3ZW9A

Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with (2s,3s)-3-hydroxy-2-methylbutanoyl-coa
Total Genus 271
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
271
sequence length
723
structure length
723
Chain Sequence
GSHMAEYLRLPHSLAMIRLCNPPVNAVSPTVIREVRNGLQKAGSDHTVKAIVICGANGNFCAGADIHGFSAFTPGLALGSLVDEIQRYQKPVLAAIQGVALGGGLELALGCHYRIANAKARVGLPEVTLGILPGARGTQLLPRVVGVPVALDLITSGKYLSADEALRLGILDAVVKSDPVEEAIKFAQKIIDKPIEPRRIFNKPVPSLPNMDSVFAEAIAKVRKQYPGVLAPETCVRSIQASVKHPYEVGIKEEEKLFMYLRASGQAKALQYAFFAEKSANKWSTPSGASWKTASAQPVSSVGVLGLGTMGRGIAISFARVGISVVAVESDPKQLDAAKKIITFTLEKEASRAHQNGQASAKPKLRFSSSTKELSTVDLVVEAVFEDMNLKKKVFAELSALCKPGAFLCTNTSALNVDDIASSTDRPQLVIGTHFFSPAHVMRLLEVIPSRYSSPTTIATVMSLSKKIGKIGVVVGNCYGFVGNRMLAPYYNQGFFLLEEGSKPEDVDGVLEEFGFKMGPFRVSDLAGLDVGWKIRKGQGLTGPSLPPGTPVRKRGNSRYSPLGDMLCEAGRFGQKTGKGWYQYDKPLGRIHKPDPWLSTFLSQYREVHHIEQRTISKEEILERCLYSLINEAFRILEEGMAARPEHIDVIYLHGYGWPRHKGGPMFYAASVGLPTVLEKLQKYYRQNPDIPQLEPSDYLRRLVAQGSPPLKEWQSLAGPHGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Isomerase and Hydratase Reaction Mechanism of the Crotonase Active Site of the Multifunctional Enzyme (Type-1), as Deduced from Structures of Complexes with 3S-Hydroxy- Acyl-Coa.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
molecule keywords PEROXISOMAL BIFUNCTIONAL ENZYME
total genus 271
structure length 723
sequence length 723
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.50 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3zw9A03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3zw9A02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3zw9A01
2O7QA 3U4HA 1CQIA 4W9NC 2RAFA 1SG4A 2G5CA 2VHVA 3A28A 5EPOA 3A4VA 3TT6A 2X6TA 3T3WA 2DUUA 3CTMA 1HYEA 1PJTA 1WXDA 2HK9A 2B4TO 4AJJA 3VZSA 1J7XA 5TRTA 3NT2A 3NAQA 3PIIA 2ZL3A 3KQFA 2B37A 1LSJA 4IPTA 3TQHA 4BO2A 1P1HA 2A81A 3ISAA 4RYFH 2W4QA 5JAMA 3DZJA 2J5KA 4DQXA 1EQUA 1HZZA 2B5WA 2P68A 3KOUA 1A4IA 3QWHA 4IJKA 4PGFA 4TVOA 4AJNA 1OMOA 1VKOA 4MJLA 4BNJA 5EIOA 1O9BA 3TZKA 4U0JA 5JSFA 