3ZW9A

Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with (2s,3s)-3-hydroxy-2-methylbutanoyl-coa
Total Genus 271
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
271
sequence length
723
structure length
723
Chain Sequence
GSHMAEYLRLPHSLAMIRLCNPPVNAVSPTVIREVRNGLQKAGSDHTVKAIVICGANGNFCAGADIHGFSAFTPGLALGSLVDEIQRYQKPVLAAIQGVALGGGLELALGCHYRIANAKARVGLPEVTLGILPGARGTQLLPRVVGVPVALDLITSGKYLSADEALRLGILDAVVKSDPVEEAIKFAQKIIDKPIEPRRIFNKPVPSLPNMDSVFAEAIAKVRKQYPGVLAPETCVRSIQASVKHPYEVGIKEEEKLFMYLRASGQAKALQYAFFAEKSANKWSTPSGASWKTASAQPVSSVGVLGLGTMGRGIAISFARVGISVVAVESDPKQLDAAKKIITFTLEKEASRAHQNGQASAKPKLRFSSSTKELSTVDLVVEAVFEDMNLKKKVFAELSALCKPGAFLCTNTSALNVDDIASSTDRPQLVIGTHFFSPAHVMRLLEVIPSRYSSPTTIATVMSLSKKIGKIGVVVGNCYGFVGNRMLAPYYNQGFFLLEEGSKPEDVDGVLEEFGFKMGPFRVSDLAGLDVGWKIRKGQGLTGPSLPPGTPVRKRGNSRYSPLGDMLCEAGRFGQKTGKGWYQYDKPLGRIHKPDPWLSTFLSQYREVHHIEQRTISKEEILERCLYSLINEAFRILEEGMAARPEHIDVIYLHGYGWPRHKGGPMFYAASVGLPTVLEKLQKYYRQNPDIPQLEPSDYLRRLVAQGSPPLKEWQSLAGPHGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords PEROXISOMAL BIFUNCTIONAL ENZYME
publication title The Isomerase and Hydratase Reaction Mechanism of the Crotonase Active Site of the Multifunctional Enzyme (Type-1), as Deduced from Structures of Complexes with 3S-Hydroxy- Acyl-Coa.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 271
structure length 723
sequence length 723
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.50 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3zw9A03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3zw9A02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3zw9A01
3TT7A 3KSDO 4RPKA 1PU2A 2WD8A 4YDRA 1E7MA 5IDYA 4CMIB 2DPHA 3RU7A 1X7DA 4E5NA 1KEUA 1P45A 3BAZA 3I9MA 2ZJ0A 3JYNA 5J23A 1ULSA 3TZCA 1I2ZA 2GERA 3FTPA 3U62A 5KKAA 3ZNNA 4AJPA 1NHGA 5AVOA 4BVAA 3G1UA 4P4LA 3TJRA 2JAHA 2W8ZA 3DBVO 3AU8A 4M87A 1BSVA 1VL0A 4RCVA 4K6FA 4P8RA 1LX6A 1PJ4A 1XQ1A 3X2EA 2D2IA 1HXHA 1R0LA 5MDHA 2JAPA 4XYEA 3RJ5A 2ZYDA 4MVJD 1A7KA 4BKQA 3H3JA 4YAKA 5KJ6A 3WYCA 3QXZA 5HM8A 2ZIZA 2C5EA 3ONDA 3KYDA 4YRDA 2PZMA 4CMEC 1B26A 1P74A 3F1LA 4ND5A 1LTHR 2C59A 2Q46A 5F21A 4GLOA 3NDIA 4YT2A 2ZQYA 4J1SA 2A9FA 1FDSA 3SC4A 5FUSA 2FZWA 2GO1A 2F6IA 3GR6A 1FC6A 1GTMA 1TLTA 3K31A 4MOWA 5T64A 5G4KA 2PV7A 2ZYAA 3SJUA 3WYEA 4XKJA 2P5YA 1ML3A 5A5FA 1RM5A 4HUJA 1C1XA 1SOVA 4IUYA 3PQDA 2EP5A 2GDZA 3FF6A 5L51A 1HYHA 3KTHA 3AJRA 3DC2A 1UAGA 3DAPA 2BGLA 2J5RA 1DFIA 3CINA 1ADBA 3U4DA 3OP4A 1GFSA 4Z9YA 4KMSA 3E9MA 1H2BA 4WPGA 3DTYA 1LU9A 1PGQA 3LU1A 1LQTA 3GOHA 1YB5A 4U1AA 3WWYA 3FNEA 1GAEO 2P68A 4YJHB 3C7AA 4LMRA 2OBYA 1Y7TA 2VWHA 4J7UA 2X8LA 1XNYA 4IDGA 1ID1A 4YRBA 3D3EA 3GN1A 5T67A 3RI3A 1A5ZA 4PVCA 2YQ4A 4FBGA 4LMPA 5EESA 3I9NA 4BO3A 4EJ0A 4JCRA 3GA0A 5EMHA 2D59A 4DGSA 3WJ7A 3OECA 4Y98A 4PCVA 5LC1A 3KYCA 2RH4A 1KVSA 3PIDA 1GEGA 2O3QA 4U6SA 4YVFA 1PWZA 2NSDA 1GPJA 4NBTA 3H2SA 3RC2A 2GLXA 4E2YA 1EF8A 3QV1A 2RH8A 3PI7A 4OKIA 5IN4A 2ZL4A 4EZBA 5I7FA 1IULA 4XYBA 3ASUA 4CMGA 1VJTA 4BO0A 3PYLA 4KDFA 4WECA 3JQEA 4XQEA 4EMMA 4I1IA 3ZWPA 2JD1A 5IG2A 1BXZA 2YUTA 5KIAA 2XF8A 3HE2A 1LSUA 3H6KA 4CMAA 4BGUA 1P1IA 5BQFA 1J7XA 3IAVA 4BO2A 2J5II 2Q99A 3S55A 1YXMA 1PQWA 2EKLA 3AI3A 3MZ0A 4PIVA 1QORA 1G6KA 4QEDA 1L1FA 3PVZA 2OP1A 5C37A 2DFDA 2FPGA 1YG8A 4F6CA 5KJEA 4KWBA 5E0SH 1GYRA 4J90A 4UVEA 5TLSA 2WD7A 1QRRA 3E9QA 2UVDA 4GKVA 4IXTA 1G0OA 1QYVA 4HFJA 2Q50A 1I3MA 2QG4A 3BZUA 2ZATA 2A92A 1MG0A 1XQ6A 4Q3EA 4RLSA 5L7YA 4GWGA 1P77A 3F3SA 1Z74A 3PE8A 2HK7A 3RASA 1WDLA 5DF1A 1YQDA 4O5OA 1P1KA 5TT0A 3UGKA 3WTCA 1XU9A 4AICA 3LAOA 2YV2A 2B83A 1RM0A 9LDBA 1ZJYA 1D7OA 3TWOA 4LVUA 2AHRA 3KSUA 3NRCA 1E6UA 1E3WA 1GADO 1ZZEA 4ZQBA 5DL1A 3VPHA 1YB1A 1ONNA 3V5NA 4OXKA 3HB4X 4ZICA 1YBVA 1PWXA 3PLRA 1XSEA 2Z1MA 3RBZA 3DO5A 2VRCD 5A02A 3NGLA 5T5QA 1V3VA 5AYVA 1N9GA 2W90A 4BNZA 4F6LA 1JLLA 3VHRA 2BZRA 2VSUC 2OXIA 3IUSA 4JBIA 5JAMA 3U4CA 3ZI0A 2HO5A 3QWFA 5TIIA 1RYDA 2ZL0A 1VL6A 1BTOA 1K6JA 4YJDA 3VC7A 1GQ2A 1ADFA 1MP0A 2D3TA 3C1AA 3IJRA 3AUAA 3U09A 3O8QB 4YWJA 1GCOA 5KVQA 4Y8VA 4XZ3A 3WLEA 1FCFA 3KTIA 4JWVA 1X14A 2VHVA 4BHTA 3M6IA 2P2SA 4IJVA 2HDHA 3NDRA 3QY9A 1GUYA 4W9NC 4FPXA 3H0UA 4K1LA 1P0FA 1CIVA 3B1FA 1HSOA 1O94A 2UUPA 3PGJA 4BNFA 3MJTA 3DFUA 4NHEA 2QRJA 4CM8B 2YJZA 1CEQA 3WNVA 1O9BA 1NFRA 1SG4A 4I9HA 1E7QA 4H7PA 1EBFA 4D3DA 3F4BA 3O03A 4NG5A 5THQA 2B4TO 1V9LA 3DBHB 3QVTA 1EK6A 1B7GO 4QECA 3K50A 5A3VA 4A5OA 4FZWC 4RQUA 1U9JA 1BWSA 5IZCC 3KOUA 1BXGB 3SLKA 1N6DA 5L3ZA 5DP2A 3D7LA 4RCNA 3TRIA 4PG7A 3RBVA 3OJEA 2JFFA 3R0IA 4WEOA 4RPLA 4A2CA 2FR8A 5A3JA 2CDBA 3NT4A 6LDHA 3KEOA 3Q11A 4JQCA 2E49A 4ILKA 2EEZA 4NZ9A 4E5KA 4GSKA 4MIYA 4QFDA 1ISGA 1CYDA 1JDJA 3PP8A 3R6DA 1LDGA 1ZEJA 2ZQZA 1PS9A 4BNTA 3IJPA 4IS3A 4B4VA 4Q3CA 3SVTA 3K6JA 2I9PA 3RVDA 3OICA 3ANLA 3T88A 1KBZA 2G0TA 1K5HA 3K30A 4PLPA 1LDEA 2E48A 3A9WA 4NU5A 1HE4A 3EAGA 2P9CA 3C85A 5K6AA 3FSRA 4M1QA 4DPMA 3JQAA 3NUGA 3H9GA 4EGFA 2UUOA 2JL1A 1MA0A 3HDHA 4LRSB 1ON9A 3DBLB 3STHA 1NNUA 2HSDA 5JDIA 1NAIA 3O9ZA 1QV7A 1UR5A 3CZMA 2FBMA 4O63O 2IXBA 1ZSYA 2D5AA 2FMUA 1YDEA 1KYQA 2DLDA 1JWAB 4PLWA 1UDCA 1EFLA 4D41A 1H94A 4LVCA 3SX2A 4NJMB 5G0WA 4CMIA 2X7HA 3ROQA 4FD3A 3ZWBA 4BIIA 2A7SA 4OO3A 1GZ4A 