3ZW9A

Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with (2s,3s)-3-hydroxy-2-methylbutanoyl-coa
Total Genus 271
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
271
sequence length
723
structure length
723
Chain Sequence
b'GSHMAEYLRLPHSLAMIRLCNPPVNAVSPTVIREVRNGLQKAGSDHTVKAIVICGANGNFCAGADIHGFSAFTPGLALGSLVDEIQRYQKPVLAAIQGVALGGGLELALGCHYRIANAKARVGLPEVTLGILPGARGTQLLPRVVGVPVALDLITSGKYLSADEALRLGILDAVVKSDPVEEAIKFAQKIIDKPIEPRRIFNKPVPSLPNMDSVFAEAIAKVRKQYPGVLAPETCVRSIQASVKHPYEVGIKEEEKLFMYLRASGQAKALQYAFFAEKSANKWSTPSGASWKTASAQPVSSVGVLGLGTMGRGIAISFARVGISVVAVESDPKQLDAAKKIITFTLEKEASRAHQNGQASAKPKLRFSSSTKELSTVDLVVEAVFEDMNLKKKVFAELSALCKPGAFLCTNTSALNVDDIASSTDRPQLVIGTHFFSPAHVMRLLEVIPSRYSSPTTIATVMSLSKKIGKIGVVVGNCYGFVGNRMLAPYYNQGFFLLEEGSKPEDVDGVLEEFGFKMGPFRVSDLAGLDVGWKIRKGQGLTGPSLPPGTPVRKRGNSRYSPLGDMLCEAGRFGQKTGKGWYQYDKPLGRIHKPDPWLSTFLSQYREVHHIEQRTISKEEILERCLYSLINEAFRILEEGMAARPEHIDVIYLHGYGWPRHKGGPMFYAASVGLPTVLEKLQKYYRQNPDIPQLEPSDYLRRLVAQGSPPLKEWQSLAGPHGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PEROXISOMAL BIFUNCTIONAL ENZYME
publication title The Isomerase and Hydratase Reaction Mechanism of the Crotonase Active Site of the Multifunctional Enzyme (Type-1), as Deduced from Structures of Complexes with 3S-Hydroxy- Acyl-Coa.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 271
structure length 723
sequence length 723
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.50 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3zw9A03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3zw9A02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3zw9A01
3OIFA 4XCVA 1G0OA 4YAGA 2B0JA 3QWAA 4Z6KA 1P31A 3R3JA 3RFTA 1N92A 5EL0A 1QYDA 2RH8A 4OLQA 3BA1A 5E0SA 4DC1A 1DPGA 2EERA 5G1RA 1ADCA 4WJZA 1XNVA 1GY8A 3QLJA 4FFPA 4J4TA 2ZQYA 5I8WA 1WDMA 2OMEA 3RCBA 3IBBA 5DTWA 2WYVA 4RDIA 1LEHA 2Y1OA 4F6CA 2P4HX 4AJPA 3DZKA 1H6CA 2HJSA 3JCZA 3RJ9A 2VX2A 4N5NA 5BQFA 2R2GA 5FWNA 3KTJA 1HE4A 3N7UA 3PYLA 2EEZA 4JBGA 3TZQA 4RYFH 4PVDA 5JDIC 4CMIA 1R0LA 1GPJA 1K89A 3OEYA 4LSMA 3GNTA 4JVTA 3MZ0A 2HRBA 2VZ8A 2W2KA 4KZPA 4J9VA 1Y7OA 3OJEA 1GQ2A 3PQEA 3JQCA 5IFLA 1LQUA 2G82A 4XEHA 3WIDA 3DAPA 2W8ZA 4G5HA 2ZTVA 1M66A 4XDZA 3WYBA 5IXYA 2RH4A 5TGDA 3FDUA 2G1UA 5G0VA 4ZDEA 3F4LA 2UV8A 3GVIA 1P0FA 3TDKA 2DTXA 2AXQA 1ID1A 1ON9A 1DIHA 4W9NC 2RAFA 3ULKA 1K6IA 2A7SA 4NK5A 1I5RA 4RF5A 3TNLA 3DTTA 3GF4A 4CLOB 1TT7A 3PDUA 4K28A 3S2EA 3JQ7B 4I8XA 4LRSB 4PLCA 5KVQA 5CDTA 5I7SA 3O38A 1TVEA 1M2WA 2Q2WA 1L7EA 4JJFA 4MINA 1RM4A 4CMKA 1I24A 4MVJP 1XO6A 1TXGA 2CY0A 2D5AA 3GQVA 2YHUA 2X0JA 1LRLA 1BGVA 4JJIA 1ZH8A 2Z1MA 5HA5A 1E1NA 2CDCA 3P5SA 4CLEA 4XB2A 2Y1CA 4R68A 5E0NX 3DL2A 2VSSF 5KOIA 2J5GA 4CR7A 2VWGA 1A4UA 2WE8A 4OAQA 1HL3A 4KTTE 4K2NA 3P19A 1FC7A 2NSDA 1LUAA 5J23A 3PDJA 5G4LA 1JXZA 3PJEA 3JYQA 4JX8A 5ADHA 4ONEA 2G0TA 3PLNA 4ZICA 4ELSA 3W4IA 3KOUA 3LDHA 1MX3A 4OOEA 4UEKA 4B8ZA 5DL1A 2X22A 1IYZA 3OH8A 4IQGA 3S55A 2VSUF 1QRRA 4E5PA 3RBZA 5EIOA 3QVOA 4NPCA 3SLGA 4FZWA 1NFRA 2X23A 4PGFA 4IGFA 1VM6A 3PXXA 3C1TA 3OECA 1WMAA 1QYVA 3PJDA 2VYND 3H9EO 5TSDA 3GG2A 4XQ9A 4DWVA 2X8LA 4IGEA 3F4BA 1CYDA 1YKFA 3WQQA 4BKRA 4CM5A 3JQAB 4F47A 2ZL4A 3QXZA 2QW8A 3MJSA 4QFCA 4ZU3A 4CMHA 3C7DB 3QRWA 4LN1A 3ZNQA 3Q7HA 2WWRA 3ROMA 4YT2A 1XNYA 4GSLA 4DL9A 2Q2QA 3MTGA 1PWXA 4ID9A 1UXJA 1QMGA 4AG3A 4B7XA 4TROA 4YJDA 3WSVA 1XKQA 3GGOA 3WWYA 3OF2A 1DC3A 4GLOA 1JWAB 5BT9A 3TN7A 1IB6A 4BKPA 4RVHA 4AICA 3Q0JA 4HBGA 5JLAA 3CIFA 2UAGA 1MGOA 3V1YA 5JFOA 2Q4BA 1QYWA 4YWJA 1A5ZA 4YCAA 1MB4A 3SLLA 3TT6A 1K3TA 4KUHA 4MKZA 4GBJA 4OKIA 5B1YA 1GTMA 1O8CA 3OSUA 4U8GA 4DQXA 4Z9FA 1SPXA 5ICSA 3FTNA 3NTRA 1W8DA 2AEFA 3PIIA 4E5KA 2OP1A 3MJVA 4NJMB 3UCXA 4F6LA 1FCFA 3W8EA 1HLDA 3RJ5A 5HM8A 1PJBA 3OQ1A 3U9LA 3V2UA 4CMAA 1XYGA 4DMMA 1P33A 1IPFA 2GO1A 3QVWA 1LSJA 3NGXA 3DB2A 3ETDA 2CZCA 2BD0A 3C24A 2DBVO 1CEQA 4ZJUA 3DWFA 1XLTA 1HWYA 4C7JA 3TZ6A 5JBIA 2Y0EA 4MVJE 4WCDA 4GKBA 4YEDA 3AI2A 3TJRA 3TOZA 4W6ZA 2FBMA 1D4FA 3W6ZA 4AL4A 3N58A 3G17A 1UYSA 4JQCA 1EK6A 4EUHA 3G64A 1AGNA 2IXBA 2FZEA 4BV9A 1B3BA 4D43A 1NQ5A 4FCCA 3RC2A 4LVCA 2X6TA 1U2GA 4FFLA 1VKNA 3T7CA 1R4MA 2Y0CA 1ZO8A 1X1EA 2YYYA 3ABIA 3JQ9C 1BXGB 4FFMA 5A9TA 4WZ8B 1E3WB 4R1TA 1A27A 2VHWA 3DC2A 4Q3BA 4J4BA 2EV9A 2R00C 3BMQB 4ZQHA 4ALJA 1PZFA 3AY6A 1WMBA 2IYOA 3VZRA 3NKLA 3M1LA 2O48X 5ICMA 3AOEA 4J0FA 3WIEA 1N9GA 4OHUA 1Q2XA 2D0IA 4RZHA 5JCJA 1H2HA 4DLBA 4MDHA 3P2LA 1Y5MA 4OM8A 3WMWA 4ROSA 1B2LA 3U3XA 1YQGA 2VOEA 4XR4A 4A03A 2C54A 1UZMA 3K50A 5F21A 2HMUA 3D3EA 4R69A 3FNEA 1PR9A 1CWUA 4WLVA 3KLMX 2NP9A 2JCVA 4BNFA 2ZB3A 3I9OA 3TVWA 3GR6A 4D42A 2Q46A 4B4UA 4J7UA 3MOYA 3KVOA 1HSZA 1TT5B 4Z0PA 1B26A 1PZGA 2GRAA 4EUEA 2EF1A 5IDQA 1BMDA 5G0SA 4NFSA 2YHIB 1X7HA 4B3IA 1FDWA 1LSUA 3ITDA 3GDOA 2O7QA 3PGJA 3E1KA 1SNYA 2QQ3A 4L6WA 1J4AA 2YW9A 3ZV3A 1NFFA 1GL3A 3S2IA 1FF9A 1DLIA 3VKUA 1AN9A 1YQDA 3PTZA 4EMLA 2NQ8A 2RHRA 3SJ7A 1HNOA 1IULA 2OXIA 1PWZA 3ZZNA 1BW9B 1KY4A 3CTMA 1WZ8A 2EKQA 4QIJA 3HNPA 3UICA 1LI4A 5TLSA 2EXXA 3M6IA 2W2LA 1FDTA 2IZ0A 3CXRA 1DC4A 5COBA 1G1AA 1U4SA 3G1UA 4QEDA 4Y9DA 2PH5A 3KYDB 2D3TA 2ZTUA 4J7XA 3RUEA 1MJ3A 3IOYA 4MVJG 2X58A 3A14A 1HDOA 5JY6A 2DFDA 1PIWA 2B4QA 2P9CA 4EMMA 4UVHA 