3H6KA 1LSUA 3PRJA 3WDSA 1XR3A 1U7HA 5B4VA 4OIMA 6LDHA 5FYDA 1H9AA 4AJPA 3K92A 4A27A 1QORA 3E18A 3IAHA 4BNXA 1ON3A 4RLHA 3U5TA 1MV8A 4NJOA 2C82A 2NVUA 3GGOA 3V1UA 3T7EA 3T4EA 5F1KA 5BSEA 1KC3A 3KYCA 2RCYA 4JXKA 2C5AA 4GLLA 5DZKH 1HSOA 1P45A 1ZK3A 4BNFA 3JQGA 3C1TA 2Y1OA 4B79A 3NGXA 1PJLA 1WWKA 3EHEA 3L4SO 5ENVA 2HJRA 1R37A 1RM4A 4K26A 5CTBA 2EERA 4YR9A 1EUZA 4JSBA 4JBGA 2O3SA 5FF9A 4YXFA 2GO1A 4I5DA 4RVSA 2VTDA 3OIDA 4CMEA 1GAEO 1N7GA 2YJZA 3FNHA 3GUYA 1WVGA 4YJGA 4L75A 4ZRMA 1KVSA 1FXSA 3ZH2A 4MO2A 1PZGA 4CODB 1VKNA 2NVBA 3INGA 3E9MA 2X5OA 2VHYA 2I3GA 4MVJI 3BMOA 3RFXA 4JP2A 2FPIA 3LDHA 1EE9A 1LA2A 5T8KA 4WASA 2DTEA 1TT5B 2YHIA 3TDKA 3GNQA 1B8UA 1DBVO 1DEHA 2Y05A 4ZQFA 4BQRA 4MKXA 3A06A 3ETEA 4BVAA 4GGPA 4Q3NA 3OF2A 3G17A 4B4WA 4WPGA 2BMAA 4CV0A 3F4BA 4RDIA 3UKOA 1GY8A 1KC1A 5A4DA 3V1YA 2CFCA 2DBRA 2X23A 3GFGA 3TVUA 3ZU5A 3RC9A 4HNKA 2NM0A 1Q0HA 3OETA 1JKIA 1FC9A 1X0XA 5CDUA 3QMJA 4KUEA 3IBBA 2XAAA 4NFYA 2F9YA 2QHXA 4O59O 1Q2XA 2WEKA 1LQUA 4BO9A 4JBIA 1T2CA 1TVEA 5DBIA 4DBVO 1O5IA 1VL0A 4UVDA 3JQAB 3JYOA 4HFMA 5I9NA 3STHA 1PJHA 1XEAA 3B1JA 4ND5A 5B1YA 2NSDA 3TZCA 5JS6A 4E2YA 1C0IA 4M54A 3S2EA 1Q52A 5L7WA 1KS9A 5K6AC 4AVYA 1MFZA 3V2GA 2O3JA 3QV1A 4CM1A 2F9YB 1WW8A 5EESA 2HMWA 1CQJA 1N9GB 1ONNA 2G76A 4FB8A 4EGFA 3GEMA 3GGPA 4XEHA 2VYVD 4KUGA 4R1NA 4U0HA 1NXQA 3ZNNA 1UXGA 3QJ5A 4CLDA 3IKTA 4CQLA 3PJGA 2F00A 2A35A 1NQAO 2WD7A 3SLKA 4IINA 3RQSA 3U0BA 4U0GA 3ZWNA 1QRRA 4I52A 2YHIB 3QWBA 4WGGA 1Y5MA 4PG7A 1JVBA 3TZ6A 2ZTLA 3PHJA 4GX5A 2PD4A 4KD6A 1X7DA 2QQ3A 4CL8A 1UUFA 4Y98A 2W98A 4AICA 1AUPA 5T8KC 4M87A 1RM0A 3K2EA 2HRBA 4YT4A 3MWDB 1CYDA 1JW9B 1G1AA 4E0BA 1ENZA 3WX0A 5DCYA 3SLGA 5G4KB 1XIVA 3H3FA 2PD3A 3HN7A 1E77A 4KZPA 3GUCA 1B15A 3JD1A 3L9WA 4XYEA 1DDOA 4U0GH 1NFFA 3F47A 2ZB4A 3Q0EA 2J5II 3RU9A 2B5VA 1NZYB 1JKJA 3RUFA 3UAGA 2VRCD 4IY1A 4BNKA 4BO0A 2RH8A 5FUSA 3BMQB 4MIYA 2GD1O 5L7YA 4XB1A 3WMXA 3ZW8A 1P0CA 2O2YA 2PY6A 2VHZA 3OIGA 5INFA 1FDSA 1DFHA 1VJ0A 2ZB8A 4FZWC 4H3VA 1LTHR 3ZWOA 2EJWA 3NUGA 4BNMA 1KYQA 4IZIA 2NU9A 5L7TA 4EW6A 2C7VA 