  3H0Q A;  2QQ3 A;  3OC7 A;  1UYT A;  2VSU C;  2ZL0 A;  3NJB A;  2F9I A;  4OLQ A;  3V5E A;  3P5M A;  2EJ5 A;  2Q35 A;  4FN7 A;  3KTK A;  3GKB A;  3P2L A;  1RJN A;  3KTH A;  4WCZ A;  4EMP A;  5DL1 A;  3R0O A;  1Y7O A;  4HC8 A;  3FF6 A;  1FC9 A;  5DU8 A;  3GLM A;  5DZK H;  3MYB A;  3OT6 A;  4Q1I A;  5DTW A;  5G1R A;  3MT6 A;  4FNB A;  1N6D A;  5G1Q A;  5DU4 A;  2F9Y A;  4JVT A;  1EY3 A;  1XX4 A;  5KJP A;  1K32 A;  3U9T B;  1W2X A;  3LKE A;  4IZD A;  1UIY A;  4FZW A;  4U19 A;  3K50 A;  5DUF A;  3KTG A;  1K39 A;  3KQF A;  5CTC A;  3QYR A;  5KDR B;  3MOY A;  4JJT A;  3TDC A;  4L8K A;  2IEX A;  2ZQQ A;  2VSS F;  4U0G A;  4OMR A;  2DEO A;  3IBB A;  2Q34 A;  1UYR A;  1EF8 A;  4FZW C;  1DCI A;  3U9R B;  2F9Y B;  1Q51 A;  4JCT A;  3QWD A;  4WZ8 B;  3I47 A;  3PEA A;  4I52 A;  3GMA A;  4IZB A;  4WYO B;  4U1A A;  4FN8 A;  4ZDC A;  4RCN A;  1ON9 A;  3TT6 A;  4K3W A;  3Q0J A;  2NP9 A;  2W3P A;  1YG6 A;  2F9I B;  5DZK A;  5FIF A;  5G1S A;  4JOT A;  4JYJ A;  3DJA A;  4I4Z A;  3T88 A;  1FCF A;  3KTJ A;  4RYF H;  5E0S A;  1ON3 A;  5DU6 A;  4RYF A;  5E0S H;  4JCQ A;  3L3S A;  3ZWA A;  4DI1 A;  5CTB A;  3V5I A;  3IAV A;  3MFM A;  3P85 A;  2A7S A;  2A7K A;  3SLL A;  4JFC A;  1XO6 A;  1JXZ A;  2ZL4 A;  2J5G D;  2A81 A;  4ZDF A;  3ZW9 A;  3T3W A;  4JSB A;  3U9S B;  4ZDD A;  4GM2 A; 
#chains in the Genus database with same CATH topology
 1WDL A;  2FBM A;  2J5I I;  1OD2 A;  3HE2 A;  4KNP A;  1EF9 A;  1MJ3 A;  3JU1 A;  5JBW A;  4MXI A;  3QXZ A;  2VRE A;  3TLF A;  4EML A;  1UYS A;  4IZC A;  1PIX A;  3T89 A;  3QKA A;  4QFE A;  2PBP A;  4NNQ A;  1X0U A;  3ZWB A;  1XNW A;  2VX2 A;  3QRE A;  2D3T A;  3M6M A;  3Q7H A;  4K29 A;  3TV5 A;  1UYV A;  5JBX A;  1YG8 A;  4Q0G A;  3QK8 A;  4OG1 A;  2C8T A;  1HNU A;  3T8B A;  5ING A;  3ZW8 A;  5C90 A;  3RRV A;  1SG4 A;  2X58 A;  4U0H A;  1NZY B;  4ASI A;  4JWV A;  3BPP A;  3H0U A;  4JCS A;  5DTP A;  3QXI A;  4ZDB A;  2CE3 A;  2VSU F;  3RSI A;  4G2R A;  1WZ8 A;  1WDM A;  1RJM A;  1WDK A;  