3KYBA 4MO2A 4B3IA 1Y6JA 1I2CA 3LT4A 4JXKA 5DZKH 4RV9A 4AVYA 4UEKA 2GZ3A 5GY7A 2G82A 3ZU2A 5C7OO 1Q7BA 1VPDA 1NFFA 5CDTA 2I65A 4AJOA 3JQ9C 1EF9A 1Z6ZA 2AA3A 1DSSG 3R0OA 2O3SA 5U4QA 4FCCA 4L4RA 1X15A 3GVIA 4L4XA 3S1LA 4XGIA 3PZBA 2E82A 3AFNA 1YDWA 3MJEA 1YRLA 4O1MA 4P4NA 3ITDA 2Q1WA 1EZ4A 4JK3A 4J7XA 1HE3A 4JVTA 1EE9A 2O3RA 1MX3A 5L4LA 3OEYA 3U5TA 1C0LA 2BHLA 4XGKA 1N1GA 2O2YA 3WS7A 4XJTA 3AOEA 4RYFH 4MP6A 4E30A 2CVZA 2B69A 2Z5LA 4E5YA 4AJ2A 3R9QA 1VE9A 5AQ1A 3WR5A 2DM6A 5FFFA 1WDKA 3GAZA 4I5EA 1SO8A 4N18A 3M2PA 4JOTA 5HRUA 3VKVA 2NNLD 3HFGA 5IFLA 5HTOA 1PS8A 3I4CA 3NTRA 4CUJA 1TB4A 3JD3A 3MTGA 4GMFA 1UZNA 4OIMA 4ND3A 4Q3AA 5K9ZA 4OL9A 2PFGA 3H0QA 1E5QA 2CDAA 5JO9A 3ROKA 4MP3A 9LDTA 1N5DA 4GX2A 4J9VA 4YA6A 2P9GA 2BF7A 5IDXA 4MVJA 5F3RA 5KJCA 2B36A 4YQZA 4R3NA 5DU6A 5BSFA 4K2NA 3IS3A 1E5LA 1LBEA 4ZA2A 1H6AA 3T8BA 2NUAA 3KZVA 4YJHA 2PWZA 3FCOA 3R9TA 3ISAA 3WGIA 3LYLA 4KUEA 1M6WA 2EW2A 1EDZA 3FNFA 1Q2XA 4Q39A 1T2DA 1KS9A 3AM3A 3PTZA 3QSGA 4YQYA 4AJEA 4HWKA 2XPCA 4F3YA 2YW9A 3RSHA 1K39A 4KP7A 4XYGA 1T24A 4NQZA 1JKIA 2CF6A 4ND1A 3H3FA 1HDOA 5JC1A 3QLJA 3KYDB 2QYTA 4DLBA 2W2LD 2AQKA 4D7AA 4N5LA 4II2A 2EGHA 1JAYA 1I8TA 2CBYA 4CM4A 1WP4A 1DC4A 1WW8A 4E31A 2Y1DA 1TG6A 1XX4A 5E0NX 2X0JA 4A0SA 2NU6A 2V7PA 2Y99A 5KJFA 5L95A 4BOYA 3I52A 1E7YA 3V1YA 5G4KB 4E6PA 4INAA 2P4HX 5DTPA 1LLCA 5CP8A 3KXDA 5AXDA 3RUDA 1JN0A 1C1XB 2F6QA 5ENVA 1P9LA 4XEHA 4EBFA 4BNIA 3UXYA 2DUUA 1RJWA 4QXMA 4DYVA 1NXQA 3LVFO 2VX2A 3QMJA 4G2RA 1GL3A 1L7EA 4UUNA 3I9KA 5TJHA 2QYSA 3UN1A 4IIUA 1DBVO 3NJ4A 1AN9A 4IJWA 2GRAA 4ZDBA 4DC1A 4W7IA 2FSSA 3P2OA 3Q7HA 1TVEA 2DTDA 2OHXA 3EUWA 3PYMA 1PJSA 1ZJZA 2HJRA 4YT4A 2X1HA 1ORRA 1Q0HA 3OA0A 5BT9A 4DC0A 4DQUA 4R3WA 3WB9A 5CEEA 1ISHA 3BMOB 3ROMA 4RF2A 2OZPA 1HE5A 5A9RA 2VSUF 2Q1UA 4NR0A 3KYCB 3C1OA 3ROPA 4OQZA 2IEBA 3UUWA 2FN7A 4A26A 3WMWA 1EBUA 1QLJA 1X0UA 4WLUA 3F46A 4ONEA 1D4FA 2O3UA 3DZIA 4IZDA 1PS0A 1CERA 4U0KA 3T4EA 4J0EA 4JP2A 1YJQA 3D1LA 4E13A 3RUCA 1P1JA 3E5MA 5B1YA 3ANNA 4EMLA 3RFXA 3GF7A 3KV3O 2IZ1A 3TL3A 5I7VA 1U3VA 2WJPA 3QWIA 3ZW9A 4P4GA 5C7LO 2DPGA 3IAHA 3DR3A 3BXXA 3IQDB 3MJVA 4RORA 1R6DA 2X5KO 4K3WA 4ESOA 4CUKA 2PY6A 1C14A 2OMEA 3B6ZA 1X1TA 3QE3A 5TS3A 2XXBA 1KVQA 4MKRA 4FJ2A 4Z0MA 2NTJA 4ZJUA 2Y0DA 2F1KA 4CMCA 3ORFA 3N58A 4LSWA 4ASIA 2E6UX 2WD7B 3G0OA 4FS3A 3JD0A 4KD6A 4MVJP 3COSA 2DTEA 2H6EA 1B8VA 1BHSA 5KOIA 3M1LA 4WLVA 2YDYA 2YFQA 2UYYA 4PN3A 2GGSA 2Z1NA 2V6GA 1UDBA 3DOCA 1E0DA 3CXRA 3P2LA 1C0IA 1NHWA 3WOHA 2VRCA 1U4OA 3JYLA 3IKTA 3O26A 3WX0A 3WGHA 2GYYA 4PG6A 2DTXA 1MB4A 3ADOA 4FGWA 3I6IA 3A14A 5KNLA 3QRWA 1DLIA 4Y6PA 2Y93A 2JJYA 4E33A 4L74A 1SBYA 2O48X 3HJAA 4XJSA 3T3WA 1E3WB 1PQUA 1C0KA 3GPIA 4XX0A 5G0TA 3T8AA 1I10A 2VYND 3S2IA 4EITA 3VH3A 3B1JA 4UEOA 4R9RA 2VN8A 1IYZA 1T2CA 3CPSA 1U2GA 2I3GA 4JSBA 2B0JA 2BKAA 4J3FA 2C7VA 4ALNA 4WASA 4XYMA 4GM2A 1JW9B 4BKUA 1BGVA 1F14A 4ZDFA 4CMHA 2IZZA 3AW9A 1LXCA 3ZGYA 4JFCA 3GMDA 1V3TA 1NAHA 2RAFA 1MC4A 4OQYA 3NV9A 3WSWA 4BKRA 4BL5A 3JD1A 3KEQA 4FN8A 3G49A 3DJAA 4XYLA 1B3RA 3ICCA 4ND2A 1D1SA 4YJFA 3UCFA 4WOJA 4WLOA 4BQRA 1DCIA 3MOYA 3L4BC 3PHJA 3T4XA 2FWMX 3E5RA 3PYXA 5C9GA 4RVDA 1VC2A 4CLRA 2I3AA 3LQFA 3EZYA 5DU8A 4Z0TA 3IIEA 4BO1A 3FBGA 3L6DA 3MJCA 4NJMA 3TL2A 2HLPA 2O3JA 2IRWA 2EJ5A 3NJBA 2VWPA 5K6AC 1OFGA 4PG4A 2ZTUA 3VTFA 2AE2A 2POQX 1XYGA 2YHUA 4DIOA 3BPPA 1EFKA 4L75A 1O8UA 2JKVA 3SBOA 3H5RA 3GVXA 4YR9A 4L8KA 3HE3A 4U0GA 3FPCA 1GCUA 3WG5A 3CMCO 4RPJA 1NQOA 2ZTVA 4BNLA 1I3NA 3D5TA 4ALKA 1DLJA 4E2WA 1FC9A 4FN7A 3SJ7A 3IMFA 1LDNA 1Y9AA 1XDWA 3MEQA 4YAIA 3KTGA 3JQ8A 1MUUA 4W82A 1V8BA 4DRYA 1PJ3A 5FWNA 4PLZA 2CFCA 2X24A 2ZJ1A 4LCJA 4Y6SA 3B20A 1YO6A 4CV2A 4ITUA 3VZRA 5JYEA 3ZNQA 2X22A 3WBFA 1BG6A 1YGYA 3LT2A 3H81A 2JFGA 2NM0A 4FFPA 4MKXA 3SLGA 5G0UA 4Y9DA 4TRMA 4RPHA 1WNTA 2IYPA 1ZXBA 4B4OA 1XO6A 5DKPA 4JP3A 3QHAA 3P85A 4PFJA 3I5MA 3L0DA 3EYWA 2Q2WA 3PEAA 5K0ZA 3ZU4A 1VJ0A 4NIMA 1GU7A 5L4NA 1SZOA 4R69A 2DFVA 2PH3A 3H9UA 3JQGA 4QUKA 3I23A 2QQ3A 2B35A 4QFEA 4PG8A 1Q7GA 5T6BA 4ZRMA 5CDSA 1XEAA 4YACA 3ZWAA 2Q35A 2QX7A 3DHEA 3Q2KA 4RF4A 4BO8A 1GV0A 2C07A 3AOEC 5FIFA 2OORA 2OBNA 4GHNA 2G5CA 2DBQA 3D4NA 2J3KA 3HWRA 1QYWA 4L4SA 2PH5A 1ISJA 1DRUA 2X86A 1GZ6A 4R41A 3RUFA 4PLHA 2X6TA 1E3IA 4GH5A 3W6ZA 3I4FA 1N6FA 2VQ3A 4P38A 1EEHA 4QIJA 2ZB3A 1QXSA 4CM9D 2J5KA 1NPDA 4R5MA 1PL7A 1KY4A 3DL2A 1FXSA 1KOLA 2ZB7A 2Y66A 3WLFA 1JKJA 1LUAA 3KHUA 1UZLA 4OJNA 4M89A 3VPSA 1G0NA 3QVWA 2LDXA 1Z73A 1E92A 3I1JA 3NAQA 4A27A 4Z6KA 5INFA 4FB5A 3WWZA 3B70A 1PGPA 1DIGA 3D64A 2ZTMA 3JD4A 5IZ4A 1KY5A 5G0VA 3ZW8A 4CLEA 1U5AA 3QWAA 3RSTA 3VVBA 2G17A 4ROSA 4WZ8B 1HF3A 1QYXA 2AQHA 5JCJD 1DHRA 3VZPA 4YJGB 1H9AA 1KEWA 2ZB4A 2EHDA 1YE3A 2I76A 4RVGA 1OD4A 3GDOA 4TRJA 1TA4A 2GPTA 1W73A 1QG6A 2P5UA 1X1EA 5BSGA 4OH1A 1GPDG 1LLDA 8LDHA 1LLUA 4FGSA 3D4OA 3BEZA 3AUSA 1BRMA 1FJHA 1P1FA 4HX5A 4R9SA 2CD9A 1NPYA 3UAGA 3H2ZA 5JNLA 1YL7A 4JNKA 4RQTA 1HL3A 1ENOA 1Z45A 2W2LA 3DTTA 2O23A 3PDUA 5T57A 4X54A 3MJSA 4AJIA 2GCGA 5CFZA 3G79A 1JVBA 4Q0GA 5DP1A 4ZQHA 3ST9A 5DCYA 4RLHA 1KIFA 1YQXA 3IP1A 5DUFA 2PA3A 3JQ7A 5EQDA 2A4KA 5G1QA 3EC7A 1HTBA 4MKZA 4Z0HO 4W4TA 1QP8A 2VSSE 3BMOA 4BO5A 3IOYA 3DMTA 4K29A 3WGQA 3L9WA 4R16A 4KOAA 4B8WA 5B12A 3OJLA 5B37A 4CR7A 