3BTOA 2PLAA 3WR5A 4DVJA 3KBOA 4HFRA 3KYCB 3DZBA 2EG9A 4DTIA 3WTCA 1B7GO 4EYEA 2WTBA 4EI2A 1ORRA 3KTIA 3GT0A 1N1GA 4PG6A 3GPIA 2Q49A 4YBZA 3VTFA 4JGBA 4RVFA 4W99A 2D59A 4DUPA 4NK4A 1HZZA 1DFIA 3RFXA 4IZCA 4L0QA 1PJSA 4IDGA 1MLDA 1EBFA 4D0RA 3OMEA 2GD1O 1VRWA 5DBGA 2WJPA 4XIYA 3RIHA 5AXCA 2VHZA 3FF4A 3QVSA 2DUWA 3KHUA 2CSUA 4TZKA 2F9IB 3GA0A 2ZKLA 3LLVA 4CM3A 4JBIA 4KQWA 4CM7A 2QX7A 5DCYA 2CVQA 1EDOA 1GD1O 1V0JA 5AOVA 3TQHA 2Q45A 5KJFA 4QSMA 5L7TA 1PJQA 4BO7A 1O89A 5DT9A 3VKVA 3DZGA 1YO6A 2C29D 3B6ZA 4LISA 3R9QA 3ANNA 3LZ6A 1V3UA 2HK7A 3WFIA 4WEOA 3RUFA 5IDXA 4J7CA 3D3WA 4RV9A 1ZNQO 1LLDA 3QREA 1X1TA 1VJ1A 3MEQA 2CBYA 3QY9A 4RCVA 1ZEMA 2GZ3A 1PQPA 1GFSA 1UXKA 1KOLA 3I47A 1ZSVA 2WEKA 1GYRA 3GEDA 4MVJA 2BGMA 2FY8A 1AUPA 4O0LA 1RJWA 4URFA 1YB1A 5TF4A 1GR0A 4K1LA 4PLVA 5I9LA 2J5IA 4FR5A 3ZGYA 1A9ZA 3RC9A 1KY5A 1HZJA 4GVLA 5JDCC 2E48A 2Y1GA 1DDOA 3F1KA 4TRMA 5INIA 2R00A 1GDHA 3WG9A 3FR7A 4CLRB 3D7LA 3ENKA 1V3VA 3H2ZA 3IIEA 1R66A 4XQEA 4YXFA 3KTGA 1KVSA 1RYDA 3ZWOA 1C0IA 1PGPA 3S2GA 3BTUA 1QV7A 3WFJA 2OL4A 5I9MA 3C3XA 3GUCA 4D46A 1NVGA 2AEJA 2X86A 5C9GA 4D0SA 3RSIA 1FK8A 3RROA 4NBWA 4YJGA 3VIVA 3QSGA 1QYCA 2GN9A 1ONOA 3CMCO 4XYEA 1YG8A 1UR5A 2J5QA 1IOLA 1P44A 2PFGA 4E2WA 4ZDDA 3IQDB 1M76A 3TZKA 2DPGA 2NADA 1YONA 1YL6A 2NU9A 4PLHA 4D3SA 4D44A 2ZB4A 5JXWA 3F47A 4MOWA 1K39A 1C14A 1NAIA 2B35A 4ZRNA 2PH3A 1MUUA 1J5PA 2NUAA 4NJOA 4FQ8A 5DBIA 3FCOA 4AJNA 1KEWA 1T4BA 2PD3A 4AVYA 1A72A 3CZRA 4F46A 1WDKA 3QK8A 5C3MA 5I8ZA 1VL8A 4Q0GA 3OA0A 3T7EA 1P1IA 1DBVO 1DB3A 3NYWA 4RPJA 4YJHB 3ETGA 4TRRA 2XPCA 3QA9A 1PS0A 3L6OO 4RVGA 5JW6A 1JVSA 1UP7A 5DULA 1HDXA 1CQIA 1QYXA 3GY0A 4P4LA 2ZQQA 4N7RA 3N6RB 5K6AA 4IPTA 4Q3DA 3IUPA 4UVGA 1UJMA 3KEOA 4KWIA 1D7OA 2DVMA 4PLYA 1DIBA 1HT0A 2OORA 3L77A 4M8SA 1VJTA 1BVRA 4FIZA 1B8VA 4AFNA 3WLFA 3VOSA 2VSSE 5LDGA 2PGDA 1RWBA 4M1QA 5A9SB 3H3FA 5CTCA 2NVUA 4RVDA 8LDHA 3DBLB 1CRWG 1J49A 5HRUA 4OG1A 3RWBA 3M1AA 1NASA 1C0LA 4GX0A 1GZ4A 1ONNA 4IQ0A 1XELA 5BNFA 3E9MA 3BZUA 4DI1A 4FN4A 3C1OA 2BF7A 5CEEA 2VSUE 4RLSA 3P85A 4RL6A 3PHLA 1O9BA 1TEHA 2ZCUA 2H6EA 5F5LA 4BO6A 2O3RA 2X5JO 1VSVA 1EBUA 1SOWA 3QVXA 1SC6A 3LT2A 1H94A 2I5PO 2C20A 3G49A 1J6UA 1C1DA 2GN8A 3OJLA 4ZVVA 3W6UA 4I9HA 3W4JA 3W1VA 1ZW1A 3B1FA 3E5MA 1ADGA 3TWOA 2HKIA 5I7FA 4KNPA 1X13A 4AJJA 3K30A 3WGHA 3T8AA 1YS4A 2HK9A 4KWBA 2FSSA 3K31A 1GPDG 2AG8A 3B1JA 3JSAA 4UUOA 2A9FA 1HKUA 1GYQA 3WX0A 3ONDA 5BSEA 3WGTA 4MJLA 5IKLB 4TKLA 4DRYA 1NM5A 4YRBA 1N6DA 3ORFA 4ZHSA 2R6JA 3CPSA 3VZSA 4LMRA 1Z7EA 2CFCA 3DMTA 1N5DA 3SLKA 4HNGA 3JD3A 4UULA 3KSUA 4CLXA 5B12A 1YH3A 4K3WA 3PFFA 2VZ0A 3GF7A 3FF6A 5G0WA 1A9YA 1LU9A 1VJ0A 4BKOA 5TJHA 5CG1A 5KWEA 1ISIA 2I9PA 2ZATA 2DU8A 4CQMA 3RRVA 3KLPX 1XQ6A 3LF2A 4GH5A 4ZQBA 3MT6A 4WYOB 3UHAA 2ZL3A 4XYBA 3QWHA 1KEPA 1R4NA 5H82A 4DYDA 3ZNOA 1MC4A 3SJUA 3AJRA 1DC5A 3W8DA 5ILOA 1ZXBA 3PWZA 4L4RA 1X14A 3ONFA 4WECA 5IN4A 1JDJA 2CUKA 3I83A 3K8ZA 4DMLA 4ITUA 4R54A 1TB4A 1YOVA 4GQAA 4I9NA 4RPKA 3MYBA 1FDUA 4HV4A 3BYZA 3OEWA 2J3JA 4Q9NA 4Y6RA 3PGXA 4QX6A 4MIOA 1ULSA 3DONA 3DBHA 3ZHXA 3E5RA 1J0XO 1E6WA 1XA0A 1EF9A 4HKTA 3H0QA 5C5IA 3LSYA 4DLAA 2WE7A 5FFFA 2LDXA 4CMJA 5LDHA 1XU9A 1X0VA 3JQ8B 3E9QA 4ZDBA 3K92A 1PU2A 5EN4A 4H15A 1HLPA 2BKAA 3BTSA 4XYGA 1P74A 4JROA 4BNKA 4K6FA 1NR7A 2ZQZA 4DIFA 1UP6A 3H9UA 1Q0QA 3E18A 2DFVA 4DPMA 4GPD1 4EJMA 1NX6A 3ASUA 1VKOA 3JYPA 5ILGA 3DHEA 2NTJA 1JLLA 3R0IA 1HZDA 3O8QA 4J91A 1X0UA 1BXZA 2I76A 3U4HA 1JW9B 9LDBA 2EKPA 2WD7A 4U7WA 1SCUA 2J3HA 2QZZA 1ZMOA 4L8VA 5F1OA 2BELA 3L0DA 6LDHA 3HLN1 4MXIA 2OOSA 2BLLA 2EP5A 4HX5A 3LC2O 4FD3A 5TJ9A 1DJNA 2HMTA 1BG6A 4E5NA 4JWVA 4BGVA 2PZKA 4Q1IA 4MP3A 4LCEA 4FZWC 3GDFA 3T4EA 2VTEA 3IMFA 3DEYX 1CERA 1QLJA 1WW8A 3IUSA 2I6TA 5JYDA 4YRAA 3R6DA 1PR3A 1Q0HA 2YZ7A 3GMSA 5AQ1A 2VSSA 2XXJA 3MTJA 4IZHA 2HMVA 3KO8A 1I01A 4RDHA 4Z3DA 3BMNA 2PD6A 4FN8A 4FJ0A 2H1SA 1P1RA 5ITWA 1GZ3A 4P4GA 1FMCA 3DDNA 2QG4A 4MP6A 1YB5A 4O6VA 3PHGA 5IDYA 5GZ1A 5L53A 1E5QA 2I67A 5HS6A 1R12A 4YYZA 2VCYA 3V5IA 4XKJA 1XR3A 1UZLA 3C1AA 4U5QA 4ALKA 5A05A 2VSUA 3DTYA 2IE0A 5JCXA 3PHJA 2VYVA 2X1HA 3QP9A 5T6BA 4JCTA 8ADHA 4TRNA 5B4UA 2FPPA 3P7MA 4BV8A 1MFPA 4BNUA 1B0AA 1YGYA 1WZIA 4A26A 1RKXA 5G4KA 4Z0MA 1Z73A 1KETA 4L75A 1PEDA 2HO5A 4EJ0A 2A7KA 2ZTLA 4OXKA 2YDXA 5KKCA 2YDYA 3DQPA 4GWKA 3QWFA 4AJHA 3HN2A 1DFGA 1ADFA 3GPDG 2EW8A 4ESOA 1B16A 4DREA 4PRKA 2IEXA 4WEQA 1E1KA 4RF3A 4ALMA 1ZVMA 1BVUA 1H93A 4R1UA 3ZV5A 3EYWA 4CM8B 1EDZA 2BGKA 4G65A 5H81A 2B83A 5KNLA 1U5CA 1KVQA 3PQDA 1E92A 4ND1A 4PLFA 1R4MB 3ZW9A 1EY3A 3NV9A 4EW6A 4OQZA 5HS4A 4NBUA 3V5NA 1K0UA 2GLXA 4UEOA 3QMJA 3RUAA 3H9GA 5TC4A 2Y67A 2DQ4A 3ZNNA 2HLPA 4CM4B 2J6IA 1I8TA 4GWGA 1ZJYA 4AJIA 1N9GB 1H0KA 5F1PA 3RUIA 3HB5X 4WPGA 4BGUA 3PJGA 5KJEA 4DBVO 3F3SA 3ZWMA 5HWSA 2E49A 1ON3A 4RQUA 4JYLA 1WP4A 1R0SA 1KVUA 3LVFO 4TQGA 3UN1A 5FUSA 3AOEC 3I6IA 2QQ5A 2HMSA 2Y0DA 4K26A 1P1FA 4FSHA 4PZCA 1LRKA 4CM1A 1PX0A 2AMFA 5CPBA 4OOFA 3C85A 5T57A 4BKQA 1SMKA 2GDZA 1ZMTA 4QUKA 3COSA 3EC7A 4MKXA 1LSOA 3I9LA 5L95A 3L6EA 2ET6A 1XG5A 5FYDA 2VRCD 3RUCA 4XYLA 2H63A 3NT2A 3H4VA 2QIOA 3I52A 3IS3A 3JD1A 1HE3A 3L4SO 4YAEA 5INFA 2NQTA 3STAA 4UUNA 5FF9A 3ICCA 1UDBA 3QV1A 4CUKA 2XF8A 5G2OA 3MWDB 1K32A 4B7UA 1OD2A 4EGFA 1MG5A 