5C9G A;  3DOR A;  2J5I A;  2VSS E;  2VSS A;  3R9Q A;  4U18 A;  4KPK A;  5HUQ A;  4B3I A;  3KTI A;  3M6N A;  4ZU2 A;  4U0G H;  3TRR A;  1XNV A;  3N6R B;  3TZ3 A;  1N6E A;  2F6Q A;  3HRX A;  2Q2X A;  2ZL2 A;  1OD4 A;  2BZR A;  4I42 A;  2PPY A;  4QII A;  3TVW A;  4ELX A;  4KD6 A;  4FB8 A;  4LK5 A;  3R6H A;  3K8X A;  1SZO A;  4B3J A;  4FJW D;  5DUC A;  1FC7 A;  2J5I B;  3WG5 A;  5INF A;  4F47 A;  2ZL3 A;  3H02 A;  4JCR A;  1N6F A;  3FDU A;  2GTR A;  2PG8 A;  1NZY A;  2HW5 A;  3T8A A;  5IKL B;  5MGB A;  2YJG A;  4ELW A;  2X24 A;  3SWX A;  3H0S A;  4B3H A;  3H0J A;  3QMJ A;  1HZD A;  2CBY A;  1TG6 A;  3STA A;  1HNO A;  3HLN 1;  2J5S A;  3BEZ A;  4K2N A;  2WTB A;  3ST9 A;  4MOU A;  3BPT A;  3ZWC A;  2UZF A;  4ELS A;  2DUB A;  3PE8 A;  5DKP A;  3PGQ A;  3RST A;  3LAO A;  3G64 A;  1XNY A;  3H81 A;  3ISA A;  2VSU E;  3TVU A;  3Q1T A;  4FND A;  3R9T A;  3PZK A;  4NEK A;  4EMM A;  3HP0 A;  3GF3 A;  1J7X A;  3HIN A;  5INI A;  2ZQR A;  4HNK A;  4L6W A;  4GHN A;  2J5G A;  1PJH A;  5FUS A;  1FC6 A;  3Q0G A;  4YLH A;  4KWB A;  3IB9 A;  4ZDE A;  4MI2 A;  3GF7 A;  4Z0M A;  4JYL A;  3BF0 A;  3R9S A;  1O8U A;  3OME A;  1VRG A;  2VSU A;  1TYF A;  1Q52 A;  2FZS A;  5E0N X;  3NJD A;  5KDR A;  3VIV A;  2F6I A;  4QIJ A;  2FW2 A;  3TT7 A;  1DUB A;  3H0Q A;  2QQ3 A;  3OC7 A;  1UYT A;  2VSU C;  2ZL0 A;  3NJB A;  2F9I A;  4OLQ A;  3V5E A;  3P5M A;  2EJ5 A;  2Q35 A;  4FN7 A;  3KTK A;  3GKB A;  3P2L A;  1RJN A;  3KTH A;  4WCZ A;  4HDT A;  4EMP A;  5DL1 A;  3R0O A;  1Y7O A;  4HC8 A;  3FF6 A;  1FC9 A;  5DU8 A;  3GLM A;  5DZK H;  3MYB A;  3OT6 A;  4Q1I A;  5DTW A;  5G1R A;  3MT6 A;  4FNB A;  1N6D A;  5G1Q A;  5DU4 A;  2F9Y A;  4JVT A;  1EY3 A;  1XX4 A;  5KJP A;  1K32 A;  3U9T B;  1W2X A;  3LKE A;  4IZD A;  4NAR A;  1UIY A;  4FZW A;  4U19 A;  3K50 A;  5DUF A;  3KTG A;  1K39 A;  3KQF A;  5CTC A;  3QYR A;  5KDR B;  3MOY A;  4JJT A;  3TDC A;  4L8K A;  2IEX A;  2ZQQ A;  2VSS F;  4U0G A;  4OMR A;  2DEO A;  3IBB A;  2Q34 A;  1UYR A;  1EF8 