1K2WA 1RPNA 1U4SA 2H9IA 3ZWVA 3WMXA 3R1IA 2RHRA 3QIVA 4CM4B 2J5QA 3ON5A 3G1TA 3MWEB 3FN4A 4MVJG 2R00A 2FR0A 1IUKA 2X0IA 4BUCA 2NU8A 4AJLA 1TI7A 3F5QA 3JV7A 4IIVA 3H9JA 4ZQEA 5I9LA 1PEDA 1T4DA 3BHJA 1YONA 2VWGA 3E18A 1ONPA 3S2FA 3UOGA 2TMGA 1YS4A 2PZKA 3E82A 3GK3A 2OP0A 3WJAA 3VH2A 3VPXA 1DRWA 2WEKA 3KM0A 2J3JA 2J5SA 3S2EA 2YV1A 1N7HA 3HDYA 3PJGA 4DYDA 1HLDA 2P4QA 4G65A 4R4JA 3RIHA 4II3A 1AUPA 3GNTA 4H3VA 4KWIA 3EY4A 5A5EA 4I8XA 1NWCA 4XRRA 4B3JA 3D3WA 3GVCA 4GLLA 4ALLA 5A1TA 3TZ6A 4MVJH 1R4MB 1ZFNA 3FRJA 4CMBA 3E48A 4BV8A 2WYVA 1R4NB 4OYRA 2F9IA 3RROA 5CDGA 3GFGA 3ZV3A 1B8UA 3H9QA 1Y8QB 3G3EA 2Y1GA 3ZZNA 4BGVA 2IDZA 3SXPA 2HAEA 4GI2A 2J5IA 3WDSA 5COBA 3AI1A 3BMCB 3TDKA 1SOWA 1XNWA 1SB8A 4BO7A 1AE1A 4MIOA 1RM4A 3CEAA 3QREA 3BMNB 3NX4A 3V2UA 1OC4A 4JJFA 3IP3A 4B79A 2Q2QA 5HA5A 1E7WA 4DL9A 4OGWA 4FFLA 3WYBA 3DORA 1FK8A 4IM7A 3ZHBA 1OI7A 3INRA 1KERA 3DOOA 1A9ZA 2H1SA 5DOZA 4D0SA 1YBAA 3DAFA 5BR7A 1LA2A 3DB2A 4H16A 1EVJA 1ENYA 3JD2A 4RVSA 7MDHA 1NQTA 3WIEA 4JROA 5CTBA 4HFRA 5JXWA 4Q3DA 4J4BA 1PIXA 2IZ0A 4NFHA 1CQIA 3AI2A 4E32A 3PHHA 2ZCUA 5T8KC 1XELA 2C2XA 3MCVA 3OETA 4M55A 4MP8A 3GGOA 1I2BA 4AFNA 3A4VA 5ES3A 2DQ4A 4E2ZA 4I42A 4IGFA 1PZEA 2VYNA 4FOSA 3WQRA 4I5FA 3OF2A 4BNGA 3OMEA 4U0JA 3PK0A 1E1MA 3SEFA 1OMOA 1ZEMA 3NGXA 4BNMA 2VYVD 1DIRA 4EMPA 3PZRA 4L6WA 4CUZA 4E21A 2ZL2A 2GUGA 1X0VA 4XD2A 3DOJA 3WICA 3OQBA 1JKFA 1ZK3A 5JS6A 1IOLA 1CF2O 1GUZA 2QRKA 4O0LA 4DMLA 3AM4A 4J4HA 1I32A 4AJJA 1ENZA 4XA8A 3L4SO 3ZHXA 2FOIA 3RAJA 5HS6A 3QKAA 5JAZA 4Z9XA 2DT5A 1OAAA 3LLVA 3CIFA 3AY6A 1YJ8A 4UVHA 1TT5B 4ZHSA 3KETA 4HNGA 3PHGA 4ZN6A 1U7TA 2VHXA 5F1OA 1J4AA 2NU9A 1AXEA 3K8XA 2ZCVA 3JYOA 2YHIA 1JTVA 1LI4A 2Q3EA 4ZGWA 3VTZA 4OXYA 3UFXA 4PZCA 5JSFA 3WNQA 3KTDA 3HZZA 1A71A 3ST7A 3PZKA 1HNUA 2FPIA 1E1LA 3AOGA 4K9DA 3DBRA 4PG5A 3VZQA 1AGNA 5HS4A 4I5DA 3PJEA 3MOGA 4EDFA 4U0HA 2PKRA 2H5LA 1YBMA 1O5IA 4YJFB 2RHCA 4B7CA 3OMLA 3M2TA 4ZDEA 4WCFA 1Y5MA 4CLRB 1U8XX 5JYDA 2NVUB 4PZDA 4W6ZA 4ZQFA 2GZ2A 3K73O 3H8VA 2X9GA 3CTMA 4D0RA 1E1KA 5CEFA 2CUKA 2O7SA 5JDCA 1DIBA 4IINA 4MVJF 2EG9A 2JCXA 1DIHA 1FDVA 4HC8A 1ISMA 4R1UA 3I9LA 2CVOA 3PQEA 2GZ1A 5JPIA 2J3IA 4Y67A 1B0AA 1PJCA 2J6IA 1IHYA 4RDHA 1W6UA 4FJ0A 1XHLA 4XQ9A 4CQMD 5I8WA 2Q1SA 4NJOA 5I7SA 3DONA 2ZL3A 3L9XA 3TRRA 4DREA 2FRDA 5CHEA 1YL6A 5H82A 4AG3A 1NP3A 3FNGA 3ZWMA 3JQ8B 4NPCA 4BMVA 1DXYA 5HWSA 1ZVMA 5EPOA 4YTEA 4I9UA 3ZWWA 4TVBA 1F0YA 2RCYA 1I3LA 1AHHA 4I9NA 4NU6A 2Q45A 3C7CB 3VDQA 3INGA 3NJ8A 3M6NA 4R5HA 3WGTA 4BB6A 1EQ2A 3NTQA 2JD0A 2SCUA 1BW9A 4OKNA 1PGOA 4BNUA 4M86A 4YAJA 3S2GA 1CJCA 2JHFA 1PR3A 1YL5A 2VHWA 5IDQA 4PLFA 3RUAA 4RVFA 2O4UX 4MOUA 4XDZA 1PGJA 4YJGA 3H0JA 2PTGA 3JQGB 3U49A 3N7UA 3TVWA 1QV6A 4FOOA 4IQGA 3CSDA 5C90A 4IDEA 4BNJA 3OEWA 3GNQA 3N74A 1ZXLA 2FZSA 4FFMA 4J49A 4WNCA 2OFPA 4JJTA 4Z0PA 2D8AA 4CV0A 3QWBA 2HMSA 1LEHA 4R1SA 1O8CA 5AXCA 4BGIA 1VL8A 1HZJA 4UEJA 1JU9A 2YY7A 4TZKA 3LT0A 2CF5A 2FHSA 2PLAA 1Y5RA 4NEKA 4WCZA 1HSZA 1E3EA 1D3AA 2C29D 2HK8A 4DIBA 5KVSA 3AY3A 5IXSA 4ID9A 2PPYA 5JCJA 2AQIA 3WGGA 2CMDA 8ADHA 2AG5A 1NYTA 3PJFA 3GN2A 3V5EA 4FJWD 1Y81A 4U0GH 3H02A 3BIOA 1PIWA 2ET6A 3VZSA 3FR7A 3QP9A 1LQUA 4I4ZA 1UUFA 3V2GA 5L45A 1A9YA 3NDJA 4IXWA 4PGFA 2G1UA 1BDBA 1JXZA 1DAOA 1YB4A 2W2KA 4ZD6A 2X0RA 2NV6A 3HB5X 1DC6A 3JU1A 1NFQA 4BKPA 2NVWA 1OOEA 2QZ9A 2I99A 3CE6A 3QW2A 1A4UA 1PGNA 2BGKA 3T89A 3Q0JA 4QFCA 2VHZA 1K0UA 3I9OA 3U9SB 4I52A 3HRXA 1TT7A 2AMFA 1O0SA 3DZFA 4ZQGA 2EERA 1WZ8A 1SB9A 4EEXA 1UP6A 1PSDA 1UJMA 3ZWOA 5KJ1A 1FDTA 4J16A 3U9TB 1A72A 1XA0A 1WVGA 4CPDA 3GGPA 4PRLA 3U3XA 5KVVA 1XLTA 2A94A 1I5RA 3Q9UA 1E3JA 5JAIA 1ZK2A 3OT6A 2R00C 4UUPA 2X23A 2XXJA 4NNJA 1PZGA 3PFFA 2HUNA 2CE3A 4O6VA 2I5PO 2A81A 1GR0A 3W6UA 4D45A 3TLFA 5A9SB 1I36A 2V6MA 3M6MA 1Q7CA 4Z3KA 3JQ7B 1R4MA 3P2YA 4MI2A 5DUCA 3KVOA 4YXFA 1R4NA 1HDGO 2WMDA 3H7AA 5ITVA 3IL2A 3VVCA 2HRBA 4ZDDA 4OOFA 1CWUA 1LSOA 3MOIA 1Y8QA 2DBZA 1ZK0A 3KB6A 3PIIA 4DLLA 1P44A 4ALIA 1ADCA 1JWBB 4FFRA 3BMCA 3ETGA 3WGZA 4D42A 5JE8A 1JA9A 2C8TA 2NP9A 2VOJA 2AXQA 4U7WA 1O6ZA 4CR6A 3TZ3A 1PL8A 3BMNA 2OOSA 1E3SA 4J7CA 4UUOA 3H9EO 5AOVA 3DEYX 3V2HA 4GBJA 1ZNQO 2BI7A 1UXIA 2VSSA 1P1HA 4IMPA 5IXYA 3AY7A 1NX6A 5DBIA 1OZAA 5DULA 1LDBA 3RRVA 1NVMB 3FNHA 5C5IA 3ZU5A 4EUFA 5L9AA 3MT6A 1P31A 1H9BA 5CPFA 1PQPA 4PLYA 2CDCA 4WUVA 5F1PA 1I33A 4WKGA 1J0XO 4A73A 2WSBA 3D5QA 5I9NA 3L6OO 2PKQP 4RGBA 4J6FA 4CM1A 4DQXA 3NT2A 2FW2A 1LRJA 3ASVA 4BMSA 3OJ0A 2NQ8A 2ZB8A 1A7AA 2Q4BA 5KJPA 5L53A 3GRKA 3HSKA 2QW8A 1W0CA 5DDIP 3GEDA 3ZV6A 1LDYA 2RBEA 4CLOA 3HADA 2GN6A 5TC4A 2PKQO 3HG7A 4JBGA 1PL6A 1TXGA 1PJLA 2CVQA 3G17A 5JMPA 4WE3A 4B7XA 1M75A 3PLNA 3NEPX 3D3WB 4CQLA 3K8ZA 4C7KA 4DA9A 4C7JA 1E6WA 1FF9A 4IZBA 3PXXA 2YYYA 4DTIA 2F9IB 1VSVA 3BHMA 4LN1A 4E3ZA 4NBVA 4WOKA 4IDAA 4GX5A 1IE3A 4NMHA 3TOZA 1KC1A 1NZYA 3UH1A 2J5IB 4FC7A 4KTTE 4TQGA 2VTEA 3EZLA 3TN7A 4FNDA 3PPIA 1L7DA 5CDUA 4TWRA 4CLDA 4OSPA 3UICA 3TT6A 5I8ZA 2B4RO 1RM3A 4LK3A 2F9YA 4QT0A 3INTA 2W3PA 1P3DA 5ER9A 1JVSA 3I9JA 1UYRA 1ARZA 3QVXA 3FD8A 3JSAA 4GPD1 4YT5A 3ULKA 4L73A 1TT5A 3DZKA 3DZJA 4K28A 3IC5A 4ND4A 5BNIA 1CRWG 2UDPA 1HYGA 3WBBA 5A05A 4Y6RA 1EE2A 2B4QA 4TMFA 1W4ZA 4BQPA 4D79A 5TGDA 3UCXA 1ZIDA 3H5AA 3GHYA 2I6TA 5C3MA 1SEPA 3QVOA 4M8SA 