4GAEA 1N2SA 1MP0A 3BPPA 1H5QA 3TRRA 3A9WA 3RVDA 2Y99A 4KQXA 5L3ZA 4AG3A 4BO6A 3WWZA 3ZWVA 4BHTA 2J5IB 5DU4A 4BNNA 3AU9A 1ML3A 3H0JA 4D46A 4D43A 5COBA 3MTJA 4TROA 1AN9A 4FFPA 1DC3A 1DC5A 1MC4A 1ZKMA 1KVQA 1EBUA 4D0RA 1QYCA 5EQDA 4Y67A 3F3SA 4XR9A 3WXBA 4RO0A 4OG1A 1VJTA 2VRBA 1T26A 3WNQA 1D3AA 1MG0A 5JLAA 4D0SA 3WQRA 4QSMA 5AXCA 1RKXA 2Q35A 3M6NA 4ONEA 5ILOA 1YL5A 1GFSA 3QWDA 4X54A 3GVXA 3BHIA 4BGVA 1V3TA 3GQVA 4CUKA 4XRRA 3L3SA 2BHLA 1Y9EA 1C1XA 4PCVA 5IN5A 2BI8A 2FP4A 4Y9DA 3PZKA 3IJPA 1N6EA 2AQHA 3EZLA 2J5GD 2I76A 2X8LA 5JYEA 2GASA 3GPIA 3KTGA 3TZHA 1X1EA 5GZ1A 4ALNA 3LLSA 4GX0A 3PI7A 5KNLA 4I9UA 1B3BA 4P22A 2QZZA 3BTUA 4NMHA 4B3HA 2BRUA 3OEYA 3JQBA 4YT5A 3R9TA 2I67A 4NFSA 4RVHA 3RU7A 3FR7A 1KERA 2EKPA 3WS7A 3DTYA 4DRYA 5JBIA 3D7LA 4DLLA 3CKYA 4U6SA 2IEXA 4WUVA 3NGLA 2A7KA 4R51A 1GPJA 2I9PA 1WDLA 3KB6A 3EC7A 3CSDA 1HZJA 1PIXA 3V5IA 4PG6A 4C7KA 3ZN2A 3U4CA 3F5QA 1Z73A 4K28A 1XNWA 1C1DA 4CQMD 3WMWA 3LC1O 1ISFA 1PJSA 2WMDA 3K31A 2P5YA 1J4AA 4IUYA 1J6UA 4HFRA 1C3VA 1VE9A 1LDBA 4DWVA 2UUPA 1NPTO 1C1DB 1QMGA 4Q3AA 3HLN1 4FN8A 1YXMA 5KJ6A 5A9RA 4URFA 1FCFA 1I3LA 1XCBA 3LT1A 2NLOA 4FJ0A 1DIAA 1VJ1A 3WQSB 1ZBQA 2CMDA 2JCYA 3HJAA 2CBYA 4IS2A 2X24A 3U3XA 2I5PO 4JX8A 2FRDA 3AFNA 3KM0A 3RSIA 2YY7A 3FTNA 5KJCA 3K96A 4UREA 1UDCA 2NVWA 1ZVMA 3BMOB 4UEKA 4XYBA 4GVLA 3X2FA 3LK7A 5TT1A 3QYRA 2PR2A 3DEYX 4UUMA 4BNGA 5G1QA 1B16A 1PJCA 4LGVA 2F9IB 3HDYA 4AJHA 3KVOA 1ZEJA 3DHYA 5JC1A 1J49A 5IZCA 3RIHA 3OT6A 3I5MA 4PRKA 1JWAB 3M2TA 1BDBA 4OAQA 1PWZA 4OH1A 4XQCA 4ALLA 2ILTA 4L0QA 4J91A 4RGBA 4RF5A 4LSWA 3RD5A 4DPMA 5A02A 4FFRA 2DBQA 2X9GA 5EINA 3QXIA 1E6UA 4JCTA 4J16A 4R9RA 3KYCB 4PLWA 4ZDBA 3G79A 4IDCA 2I6TA 1NR1A 1VL6A 4JYLA 3GDGA 4IQ8A 1OI7A 3NJ4A 4M89A 3VH3A 3GC6A 5JDIA 2OL4A 3G0OA 1L7DA 1U2DA 1W6UA 2Z1MA 1OD4A 2UZFA 2FR1A 4NBVA 2YUTA 4BB6A 4WLNA 2X9VA 1YDEA 5KVCA 4BO7A 2R00C 3GHHA 2J5IA 1AXEA 3QWAA 1M76A 2HK7A 3ABIA 5IDQA 3LQFA 1ONPA 3DFZA 3WGHA 3WGGA 3FRJA 5KJFA 4XGIA 2QRJA 4FC6A 4ZU2A 3O9ZA 4BNVA 2R00A 1DRUA 3VKUA 1PGQA 2NADA 4FQ8A 5EMHA 3WIEA 1MGOA 4J9VA 