1GV0A 2DBQA 2BFPA 2YQ5A 4A27A 2RIRA 4D45A 2VRBA 1LA2A 3EUWA 3LC7O 5AXDA 5BSHA 1AXEA 1T1RA 2Q99A 2IEBA 1DLJA 2CF6A 4N54A 1UYRA 4J9UE 3K73O 1VRGA 5A4DA 4U0GA 1U3WA 1PJHA 1NVTA 5BSFA 4JIGA 4CMEA 2J3KA 1I33A 4IINA 1E5LA 1VSUA 4GX2A 3BMOA 2B36A 4FPXA 4HNHA 4TKMA 5AVOA 4CUJA 2NU7A 4WLFA 5U1PA 4GGPA 1O8UA 2ILTA 3GFGA 2Q2VA 4FW8A 2O4CA 4PLZA 3IJPA 3NEPX 4E5MA 4M55A 1B15A 1LLUA 2VYNA 2DAPA 1OOEA 2X5KO 4J1SA 3JTMA 1HNUA 1MP0A 2C7GA 2Q2XA 2IEDA 4UAGA 4YJFA 5JYEA 3A9WA 4RPLA 4KQXA 4R3NA 4BO4A 2NWQA 4GSKA 4FNBA 3JYOA 1RM5A 5DTPA 1XDWA 2PNFA 3MJCA 5T64A 2AQKA 1EVIA 1E1MA 3TRIA 5DCUA 3H5NA 1G6KA 4K9DA 2PWZA 4CV1A 1PIXA 1SEPA 1C0PA 1V6AA 2O3TA 4GVXA 4ND3A 1Y7TA 3PWSA 3G3EA 4FFNA 5TX7A 3UW3A 3GK3A 3WJAA 1DXYA 4HWKA 5IG2A 3Q11A 1J7XA 2VUSA 5KTKA 3DBRA 1RM3A 2WSBA 3HE3A 1MC5A 2AQ8A 2VWQA 1E0DA 4DGSA 1F8FA 2B37A 3MOGA 1GCOA 1I36A 1NYTA 1YBMA 2Y1DA 2Y1EA 1ZEJA 1Y1PA 3ANLA 4AJ1A 1VL6A 2RHCA 4A5OA 4EBFA 1T26A 1EE2A 1A4IA 3HJAA 5DN9A 4KDFA 1KERA 3STHA 5FIFA 3PP8A 4XZ3A 3ZV4A 2PZMA 1PJCA 4ND2A 2P91A 3D3WB 3D64A 5CDSA 1ZJZA 3SX2A 5JS6A 3D0OA 2CDAA 3GNQA 1IPEA 1VL0A 2EP7A 2ZB7A 1PJ4A 3QJ5A 4U0GH 2P68A 3I9JA 3Q9NA 1U9JA 4Y98A 1Q7CA 1W4ZA 2JD1A 3HG7A 5KVCA 1EZ4A 3GG9A 3K5PA 1ARZA 5COAA 5A02A 3GKBA 2XXBA 3KTHA 5EERA 1LDBA 4BO5A 3HP0A 1WLYA 3M2TA 1E3LA 1B14A 4GMFA 4RCNA 4RF2A 1KVRA 1ISMA 1FDSA 4WCZA 1W73A 5JMPA 3GOHA 1U5AA 2WYUA 4GAEA 4KWHA 2TMGA 4B3JA 2B5VA 1I10A 4EITA 2BMAA 3KTDA 4NFHA 1LTHR 4R51A 1DC6A 2BH9A 4GX1A 2J8ZA 4W82A 4JLWA 4XA8A 3ZHZA 1PZEA 3JQBC 3NDJA 3OMLA 1F17A 5KVVA 4YJGB 2EJ5A 2B4RO 2NU6A 1MG0A 3HRXA 1EFLA 4J1NA 3QQPA 3FNHA 1H6BA 4I42A 3NTOA 2X4GA 2NU8A 4CQLA 4BO3A 1RYEA 5L51A 3KB6A 4FJ1A 4L4SA 1E7WA 2J5RA 2ZB8A 1CF2O 4ZA2A 4K6CA 1TI7A 3VPGA 4CV2A 1RPNA 1M6WA 1NXQA 4OL9A 3TF5A 1QSGA 1ZK4A 5DZSA 4WLOA 4XYMA 4CUZA 4JCRA 4WASA 2Q1WA 3M6MA 1O0SA 4NDNE 5KJ1A 1BWSA 3Q0GA 4BO9A 1JQBA 5I7EA 1PQUA 3H9QA 3JYNA 3NJ8A 1NPDA 2OGUA 3KXDA 1ENPA 2NACA 4AJLA 4YDRA 3RBVA 2O7SA 5DKPA 3EGOA 2A81A 2EGHA 5DNAA 4A7PA 1U28A 1RJNA 5KCZA 3KSZO 3DZIA 1OC4A 5CEFA 1YQXA 2OZPA 3BHJA 5JSFA 1KEUA 2CMDA 1EVYA 1OZAA 1N2SA 3RUHA 4EDFA 5K6AC 5KDRB 1H2BA 5DU8A 3QE3A 3GZNA 5FEUA 1I3LA 3JQ6A 1UYTA 1GV1A 3Q2IA 2NVUB 2Y68A 4OMRA 3OQ6A 4E3ZA 4BO0A 5CDUA 1PQWA 3AW9A 1ZK0A 3RVDA 2CE3A 3W4KA 2YV2A 3NTQA 4TZTA 3ZHBA 5IAAA 2FN7A 1I3MA 1S7CA 5A5FA 3B20A 4BQRA 3AU9A 5CEJA 3U09A 3RQSA 1IUKA 1U8FO 2EJVA 2UDPA 4P38A 2DLDA 1F06A 3K96A 3R1IA 2O23A 3LU1A 2W2LD 1HEUA 1K2WA 3CSDA 4Q3CA 4XQGA 2GERA 3SEFA 3WICA 1OI7A 3DJAA 2Y66A 1DRVA 4ND5A 3GF3A 1ZFNA 4BO1A 5DF1A 2OBNA 3T4XA 5DU4A 1C1DB 2O50A 4J4HA 1EUCA 1NZYA 4YT5A 1X15A 3VH1A 5G1QA 4N5MA 1EUDA 3GGPA 4XGNA 3ADPA 3TFQA 2HDHA 1WZEA 3A1NA 4MP8A 3O26A 3KSDO 2XOXA 3H7AA 4I1IA 3JQAD 3WS7A 2FRDA 2VT2A 1ENZA 1PGQA 3LF1A 1ZK2A 1Y81A 2E82A 4BNNA 3WGIA 3NJBA 4A10A 3U4IA 1EF8A 3NJ4A 3GZ4A 3TT7A 5C7IO 5INGA 1YDEA 5DU6A 3G79A 4DYVA 2FOIA 1C0KA 2X9NA 3Q1LA 2GASA 4UVEA 4J49A 5L9AA 3H0SA 1QR6A 2VNAA 3EVNA 1H6DA 1AHHA 1DIAA 1I2BA 3DMTC 4FN7A 1EFKA 4CQMB 1JAXA 1H9BA 2DTEA 1KEVA 2PKQO 4GL4A 2P2SA 1QKIA 4NNQA 4H3VA 1Z45A 3FBGA 1M67A 3FN4A 4UUMA 2CD9A 2W3PA 4HFJA 4ASIA 2FP4A 3BAZA 2JL1A 3RU9A 4JSBA 3ISAA 4R01A 4JXKA 4DLLA 3V8BA 5JAMA 1Z74A 2JJYA 2BI8A 3TV5A 2O4UX 2P9GA 2LDBA 3JQBA 3TFOA 2X24A 4D7AA 4Q3AA 3VDQA 3IP1A 2EJWA 3DBHB 1JVBA 3AI3A 3O03A 4O5OA 1T1SA 3PIDA 3NT5A 1UDCA 4INAA 1V9LA 5JPIA 3IKTA 4B4VA 3RASA 3E6AA 1DHRA 1VI2A 4W7IA 2HQ1A 3UFXA 4I08A 3HADA 1QV6A 2JFHA 3PLRA 2HUNA 4YQYA 3ZWCA 3ZWXA 4DQUA 4CPDA 1LBEA 4PRLA 4WKGA 3DOOA 3DFZA 1LDEA 3GVXA 3I1JA 4FS3A 4JCOA 3R9TA 4DIBA 1GEGA 2C5AA 4WOJA 5CDYA 3I4FA 1KIFA 4JNKA 4K29A 2D1YA 1Z6ZA 4IIUA 4NBTA 3LT1A 3ZWAA 3Q0EA 4UEJA 3HINA 3GLMA 1E3JA 2A94A 2E6UX 3O8QB 4OSOA 5L40A 3V2GA 3OM9A 2FR8A 5A04A 4QECA 3FHLA 1EVZA 3EAGA 3UCFA 3R6HA 2JAPA 4HADA 3TOXA 1NHGA 5ER6A 4QO8A 5CTBA 2NTVA 4P22A 1PGNA 2A4KA 1CETA 4NHEA 3JD4A 4YVFA 5DOZA 4Q3EA 1R6DA 9LDTA 5IZ4A 4E2ZA 4QT0A 1A71A 2V7PA 3OETA 3I6QA 4GGOA 4BQPA 2FPIA 2Q1TA 4XD2A 1T2DA 2YUTA 4JFCA 1UP4A 4IJKA 4J3FA 3D1LA 2X0RA 4IDCA 1NR1A 1ZSNA 2BFMA 2CDBA 2V6GA 4E5YA 3EMKA 2C8TA 3ZU4A 4EEZA 1E7YA 2XAAA 3BMNB 1IHXA 4E32A 1SO8A 3NAQA 4IJWA 2PZLA 2VHXA 4JK3A 4BNZA 2GTRA 3H3JA 5EJ2A 1Q51A 4TVBA 4NQZA 4U0KA 3WQRA 3F5QA 2ZK7A 3GVHA 5CHEA 3PGQA 2FSVA 1BW9A 1YE3A 3B1KA 4L8KA 3CZMA 4CMBA 1JTVA 5CDGA 3O4RA 3ZN2A 3GMAA 1OFGA 3IB9A 4MPDA 1HE5A 1E6EA 3GDGA 3CMMA 5G4KB 2VSUC 2Z95A 3OP4A 2D4AA 4FJ2A 5BNTA 4OYRA 1JKIA 1D8AA 4BGEA 1GYPA 2YQ4A 1XWFA 3JQDA 4NMHA 4CL8A 2JFFA 5KJCA 2I66A 4IXWA 3MJTA 1Q0LA 5CPFA 3Q1TA 1PGJA 3VAZA 2BGLA 3BEZA 1GCUA 5JMWA 2W4QA 1ZUD1 3GUYA 4A0SA 5ES3A 3VZQA 1XEAA 4R3WA 3ZV6A 1NPYA 3SWXA 3FPCA 1E7SA 2IODA 1ZK1A 2F9YA 1H9AA 5L3ZA 3ENNA 1LQTA 3I9MA 3PEFA 4I5GA 1UXGA 4NG5A 4U6QA 3L3SA 4LGVA 4Z0HO 4CMIB 1PGOA 3AWDA 3KUXA 4IMRA 3GEMA 4XX0A 3DR3A 4XGIA 3TZCA 4CODB 2BRUA 5IDWA 2W2KB 2DC1A 2JHFA 4IM7A 3RKUA 3OJ0A 1LSSA 3ZNPA 2C07A 1LXCA 2X0NA 4XJTA 3ZHYA 2B69A 1O5IA 4UVDA 1UYVA 5KJPA 4JJGA 3S2FA 1GU7A 2Y1FA 3ITKA 3VDRA 4HFMA 4B79A 2P9EA 5HTOA 2HW5A 1NBOA 1NAHA 3U0BA 2Y05A 3GAZA 4H16A 4O1MA 5JC8A 2IZ1A 3CKYA 5DP1A 5TS3A 3UOGA 3E48A 1P9LA 4YB8A 3W8FA 1AXGA 3H6KA 5F5NA 3SC4A 1P1HA 4R1NA 3NRCA 1DEHA 2VT3A 1IZ9A 