3BMQB 4D46A 5INGA 1MFZA 1IZ9A 1R66A 4A10A 1J49A 2EW8A 4HADA 1HLPA 2Q1TA 4XWYA 1F06A 1IY8A 1U28A 5FI3A 4ZDCA 1TEHA 2Y1EA 4TKLA 2IODA 4GX1A 2C2YA 1M2WA 3GDGA 1N7GA 3RKUA 4IPTA 3VH4A 2Y67A 4HP8A 4ZU2A 1ONOA 2V6FA 1HWYA 2NVUA 4N54A 4GX0A 1O95A 4L76A 3PGXA 5KDRB 5GZ3A 2GTRA 4IZHA 4B3HA 3GGGA 1XG5A 1ZMOA 1EVIA 2WDZA 3EVNA 4JJGA 4KUHA 3TSCA 4OMRA 4CLHA 2PGJA 4E12A 5BSHA 5EL0A 4BNWA 2BMAA 3JQCA 1GY8A 5FYDA 3W4KA 4YYZA 1UYTA 3LT1A 2EKPA 4AJKA 3LDHA 4WCFC 3JYPA 5JDIC 3FWZA 4CM6A 1ISFA 3V1UA 5ICMA 2DUWA 3H0SA 1EVZA 2BFPA 3OJFA 2ZYGA 3Q2IA 3PQFA 4CODB 1S7CA 1DHTA 4ALJA 2HQ1A 3PHIA 3TV5A 5JDCC 3OSUA 1SZJG 5JO0A 4GGOA 2EIHA 2YDXA 3LSYA 4HKTA 2FP4A 3CKYA 2XAAA 4E5MA 1MXFA 3JQAD 2YHIB 4G5HA 4YRAA 1NM5A 4JYJA 3HDJA 2AEFA 1D1TA 1U2DA 3F5SA 2EXXA 4U6QA 2G76A 2ILTA 3HN7A 1UYSA 3U4IA 5EN4A 1UXKA 2BD0A 3ANMA 4MIEA 3DBRB 4CM5A 4F47A 3TZHA 1H0KA 5A9TA 3GG9A 2HMTA 1K3TA 1NQAO 5I9MA 4CQMA 1C3VA 4WCFB 1H6CA 4HXYA 3S8MA 5U1PA 4YLHA 3EGOA 3R3JA 4A7PA 1AXGA 1UDAA 2X4GA 3V5IA 1EMDA 3PEFA 4WLFA 3VH1A 1HEUA 4KQXA 3ZWXA 4RO0A 5ICSA 5L7TA 2EKQA 1PTJA 3GEMA 5JY6A 2HCTA 1B2LA 3GLQA 2EP7A 3GRPA 3GZ4A 4I5GA 3KQFA 3AU9A 3PRJA 3VAZA 4JCQA 2EWMA 3GT0A 3V8BA 3RJ9A 1K6XA 1I01A 1X13A 4QQRA 5DCUA 4MPDA 1VKNA 3PWZA 3WIDA 1X7HA 5EJ2A 4PLVA 3HNPA 1ZBQA 2HU2A 1E7SA 3QA9A 4QTZA 3H4VA 5EQFA 4U19A 2D5CA 4EEZA 4CMKA 5AXBA 4NDNE 4G2NA 4GAEA 4KQWA 5LCXA 3W8EA 1FDWA 4FFNA 4OG1A 1DO8A 2B37A 1U3UA 4DBVO 4BO9A 4O59O 1SAYA 3ZDFA 2O50A 3GZNB 1OBFO 4J2HA 3NKLA 1KVRA 3PDJA 1DC3A 1BW9B 2V65A 4CLXA 4PRKA 2NQTA 4KTVE 1GV1A 3RUHA 2QIOA 3C1TA 3RBXA 4Q3NA 1SEVA 1LLQA 2JCYA 4CM7A 2EJVA 4BS9A 3WQQA 4CL8A 2B5VA 4XIJA 3U4HA 3F4LA 3LC7O 1GQYA 2E4AA 3E8XA 5JAQA 3IBBA 1B8PA 1ENPA 3TF5A 2I66A 1R12A 4WCDA 1N2SA 3OQ1A 1Q0LA 4L0QA 1KC3A 2WE7A 4GL4A 3QK8A 1QYDA 4YBZA 4RVHA 2GN9A 4AJNA 3KRTA 4XCVA 1Y8RB 1H6BA 1Z7EA 4LRTB 3TNLA 5I7EA 5CPBA 2O2SA 2Y1OA 2GNAA 5A9SA 4XRGA 5L7WA 1YOVA 4ELXA 5TQVA 1MXHA 4YPOA 1SPXA 1E6EA 2EGGA 1IL0A 3FTNA 3JQBA 4Z3DA 1RJNA 4XQCA 2X9VA 3STAA 2CZCA 4FNBA 1B16A 2VT3A 1HZZA 2WYUA 4FQ8A 3UKOA 3N6RB 2BRUA 1WAMA 3VOSA 4IQ8A 2Y0CA 1F12A 2W98A 5IN5A 1XR3A 4GGPA 1XNVA 1QKIA 1KETA 2BH9A 3DMYA 3WQSB 1J5PA 4TRRA 1FDUA 4QO8A 3WTBA 1KVUA 3ADPA 4JX8A 1CQJA 1R15A 2AQ8A 3IUPA 3ONFA 4KZPA 3Q1TA 2PZJA 2UZFA 5U9CA 1IHXA 1PJ2A 5DBGA 3GUYA 5A4DA 2W2KB 4DBZA 1LSSA 3VDRA 1F8FA 5DNAA 2ZK7A 2CY0A 2OL4A 3DDNA 1UYVA 3PGQA 1FC7A 3VIVA 2PD6A 1ZH8A 5TT1A 4Q1IA 2HKIA 1UIYA 2DBRA 1KEVA 1GQQA 4BNHA 2O3TA 4MDHA 2Y1CA 2C7GA 5ADHA 2VUUA 5CDYA 1HDXA 1WDMA 3MTJA 1BDMA 4OOEA 4YCAA 3RCBA 4DWVA 3UCEA 3RFVA 2VCYA 3ZNPA 3WFIA 5THKA 1Z7BA 4N5NA 3UW3A 1YG6A 3BYZA 4RF3A 1RYEA 3GLMA 1U5CA 3OFSA 4JGBA 2NTNA 3FR8A 2PG8A 2IEXA 4LK5A 1O89A 3O4RA 3UVEA 4CR8A 2NVBA 4K6CA 4E2XA 3SC6A 1LRLA 5LDHA 1QSGA 4ALMA 2Q49A 2E37A 4MXIA 4GKBA 4NBUA 2HJSA 3DHNA 5B4UA 5EIOA 4U8GA 3LF2A 2VSUE 5BSEA 1MLDA 3OH8A 4ZU3A 4GSLA 2WE8A 2R2GA 3KTKA 3MJ4A 2C82A 1WZEA 4GQAA 1ZSNA 2PR2A 4IDCA 2WTBA 1T2FA 2AEJA 1HZDA 1J6UA 4EJ6A 2X0NA 1ADGA 1Q52A 4FN4A 1ZMTA 4OAQA 4DPKA 1LC3A 1B14A 1SCUA 3JQDA 4J9UE 4YB8A 4DPLA 1MG5A 1DB3A 4BB5A 1SMKA 2OUIA 2VNAA 3P7MA 4Q9NA 1HYEA 3QWHA 4I08A 3HINA 5F5LA 1WMBA 1Q1NA 2FY8A 1U3TA 3OA2A 5BNFA 4BNYA 5GZ1A 4R01A 2HMVA 2IE0A 1GDHA 1PX0A 2LDBA 3OIGA 3PJDA 4UVDA 2BELA 3K96A 4CL3A 3BMQA 3GVPA 5ILOA 5TNXA 4AJ4A 1WPQA 4CLOB 2F00A 1JQBA 1GZ3A 1Q0QA 2EF1A 2JD2A 2X5JO 3DFZA 4XR4A 3RSIA 2YV3A 1XGKA 4CQLB 1Y9EA 2P9EA 1N8KA 3ETEA 1DPGA 1DEHA 1HDYA 3GFBA 1GYQA 1EUDA 3E6AA 4CM3A 1HDRA 5KDRA 1QMGA 4RJTA 3L77A 4EW6A 2JHGA 4FSHA 4J0FA 5DTWA 1MC5A 3ZV5A 4TRNA 1YKFA 3RC1A 2QQ5A 3SLLA 3WGYA 2GR9A 1E77A 2VRBA 5JFOA 1NZYB 3ZH2A 1YWGO 3U9RB 4XB1A 1VM6A 4U18A 1DC5A 2NACA 2VNSA 3GF4A 3ZU3A 3H65A 4IZCA 3ZV4A 1W2XA 3P5SA 5FEUA 2F9YB 2FSVA 4FDAA 3RKRA 1VI2A 3Q0EA 3W8DA 4CMJA 1N6EA 1NR7A 4LISA 2VHYA 2FZEA 3GDFA 1NPTO 1KEPA 4LSMA 4QX6A 5H83A 1LJ8A 4UUMA 3AUUA 2O4CA 2VZ0A 3E1KA 2FR1A 3PHLA 2R6JA 4LW8A 5G2OA 2HK9A 1PJTA 2GN8A 1LRKA 4JJIA 3BTOA 1WZIA 2CNBA 1WWKA 1PZHA 3ENNA 1NASA 2D4AA 4J1NA 1GUFA 4DUPA 5AXAA 5JY1A 4BO6A 4P22A 2WYWA 3K92A 4HFNA 2A7KA 5CAEA 1DRVA 2PD3A 4WGGA 4W99A 3HFSA 3L4BA 2DKNA 1HETA 3I3OA 3LC1O 1JAXA 1RWBA 3GG2A 5JLAA 3R6HA 3E03A 5L4SA 4PVDA 4J1TA 4BNXA 4CJXA 1DUBA 1SNYA 3DAGA 3Q1LA 3D0OA 4IDDA 1K89A 1XU7A 4KPKA 5F5NA 3KUXA 5DT9A 3DWFA 4B4WA 1T2EA 4HBGA 4A03A 1B15A 3DZHA 4JCOA 3NJDA 3GNSA 1T2AA 4R51A 2RIRA 3W8FA 3GHHA 3HUDA 4E0BA 3I47A 3IDSA 4TROA 1C1DB 4PLCA 1F17A 3OBBA 3L3SA 2JFHA 4U5QA 3W1VA 3KLMX 1P0CA 2AEMA 3KTJA 3HHPA 2ZQRA 4IMRA 4DI1A 1WXDA 3JQFA 1K32A 2FPPA 4XR9A 5F1KA 3GH3A 3HQ4O 5B4VA 5G1RA 1NVTA 2EJWA 1K6IA 1DFHA 2AG8A 1MFPA 1QYCA 3QJ5A 1ULUA 3GZNA 4W7HA 4L8VA 3HP0A 3NT5A 3U0BA 4J43A 4BO4A 4G81A 5CG1A 4OXNA 4QO7A 2YFHA 4AL4A 4S1VA 3FPLA 1IPFA 5A03A 4WEQA 2VWQA 4RL6A 1E7RA 3V1TC 1ZKMA 3CH6A 2PNFA 4KWHA 4NK4A 5TSDA 2J5GD 5IKLB 3FBTA 1DFGA 3D4PA 1F8GA 1MV8A 3JCZA 3NYWA 4KDEA 4DVJA 1PJBA 1UH5A 3Q9NA 4CQMB 4XGNA 2X5OA 3EMKA 1R0SA 4CM9A 2VT2A 5G1SA 1VLLA 1VSUA 1Y1PA 4D44A 1HT0A 1DAPA 3ABIA 4XIYA 1X0XA 4MVJI 4HNKA 3TVUA 3MYBA 1GD1O 3E9NA 3VPGA 2BI8A 1Y7OA 2IEDA 1HNOA 3GPDG 3F9IA 3GY0A 3Q3CA 3K5PA 3OJOA 5KKCA 3DHYA 1Y8RA 4PZEA 4QIIA 2AE1A 3TPCA 3F6YA 4HNHA 1EQUA 1NTOA 