5DP2A 2OBNA 4MI2A 1L1FA 2EJVA 1IL0A 3W8EA 4ALKA 4RCNA 3C85A 3BMQA 2CF6A 3WIDA 1NAHA 1CRWG 2QYSA 3KBOA 3W8DA 3INRA 1XHLA 3RUIA 1NZYA 3ROPA 2HKIA 3DMTC 3PK0A 3EVNA 4CLRB 4IZBA 5DL1A 1HYGA 4MVJF 3WGQA 3D4NA 1TA4A 2PZMA 1BDMA 3AWDA 4ND4A 1XX4A 2I66A 1HDGO 1YQXA 2JD2A 2Q99A 4IJWA 4W9NA 5I9LA 3CXRA 5F1PA 2ZTUA 5G0UA 4KPKA 4JOTA 2E82A 2RBEA 3GGGA 4FGSA 1ARZA 5FWNA 2O3UA 2X9NA 4W7HA 1Q1NA 2WTBA 4AL4A 1KIFA 1UAYA 2CY0A 2X7HA 3BMNA 1ZXLA 3I4CA 3Q9UA 1ZK4A 3F5SA 3QSGA 2RHRA 2FY8A 4DL9A 1OBFO 5GZ6A 3AU8A 3TJRA 3RKUA 1I33A 3CPSA 1ZMTA 3UFXA 3PEAA 3I9JA 2P9GA 2WD7B 3DMYA 4HP8A 4BOYA 3SC4A 4CQLB 3VAZA 1BMDA 3P7MA 4R1SA 1ONOA 5L4SA 1NPYA 1E1LA 1GPDG 5HBRA 2J3IA 2GUGA 3PQEA 1F12A 1ZSNA 2Y0DA 2VHXA 3ADPA 2P5UA 3NTQA 5BQFA 2CDCA 2Q34A 1BW9A 4R3NA 4BGIA 3ZWPA 3I1JA 2P9CA 1WMAA 3D64A 2Y68A 3R3SA 2IYPA 3DHEA 3O03A 4JK3A 2GYYA 4XQGA 1UH5A 5TC4A 3ROMA 3JQAA 2OP1A 4UULA 2D5AA 3MWEB 4M86A 3C3XA 4MVJA 2FW2A 5IDWA 3F4LA 4RPHA 3RRVA 2YDYA 4Q1IA 1LDEA 1U5CA 1DSSG 3TLFA 4H15A 4XQ9A 4WK6A 4WYOB 4KWBA 1T1SA 4XJSA 1HRDA 3PDJA 2Q1TA 5C3MA 4NU6A 2C59A 3OHSX 2AMFA 4IDGA 1MX3A 3PHIA 1UYTA 1JLLA 2CE3A 1K32A 3AUAA 4PVDA 3FCOA 4G2NA 4ZICA 2EGGA 1IZ9A 1LJ8A 4G65A 3EY4A 4MVJG 1YB4A 1HDXA 3H7AA 4U6QA 1XLTA 1FDTA 4I42A 5JBWA 2ZL0A 3P19A 2FR8A 2X0IA 4JLWA 1S6YA 4R3WA 3LKEA 2I65A 3BZUA 2DC1A 5HM8A 3GZNB 2ZTVA 4MIEA 4AFNA 2FBMA 3VTFA 1W4ZA 4E12A 4YTEA 1LLUA 4BNZA 4N18A 2Q2VA 4UAGA 3ONDA 5KKAA 3HZZA 1O89A 1QP8A 4CM6A 3CMMA 5TX7A 3BIOA 3WWYA 4GLOA 3VPXA 4ZHSA 4IIUA 4QX6A 2G82A 4R69A 3IDSA 3JQGB 3GFBA 4II2A 4CMEC 3T88A 1GYQA 2HMTA 2BFAA 3ITKA 1R0SA 4E2XA 2NTVA 2EKLA 5JAZA 3H9QA 4CPDA 4CUJA 3FDUA 4WZ8B 3SVTA 2NVUB 1D7OA 1K6XA 1EE2A 2C2YA 4R68A 1QG6A 1XGKA 3OJOA 1ZIDA 2DPHA 4DA9A 2VT3A 2DVMA 2LDBA 2NU7A 3WBBA 4KOAA 1FMCA 1OAAA 5G0TA 9LDTA 1O8CA 2OO5A 4IDDA 4E13A 5KJPA 3JU1A 1GD1O 2BELA 3WICA 3LYLA 1WPQA 4E2ZA 1MC5A 4OOFA 3PFFA 4OJNA 2ZIZA 2NUAA 3H8VA 1ENOA 2YYYA 1P3DA 2HU2A 2WM3A 5JC8A 1ADFA 3BF0A 5CTCA 1Z75A 1LSOA 2YFQA 2NQ8A 3DMTA 1H6AA 2PWZA 3TT7A 1YJQA 3MJEA 3PJDA 4OM8A 4CQMB 4K29A 