2JHGA 2O3JA 4IUYA 5COQA 1KBZA 4R1SA 3ROQA 2HMWA 3VPHA 4Y6PA 4ALNA 4GHNA 1PZHA 4I5DA 1P3DA 2CNBA 3D5QA 1IL0A 2CVZA 4S3MA 3S1LA 2BFOA 1SZOA 1I3NA 4F45A 1WNTA 2D2IA 3H81A 4HXYA 3DHYA 1XGKA 4BNXA 1YB4A 2AW5A 1UIYA 3E03A 1HDZA 1XHLA 3LLSA 3C7AA 1PS9A 1PL6A 4KMSA 2GCGA 4NR0A 3ZU2A 3AK4A 4UVIA 3LT4A 4J2HA 1PJ3A 1Y8RA 2VZ9A 1O6ZA 1CQJA 1HDCA 3JU1A 3F9IA 4YRDA 2GZ1A 3EDMA 3GEGA 1JN0A 7ADHA 2VHVA 4NU5A 4CV3A 4AJEA 3OIGA 4ZQFA 5JO0A 1JA9A 1BTOA 1Q7GA 4PG8A 4HY3A 4U0HA 2YFHA 3WSWA 3BHIA 3RC7A 1JU9A 3VH2A 1YG6A 4RVUA 5JE8A 1S6YA 5TQVA 3BMOB 2Y93A 3MJEA 2BI7A 4GLLA 3BIOA 2B4TO 3F5SA 3FR8A 5F1KA 4E4YA 3EZLA 5B4VA 3UAGA 3IL2A 2BFAA 1T24A 4CMEC 1EMDA 2PA3A 5T67A 3KYBA 3H02A 3WG5A 4GI2A 2GZ2A 4BS9A 2PGJA 3ZU5A 3BF0A 4RORA 4YJFB 4E2XA 1O94A 3P2OA 5IN5A 4KUGA 3M6NA 1B3RA 3DFUA 2P5YA 3ZWVA 4OXYA 4GM2A 3PQFA 1M6HA 4D41A 3AM5A 5BSGA 1UH5A 5C37A 4YJHA 3OJOA 3PYXA 3PEAA 4XB1A 3VHRA 4S1VA 2AE2A 5JY1A 3VPSA 4WCFC 3QWBA 5A06A 3GVCA 1LDMA 1N1EA 2HU2A 2IYPA 3L6DA 1V35A 4BNJA 3TRRA 4XQCA 3TSCA 3ZWNA 4AJ4A 1HXHA 4I9UA 3SXPA 1D1SA 3DBRB 3H5RA 3IP3A 4TVOA 3PZKA 5GZ3A 1IHYA 3GNSA 3NUGA 2I65A 4BMVA 1QP8A 3P2YA 5A5EA 5IZCC 3SVTA 1TA4A 1T2FA 5JAZA 3WNVA 2HSDA 5L4NA 4MVJI 3PWKA 2ZJ0A 3T3WA 3U9RB 1YBVA 2VUUA 3HDYA 2NV6A 3Q3CA 4OIMA 4EJ6A 2E37A 2NLOA 4E13A 3A4VA 4CM9D 2POQX 4L76A 3VVBA 2OFPA 4J6FA 2ZJ1A 3EW7A 3AUTA 2AA3A 4BNTA 4IDAA 4H7PA 1C1XA 1NPTO 1FC9A 1RJMA 1LRJA 3E8XA 4RPGA 4PZDA 5A9RA 1HTBA 1Y8QA 3I23A 4CR8A 3H5AA 3I5MA 2D8AA 3RSTA 1UAGA 2UUOA 4QFDA 3VTZA 5A03A 3IAHA 3K2BA 1N7HA 1SOVA 5HBRA 5T8KC 1VC2A 4UUPA 4IZIA 3TZHA 4BIIA 5C90A 5JNLA 1TG6A 1HDYA 4KUEA 1YJ8A 2DKNA 3IDSA 2VQ3A 4JP3A 1XNWA 1ZZEA 4NZ9A 5C7LO 1UDAA 3ADOA 3HSKA 4TRJA 3E9NA 1N8KA 3X2FA 1I0ZA 5JAIA 4ZDCA 4MOUA 1NP3A 4P4NA 1ULUA 5EINA 3GVPA 1R37A 1XU7A 3ZI0A 1LC0A 3JQFC 3KV3O 4QO7A 2HJRA 1LDYA 4IDEA 5G0TA 2ZIZA 3BHMA 4OSPA 4BNHA 4CQLB 3HDQA 4C4OA 3A28A 3OHSX 3RSHA 3F6YA 3RD5A 1EEHA 2PPYA 2EIHA 2Q1UA 5A1TA 1PL7A 4L73A 4E33A 4JYJA 4U19A 3L9WA 1WXDA 2Z5LA 3RC1A 3AFNA 2O3UA 4WLEA 2VRCA 3JYLA 4YACA 1MXHA 1U1IA 3WGOA 3PYMA 4B4OA 4AJKA 1N7GA 2JD0A 1C3VA 3DBVO 2ZL2A 4PLWA 4BMSA 1E1LA 1HYGA 3HFGA 4II2A 4D79A 4Q3NA 5F3RA 2AQHA 2P4QA 5EMHA 2JAHA 3LC1O 2GPTA 5JBXA 2V6FA 5ITVA 5MGBA 4XGKA 4JCSA 1DRWA 2Q4EA 4NNJA 5BR7A 4RZIA 1VPDA 1XQ1A 2DM6A 5KIAA 2CF5A 1KYQA 1T2EA 3NX4A 1K5HA 4LMPA 5JO9A 5EESA 3FI9A 4JCQA 3JQ8A 3FRJA 3AY7A 1VE9A 4BB5A 4E31A 4HNKA 3GZNB 1X7GA 1T25A 3PRJA 4FFOA 1W0CA 3FD8A 3ZW8A 2FMUA 5TT0A 2J5GD 3IAVA 5DBFA 5E0SH 4RGBA 1P1KA 2X5OA 3D4NA 3ICPA 4KP7A 4LCJA 2UZFA 1LDNA 1ZXLA 1YDWA 1ZKMA 4ZD6A 1HRDA 5DP2A 4BNWA 4FOSA 2OO5A 1U8XX 3WMXA 4BVAA 2E4AA 4DPKA 3BMCA 1U4OA 1DOHA 1IY8A 4BUCA 4L4XA 5ENDA 5DUFA 2UYYA 4CM6A 2V6BA 3DZHA 5FI3A 4WCFA 4YAKA 4G81A 4KD6A 2JCXA 1LJ8A 2QRLA 2QHXA 2SCUA 4BL5A 1HE2A 1V8BA 3ON5A 3E82A 3DMYA 2JD2A 1NZYB 3JV7A 2A35A 1NNUA 4BNGA 3IC5A 2EGGA 1AE1A 3QVTA 3WXBA 3QHAA 4YAIA 5K0ZA 2OP0A 5IZCA 2OUIA 3DZFA 3L4BA 3TDCA 4BNMA 4PG5A 4R9SA 2FR0A 1E7MA 3LAOA 1HYEA 2PKRA 1EQ2A 3U4CA 1KC1A 2AE1A 1HF3A 3PK0A 3OC7A 4XDYA 1Q52A 4N5LA 4PCVA 3JQGA 4CLHA 4B7CA 1NQTA 1I32A 2FWMX 3PZRA 1YJQA 5LCXA 1E3EA 2GUGA 3SC6A 3T88A 1H5QA 1QORA 4R41A 1G0NA 4ZQEA 1WWKA 4FJWD 3GC6A 4I4ZA 1SB9A 4Z9YA 1JKFA 2C59A 1L1FA 4PIVA 2A92A 1U7HA 1A7KA 3FWZA 5DZKA 1DO8A 2AEMA 2ZYDA 4Q39A 3AFMA 4PLGA 3PE8A 3FPLA 3AOGA 4IBOA 5DDIP 1HDGO 1EE9A 5T8KA 3TL2A 2FHSA 5CP8A 4DA9A 4ELXA 1Z7BA 1QXSA 2YV1A 4J0EA 3ZWPA 2J5IB 4E0BA 3T89A 4RQTA 4CMGA 3WGYA 4EMPA 1K6XA 3CEAA 3ST7A 3OFSA 1Q1NA 1AHIA 4QTZA 1TYFA 4QFEA 2G17A 3Q9UA 4JN6B 4BNYA 3QYRA 1L7DA 1W2XA 1Q7BA 2HAEA 1LDGA 2C82A 4PG7A 2WYWA 1XX4A 1JAYA 3HB4X 4TWRA 3DHNA 4M89A 4Y67A 4A73A 4NEKA 2OHXA 2DUUA 3L07A 4GMGA 3JQFA 3F1LA 2O2YA 2V65A 4YAJA 4RLHA 4PN3A 5ENVA 3AUSA 4YT8A 1DUBA 5JDIA 1SG4A 4XRGA 4TSKA 2IDZA 2PTGA 2VREA 1Z75A 5ER9A 2PG8A 4BHTA 1LNQA 3ETEA 4CM8A 4XR9A 3GLQA 2F00A 4BKUA 5LC1A 2ZCVA 4CV0A 4RPHA 3VPFA 4BO2A 4FNDA 4ZN6A 2FR1A 3HDJA 4W9NA 3WNQA 1HYHA 1ZCJA 4J16A 2Y99A 2PBPA 2EKLA 1SEVA 3ROKA 1DRUA 2IZZA 4CM4A 4I5FA 1ML3A 3GHHA 5JCJD 1CDOA 4R5HA 5JC1A 5EPOA 2VN8A 2ZYAA 3MJ4A 3KETA 3F46A 1LX6A 1PJTA 1YWGO 3HN7A 3GN1A 4CLOA 1XSEA 3HHPA 3JQ7A 1E3IA 3ZWYA 3MOIA 3G0OA 4NBRA 1DSSG 2GN4A 1O95A 3CH6A 1GZ6A 4N18A 3WYCA 5DZKH 3WYEA 2GSDA 5GY7A 3C8MA 4R9RA 4LRTB 3NT4A 1T2AA 2VOJA 2Q1SA 4OMUA 3FNFA 2QZ9A 5KJ6A 4B3HA 5U9CA 4ZDFA 1DIGA 3UKOA 2O2SA 1WAMA 3A06A 4YQZA 2PGLA 1YL7A 1RM0A 2ZTMA 1V3TA 2I3AA 3M2PA 2WD8A 3SBOA 3KEQA 3I3OA 3GAFA 4Y6SA 1LLQA 1E6UA 3K6JA 1A7AA 1CIVA 4AJ2A 4B4WA 5I7VA 4IZDA 4XIJA 4NU6A 4FDAA 3BTVA 5TRTA 1GQYA 1QG6A 4JP2A 1NQOA 1P1JA 3AM3A 2J5SA 3ZDFA 3I4CA 2C0CA 3GRKA 1I2ZA 1ISHA 1P0CA 3ASVA 3HZZA 4IDDA 2ZQRA 4MIYA 3V1UA 3UCEA 3EK2A 1B8UA 4IDBA 3TLFA 4HFNA 3JD2A 3U5TA 5FI5A 4U18A 3VZPA 1XCBA 2VWPA 3C7CB 3CUKA 4FB5A 3H65A 4U0JA 3PZBA 1U7TA 3MWEB 1Y9EA 2H9IA 2X9VA 3NDRA 2NVBA 4IXTA 1IE3A 3JQAA 4PLPA 3LKEA 2H5LA 4Y8VA 1BRMA 1GAEO 4NH4A 3WBFA 4HP8A 4NI5A 1HETA 2F9YB 3NDIA 2NNLD 3ZH2A 1DAPA 1ISFA 1NFQA 1LC3A 2O3QA 3LT0A 2Q34A 2ZYGA 4YLHA 2NM0A 3INRA 4MKRA 4LK3A 1JWBB 2I3GA 2VHYA 7MDHA 2DEOA 3FBTA 4M54A 2DT5A 4A2CA 3H8VA 1R16A 4MIEA 2VTDA 1F14A 3AI1A 3JQEA 4QIIA 1GUFA 4HUJA 4O63O 4ZGWA 5IJZA 4OJNA 