3TQHA 3R9SA 4EJMA 4TZTA 1EDOA 3OC7A 1AHIA 4MVJM 1E1NA 2VUSA 3GAFA 5G0SA 2Z95A 5E0SA 5IDWA 1LDMA 3RD5A 5L40A 5JBIA 5KTKA 1IB6A 4B8ZA 2VTDA 2WWRA 1VRGA 3B1KA 1YQGA 1UAYA 5TJ9A 3FHLA 1T26A 1DDOA 1T1RA 3I83A 2D0IA 3BA1A 2PK3A 4B7UA 1Q51A 1M76A 2ZQQA 3BF0A 3BTUA 4J4TA 1U7HA 2Q34A 1IZ0A 1EUZA 4J1QA 1UP4A 3AUTA 4HFMA 4CMEA 3K2BA 1H5QA 1ZO8A 2HRZA 2Q2VA 4JBHA 4MINA 4HY3A 1NBOA 2C54A 4IDFA 3WSVA 3ZHZA 5BNTA 5MGBA 3JQBC 4UVIA 3JQ6A 3QWDA 1BMDA 2C20A 3F47A 3FF4A 3LZ6A 2VSSF 4XB2A 4CV3A 3DMTC 4PLTA 4BNNA 1ZK4A 4FFOA 4OHUA 4DIFA 4PLGA 4JCTA 4RVUA 5ILGA 4OLQA 4IJKA 1PZFA 2BFAA 5JW6A 4R1NA 1T1SA 3LF1A 1MGOA 2C5AA 3RUIA 2VUTA 1V6AA 2DAPA 1PJHA 2GD1O 3C24A 3DZGA 2DVMA 4GWKA 5HBRA 4BNVA 1DIAA 1PR9A 3DZBA 4B4UA 1UXJA 2GF2A 4NH4A 4RZHA 1DJNA 5KWEA 1HKUA 1H93A 1T4BA 5JBWA 3CUKA 4AJHA 1WMAA 1CETA 3P19A 1E3LA 5CTCA 3U9LA 3PWSA 3ENKA 4IJUA 1YOVB 3NTOA 2VOEA 3KBOA 1RJMA 4RZIA 3WXBA 1BXKA 4NBWA 3K2EA 1EVYA 2P91A 3FDUA 3OIDA 1IPEA 3KLPX 4FJ1A 5DCWA 5B4TA 3CMMA 1Z82A 1XWFA 2NADA 4WLEA 4E4YA 2PGLA 2VZ9A 3LC2O 3Q0GA 5C7IO 4BV9A 3C7DB 2Y1FA 4LCEA 1LNQA 3VKUA 1GYPA 3ZWYA 5JBXA 3HN2A 4BGEA 2HMWA 3ZWNA 3OHSX 1SC6A 4WJZA 5EINA 1UXGA 1XIVA 3FI9A 4WK6A 1NR1A 2NU7A 2PBPA 4IGEA 1LC0A 1QR6A 2H63A 2UAGA 4M49A 4UAGA 4JN6B 3EHEA 2HMUA 2J3HA 1CDOA 4J91A 5JMWA 3K9QO 3TZKA 3AFMA 5GZ6A 4YAEA 4C4OA 3QXIA 2Y0EA 1H2HA 3PFWO 1DOHA 3LLSA 1P1RA 1NWHA 3ZN2A 4RDIA 1ON3A 1V35A 1B3BA 2DC1A 2JCVA 3UF0A 3AK4A 4GVLA 3ONEA 1I30A 3KO8A 3T7EA 1S6YA 1NQ5A 2Y05A 4KNPA 2BFMA 2BGMA 2XOXA 3GUCA 4JIGA 3UHAA 3W4JA 2QRLA 1RKXA 4H15A 2VREA 3QYRA 4R68A 3GEGA 1M6HA 3TFQA 3ETDA 4UREA 4XQGA 4UVGA 1R16A 4FB8A 1D8AA 1EUCA 1VJ1A 3O8QA 1I0ZA 5CG2A 4GVXA 5INIA 3GQVA 3ICPA 2NLOA 3GKBA 2QHXA 1C0PA 3G64A 3TOXA 5COQA 4S3MA 1XCBA 3IKVA 4RF5A 3EVTA 1A27A 1MJ3A 2PZLA 3F1KA 3ZWCA 4BNKA 4R54A 1BVUA 1U8FO 4NI5A 3IB9A 4F45A 4IBOA 4D3SA 1ZSVA 3JTMA 1YH3A 5DZSA 4OM8A 2NWQA 4CM8A 3RFTA 3ZCXA 2W4QA 2TMDA 1V3UA 3TFOA 3A28A 4TSKA 3Q6IA 4AJ1A 5DZKA 1T25A 3GMSA 4UULA 5DOVA 2YQ5A 3RWBA 4EYEA 5TRTA 1R0KA 1W8DA 2OO5A 4K26A 5DBFA 3P5MA 1P33A 4NBRA 4HV4A 3A06A 5LDGA 3W4IA 5ER6A 3O38A 3DBHA 4EUEA 1OC2A 1KVTA 4LGVA 1ZK1A 5DN9A 3ITKA 5FI5A 3RC7A 1OD2A 4NFSA 4NK5A 2NTVA 3BTVA 2VSUA 4WYOB 4FC6A 4JYLA 3LK7A 3H5NA 4DQVA 4BKOA 4TKMA 1BXGA 1R37A 2X58A 3TDCA 4IY1A 3RU9A 4NNQA 2VYVA 4XDYA 4IQ0A 5ITWA 1YVEI 1A4IA 3BHIA 5IJZA 3C8MA 1WLYA 4IS2A 2B5WA 2J8ZA 4W9NA 2ZKLA 3EDMA 5T8KA 1LSJA 5G4LA 2PD4A 1EY3A 1N9GB 2A35A 4J2OA 4RYFA 3C3XA 4FW8A 3MFMA 3WFJA 4ELSA 3HDQA 1UZMA 1DJQA 2EV9A 1NVGA 3KSZO 3T7CA 3OIFA 3RUEA 2GASA 3GC6A 1ZUD1 4YT8A 7ADHA 5EERA 4R1TA 2CSUA 1GEEA 4N7RA 3FWNA 3TZQA 3I6QA 1M67A 1HDCA 3GF3A 3QVSA 4D3FA 3GMAA 5KVCA 2QZZA 3LKEA 4Q3BA 4FZWA 4TVOA 4JCSA 1X7GA 4IDBA 1C1DA 3DBLA 2BLLA 3OQ6A 5CEJA 5IZCA 1VRWA 2GN4A 2Q4EA 4URFA 3ZHYA 1G1AA 4E5PA 4EUHA 2C0CA 5IF3A 3WG9A 3RQSA 2Y68A 3CZRA 1HRDA 3X2FA 2GSDA 4WLNA 4NFYA 3EK2A 3L07A 1U3WA 4OSOA 3WGOA 1FMCA 4KUGA 4IZIA 2UV8A 5DU4A 3BTSA 1UXHA 5GMOA 5TF4A 4GMGA 1ZCJA 1PJQA 2V6BA 3JYQA 2O7QA 2ZTLA 2BFOA 5A06A 2IYOA 1XKQA 1Z75A 3OM9A 4L9RA 5FF9A 4YAGA 4RPGA 5JCXA 5KCZA 3HLN1 3QQPA 3VPFA 3ZNOA 3L6EA 1UP7A 4QSMA 4D43A 5A04A 3DQPA 4MJLA 4DLAA 2DU8A 4N5MA 3RC9A 3JQFC 3AM5A 4EI2A 3DXFA 1I24A 1M66A 3M1AA 4FIZA 2DBVO 4BMNA 2HW5A 5TX7A 2VZ8A 2AW5A 4Z9FA 4M54A 2Q2XA 2DEOA 2DUBA 1VKOA 1U1IA 5COAA 1V0JA 2PGDA 4YEDA 3GVHA 2X9NA 4CV1A 5JC8A 1N92A 1N1EA 3PWKA 2IXAA 1H6DA 3SWXA 2WM3A 1HE2A 4F46A 4DXHA 4ZRNA 3EW7A 4ZVVA 1ISIA 4OMUA 5H81A 1EK5A 3JQAB 4DMMA 1TYFA 1ZW1A 2D1YA 2I67A 4MVJE 4JLWA 1I3KA 1HDZA 4ELWA 2OGUA 1BVRA 3R3SA 4WNIA 1QLHA 3A1NA 3JQ9A 5IAAA 6ADHA 3MWDB 2YZ7A 5ENDA 4FR5A 3AWDA 2J5GA
chains in the Genus database with same CATH superfamily
3ZHXA 1M6NA 2PX2A 2YBEA 4HNQA 3ZWKA 4YDRA 3I5YA 3AF3A 1Z2EA 3VM6A 1NW8A 2DSNA 3LPLA 4RKQA 4LYDA 1NYQA 1ULSA 2YWCA 3FXAA 4QDUA 4NS1A 2ZJFA 2QM8A 4UDOA 1QG4A 3PD0A 3U62A 3GLGE 3SF0A 2G88A 1NHGA 2B9EA 2FUKA 5AVOA 2NSYA 1UKBA 3AIOA 3DBVO 3PWTA 4PW0A 3SGLA 2O07A 1A9XA 2R4QA 5DI3A 1BN7A 1NATA 1EYZA 1CRQA 1OROA 1QG2A 3M5CA 2C2HA 4IHQA 3T35A 3X2EA 4W5QA 1HXHA 1R0LA 3P1JA 2JJ8A 3RTCA 3S2YA 2Z09A 1YR9A 1ZIPA 5DTQA 2DFPA 4BWYA 2EDAA 3OZFA 4Y0NA 4F71A 2ZZNA 2HRQA 3LW7A 2ZBPA 1DKMA 4KDCA 4CETA 3TSOA 4XYEA 1T13A 3LUKA 1G5PA 3UENA 1A7KA 3R3ZA 3N8NA 3WYCA 3QXZA 1GZDA 1L4BA 1SXHA 2QW1A 2R6R1 3KYDA 4YRDA 1J20A 4OQLA 4CDNA 1THMA 1QYIA 1R2QA 1Q50A 2PZMA 3MUOA 3QUCA 4TWJA 4D9EA 1HO3A 1W35A 4DHEA 2J87A 3L0PA 2O0JA 4EQ6A 4HT3B 3B3AA 1P5JA 3FY4A 5FADA 1KZ4A 3FCYA 2A9FA 7AT1A 1JVNA 4KIJA 5D86A 2GDJA 2DJIA 3SSOA 2GO1A 1NVDA 1OI4A 1U0SY 4PF1A 3PA8A 4Q02A 1FC6A 1TLTA 1R6XA 2ODNA 5IYZA 2HN9A 5G4KA 2ZYAA 5KC9A 3T12A 1Z4PX 1TJ4A 4L85A 3WYEA 2HDNB 1AKQA 2CUTA 5F23A 4HUJA 4QUAA 2G71A 4JVNA 2ZGVA 2R0QC 3NJRA 4J3JA 4RJJA 3PQDA 2EP5A 1AQYA 1VYVA 2GDZA 4Q4LA 1SWVA 5L51A 3KQNA 3BGOS 5ALUA 5KX5F 5LMNB 3JZIA 3OP4A 1XL1A 5BN3A 3T3PB 4Z9YA 3OY7A 1G7CA 4Q9KA 3RIXA 3EGDA 5LQCA 3VZCA 1XXHA 1K4YA 5LZ5A 3Q8LA 3BIWA 5GV7A 5EC8A 4EHJA 3GOHA 5HFJA 2CJFA 1N2BA 4U1AA 1RYNA 1RXYA 4OY3A 3TAHA 4YJHB 3V4SA 2ZVQX 3LUAA 4LMRA 2CBZA 1XNYA 1R3DA 1ID1A 3T9BA 3D3EA 2BGNA 2FG5A 5FL7D 2PXCA 5TQ0A 1JDNA 1YRWA 2P3QA 1TOAA 3WK5A 3WSTA 5BW4A 4PVCA 5HXAA 