A;  4FZW C;  1DCI A;  3U9R B;  2F9Y B;  1Q51 A;  4JCT A;  3QWD A;  4WZ8 B;  3I47 A;  3PEA A;  4I52 A;  3GMA A;  4IZB A;  4WYO B;  4U1A A;  4FN8 A;  4ZDC A;  4RCN A;  1ON9 A;  3TT6 A;  4K3W A;  3Q0J A;  2NP9 A;  2W3P A;  1YG6 A;  2F9I B;  5DZK A;  5FIF A;  5G1S A;  4JOT A;  4JYJ A;  3DJA A;  4I4Z A;  3T88 A;  1FCF A;  3KTJ A;  4RYF H;  5E0S A;  1ON3 A;  5DU6 A;  4RYF A;  5E0S H;  4JCQ A;  3L3S A;  3ZWA A;  4DI1 A;  5CTB A;  3V5I A;  3IAV A;  3MFM A;  3P85 A;  2A7S A;  2A7K A;  3SLL A;  4JFC A;  1XO6 A;  1JXZ A;  2ZL4 A;  2J5G D;  2A81 A;  4ZDF A;  4J2U A;  3ZW9 A;  3T3W A;  4JSB A;  3U9S B;  4ZDD A;  4GM2 A; 
#chains in the Genus database with same CATH homology
 1WDL A;  2FBM A;  2J5I I;  1OD2 A;  3HE2 A;  4KNP A;  1EF9 A;  1MJ3 A;  3JU1 A;  5JBW A;  4MXI A;  3QXZ A;  2VRE A;  3TLF A;  4EML A;  1UYS A;  4IZC A;  1PIX A;  3T89 A;  3QKA A;  4QFE A;  2PBP A;  4NNQ A;  1X0U A;  3ZWB A;  1XNW A;  2VX2 A;  3QRE A;  2D3T A;  3M6M A;  3Q7H A;  4K29 A;  3TV5 A;  1UYV A;  5JBX A;  1YG8 A;  4Q0G A;  3QK8 A;  4OG1 A;  2C8T A;  1HNU A;  3T8B A;  5ING A;  3ZW8 A;  5C90 A;  3RRV A;  1SG4 A;  2X58 A;  4U0H A;  1NZY B;  4ASI A;  4JWV A;  3BPP A;  3H0U A;  4JCS A;  5DTP A;  3QXI A;  4ZDB A;  2CE3 A;  2VSU F;  3RSI A;  4G2R A;  1WZ8 A;  1WDM A;  1RJM A;  1WDK A;  5C9G A;  3DOR A;  2J5I A;  2VSS E;  2VSS A;  3R9Q A;  4U18 A;  4KPK A;  5HUQ A;  4B3I A;  3KTI A;  3M6N A;  4ZU2 A;  4U0G H;  3TRR A;  1XNV A;  3N6R B;  3TZ3 A;  1N6E A;  2F6Q A;  3HRX A;  2Q2X A;  2ZL2 A;  1OD4 A;  2BZR A;  4I42 A;  2PPY A;  4QII A;  3TVW A;  4ELX A;  4KD6 A;  4FB8 A;  4LK5 A;  3R6H A;  3K8X A;  1SZO A;  4B3J A;  4FJW D;  5DUC A;  1FC7 A;  2J5I B;  3WG5 A;  5INF A;  4F47 A;  2ZL3 A;  3H02 A;  4JCR A;  1N6F A;  3FDU A;  2GTR A;  2PG8 A;  1NZY A;  2HW5 A;  3T8A A;  5IKL B;  5MGB A;  2YJG A;  4ELW A;  2X24 A;  3SWX A;  3H0S A;  4B3H A;  3H0J A;  3QMJ A;  1HZD A;  2CBY A;  1TG6 A;  3STA A;  1HNO A;  3HLN 1;  2J5S A;  3BEZ A;  4K2N A;  2WTB A;  