1ISGA 3VPXA 4E30A 3WJ7A 4I5EA 4EZBA 5TIIA 1R4NB 4KDEA 1H6AA 4WNCA 4DC0A 3G1TA 3RBXA 4U1AA 3TZ3A 4C7KA 2B5WA 1SZJG 4NJMA 3UF0A 1N6FA 5A3JA 3T8BA 3DOCA 1NWHA 1MXFA 4FC6A 4II3A 5IF3A 1FXSA 4IJUA 4E6PA 5L4LA 3EVTA 1YOVB 3OT6A 5G1SA 4ELWA 3AUAA 3D4PA 3PI7A 1DIRA 4MVJD 4L74A 1WVGA 3PFWO 4MI2A 4KPKA 5BNIA 2FZSA 1D1TA 1U3TA 2WMDA 1YL5A 3VH4A 1FJHA 4MVJM 2X9GA 3GHYA 4OO3A 1BDBA 1NWCA 4JOTA 2AQIA 3JQ9A 4Z9XA 3RFVA 4E2YA 2HK8A 3DXFA 3UVEA 4LK5A 2CVOA 4F3YA 4CJXA 1N6EA 3H0UA 2PY6A 1OD4A 2UVDA 2FZWA 4EUFA 4CLDA 3WGZA 1PS8A 1BXGA 2PD4A 3R9SA 1Y8RB 4CL3A 1E3WA 1X7DA 4W7HA 5CAEA 3GMDA 5GZ6A 4PLTA 3BMQA 3FSRA 4GX5A 3QKAA 1F0YA 1NQAO 1ENYA 3KM0A 4BNVA 1OMOA 4ZU2A 3U9SB 3EY4A 3HQ4O 5THQA 5A3VA 3FWNA 4P8RA 3FNGA 1OBFO 3Q2KA 4IS3A 1EK5A 1Y6JA 4DQVA 2WD7B 5MDHA 3ROPA 1PJ2A 1UUFA 4FBGA 2O3SA 3WBBA 1MV8A 4LVUA 4D3DA 1YVEI 4FC7A 4DIOA 4IIVA 4DXHA 5IXSA 4M86A 4FB8A 1DFHA 5CG2A 1KS9A 3PVZA 3Q6IA 3VVCA 3BPPA 4BGIA 1BSVA 3WQSB 5L4SA 3CE6A 1TT5A 3OBBA 2HCTA 4Z3KA 2EW2A 3KTKA 2YHIA 4BMNA 4FOOA 3DO5A 4ALLA 4LW8A 3NGLA 1JKJA 4ILKA 3JD0A 5EQFA 4IJVA 4MVJH 4FFRA 2DPHA 3RI3A 3KRTA 1BXKA 3INGA 4I52A 3U49A 1F12A 1IZ0A 1SAYA 3DAFA 1ZIDA 1U3VA 3INTA 4X54A 3VC7A 6ADHA 4OQYA 4M87A 2JFGA 1OAAA 3QW2A 5KDRA 1FDVA 1UXHA 1F8GA 3BXXA 3LK7A 3ZWBA 4IQ8A 3WOHA 2J5KA 2QRJA 5TT1A 1GADO 4RF4A 3P5MA 4XWYA 2Z1NA 3HDHA 3KYDA 3TL3A 1ONPA 3AY3A 4OXNA 2F6IA 5K9ZA 2G76A 3B70A 1EVJA 3GRPA 4AJOA 1NVMB 1Y5RA 3WB9A 2PR2A 4RVSA 2BHLA 4U6SA 3UGKA 1C1XB 1MA0A 1OC2A 3V2HA 5L7YA 3ZWWA 3HFSA 3KYCA 2ZL0A 1M75A 1T4DA 4CR6A 3H2SA 2I99A 4L9RA 4E12A 5C7OO 4J1QA 1Y8QB 4MVJF 4Z0TA 2GNAA 1EQUA 3H9JA 4J1TA 4YR9A 4XJSA 5U4QA 2JCYA 2Q3EA 1PTJA 4NFYA 3DOJA 5B4TA 5T5QA 1QLHA 3ZCXA 1CJCA 2V6MA 3MFMA 3OQBA 2NVWA 3LQFA 3RUDA 1GUYA 2YY7A 3R3SA 2F9IA 1ZK3A 3AM4A 3CINA 4BO8A 4QQRA 3R0OA 2QYSA 4WOKA 2DUBA 2YFQA 1E7RA 2GN6A 4DPLA 3UXYA 1DHTA 3WTBA 1ENOA 3L9XA 1P77A 4PG4A 2X0IA 4WNIA 1HSOA 2DBRA 4JBHA 3PHIA 4J43A 3EZYA 1DJQA 4LSWA 5THKA 1YRLA 1I3KA 2YV3A 4MO2A 3HWRA 4CMCA 3AU8A 4CQMD 4YT4A 4RO0A 1KC3A 3V5EA 1I30A 2FPGA 3UH1A 4NIMA 1GUZA 4R4JA 1E77A 3N74A 5JDCA 2Q50A 4WGGA 2QRKA 1PJLA 3WLEA 4OH1A 4WE3A 4YTEA 3VH3A 3HE2A 3OJFA 4ALIA 1LLCA 3GFBA 3DZJA 2YJZA 4WUVA 5GMOA 3DAGA 3HUDA 2WM3A 5EQDA 1VLLA 1W6UA 5DCWA 3ONEA 3TPCA 3WWZA 4CLRA 4R5MA 3KQFA 4J2OA 4ZRMA 5CFZA 2J3IA 3V1TC 4E21A 1P45A 5TNXA 3QXIA 4FGWA 2VWHA 4M49A 3FTPA 1KVTA 1EUZA 2F6QA 1YXMA 3TVUA 5JAQA 5AXBA 2D5CA 4KTVE 4JJTA 4NBVA 2PKQP 5KKAA 4KOAA 3U9TB 2W90A 3LYLA 4J90A 3PJFA 2C7VA 2QYTA 3UUWA 1U2DA 1NTOA 4PVCA 3U62A 2C2XA 3QIVA 3I9KA 5H83A 4GKVA 2P5UA 1MFZA 2C2YA 1B8PA 3D4OA 1YBAA 2IRWA 2DBZA 1DCIA 3OICA 4WLNA 2GGSA 2VUTA 4BOYA 3BMCB 2IXAA 3GN2A 5AXAA 4YPOA 1BDMA 4HC8A 1U3UA 3U4DA 4B8WA 4DBZA 3IJRA 1TLTA 2GF2A 2JKVA 2PK3A 4WCFB 3ST9A 2DTDA 1HDRA 3MCVA 2Q35A 1K6JA 4PZEA 5L7WA 3QWDA 4IZBA 3D5TA 2GR9A 3K8XA 5JBWA 3K9QO 1FC6A 2GYYA 2PV7A 3OIDA 4BNLA 1UXIA 3EHEA 4TMFA 3RKRA 3GH3A 2X7HA 4G2RA 3GGGA 4D3FA 2EWMA 2OBYA 3O9ZA 1UZNA 3WGQA 4BB6A 1PL8A 3KZVA 4RYFA 1ZSYA 2UUPA 2WDZA 1ZBQA 4ZQGA 1ISJA 5AYVA 4FGSA 3ANMA 4IDFA 1T2CA 1X0XA 1NHWA 4IMPA 3X2EA 5B37A 4YA6A 4PFJA 3OA2A 4EEXA 2FW2A 2G5CA 4OGWA 3PPIA 3WDSA 2RCYA 3JQGB 2NTNA 5KVSA 3NJDA 3L4BC 1GEEA 1Z82A 5A9SA 4IY1A 4IS2A 1R0KA 3DBLA 1ADBA 1R15A 3K2EA 5DOVA 2EHDA 2HRZA 3S8MA 1SBYA 2AHRA 1BHSA 2TMDA 1Y9AA 1E3SA 3AUUA 2J5II 1DAOA 1PSDA 3IKVA 4OKNA 3QWIA 5I9NA 1WDLA 2F1KA 1UAYA 1XIVA 2VNSA 4G2NA 4ND4A 4O59O 2BZRA 4WK6A 4CM9A 3RAJA 3WGGA 4UREA 4BNIA 3PHHA 3DORA 3I9NA 2C5EA 1GQQA 2RBEA 1E7QA 2VYVD 5G0UA 5L45A 2AG5A 4R16A 4WLUA 3ZU3A 3H0JA 5DUCA 2PZJA 1D3AA 4XRRA 1WPQA 3RU7A 4QXMA 1SB8A 4W4TA 2W98A 4RJTA 1I2CA
chains in the Genus database with same CATH superfamily
1TYEB 1TAUA 3OIFA 1AS0A 2B0JA 3QWAA 3A6HA 1P31A 4BP8A 2XKJE 3G2OA 5ALWA 3RFTA 3RTAA 1N2EA 5EL0A 1QYDA 2RH8A 3TMKA 3O0TA 3BA1A 5E0SA 4DC1A 3KAPA 2RGAA 5G1RA 4OREX 3P4XA 1XZCA 4NCIA 2NPFA 3ZDXB 4A0QA 2QLTA 2I91A 4WXMA 1QQAA 1D6JA 1VECA 4J4TA 1SVUA 2IYXA 2AOVA 2DWUA 4Z4HA 3I5XA 3VSEA 2IITA 3TZBA 3IBBA 3GGJA 3V1LA 2WYVA 3V9PA 1LEHA 2Y1OA 1ODFA 3EXIA 3SYNA 3TTTA 4AJPA 2ZI7A 1H6CA 2HJSA 4RSMA 3RJ9A 3NHJA 2WFAA 4U7HA 1J2EA 4AX4A 1GPWB 4X7MA 4J3JA 1G8AA 1K0FA 1OLSB 3PYLA 1S3IA 2EEZA 3NHMA 4FBLA 1L1EA 5FBKA 2ZBGA 3SZMA 5EHZA 4RYFH 5D3QA 5LWQA 3HR8A 4KAXA 1Q77A 1VCOA 1T5LA 2DMRA 3FIUA 1KYYA 3GNTA 3JZDA 3MZ0A 3QFRA 4Q7LA 1N6IA 1NW9B 4AT1A 3ANXA 2HDNB 3EGXB 4J9VA 1YU6A 3DDZX 1ORDA 1Y1SA 1ZC4A 2YYZA 3G2MA 3OJEA 1Y7OA 3F78A 1Q1GA 5IFLA 3SSMA 1LQUA 1VE6A 2G82A 2DR3A 2XQGA 2W8ZA 3B9BA 2ZTVA 1M66A 1II8A 1QZXA 4HAOA 3WYBA 5A6VA 3FDUA 5G0VA 1OJLA 4NENA 3FIJA 2YJNA 3GVIA 3PUHA 3TDKA 5H3CA 5LD2C 2AXQA 1AK2A 2EVWX 3TQIA 4RFVA 3RIGA 3ULKA 1K6IA 1I5RA 3EUEA 3O75A 4LFBB 3TNLA 4JJKA 4ZT3A 2J7PA 3O2QB 2JFPA 3GF4A 4CLOB 1TT7A 2L2QA 5DH9A 3FCSB 3P9PA 4G6ZA 4RABA 1TM7E 4LRSB 4OHBA 1KAEA 4LDPA 1F2DA 2G83A 5GVRA 3ZQ4A 3FE2A 1F9EA 5JALA 1ESEA 1TRKA 2EHJA 4BVGA 4N40A 2RGNC 1Z4NA 4D4HA 1PK7A 4H7HA 3I5UA 4JJFA 3WIOA 2QDKA 1N2OA 4CMKA 1AV6A 3S0JA 1FYXA 3WK4A 4Z8XA 5EKDA 1XO6A 3FUXA 5EJGA 3GQVA 4JZYA 2AEEA 3RS7A 5BMVA 2C2BA 3COZA 4ASUA 1ZH8A 3A58B 5EE3A 1E1NA 3HLTA 1TUIA 3P5SA 3I6ZA 3OCUA 4ITRC 4XOIA 1NI4A 2XQIA 1CUXA 4XB2A 3SJZA 