4MHTA 2YQ4A 1TPZA 1TMOA 5ULLA 4TUYB 5EESA 1FRNA 1OA0A 2ZI5A 3IAS1 2DR3A 3F9CA 2FUNB 4OG2A 5EMHA 2D59A 3PUIA 1BMQA 4ISCA 2WWWA 4L7QA 2WI8A 5LC1A 3GARA 1YNOA 4YDSA 3JVDA 3B3QA 3IA2A 4XVRA 5AM3A 3QXJA 3U3KA 2O3QA 1IIBA 1PWZA 3MNFA 2W0MA 4TYWA 2NSDA 2D8MA 1RVV1 6REQA 4YYEA 2PLWA 1HA3A 2JGAA 1SKAA 1TYAE 2LR0A 2R66A 3AFGA 3LQRA 3N8KA 1NLUA 3H0EA 5IUJC 4DCUA 5IN4A 3SJZA 2FX3A 4RHTA 4FFVA 4EZBA 3AUFA 2C3YA 3B6MA 1CZRA 3ASUA 3C15C 4CMGA 3PYLA 3R5XA 2XXAB 3OQHA 4QYIB 4DJ5X 5IG2A 1X92A 5KIAA 3OZUA 1GLVA 2ZULA 1OKKD 2A9RA 4OQXA 2IELA 2Z9CA 1G8MA 3STYA 1J7XA 5E4YA 4EG3A 1U9IA 2DQYA 3IAVA 1GGNA 1YXMA 3RYHA 3OFVA 3H2BA 1P6UA 1QORA 1CRPA 2IHJA 3KJNA 3MWGA 4QEDA 2IS4A 1V41E 5EKSA 4ZI7A 1T9GR 2FPGA 3GQBB 2R1UA 4DIEA 2BFCA 4POAA 5KJEA 5E0SH 2PQ6A 4ZVOA 3E9QA 1QRRA 3T61A 2UVDA 1C5KA 2AFIB 1CUDA 1MABB 1SU8A 1WKBA 2WHPA 1SCQA 1I3MA 3PA6A 1OPRA 3IPYA 4GKJB 5L7YA 3VAAA 2JNWA 3F3SA 4AU1A 3EVZA 1SXQA 2E5LB 2GX6A 4QBKA 1ETHA 3RYIB 1KOJA 4MYRA 1V9CA 1QQ7A 1YQDA 2WIAA 3UGKA 4YJ3A 4AICA 2OC9A 3Q3GE 2JLVA 2FLKA 1W5EA 4CEHA 3G0DA 3H4MA 1GDTA 1JLKA 3EGVA 3KOOA 2ZWIA 3NHPA 1ATIA 1D7OA 1MX1A 1XCPA 5EP3A 1DKUA 1NE7A 4J0KA 4QUIA 1GKIA 1GADO 2IY9A 5DX1A 5ADUS 3P0IA 1L6IA 5REQB 2WIKA 4EGJA 3HUTA 2IPLA 2HA0A 4WZ6A 1KGDA 3CYFA 3PLRA 1YBVA 1XSEA 1JEJA 3PXCX 5JMOA 1R5JA 2AFVA 5AYVA 2EFYA 3L0ZA 1AGXA 2BISA 3DE3X 1JLLA 3HBNA 3IMGA 3TM4A 3VHRA 4F6LA 2I9KA 4PZZA 3HA3A 3IUSA 3U4CA 1JR4A 4FGJA 1FFAA 3QWFA 1HDEA 1RYDA 1VL6A 1BTOA 4MUJA 4TYNA 2VA9A 1GQ2A 1KL7A 2O5VA 1U5BA 3IJRA 4JQYA 1EUCB 3O8QB 4OA8A 4UZEA 3W0LB 1GCOA 1MIOB 1RQ2A 2QI9C 1T9ZA 4HG2A 3R8CA 4O2AF 2VDRB 3WLEA 3NTUA 4JLDA 3M6IA 5FR1A 3AM1A 2C4TA 2P2SA 3OZSA 3S29A 2ZIWB 1EVLA 4ZVKA 4OP2A 3RF6A 4Z4HA 1N33B 4LY3A 1U28C 4K1LA 1O54A 4GR9A 3B1FA 3M6AA 1HSOA 1O94A 2UUPA 1Q3HA 3PC4A 1KE2A 4CM5A 4C04A 4LPKA 4J29A 2YWGA 1ID8A 1CS0A 4EGAA 4CM8B 1AN0A 4QT4A 2ODEA 1DQYA 1TVCA 3IV7A 1SG4A 4K2HA 1E7QA 1WDTA 1EBFA 3ICQB 4GPBA 1UEJA 3O03A 1JB9A 2LV8A 3AGPA 4ATNA 2B4TO 4TS9A 1E2PA 1TTQB 2ZBRA 2NYVA 4R9UC 4ZZ2A 2JF0A 3QVTA 5HSGA 5H4HA 2C9OA 1PYGA 4QECA 5A3VA 2VJQA 4A5OA 1W44A 2JFVA 1SXJE 3AB8A 1XU4A 1WSBA 3BWYA 1EB9A 1GPYA 3NLLA 1KI8A 5L3ZA 4X44A 4JP5A 5I7RA 3E7FA 3TRIA 4PG7A 2J48A 2I3BA 3RBVA 2SNIE 5ALVA 1M0EA 1TRHA 4ZT5A 1JJAA 1SKQA 3KAPA 6LDHA 4J0DA 1SCKA 3C3WA 2E49A 4NZ9A 2ZW9A 4E5KA 1QJ4A 2ZCJA 2E85A 4MIYA 1O2DA 2PSHA 4E7OA 1LDGA 2FW7A 3EPHA 3IQXA 5K4HA 2VT7A 1Y8CA 4IS3A 1M6VA 3NDBB 4KCGA 2FSUA 3T88A 5FULA 3OSZA 1MRZA 3ZOZA 4X3PA 3ZX4A 2OHOA 5BWCA 4TL8A 4OLFA 1KFEB 3WLLA 2XMCA 1RE1A 1G18A 3B1WA 4DLKA 4RSRA 4HRXA 1HE4A 3TIGA 2NO5A 3LUHA 1ECFA 4XD7A 3PXAA 1GGMA 2JIZD 3AF5A 4NYJQ 4ZT4A 5K6AA 3MTIA 7YASA 4RHYA 4C0AC 4D98A 3H9GA 1MTOA 2UUOA 4HDRA 4JA0A 4R05A 3STHA 4JQSA 5DEOA 1C9KA 5FO1A 1NNUA 1LH0A 1JEOA 1QTIA 1UBEA 1JQ5A 1NAIA 4H4EA 3UMBA 3S8EA 1UR5A 3CZMA 3AHGA 3AESA 4UM8B 3DEKA 1TCAA 1Q44A 2W93A 4G1CA 4PLWA 3GPCA 3EFOB 3QITA 2FHPA 4LRYA 1X2EA 4LVCA 3SX2A 2HBRA 1DEAA 5BYAA 1IJFA 1KO8A 4O4HF 2X7HA 2YC2C 4D26A 4V2UA 2A7SA 1GZ4A 2JGDB 2H07A 1RPTA 3KYBA 3W77A 4XDHA 1Q0UA 1F38A 3BRWD 1YJAA 4G2TA 1MJFA 4AVYA 4B8YA 5GY7A 2ZQ5A 2ZM6B 4JJ7A 2IQ5A 1ULHA 3C6ZA 1Q7BA 4MMYB 4ZGGA 5INFA 2V98A 2BYTA 4AJOA 1ECBA 4IAOA 2N0SA 1E69A 5FOTA 1A2QA 1NXVA 4K8OA 5GGYA 5FX2A 2O3SA 4D56A 1ULTA 4FCCA 2Z6VA 4L4XA 4OH7A 2GYWA 2PMCA 1UM8A 1XO1A 3PZBA 2RGUA 2E82A 3OM8A 1YDWA 2E4ZA 2A9KA 2NUBA 2OAEA 5AVXA 3IUMA 3N76A 4MV8A 5CT6A 2D1FA 5DV9A 3VKHA 1ML4A 3NHJA 5HKKA 4JB2A 4QATA 1M2GA 1XZCA 1FXUA 2WPDA 4JVTA 1EE9A 1SQFA 4OLJA 5K0GA 4FSXA 2HJVA 2O06A 3C3YA 3C6KA 1YI1A 3U5TA 1N1GA 5CBPB 1YR8A 4WFKA 4AJ9A 2YW2A 2HYDA 3AOEA 3E3MA 1OREA 5JS2A 5EE9A 4E03A 4MP6A 3PI6A 3FTCA 4E30A 5ITZA 1KOGA 3AINA 1BVHA 1VPLA 3EC1A 1O9GA 5HOEA 1VE9A 4JKIA 4FYYA 2HSGA 5FFFA 4Q3OA 1ATZA 1LGYA 1RKBA 3A26A 3N8DA 1YA4A 1KDYA 3OTQA 2O8DA 4N18A 3P32A 4GOND 4AULA 4D3ZA 1QCDA 4N0QA 4BVJA 4JOTA 4G8CA 1X6VA 3HFGA 5KNBD 3L7IA 1W85A 4JT8A 3S28A 5CFPA 3D8NA 4NG4A 3WLJA 2WJYA 3F7MA 3V32A 2IHVA 1YJCA 1C2YA 3LKDA 2BR5A 3Q3EA 5K9ZA 2V3CC 4M9XA 1MQ9A 2PFGA 3A1EA 5DNCA 4EZEA 1E5QA 1KYXA 3AHCA 3GAMA 5JO9A 4MP3A 1GA4A 3ROKA 1CJMA 4YUZA 1DG3A 1CE8B 2ZIFA 1YA6A 2RH5A 4YQZA 4FDVA 3K1TA 1TKBA 1HYBA 4MMZB 3BSFA 3PE6A 1Z3IX 5JNSA 2PEYA 2GVZC 2ZYWX 5LXTF 2X0DA 2NUAA 1EFHA 2ZUDA 3NEJA 1Q1GA 3TJZA 1BKSB 2SECE 4IVRA 3ETNA 4WX2B 4Y0AA 5DTMA 4X8HA 4KUEA 1OBOA 3CUSA 4IQFA 5CDFA 1OWPA 1GZUA 1Q2XA 1Y89A 3V9PA 1T2DA 4AMUA 3QSGA 3L46A 1C50A 1XD2B 2P1RA 3GZJA 4M1YA 3O4GA 1QWSA 2Q9AA 1CVIA 4F3YA 1AF7A 3RSHA 1K39A 1KK1A 3V00A 1T24A 2PRJA 4NQZA 3W5BA 3K2IA 4R83A 3GLGA 1HDOA 1I4OA 1V16B 2RE8A 8ABPA 4HZUB 3FHCB 4II2A 2EGHA 1F0KA 2M2IA 1JAYA 2JPDA 3AIIA 4ZOEA 5BSMA 4CM4A 1TG6A 4E31A 2Y1DA 4IQ4A 1P3JA 1BMFD 2QTCA 4F92B 4ADSG 2HPVA 2NU6A 1SKYE 4NDAA 5L95A 1KRXA 3UO8B 4W6QA 1JIUA 1PSZA 3PEEA 4WJLA 5GJWC 3C3JA 3HDVA 3L3BA 5J5VA 4C0WA 3KXDA 3K09C 3CUEF 2BHNA 4H1HA 3FYHA 1JN0A 3HACA 5A6SB 2X13A 4F04A 3U60B 2GPWA 5ENVA 4JMPA 3NVKI 1RYHA 1H2ZA 3LPCA 3D2CA 4XEHA 4EBFA 2P27A 3JAWA 3UG6A 4QXMA 4BNIA 4G89A 4F3NA 4CIWA 4JBNA 2YJNA 2O8EA 3MBKA 1BH6A 1C8KA 1THTA 5DYYA 5J9FA 2FG6C 2NYRA 3A6JA 4HUQA 1LW6E 4XIIA 5L3SA 5BN1A 5TJHA 2QYSA 4N5IX 1DBVO 5HE8A 4YQFA 2GXAA 5AKZA 3L5OA 2P3LA 