3ST9 A;  4MOU A;  3BPT A;  3ZWC A;  2UZF A;  4ELS A;  2DUB A;  3PE8 A;  5DKP A;  3PGQ A;  3RST A;  3LAO A;  3G64 A;  1XNY A;  3H81 A;  3ISA A;  2VSU E;  3TVU A;  3Q1T A;  4FND A;  3R9T A;  3PZK A;  4NEK A;  4EMM A;  3HP0 A;  3GF3 A;  1J7X A;  3HIN A;  5INI A;  2ZQR A;  4HNK A;  4L6W A;  4GHN A;  2J5G A;  1PJH A;  5FUS A;  1FC6 A;  3Q0G A;  4YLH A;  4KWB A;  3IB9 A;  4ZDE A;  4MI2 A;  3GF7 A;  4Z0M A;  4JYL A;  3BF0 A;  3R9S A;  1O8U A;  3OME A;  1VRG A;  2VSU A;  1TYF A;  1Q52 A;  2FZS A;  5E0N X;  3NJD A;  5KDR A;  3VIV A;  2F6I A;  4QIJ A;  2FW2 A;  3TT7 A;  1DUB A;  3H0Q A;  2QQ3 A;  3OC7 A;  1UYT A;  2VSU C;  2ZL0 A;  3NJB A;  2F9I A;  4OLQ A;  3V5E A;  3P5M A;  2EJ5 A;  2Q35 A;  4FN7 A;  3KTK A;  3GKB A;  3P2L A;  1RJN A;  3KTH A;  4WCZ A;  4HDT A;  4EMP A;  5DL1 A;  3R0O A;  1Y7O A;  4HC8 A;  3FF6 A;  1FC9 A;  5DU8 A;  3GLM A;  5DZK H;  3MYB A;  3OT6 A;  4Q1I A;  5DTW A;  5G1R A;  3MT6 A;  4FNB A;  1N6D A;  5G1Q A;  5DU4 A;  2F9Y A;  4JVT A;  1EY3 A;  1XX4 A;  5KJP A;  1K32 A;  3U9T B;  1W2X A;  3LKE A;  4IZD A;  4NAR A;  1UIY A;  4FZW A;  4U19 A;  3K50 A;  5DUF A;  3KTG A;  1K39 A;  3KQF A;  5CTC A;  3QYR A;  5KDR B;  3MOY A;  4JJT A;  3TDC A;  4L8K A;  2IEX A;  2ZQQ A;  2VSS F;  4U0G A;  4OMR A;  2DEO A;  3IBB A;  2Q34 A;  1UYR A;  1EF8 A;  4FZW C;  1DCI A;  3U9R B;  2F9Y B;  1Q51 A;  4JCT A;  3QWD A;  4WZ8 B;  3I47 A;  3PEA A;  4I52 A;  3GMA A;  4IZB A;  4WYO B;  4U1A A;  4FN8 A;  4ZDC A;  4RCN A;  1ON9 A;  3TT6 A;  4K3W A;  3Q0J A;  2NP9 A;  2W3P A;  1YG6 A;  2F9I B;  5DZK A;  5FIF A;  5G1S A;  4JOT A;  4JYJ A;  3DJA A;  4I4Z A;  3T88 A;  1FCF A;  3KTJ A;  4RYF H;  5E0S A;  1ON3 A;  5DU6 A;  4RYF A;  5E0S H;  4JCQ A;  3L3S A;  3ZWA A;  4DI1 A;  5CTB A;  3V5I A;  3IAV A;  3MFM A;  3P85 A;  2A7S A;  2A7K A;  3SLL A;  4JFC A;  1XO6 A;  1JXZ A;  2ZL4 A;  2J5G D;  2A81 A;  4ZDF A;  4J2U A;  3ZW9 A;  3T3W A;  4JSB A;  3U9S B;  4ZDD A;  4GM2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...