3DM5A 2HA2A 4D8UA 3KHKA 1NJ6A 4I81A 2R96A 3REFA 4Z2AA 2VSSF 2J5GA 4KK4A 2VWGA 1L5YA 4CEJA 3GIDA 1THTA 1SXJD 3FOFC 3HABA 1M1XB 5EHXA 5CBKA 4GL2A 5IBQA 1I80A 1CY8A 2B6HA 2W5UA 3K0AA 3KOYA 1OT3A 3EQZA 4Q6WA 3SZUA 2ZE7A 5J23A 2QUZA 2CL7X 4O1IA 1GFIA 1C0EA 3UTDA 2PH7A 4AC9A 4DT1B 2VH1A 3NAZA 2HHHB 4HI0E 2AUTA 1FTQA 1Z38A 4LDRA 3W4IA 3TVYA 3GT7A 3FETA 5DL1A 4JP5A 4ZO4A 1BKDR 2VZEA 3IESA 3ONNA 4NOJA 5AUQA 4LCBA 4UNSA 2YWBA 4KXFB 3LO8A 1K92A 3OLWA 5AJUA 4C06A 5KTRA 1EK2A 1XROA 1DQYA 5EIOA 1LB1B 5AW0A 1YB2A 1ECGA 5DTMA 2PT9A 3PXXA 2YIDA 3E5NA 3RVQA 1CZKA 3N2ZB 3OE4A 3PJDA 2VYND 5CLGA 3EDQA 1U7WA 2YWFA 3CSUA 2J9YB 2X8LA 1QH0A 4WZAB 2P9TA 3IAXA 2PS9A 5DWQA 4CM5A 4EX7A 1B1CA 1CS0A 4JL6A 2F9FA 1RXEA 3OESA 4PSAA 4N0QA 1MABB 2A5GA 3JWEA 5AVKA 3C7DB 1JX6A 3ZNQA 3K53A 1KEEA 2WWRA 1OREA 3F90A 5FOWA 2Y77A 4NDZA 4DL9A 4YT2A 1F48A 1OX6A 1PWXA 1UXJA 1QMGA 1S1MA 2ZUTA 2XUQA 4YJDA 3OF2A 1P18A 2VDJA 4GLOA 3H1GA 3CIFA 5JLAA 5JFOA 3LI2A 2ZR0A 1A5ZA 2MHCA 3TT6A 2R7MA 5CLQA 4K6KA 3F6BX 2IYFA 1UMCA 1UAAA 4GBJA 2BEVA 5IM4F 1JP7A 1GAWA 4DQDA 1E2DA 1I1QB 1KK3A 4MHOA 5GINE 3PIIA 4UD6A 4OJMX 1YZQA 4PV7A 2I1VB 4F6LA 3W8EA 2AZTA 2YFYA 3EF3A 4QBFA 1RJFA 4GOND 1T3TA 1PJBA 3NIDB 4RJKA 3TRHA 4CMAA 3WNZA 5HM8A 1XYGA 1X9GA 4DMMA 1P33A 5BXYA 3FNIA 4A8JA 3LS2A 3V2IA 5DX1A 1TF5A 2UUAB 2CZCA 4DR5B 3SWXA 4WZBB 4DLYA 4ZJUA 5EWJA 2XRFA 3WZ2A 5JQWA 1GQRA 3LCMA 2JJ1A 1XLTA 4GE3A 3QKIA 2GEKA 4QJIA 3TZ6A 4UTRA 2VT7A 3EXHB 3H2GA 2AFIA 3LVBA 4GKBA 4HRAA 1WVMA 4YEDA 3BSYA 3TJRA 3VYWA 1STOA 1QX4A 3W3AD 2FBMA 2QVBA 3BWVA 3AF5A 5KB3A 2XCRB 2F55A 2GAFA 1FQKA 4YCBA 1D2NA 2ETXA 1TCBA 1T3SA 3M4XA 4OHVA 3TJZA 4UC0A 5G3YA 5HNKA 5EQTA 2F43B 3QQ5A 3Q7PA 1QS0B 4BV9A 2WUGA 1VHJA 2QPOA 1KKUA 2OTCA 2VP3A 5AJYA 2X6TA 1DT5A 1XMSA 5EJ4A 1U2GA 4FFLA 1VKNA 4PPNA 3T7CA 3HYRA 5AHKA 2KHZA 2Y0CA 1ZO8A 3AILA 4MW9A 2D1RA 1BH6A 2YYYA 2FX3A 2WSLA 1DAGA 3T9FA 1BNCA 1RYBA 2Z5VA 1JHXA 4NOKA 5EJ5A 2C57A 3AHIA 4WZ8B 2E21A 4R1TA 4F12A 3NHLA 2PUHA 4OGGA 4Q3BA 3TLGA 3AR3A 3UJPA 3F9RA 4ALJA 4Z4GA 3VZRA 3FCAA 3NKLA 3M1LA 3MWGA 5AK5A 3AOEA 5E6RA 1IJBA 4LBYA 2ZVQX 4KXMA 1N9GA 4KZKA 3RKSA 1W5TA 1LGYA 2D0IA 3QKTA 1N9KA 1L4GA 3IB3A 4HVCA 5CB6A 2AB0A 1UMDA 3TBHA 4OM8A 3ZJ5A 3BGVA 2F90A 3C6XA 2PL9A 3BH6A 4I5IA 1S3FA 1B2LA 3U3XA 3U44A 3MBIA 4XR4A 1EE1A 1IZZA 1M7GA 1OA1A 1UZMA 2VYCA 1LI7A 2HMUA 2HV8A 3CV3A 3IQXA 3LUFA 4MRRA 4MRAA 5E4YA 4Q15A 4CIWA 4KXXA 3GR6A 2ECKA 1LPSA 3KXKA 4FLFA 4B4UA 3GXOA 2VJNA 4B74A 3M6MD 1EXDA 3TSAA 2GRAA 1ZKDA 4EUEA 1UT6A 2EF1A 3FMFA 2XTZA 4P0PB 1QVWA 4X61A 3BCSA 3QFFA 1FP4A 4RLFA 1KE2A 3FPEA 2OCKA 2CCKA 4B3IA 1HK7A 3ITDA 4AULA 2H4ZA 2O7QA 3PGJA 3BFPA 3K5HA 3IVMA 3D5EA 2HDOA 4AWXA 2R5NA 4JJ7A 1SNYA 4S1PA 4NPAA 4QT4A 3L8YA 2A5JA 1FNSA 3DMDA 4JY7A 2XNJA 1XZKA 2ZI4A 2Q7OE 3TX6A 3AEQA 2C03A 3IDOA 3PTZA 4RLQA 5J5VA 4AQDA 2NQ8A 4EMLA 4UZFA 5FEMA 3RTDA 4QXAA 2WQ7A 4E94A 1KY4A 1W0KA 4K86A 4NTZA 1G9SA 2V9ZA 5KYXA 3G5MA 2WUEA 3HXLA 821PA 3D2CA 2QTRA 3CXRA 1DC4A 3F6EX 3WK9A 1U4SA 2ZU0C 2WSYB 2XKBA 3GJ4A 4FYIA 3WGVA 2C8JA 4QEDA 2GBFA 1RE0A 4E3WA 5DX0A 2ZTUA 2JG3A 4J7XA 2Q6OA 3RUEA 3VZCA 4Y2VA 4MVJG 3SU8A 3ECSA 3ICOA 2X58A 1ZGBA 1MJ3A 1HDOA 4URZR 2Z2KA 1JT2A 1VCMA 2E3JA 3DCYA 2DFDA 2YZ2A 3F5FA 2CHEA 2P2ZA 4EMMA 1HG0A 3J81A 3WK8A 4OJTA 1PK9A 3LUGA 3EG9B 4GEKA 5IC4A 2QTZA 5D1NA 2XNCA 3QYFA 4MVYA 4TWIA 5DM1A 5CDFA 2R1VB 4GMHA 3VU1A 3WTCA 3TX2A 2WTBA 1OA0A 2Z04A 1JEOA 4OK6A 3HSSA 3GFPA 1Q14A 3PKZA 4BQIA 5SZHB 1VIMA 3GPIA 3CF2A 3K0CA 3M83A 2R4TA 2DFLA 5KOYA 3H1PA 5FPHA 4ZCSA 3K2IA 1E0SA 4HWRA 2R62A 3KAKA 1HZZA 4IIXA 4QICA 4L0QA 3FDZA 1PT7A 4IDGA 4D0RA 4F4DA 2RG1A 3OMEA 1VRWA 3F7TA 2WJPA 1C7EA 5BN5A 1R8JA 2JHPA 4XVCA 5JD4A 2DUWA 1GWNA 5TEVA 4ZC1A 3PVCA 3U2QA 3NV7A 4CM3A 3CRNA 3IURA 5BNZA 1AF4A 4J94A 2VS1A 2QX7A 5DCYA 1K5DA 2CVQA 2NO6A 1V0JA 2X3FA 3DWGA 2C58A 2WP8J 3GJ5A 4LYFA 3TRDA 1RPZA 3BSSA 2ZPUA 3DLPX 4Q00A 1A50B 3FTEA 3CWCA 3MT8A 1GSOA 3BD6A 4ZOLF 3ZHVA 1YO6A 3PF8A 2C29D 4RK4A 1W2GA 1HQCA 3C5WP 1TO6A 3W7BA 3R9QA 5AICA 1FU8A 5I4CA 1X8JA 1V3UA 2HK7A 2CD7A 3KOZA 4TKZA 3RUFA 5IDXA 4J7CA 2GEVA 4EHDA 1KTIA 5DFAA 1ZNQO 1LLDA 2BONA 3QREA 2QVGA 4WACA 2X7JA 2XUPA 1KYTA 2CXXA 1WW2A 2ORYA 2OCXA 4I7EA 1PQPA 4MW5A 2F1JA 3FDJA 4TTTS 4Q05A 3DNPA 4KYIB 3AUXA 4PGMA 3QZUA 1NR5A 3C7KA 3HMKA 4O0LA 1RJWA 1KI7A 1QVZA 1WLSA 3RV3A 2ZBEA 3NG1A 4F3RA 1PNOA 1CZNA 4Z3OA 2F3SA 1NRJB 1C9EA 2WHXA 2DSTA 3HWX1 1A9ZA 4G9EA 4KE9A 4NMMA 5GOZA 4FE3A 5F23A 1HZJA 2H7VA 5JDCC 4C2BA 2E48A 1IXSB 1NXTA 3F1KA 3KT8A 3HO6A 3H5LA 1SHUX 2E9SA 3WDMA 3CCBA 1A2KC 2ZLBA 2NO0A 4P36A 3FSJX 3EPLA 4Y1FA 4NYIQ 1XAIA 4JITA 3GLSA 3TFWA 4BAZA 2TYSB 3KTGA 1GZUA 2EP8A 3C3YA 1C0IA 1PGPA 1PCXA 1SRRA 2W00A 1M2JA 4GXRA 3S2GA 3NASA 5KTNA 1Q0UA 2HSGA 2KS6A 1NVGA 3BS4A 3NATA 4QU9A 5KNBH 5C9GA 4D8WA 1S1CA 3SLRA 3HPRA 4E6EA 2NXJA 1P19A 2FEWB 2RK3A 2ZI3A 3OT5A 4NBWA 2Q9AA 5ES4B 2GN9A 3WV5A 3EXAA 3JZAA 4K3VA 4GP7A 3M8KA 3LPLA 4YNBA 1G6HA 1Z5WA 1P44A 1Q0PA 4HJRA 4IIBA 3SIRA 4E2WA 3E3NA 4KI7A 2GETA 4W5OA 1O0BA 1IZ7A 3LWNA 1NL3A 5BUSA 2GA8A 1YONA 1Q1EA 2NPIA 2GEUA 2NU9A 3DZDA 3HVKA 1W85A 3KKZA 1P62B 2FZKA 2I2WA 3F47A 4N39A 3T5CA 3W04A 3T41A 1ETHA 5HJ5A 4IDOA 1C14A 1K39A 3QEAZ 1B6GA 1ODCA 2A9KA 4B73A 5DBIA 1MCZA 1MUUA 