1K06A 2I62A 4EY4A 4XPIA 3EUWA 4IDQA 1G21B 3CLTD 2ANBA 4AXBA 4GOJA 1KJNA 2JASA 4F7WA 4YT4A 2O8CB 2X1HA 2C0PA 2OCXA 3I01A 3LAWA 5IC5A 1IVSA 4R3WA 1D0VA 4DAOA 3IMKA 5CEEA 1Z8DA 2NZJA 2E55A 1RJFA 1IBKB 1L7MA 3GELA 2EKDA 4RF2A 1AKYA 2JHPA 3DW3X 1HE5A 3U16A 2VSUF 4ZDKA 4RS4A 4NR0A 5IHXA 1VRCA 2VDPB 3FUTA 3C1OA 3AZPA 4WAUA 2UU9B 3UUWA 3GWGA 2C5LA 4EA7A 1DNPA 4CCYA 1Q12A 4X8OA 4IRXA 4L72A 1A9QA 1JHDA 4NMLA 2FSHA 3TXXA 3AEKB 1NW7A 3PC3A 4WLUA 3VHXA 3W5VA 3L82B 4ONEA 4KFUA 1PS0A 1YE5A 5EKUA 3T4EA 4D0GA 3H7IA 5IVIA 3ZVKA 4EYSA 1J09A 4YMLA 2Q7OE 4DR1B 4KN6A 3RUCA 1P1JA 3E5MA 3EXFB 4OUDB 3ANNA 4BX2A 2C4KA 1WHSA 4EMLA 3R0VA 1UDXA 1BC5A 4EF4A 3GF7A 1U3VA 3QPWA 3ZW9A 1V26A 5K09A 4P4GA 5C7LO 1S8FA 3IAHA 3DR3A 4DBLE 3BXXA 4RW0A 3IVMA 1WW2A 1KEZA 4K3WA 3NANA 4ESOA 1RACA 3K1ZA 4AM8A 1J0DA 1CJSA 4BZZA 3G7UA 4R0NA 3QE3A 5TS3A 1QGZA 2L42A 3SSAA 4BAZA 1Y7IA 3W05A 1VHJA 2FEAA 1QHFA 2F1KA 2Y0DA 3BXPA 2I4MA 3GXOA 1DQRA 1XZEA 3FMOB 3N58A 4MR7A 4LZWA 3PEWA 2HV8A 4GZ6A 4IEIA 1BEEA 4KD6A 2QRMA 3COSA 3H0CA 2DTEA 4P5DA 5CCXA 1BHSA 1NJSA 4WLVA 1VYTA 4ZO6A 3WRYC 3HH8A 4DDMA 4Q9IA 1GT91 3TL6A 1AQJA 2EFDB 4N0PA 3DOCA 1C0IA 4Y1FA 3KIPA 3K2QA 2VRCA 3DC7A 3JYLA 3P2EA 4JB8A 2WICA 2IA5A 4Q4JA 3DPIA 3N2ZB 5BSTA 1IN4A 1E4VA 3WX0A 4AY3A 5J2TB 1UQRA 3IKTA 4PG6A 4EO9A 4P33A 3G2NA 1MB4A 3N2KA 3ZVLA 3KEGA 1NJ2A 2ZWPA 4Q21A 5E7MA 3S44A 4DEXA 1E4YA 4RD0A 4DY6A 3AVOA 4YCNA 1Q1BA 3R9KA 4XARA 2O48X 3HJAA 4XJSA 5F9MA 1BS2A 4YAUA 3T3WA 3PNMA 1P73A 4K46A 1C0KA 1JX6A 3H11A 5FOSA 1DC7A 1G8KA 2HA4A 5ALHA 1RQXA 2A4MA 3RVQA 3S2IA 1ISRA 2X7XA 2YCBA 3C5VA 3DXZA 1Z6GA 4XSGA 4EITA 1GPBA 4UEOA 4Q1BA 1J97A 1L1EA 1V48A 3LWNA 4O4IF 2JAWA 4FLEA 2DECA 1J0EA 1RVDA 1YI8A 2VBGA 3JRXA 3NAMA 4WASA 3KR2A 2I71A 1JW9B 3H87A 1XL0A 2WUFA 3SPXA 4CNQA 5EJ8A 2O14A 1CNMA 1DBSA 1D9XA 3HEMA 4PZYA 4YCSA 1P19A 1WXGA 2GZRA 2IZZA 1CJUC 3ZGYA 1LXCA 5KQMA 4JFCA 3KJGA 5CT8A 3OCWA 4HEA6 4QYTA 3NV9A 5E6RB 4QBIA 1OIWA 1PDOA 4BKRA 5EJ5A 3JD1A 4AY2A 2FR8C 1NSTA 1T34A 4BX8A 3G49A 3HBJA 3DJAA 3D5EA 4O4LA 4DLSA 3SDBA 4XTRA 3ZIAA 3BKWA 3ICCA 1OA1A 4W5WA 4KVZA 4CWAA 4YJFA 3EOBI 3PC8A 2ATCA 5BR8B 1NVUQ 2I4OA 5TMBA 5HUJA 3KQPA 4K0KB 2WJWA 2XZTA 3T4XA 5JU6A 2NV2B 1SJ9A 2FWMX 3E5RA 1JE1A 3F3MA 1VG8A 5E0OA 5DEIA 5C9GA 1YRAA 2I3AA 2Z04A 1BJTA 3EZYA 5DU8A 4TQUS 4BO1A 1JE0A 1BE6A 2ZBVA 4RDCA 2DQSA 4NJMA 3L8DA 4WBNA 4GZMA 4B3XA 1P39A 5CX4A 3AJ9A 5HIJA 1UF9A 1ZHFA 5BP7A 1XYGA 4I9GA 2YHUA 5D6NA 5FNZA 4DIOA 1RD4A 4FB4A 5K99A 3V1MA 2C9CA 4L75A 1O8UA 2JKVA 4KW7A 2X8WA 1MAUA 3F6CA 1NJGA 3H5RA 1EHYA 3SBOA 4D4HA 5JALA 1XPRA 3HE3A 5EE0A 3K70D 2B1RA 4WBXC 3D0QA 2WLTA 3KZ1E 3FOAA 4LZOA 5JVDB 1TEVA 3CMCO 1NQOA 1FC9A 1UK9A 3D5TA 4ALKA 4DQLA 3GLRA 1H1LA 4KLCA 1G55A 1K9VF 2GLTA 4WZZA 4YAIA 3MEQA 5K8JB 4CF5A 2RG1A 1T3SA 1X70A 2QOEA 4OQNA 4DRYA 2GF0A 4LCJA 1YO6A 2C8KA 1DOZA 1SXJA 1ZN2A 3I6BA 5JYEA 1ZY2A 2NU9B 3U4GA 1BQ3A 5BUQA 5JTTA 3H16A 5MN4A 2BGUA 2JFGA 1GTRA 2ZRMA 3R20A 4LHZA 2OBFA 2VYCA 4Y9DA 4YBRA 4RPHA 4A6PA 5FDFA 5KTNA 1ZXBA 1S2NA 5AH0A 1M74A 1Y6RA 3O8OB 2VAMA 4JP3A 1XJWA 3QHAA 1KARA 2C4WA 1WB5A 2P9ZA 3OBIA 4PFJA 7REQA 1PJ8A 1YAJA 4GOOD 5AIAA 5HF6A 4OBBA 4X20B 2I03A 4OD0A 3CVVA 3PEAA 4EG6A 3CG0A 1VJ0A 4HVLA 2DLCX 2RSLA 2VPYA 1GU7A 3FI0A 4MVXA 5TQ2B 3W04A 1N36B 4LF7B 1SZOA 1RYYA 1YCGA 3B60A 2O0KA 3C6MA 3JQGA 3W9SA 3CCCA 2B35A 3H84A 3PUJA 4ZRMA 1X2BA 1RAGA 4YACA 3NWJA 4E46A 2JLBA 3DHEA 2CLIB 1JHZA 3Q2KA 4MKFA 5AM1A 2JJ1D 3QJYA 1VE1A 2HQRA 5SZJA 3O2NA 2VNHA 5G3YA 2D2FA 5ALFA 2DR2A 1RCUA 2MR5A 2OBNA 3L7OA 4GHNA 5BQPA 2G5CA 3FDZB 2D0OB 4KR6A 4JUIA 4HNSA 2OCIA 3UMYA 1ISJA 3FSEA 2X86A 3I0ZA 4A9AA 2WAAA 3OTGA 4LHYA 1UBOS 3IDAA 4UU8A 1O58A 3RUFA 5GOTA 3DDWA 4CYMA 4EF6A 2WDPA 3SHVA 4PYNA 2XLBA 4GH5A 1EI9A 3W6ZA 1TFRA 4BTLA 4HAYA 5DM0A 3T3EA 1K92A 4OQQA 4P38A 1EEHA 4BYGA 4QIJA 2WJGA 2ZB3A 4QOFA 1NQXA 1QXSA 2X77A 2P2LA 2J5KA 3PNYA 4GF5A 4KMMA 3U4AA 5KHOC 3GIDA 1PL7A 1KY4A 1U0JA 2BY4A 3DL2A 4WMLA 3EQZA 4G4IA 2ZB7A 4J75A 3GFFA 1D5WA 1Y1SA 4DLVA 2JIMA 2GZSA 1J8YF 3LS2A 1KIAA 1TW2A 4PPGA 2QMHA 4OJNA 1ZU5A 3O21A 5E4TA 3QVWA 3W5UA 3PNVA 4URVR 3FAKA 1YU9A 5AUPB 5BV1A 4JV5B 4FFWA 2HQBA 4A27A 2VVTA 4CU5A 2NZYA 2QVLA 2XD9A 2C99A 3T3NA 1PGPA 3BWVA 5MGNA 5FBZA 2ZTMA 1XZGA 3JD4A 2VJOA 2RGNC 4KXFB 2BUCA 5FT9A 4PWZA 1T9BA 4HAXA 4UQOA 4EG7A 1KH1A 2CXXA 4S24A 3VVBA 2F1JA 4ROSA 4BZWA 2J6BA 3CRQA 1HF3A 5K3OA 2R8PA 1OFIA 1T6XA 3VZPA 5LP6F 2RGYA 2OZLB 1T9HA 1FY2A 3QE4A 2XUZA 4U39A 1RKUA 3QLVA 4INZA 2FLWA 3RVMA 4IMIB 2ZB4A 2JLAA 2NZVG 1RQRA 3UOWA 4DB4A 4JHXA 4NOJA 4MJ3A 1TA4A 2R5FA 4IIJB 1DTWB 5JCOA 3TE6A 4BEVA 3WA7A 1V4NA 5THXA 2GCPA 3U9TA 1RAHA 1LLDA 1DOAA 1OB2A 4NZNA 2YZ2A 3C87A 5KNCD 5GJBA 1Z62A 3D4OA 2FN3A 4YMGA 2J33A 1CB7A 2QJTA 3GEIA 2IYZA 2F1HA 2HGZA 3R76A 3H2ZA 1UOPA 1PR2A 4GP9A 3SQOA 3TIIA 1KAHA 5JNLA 1YL7A 3U7IA 4F38A 3MC1A 1HL3A 3BWDD 5T57A 3PDUA 2XUDA 3T1QA 6PFKA 1QTQA 3G79A 4OP1A 5DP1A 4ZQHA 1RRGA 1U1DA 2OGSA 3HXQA 1D2CA 3DMDA 5DUFA 3E3OA 5EQDA 3IVAA 2WVAA 3UJ3X 3W7AA 4M0FA 5L6LB 3CVYA 1ZLYA 2JLRA 2H4XA 3HKCB 2YN0A 1HTBA 3WTCA 1CCWA 5GIPE 1QP8A 4BO5A 4C5AA 4EVRA 4CT4B 3X0DA 1SD1A 2ZZMA 1WXWA 2PSEA 3THSA 3JAKB 4MNTA 2C2MA 3SIXA 2IITA 4UJ3A 5DCLA 3HB7A 3HL0A 2ZJBA 2VAWA 3AEZA 3WL6A 5IKXA 1W36D 