2NUAA 1HM5A 3UMFA 1SVKA 3WBKA 4AVYA 1KEWA 1T4BA 1XV5A 3FYCA 3ETNA 3GJTA 3E2PA 4FGKA 4KQIA 1BD4A 3PFNA 3WLHA 4J7AA 4NYMQ 4C43A 3QK8A 5B2EA 3K16A 3PR1A 2HHLA 2DH5A 1T9GS 1OFIA 2DX7A 4FCVA 4MJXA 3W9BA 3VX3A 4D96A 4ZJYA 3SHOA 1RC8A 3UWKA 1J2JA 1XO1A 5F7OA 2XPCA 3QA9A 5DBHX 2D54A 4X91A 2FLVA 4ZDWA 1Q91A 3MJDA 1DTWB 3IELA 4ON9A 2HCJB 5K2MA 1HDXA 2P69A 5JJCA 1GG9A 3RRFA 4F5ZA 1GLNA 1KDRA 3KOWA 4MLPA 2X1LA 2VK4A 3FI0A 4CF5A 3BVPA 1I6KA 4KWIA 1D7OA 2DVMA 3K9CA 5CX1B 1DIBA 1HT0A 1M33A 4OG2A 3JQFA 5G02A 2ZT7A 1P5ZB 2KLHA 3E7DA 1X7WB 4MMYB 2FFRA 4ND6A 3EN0A 4ZVSA 4G0QA 4AFNA 5IVKA 5E9QA 1MHPA 3G23A 2VSSE 1AIPA 1ZW6A 3HVJA 5CJJA 4IZ6A 5CTCA 3I0NA 3QJGA 1CRWG 4IGIA 4QARA 3LTEA 3AVPA 4QPPA 4AS1A 1NYLA 4Y3UA 5HF6A 4E70A 4DLVA 4BEVA 1C0LA 5J4YA 3UGJA 4GX0A 1GZ4A 4N82A 2Q28A 1ONNA 4IQ0A 3WJ1A 1UOQA 1XELA 4GM0A 5BNFA 2RHLA 4LYGA 4QPCA 3ZLUA 3DL0A 3B1YA 3TRFA 4UM8B 4B32A 5LKRA 2V4UA 4H7KA 3VU8A 1YK1A 4AZWA 2WK1A 3GMIA 4DI1A 1L5LA 3BF7A 1KO5A 3IT1A 3RK1A 4S24A 2Z6UA 3A7EA 3KZOA 3ZWQA 4QD3A 2Q5EA 3ZWDA 1TEHA 3KFVA 2F8SA 5F5LA 1JSXA 2X5JO 3VZBA 2HR1A 4OP1A 2PUJA 2J6CA 2ODPA 3WP0A 4L2IA 4YUWA 1SOWA 1A88A 1H94A 4OXXA 2C20A 2I5PO 2GN8A 4DSAA 4DR4B 4FXOA 4GLJA 2QUIA 4MS1B 3V1KA 4XPIA 4BFUA 1ZW1A 3GGSA 4EG0A 5I7FA 5BV7A 5H16A 1N8SA 3ONWA 4AJJA 2VQEB 5HEKA 4HVLA 3RG2A 1MDFA 2R8BA 4F97A 2QN1A 2ZITA 2HA3A 4OX9Y 5DN6D 3BXFA 2HK9A 4LZNA 3C8HA 4KWBA 3K31A 4L07A 4ZVMA 4UUOA 3MWFA 5B53A 3LX6A 3ESQA 1L7OA 4PZ0A 5GJVC 1WE2A 4MJLA 1RKVA 1Z13A 2HBZA 1TLLA 3ORFA 1Z7EA 2CFCA 1EWVA 1E0KA 2OQ2A 2P62A 3R9IA 1SWWA 4HNGA 3ZE7A 3MG9A 4EHLA 2R6DA 3LRTA 5B12A 3BRWD 5JXIA 1QGYA 4K3WA 3PFFA 1SKMA 4PZZA 3ZQUA 5CB4B 1U7DA 4LGCA 3T9CA 3MW8A 1LU9A 3TQFA 4BKOA 2AHOA 5TJHA 2O5EA 3KQQA 2I9PA 3GARA 2R751 2CJXA 4UU7A 4CQMA 3UAYA 1GA4A 1VLJA 3KLPX 1XQ6A 3OU2A 1JFSA 2ODQA 1RBMA 2BOVA 3CLTD 2X4LA 3H8WA 3QVUA 3UHAA 2IS2A 1UBSB 3SXUB 4WL0A 4DYDA 1R4NA 1XD2B 3UH0A 1TTPB 2VAMA 3AX6A 3AJRA 1DC5A 2IZ6A 3W8DA 1CY1A 1RKQA 4X90A 2YR0A 3RHFA 3RLFA 4AECA 5HVNA 5NULA 1RBZA 1M7HA 1JDJA 2CUKA 4MRPA 3PNVA 2XZLA 4ITUA 4P92A 1Z4LA 1HTWA 1TB4A 3RVSA 1XNGA 3OZBA 3X1JA 3THXA 4A36A 4OBXA 3ZY5A 3STUA 3FBWA 1QDEA 4QX6A 2Q7XA 3X44A 2CXOA 3AIOA 3N28A 1ULSA 4PX9A 4IIEA 2OXRA 3DONA 2WKQA 2ONJA 2G4VA 1SU8A 4OPMA 5AKXA 1UDXA 4V0RA 4HKTA 5K0TA 1EF9A 5C5IA 2QLNA 4DLAA 2WE7A 1G3UA 5FRDA 3LNCA 1XNHA 2P67A 3JQ8B 5FLYA 5B57C 2D74A 1T6NA 1Y8ZA 3RQIA 1NLUA 5HZGA 3TLZA 3BRQA 3GLFA 1JTFA 5EN4A 5JARA 3ZCQA 1CZUA 1HLPA 1V9CA 2Z2YA 4AN0A 2BFBA 1EP2B 4BNKA 3EFOB 2ZJ6A 3GYGA 4QKQA 5HXAA 1ORIA 1NULA 2C5HA 4YJ3F 5EY5B 2PMCA 1LPBB 2CXSA 3LQ1A 4DIFA 2ZI5A 1J8QA 3A1EA 3G2NA 4YV1A 4FMCF 1P5FA 2CFSA 2CL6X 1UT8A 3E18A 4WA7A 4F4FA 1OU0A 3WGJA 4EJMA 2V3CC 2AG0A 1NX6A 1DG9A 3GLIE 1GRRA 5FIUA 2QUAA 4KBYA 4LKOA 5JJKA 3HL4A 1JLLA 1Z08A 3R0IA 4LDJA 3LO5A 4XVUA 1WA5A 4PYNA 1DELA 2I76A 3VR3D 1ESZA 1QWOA 2EKBA 5DB4A 3B7PA 4D3ZA 1OFHA 4ILEA 4OHCA 3STVA 1COWD 1CLEA 3BD7A 3JARB 2C4WA 1L7MA 5BW4A 3L8CA 4JDUA 4JMPA 2QZZA 5F1OA 3L0DA 4GDMA 2OOSA 5F4BA 4RENA 4HX5A 5TJ9A 3LC2O 4JWVA 1IRIA 1SCBA 2WJIA 1JDZA 2H4YA 2QJTA 3AESB 4O2BB 3IMFA 3QE4A 3IUSA 4LY3A 2E5LB 2P9HA 4RE5A 1PR3A 4YPFA 5AQ1A 2NGRA 2JI8A 4EO4A 2HMVA 3DKRA 1HFJA 4IMIB 1MJ5A 4X3CA 2F64A 2ISSD 3JY6A 4QUAA 4Z3DA 3V8VA 5B30A 1KI6B 2B6NA 2PU5A 3E22B 4FN8A 1Z0SA 3A6KA 2WJVA 2ZBPA 4KB5A 5BW8A 2J9FA 4PZUA 4GR9A 4D8YA 2O19A 4GZ6A 4MP6A 3C6YA 4O6VA 4WFKA 4BEWA 2ID7A 1NVEA 5F2NA 2I67A 1OH7A 4PQGA 4ID3A 4RAOA 4XKJA 3D9QX 1V1RA 3B1WA 3R8XA 4ZYWA 3IUQA 1GVNB 1MTOA 1UZLA 4E14A 2VSUA 3E4CA 3EXEA 5EJ8A 3DTYA 5JCXA 1N2ZA 4HNSA 4UBOA 5T6BA 4JCTA 5AVVA 8ADHA 2PS1A 1Z18A 4WK2B 5B4UA 2FPPA 1S2OA 4UXHA 4B3FX 3R8CA 4BJ5A 4XWKA 5KU1A 1S2GA 1E9RA 1B0AA 2B98A 4HAZA 2P41A 4OQLA 4TTPA 2KM1A 1VE3A 2GBCA 2OXEA 4ZKDA 2GTIA 2HO5A 3PEYA 4S35A 4Z0MA 3OFKA 1ECLA 5KCMA 1EUYA 1DAMA 2PXAA 2YDXA 3PD0A 4KO3S 3FMGA 5JZSA 4M8LA 4GM4A 4NY1A 3U39A 3O4IA 3SJCA 1M83A 3L06A 1ELOA 4XE5A 5JXJA 1Z0AA 4ESOA 4R1MA 3WWOA 4PRKA 5BYAA 1PDVA 4X93A 4X5OA 4A8JC 2QTBA 3LKZA 4GS5A 4ALMA 1NBAA 4R1UA 4MYCA 2ZZKA 4WUTA 2NXWA 2ACWA 1UDWA 1QZZA 1NP7A 5HFNA 4BMDA 2VQSA 1EDZA 3P5BA 4G65A 1XLTC 1ZQ1A 3MGCA 2B83A 1AC5A 1E3TA 1NRIA 2C5GA 2IUEA 4RKEA 3KD2A 5ESWA 1V39A 1XTRA 2HTEA 2IXDA 4FVTA 3KWLA 3PQDA 2PNJA 1R4MB 4TLEA 2P0AA 2IDKA 3A3KA 1MO2A 4GOOD 4X95A 4K9NA 5LMCA 4DV4B 1V7ZA 4JI2B 1JDNA 4HDKA 1G9TA 3WA6A 4H17A 2PX6A 4YAJA 4TV9A 1U2GC 2Y67A 4FZ3A 5E3HA 4W63A 2XWPA 2J6IA 4ENRA 4ZMRA 2PSDA 4AJIA 2P78A 5F1PA 1GR1A 5C8YF 1OH5A 1WS6A 2OG2A 3F5DA 5KJEA 4BWYA 4JLDA 4BTEA 1OIWA 2E49A 1ON3A 4HMOA 5FUSA 4QDKA 3RYIB 1GM5A 3AOEC 2QDXA 3EDCA 3I6IA 3K4QA 5A62A 2Y0DA 2XMBA 1KIAA 4K26A 4O4IB 4X9XA 4AUMA 4KR0A 3UXHA 1E89A 3U3JA 4H6PA 3CO0S 3KOXA 2OE2A 5T57A 3DEHA 3IIKA 3JQQA 4KO8A 4TSFA 5HX7A 4D0NA 5L95A 2O8DA 1R8QA 3I9LA 1WETA 3L6EA 3IUBA 3RUCA 2VRCD 3IFSA 2WNSA 2EAUA 3NR2A 3NYRA 2VSYA 4RMJA 3H4VA 3IS3A 1HE3A 2A6PA 2NQTA 3B6IA 3SXJA 5HE8A 3BXEA 1FIUA 4GPAA 5E4FA 1OPRA 2V0NA 3P9ZA 2C7OA 3HKBA 3OF3A 4CUKA 2HIAA 5EZ6B 3FPSA 5G2OA 4DV7B 1BWRA 4LOKA 4RQBA 3LAWA 4B7UA 1VGQA 1R6VA 3DKKA 3H0CA 4G5YA 2YXNA 3VU0A 2I8CA 2YQ5A 1WJGA 2EF0A 3DE0X 4MCJA 3D3JA 1SXJA 3VNBA 4DSOA 1EXWA 2BBSA 1LA2A 2FSUA 3EUWA 5D2CA 5THXA 1HNNA 5AXDA 2N42A 1AXEA 1Z2NX 4N3GA 2K2QB 3MINB 3JQPA 2NSLA 3H2BA 4N54A 3OTQA 4Q4DA 1B43A 3DEFA 3L0SA 4TKUB 1RXUA 5DASA 1Y1TA 3DUFA 3GCDA 1NVTA 3L0BA 2IBTA 4PZLA 1Z0FA 3CZ9A 1Q0ZA 2J3KA 3WMEA 3K35A 1GVHA 3KQWA 3M82A 4BRWA 1TZKA 1KEKA 1CUIA 3DYBA 5EMMA 1K9SA 4WLFA 5U1PA 4DRXB 1RWOA 1TLFA 4GGPA 4F5WA 2Q2VA 1RAFA 5DBOA 4HG2A 1QZ3A 2VJAA 1MEEA 1XCGB 4MR8A 1H2YA 2HXYA 3KQOA 4E5MA 1TUEA 4M55A 3UV6A 2AYZA 2VYNA 2GKSA 2X5KO 3E0QA 4DIMA 1TTQB 2O2ZA 3P2JA 2EBHX 3DE5X 3H11B 4YJFA 3A9WA 5A0FA 5I7HA 1TM4E 1H2AS 1UM9B 2VLIA 4KN8A 1E9DA 4OATA 4MQFB 5DNVA 4RH1A 1R6AA 3L0PA 4DCTA 1PYGA 2Q6VA 2QVCA 3JYOA 3KQYA 4L0DA 3ZPXA 1XDWA 4BLVA 4GXQA 4EPVA 3MJCA 5T64A 1YHYA 1EVIA 2QWXA 2YINC 3QEOA 3GJRA 1E2PA 3H5NA 5DCUA 3ER8A 1G6KA 4K9DA 4AF8A 4CV1A 1SEPA 1UXOA 2O3TA 5C0OE 4DV3B 1Y7TA 3PWSA 3G3EA 4L9WA 3GK3A 3SPXA 4QUBA 1NYRA 4TYQA 4B7ZA 3K0CC 4OV6B 1CUBA 3K71B 2REBA 4TUYB 3IEPA 4PPYA 4WZAE 5IEJA 4EB6A 3AR2A 2NUTA 4EG3A 3HE3A 1HZZC 1MC5A 4V1CB 4LF5B 4B44A 1SVOA 4RXMA 4D81A 2CDRA 1F8FA 4Z9BA 4W9RA 3R74A 3U7EB 1NKSA 2C9CA 4YJ2A 4QGSA 3ANLA 1ZEJA 2O8NA 2P40A 1VL6A 4F8JA 3LCJA 1N2XA 3OVMA 4WXYB 4EBFA 2NO1A 3HJAA 4H7IA 5FOSA 1KERA 1MH1A 2YMMA 3H5VA 4PTZA 3VZDA 2QMEA 3GNLA 1G8KA 2IELA 3ILSA 3VBCA 1UFKA 4GPZA 2PZMA 4GG1A 2BN4A 2P91A 4NKRA 4RZ3A 5GP1A 3U61B 3OQMA 2JLZA 1VIAA 3K1TA 1KMCA 3SX2A 1B73A 1FTWA 1USVA 2X5NA 1J42A 3D0OA 3GZJA 5JS6A 2X6QA 3DMPA 4NE9A 2CWDA 3GNQA 3D54D 2RGDA 2EP7A 3CN7A 3HKEA 2J08A 3FUUA 1Y6FA 3PX2A 4GR5A 1IHPA 1UIMA 4NCXA 4BNDA 2FA9A 2VDWB 3W2GA 3SEQA 2AJLI 2JD1A 4OYHA 3M6AA 1EZ4A 4XD7D 3K5PA 3GKBA 3F6SA 2NTYC 2XXBA 2ALJA 5JSYA 1LDBA 4AIIA 3A3PA 5D86A 4EHNA 5C80A 4O29A 4BP3A 3M2TA 3HM2A 4RCNA 4RF2A 4HDMA 3DYIA 1QQ7A 3ORRA 3B1ZA 1C9JA 5KTPA 1ULBA 1TQDA 5HUHA 1VCHA 5JMPA 2ZAIA 1XMOB 1L3IA 1Y8CA 1XWWA 4GAEA 3QKSB 5LZ9A 2B1RA 3HA2A 4U3JB 4KWHA 4WZBE 2O54A 2W2QA 4HRVA 1QGDA 4EITA 4JUIA 1Z6PA 3T1VA 3ZTYA 1Z62A 1JEAA 1YZLA 3FGNA 3K1AA 5K8LA 2AJCA 4C7XA 4XA8A 4JLWA 5KO2A 3KYIB 3L7LA 4EX6A 3R5FA 2M6LA 1F17A 3B7GA 1E1QA 3BB4A 4YJGB 1HA3A 2XH8A 5TARA 1BJRE 3OPVA 2NU6A 2WHEA 4Q47A 4DLTA 1JG3A 1EFLA 3HRXA 4B6EA 5J2TB 4HDRA 4BIMA 4DV6B 1QF9A 3NTOA 3F3MA 2WM2A 5C4MA 4XARA 4CQLA 4F6RA 3OZ7A 2P6PA 4Q4HA 1KBOA 1RI2A 2ZP1A 4JQYA 3S2YA 4X71A 3RAPR 4ZCRA 4IKEA 1ZOOA 1RAGA 1YRWA 3CUUA 2BJHA 1ZHHA 1CF2O 4ETIA 5F7XA 4LG1A 1GUAA 4PPFA 1TI7A 4XSVA 2CFOA 3EOZA 2CLIB 1M6WA 1NXQA 5AJZA 3VSAA 4EUKA 4PNPA 4OL9A 2IKSA 3D8SA 5KWVA 2VBIA 2WC1A 4KFTA 2QRNA 3U40A 3M6MA 1MPXA 2AIRA 2H85A 2NZJA 3H18A 4I8IA 3VHLB 5I7EA 5JZVA 1PQUA 3W05A 1R5JA 1AJEA 1NPDA 1O95D 2OGUA 1Y4ZA 2NACA 4W8GA 1DIOB 3OIVA 3EGOA 1D2MA 4ZANA 2DPLA 4A7PA 1U28A 2G77B 4JT8A 4RHXA 3CZQA 2YMLA 4OLAA 4KQEA 1J09A 1BDHA 5DHUA 4O4HA 1OB5A 3LCUA 5CEFA 1AUQA 1FEZA 2YN0A 3DPUA 1ADJA 2W2MA 5AK4A 5C46F 4RY8A 4AY2A 5TQ0B 4ECEA 2L17A 4Z8YA 3IKJA 1F8UA 1NONA 3T7DA 2R0QC 1J8YF 1I3LA 4G1VA 1GV1A 3Q2IA 2PA0A 4FTWA 3GGCA 4OMRA 3KV1A 4BO0A 5CDUA 2ASEA 4DE5A 4P31A 1IHDA 2ABWA 5FLKA 2BKEA 3W4KA 4A91A 2CE3A 3OQHA 3ZHBA 5TF0A 5IAAA 3CZPA 1I3MA 2H8KA 3WYDA 4JYMA 1KMHA 4GI3A 4KX3A 3B20A 1VA5A 1A4XA 5CEJA 1EXNA 2WYHA 3KT6A 4UCFA 3RFCA 1U0BB 4COKA 1ADYA 1U1DA 1Z35A 2GS9A 3P4YA 4P38A 3LPMA 3LW8A 2PM8A 3GB9A 4Z51A 2W2LD 1Q22A 5CVVA 2QYOA 3DJAA 4UKDA 3LBAA 5FO0A 1HMPA 3IQIX 1ZFNA 1OX4A 3CRQA 5DF1A 5C1BA 1U7PA 3DQQA 5J4LA 3STAA 2R8XA 3LXUX 1EUCA 3MB5A 3MYYA 3EA0A 4ZAWA 4DCNA 4X62B 3FFBA 4N5MA 3D8HA 2I8AA 3KZCA 3BWMA 4G5FA 3TIIA 5LWHA 3O26A 4OGFA 4MWDA 3H7AA 4H08A 3EMDA 2IEAA 5JYCA 2HZ7A 2IHBA 2VT2A 4MGZR 3H2YA 3LF1A 3F71A 4BLSA 1Y81A 1PNVA 4GECA 3FCYA 4EHJA 2ZJ5A 3RSQA 1EFVB 2OAEA 3OEHD 3GZ4A 3R5HA 4EG7A 5DU6A 1KFBB 2OY0A 2W0MA 5GV8A 4W5JA 1TC2A 1EK1A 5EJAA 3MPUA 2ANCA 1G5FA 1V5EA 1VFNA 4J49A 1PSZA 3NCHA 3H0SA 3TW0A 3AXSA 2VNAA 2XA2A 3EVNA 4BFLA 3I8OA 2ZI6A 5LOVA 2X8JA 4TN1A 2VJDA 1R0XA 4NCJA 2O2XA 1EFKA 2W8BA 4BVHA 1E1CA 4XWOA 1GNQA 3CUWA 2W2PA 3PTLA 4MR7A 5BRNA 4YMHA 2B4KA 1Z45A 5D00A 5T4BA 2FJUA 3O93A 2MSNA 3NBYC 3QBDA 1TIKA 1U8AA 1RNLA 5FHQA 2LR0A 2CD9A 2YXPX 3ROZA 3RVOA 1ZH0A 3T1NA 4PNZA 2NPOA 2ZIGA 3ESZA 3OMXA 2R6FA 3RU9A 4DGQA 3ZWKA 1XTTA 4JXKA 1OU4A 3NBZC 2R8OA 1B42A 4K9RA 3HLKA 3REQA 3WWEA 5FNZA 3BE4A 4LVOA 1Z37A 2XMSA 4F5DA 4PBRA 2PBLA 4NBKA 4ZO6A 3TFOA 2EJBA 2X24A 4D7AA 2IXTA 5FJIA 2OPHA 1SXPA 3DBHB 4O5OA 4O4IF 4P7JA 3NNDA 4RS4A 3NT5A 5DGXA 1E3QA 3ZXSA 4LE1A 4EWLA 4YUYA 2IU0A 3PQ7A 5TB5A 4CQJA 2Z57A 1CB7A 3L8DA 1UMBA 3E6AA 1DHRA 1VIDA 3N2GB 2OZLB 4W7IA 4WY8A 3RASA 4NXNB 4BUJA 2BTEA 2FSHA 4AO8A 4TM8A 3EXG2 5B55A 1EF8A 5FOXA 3ZWXA 4DQUA 3I1FA 3OFVA 5AKEA 5EXPA 3VNAA 4CPDA 1LBEA 2IYAA 4KQ6A 1E2EA 4WKGA 5ALOA 3KYJB 1YZHA 2R5FA 4JCOA 2Y76A 3D7RA 1KSJA 4BV3A 2OKGA 3W5UA 9GPBA 4P0TA 4G1UC 4ZKEA 4BFSA 3GL9A 2CMKA 2ZFUA 4IIUA 1CZOA 5LZ4A 5CFNA 3S81A 1KS2A 4K8OA 3ZWAA 1CDEA 2QYHA 2XR1A 4NSNA 3WO0A 2OYCA 3DV0B 4F2GA 3GLMA 2A94A 2E6UX 3O8QB 4OSOA 2Q8NA 2AXPA 4LQCA 2FR8A 4KIWA 1VSQA 2H1OA 2Z3VA 1KK2A 3BIJA 3FHLA 1YZFA 3EAGA 3L01A 3PDIB 3QBJA 4X85A 2JAPA 3UCFA 3R6HA 4MQLA 1GPUA 4FNMA 4JA0A 2B8NA 3C3AA 1GRNA 3EUAA 4C3UA 4MR9B 2MU1A 1UPAA 1CETA 2PSHA 3ISTA 3SIPA 1HKHA 3X1XA 4JCSA 2AZDA 4YVFA 2PIDA 3ZDAA 1AZSC 5BV0A 4F91B 4K03A 1T10A 5CA0B 5K3EA 3OZWA 1ABEA 4GGOA 1V47A