3ZWVA 1GTSA 3LP6A 5IABA 5JHHB 2F90A 5LVAA 1GDDA 1USWA 2SBTA 3PGA1 3VR4A 3ZK9A 4EUNA 1K7YA 1R0RE 2Q7XA 3EY9A 2LBPA 3G1TA 3IUJA 3I04M 3RYCB 4HDQB 3RVLA 3EYAA 2X0IA 1ODIA 4AJLA 1K5GA 3JV7A 5KC8A 5DB4A 2G6TA 3IOBA 4IG4A 3R24A 3LPAA 2QVCA 4J0CA 2UKDA 1YOBA 4ZVLA 1D4ZA 4TWBA 3FYCA 3STUA 5LD2B 5HPYB 1TLLA 4KFCA 1Y0BA 3CISA 4RJIA 2QNBA 1Z2NX 2GARA 2TMGA 3T3IA 4R9NA 1W0JA 1W96A 2AMYA 2ZUWA 5K3FB 1E79D 3GK3A 3I9FA 3WJAA 2IF2A 2IW3A 4W5HA 1MF7A 5HM6A 1WABA 3M5WA 2W5UA 2H1CA 5IS2A 4IIYA 2YV1A 4TV8A 4U2FA 1C7QA 4WK4B 4JXZA 2QN7A 1ZG3A 3QLUC 3EY4A 3RREA 5F7JA 2FWJA 3TRKA 1NWCA 1IXYA 3QUTA 4KIFA 2WSSA 3GVCA 5EZYF 2H85A 2XDQB 4JP1A 4A1OA 2JBAB 2JGKA 2DX7A 4ALLA 4ZAXA 4EYOA 4FVTA 5A1TA 3USZA 4W5NA 3RU2A 1IY1A 1S2OA 1XALA 4LDPA 4N76A 2FPKA 1XZDA 1SIUA 2HPZA 3WGUA 5KWJA 4C6HA 3LCJA 3OZGA 4GQBA 5ICFA 1B8UA 3SXUA 4QXRA 3USES 3Q9SA 1UMCB 3SXPA 5HK8A 2HNBA 4OSEA 1RQNA 4GI2A 2J5IA 1NIPA 1FMLA 2VZEA 3BMCB 4RWEA 5DHSA 4GEGA 2PO5A 5DGDA 1AE1A 4FI3F 4BO7A 3CEAA 5AHWA 1PE0A 3B6IA 5DNUA 3V2UA 4B80A 2ABWA 2IXDA 4GM4A 3AFOA 1E7WA 3DAOA 4FFLA 2Y3IA 4KXUA 3FKSA 4QWWA 1BHO1 1BZYA 5HTKA 2ATVA 2BFFA 2WF6A 3RRNA 1TCVA 2H1SA 4N6GA 1QRSA 1LA2A 2NYAA 2O5CA 4C4XA 4DEYA 1EVJA 2FPOA 1WX1A 2I0FA 4FN5A 1NQTA 4WESA 4TOIA 3S68A 3WIEA 2BTEA 1AB6A 2OB1A 4HFRA 1F5NA 4J4BA 1J0CA 2IUTA 3E22A 1KH2A 3L4EA 4AAYA 5I9IA 2DQZA 4NPAA 3V3KA 1OTHA 1U0RA 3QYJA 4ENTA 1LKZA 3AI2A 1TAHA 4E32A 1Q19A 1V1JA 1XELA 4LOHA 2CZQA 4MWGA 1JYSA 4F5WA 2EC5A 2HA5A 3KKPA 2ZT7A 1TF2A 4MPTA 4OIFA 2B7LA 1JDTA 1RAIA 2PCJA 3AEYA 3B2QA 2VYNA 5E0NX 1TM5E 4HPWA 4KGDA 4FOSA 3WQRA 2E5FA 9ABPA 3VBEA 1XXLA 4BNGA 4PQFA 2ZSFA 3QU2A 1ZEMA 4AUKA 2ZRHA 2VYVD 5B55A 1C7FA 3PZRA 3A2LA 3MMPA 4UMEA 3LZDA 4QTYA 4E21A 1P0QA 4QG3A 2Z98A 4AZ0B 4R1PA 5LA6A 2ZL2A 2AOUB 1Z12A 4UNQA 5TY0A 3WICA 4K0RA 1V2GA 4MV4A 4R2IA 1GUZA 1CF2O 4WFJA 3RTEA 1GRNA 3LBYA 1YK0A 4O0LA 5HOQA 2B1QA 3O4VA 3GJZA 2BFDA 2X0EA 2ZBQA 1I32A 4MV6A 4XX0B 2GM4A 4XA8A 5LZ4A 3BJMA 1BXRB 4ZHQF 5HS6A 3KJZA 3LUFA 1QNLA 2JG3A 2JEZA 2EQ5A 2XW6A 1OAAA 2DT8A 2WOOA 3IUYA 4IZOA 4NAVA 2QS9A 3AY6A 2ONJA 5E3HA 4KQJA 5D3MB 1DU4A 3I12A 3C43A 3QX8A 4KODA 3KETA 4R7TA 3SX0A 5J59A 1JLSA 3I62A 2ZOSA 1U7TA 3KKLA 4G1VA 1HI9A 1XROA 2FX5A 1AXEA 1US8B 1VL2A 3DWIA 2ZCVA 4N01A 3UK2A 3K8XA 1JTVA 3COJA 4OXYA 4Z9BA 4C03A 3G9XA 3MN1A 3N9IA 5F1YA 4S12A 3KTDA 1JNXX 2QDKA 3HZZA 3ST7A 1QP0A 1PTKA 5J5CA 3V7WA 3ZY3A 1K3UB 4OLAA 4K9DA 4OQPA 5B6JA 2OB2A 2QR2A 2CE2X 3VZDA 4A5SA 3WHLA 1ACMA 3WKAA 5HS4A 5B7GA 1HTTA 2PKRA 1EFPA 3DOFA 4LHEA 2X5XA 3OMLA 2XMZA 3M2TA 1G64A 4IKOA 4MUXA 4LWZA 3KEFA 1U8XX 3AG6A 1Y4UA 2NVUB 1UFKA 5JYDA 2FSPA 5HKLA 3LSTA 3K73O 4KKVA 1ZRHA 2JRCA 2QL5A 1C8BA 2G4VA 2ZFUA 3E05A 2CCJA 1GZVA 5JDCA 3I0MA 5HUQA 1DIBA 2WOJA 2XBUA 3GJ0A 4PZUA 1X3SA 3K9BA 4RH3A 3UWPA 2JCXA 3OCZA 4HC8A 1ISMA 1TTPB 1IDN1 1IK4A 3I9LA 4R1UA 5CVJA 3OFKA 4M1WA 1G5HA 1L4NA 2J3IA 1KMQA 4IICA 2J6IA 4OK5A 4ZU1X 3HXLA 4CEIB 4RDHA 1W6UA 3OZXA 1XHLA 4U7FA 4CQMD 5EWLB 3OZBA 3ODPA 2VDOB 3LHDA 4WKOA 3KL2A 3L9XA 2C7PA 5JXJA 2H1OA 1Z68A 3AP3A 3TRRA 3MJFA 4C6TB 3JQQA 4L8YA 3HKEA 4PBRA 1ZGBA 5BMVF 4ZDBA 2OORC 3JQ8B 3RODA 3B13B 4M0KA 1JMKC 1ZVMA 4MRVA 5EPOA 4I9UA 5IP5A 4I9NA 4PX2A 1AHHA 4NU6A 1ZAKA 2Q45A 3PQ2A 5HFNA 2W42A 5EIHA 4IVPA 1XZJA 2VAPA 1WXHA 1SG9A 4MSUA 3PGKA 1N3YA 4BJ3A 2SCUA 2WD9A 3QFHA 4OKNA 3P9NA 3UTDA 1NJFA 5JSQA 2IHNA 1QHNA 3N5KA 4YAJA 3PGMA 5CTJA 2Q4TA 4B2LA 1GKYA 3B2NA 3HYSA 4TMKA 5FFNA 2ON6A 5CITA 3L1HA 2WQ6A 1RXCA 2VHWA 4KPFC 4Y2PA 4DRXA 4JI0B 2ZRPA 3I37X 1WR8A 2JLQA 3PE3A 4R2JA 3QFTA 1UWVA 3PDCA 3K20A 1P9WA 2G40A 3TVWA 1G8GA 5F77A 4MAFA 2L17A 1QHEA 3ET4A 4MR8B 2F3SA 1QH1B 3MGGA 4IDEA 3WB2A 3OEWA 1WKCA 3K0CC 4WNCA 4I50F 2OFPA 4D97A 4JJTA 2XVYA 4ZOQI 4JDPA 2WG2A 3ZXSA 3TXYA 5CVTA 1S9DA 1A9TA 2PZBA 4R1SA 3D3KA 4URXR 4HLQB 3F71A 4BGIA 1VLVA 3V8NA 1FZQA 1AKUA 1I0IA 4ACBA 4UEJA 4EA9A 3F7NA 5HNKA 1AURA 1ZCFA 5IFKA 2NVOA 2YY7A 3JVVA 1SQ5A 3LPDA 2Z43A 3NBXX 4HGZA 4YQEA 4WCZA 1KQOA 1Y5RA 4JC8A 4R1MA 3RR2A 2V6JA 5A5VA 6Q21A 2A57A 5EZ5A 3TXAA 5JCJA 1JJFA 1YBFA 2YBDA 4UUAA 2O57A 4C3UA 4AKEA 2P6NA 1VI5A 2YASA 4FHEA 4A6XA 1L5OA 1U7PA 2COEA 3M4ZA 3P71T 3N6RA 1HURA 3ASZA 3VR6H 3ZCUA 4XUGB 4IIEA 5JANA 4ZMBA 1YR1A 2ETXA 2PIAA 4PGFA 4DR6B 3O3OB 2XZOA 1V7CA 1X7WB 1YSCA 2YIJA 1GM5A 3GX1A 1Z6YA 3PBKA 3TCNA 2W2KA 4ZD6A 2ZSEA 1DC6A 5JSZA 4MJ7A 2JATA 3VU8A 3UGJA 3G0BA 3A1DA 2BHRA 2I99A 3CE6A 3QW2A 1T4CB 3PC6A 3Q7RA 3Q0JA 2JZNA 4U2DA 4R9VA 2QUKA 3WJ1A 3HRXA 1TGYA 1TCCA 2EERA 2FWRA 4MRMA 5FL7A 1WZ8A 1MJHA 1ZH4A 4G8BA 3RAPR 1WB4A 1JWLA 3RSQA 1A72A 1XA0A 1MOQA 1WVGA 5BOSB 1NNSA 2XNDD 2YQZA 4KYUA 2A94A 2O19A 3Q2OA 3GCDA 4ZJZA 3PPWA 3Q9UA 3PNSA 5JAIA 3MJDA 4ZAZA 3PEUA 3KJQA 3H1BA 1R7RA 3LUCA 1EXNA 1MENA 2BZ0A 3TLXA 1UPXA 3W6UA 1TECE 1Y3IA 2XNJA 3THRA 5IJ9A 2P9BA 4B6OA 1ODKA 1ICIA 1PT7A 4E5SA 2P4UA 1CIPA 4DNFA 4WKBA 2QEQA 5I9BA 3Q7QA 3ROZA 1EG7A 2QD5A 1F8UA 3JQ7B 4Z3KA 3C97A 1R4MA 3P2YA 1L3CA 3EBLA 4YXFA 3KBBA 5KSZA 1HDGO 2VHCA 2ZJ6A 5EMLA 3VVCA 2O1WA 1L7RA 3ZDCA 5B64A 5GV8A 3NMUF 5CM2Z 3ENZA 2DBZA 4KAAA 4Q18A 1WBBA 3CN7A 1BRTA 3GUHA 4DLLA 3PIIA 3RWBA 2HFJA 1OKKA 3M8KA 2IP2A 1PHPA 3HV2A 3ETGA 2AJLI 3NC4A 4D42A 3BERA 4LE0A 2NP9A 1EDBA 1V96A 2BR3A 2RHGB 2ZT8A 3QBEA 4V1CA