3H0UA 1I2BA 1HTBA 4DC1A 1P9LA 5CPFA 1AE1A 1F14A 1EDZA 3B1FA 1OZAA 3MFMA 1V35A 4CJXA 1TB4A 2BFPA 4CR8A 4UVGA 3NYWA 5E0SH 4CMBA 1IYZA 3P5MA 3DOJA 2GCGA 3GNTA 3S55A 3G3EA 4BO1A 4Q39A 4TWRA 3UF0A 1PGPA 5KCZA 1Q7GA 2QIOA 3UICA 2PKQP 4I8XA 5A03A 3QE3A 4OOEA 5TGDA 3FNEA 2EP5A 1NWCA 4WOJA 5INIA 4CMIA 3O4RA 2IE0A 4AJ4A 3S2IA 3LF2A 1CEQA 2O23A 2OFPA 2DFVA 3EDMA 3ZCXA 3ZNQA 4GM2A 2HAEA 4ITUA 3DFUA 1O0SA 5H81A 5CEEA 4PLTA 2O48X 4L4SA 3I9OA 1GEGA 1K6JA 5CEJA 1B26A 5JO0A 1R0KA 3D0OA 2BFMA 3PGJA 3JYNA 2EHDA 2Q1UA 5JBXA 3Q6IA 1D1TA 2FPPA 5JW6A 2AEFA 1R0LA 5G1SA 4RPKA 5A05A 3KETA 1EEHA 4IGFA 2XPCA 4FC7A 4MVJH 5U1PA 1UP7A 1FC6A 3W6UA 4ILKA 5L4NA 2FZSA 3ICPA 5L45A 3BHJA 1UZMA 2NTNA 1W8DA 1PTJA 4BGUA 4F3YA 1XYGA 2Y1DA 4HUJA 3ENNA 3GLQA 2BF7A 5TNXA 4E5NA 3OEWA 4E5YA 4JJTA 1CETA 4ASIA 4IXWA 1YH3A 1QYWA 4R1TA 5INGA 1HDRA 4KWIA 5ES3A 2A94A 1W0CA 3AI1A 3RC1A 4LK5A 4N54A 4D3FA 5KKCA 3PVZA 3JQ7A 3DB2A 2EKQA 3DZHA 3QW2A 1EVYA 3R6DA 4DC0A 2VX2A 3KLMX 4KWHA 5IDYA 4CM8B 1WMBA 1MJ3A 2PLAA 9LDBA 4R9SA 2FPGA 3NTRA 4PIVA 4XKJA 4NPCA 2B36A 4M55A 5A04A 5CDTA 1HSZA 1E7WA 2ZTMA 1NVTA 3FNFA 3SJUA 1SEVA 4Z3KA 3X2EA 5F3RA 4IZCA 1ENPA 4BS9A 4L74A 1YWGO 1KY4A 4Z0PA 2B69A 1T4DA 2G1UA 4BKPA 4ZU3A 3HNPA 2CSUA 1H6CA 1E7YA 4GSLA 3U9SB 3GPDG 1EVIA 1GU7A 4II3A 4RQTA 3IAVA 1A9YA 1GTMA 4GWKA 2HW5A 1LNQA 3PZRA 4GX1A 3WSWA 4A26A 4IS3A 4JJFA 3QY9A 5DCWA 3V5EA 1O94A 1PSDA 5COQA 4EZBA 5DNAA 1C0LA 4EJ0A 2C0CA 4HBGA 3Q1TA 1WZEA 5DTPA 5IN4A 2CUKA 1DLIA 2PH3A 2Z5LA 3K8XA 1N8KA 1T2AA 1N1GA 2BD0A 1RJMA 1DFIA 1WNTA 2Z95A 3GMDA 4YPOA 2ET6A 4MVJM 3PZBA 2QRLA 1XO6A 1JVSA 4QFDA 3RCBA 4CLXA 4YJFA 4D3SA 1HETA 5HA5A 1PZHA 4FN4A 1LSSA 2ZK7A 4M8SA 3LAOA 2D3TA 2X1HA 5AQ1A 1JTVA 4TSKA 5B12A 1ZFNA 3ONFA 3I4FA 3WGIA 5IF3A 1QLJA 3BEZA 4F46A 4JCSA 3I9LA 4RF4A 4K3WA 5K6AA 1XQ1A 1NBOA 3IMFA 7ADHA 2VSUE 1YB5A 3H0QA 1PZFA 1GCUA 3QWIA 3FWNA 3AM3A 3LSYA 4XJTA 2GN9A 3OECA 2ZATA 4QIIA 3GMAA 2FOIA 2Q2WA 5EL0A 1PS0A 3DXFA 2OXIA 3KO8A 4NNQA 2J3JA 2BH9A 3JQDA 3E8XA 2IXBA 4RZIA 5KDRB 1KOLA 3SX2A 4NG5A 3SJ7A 4ZDEA 1Y7OA 3CINA 4B4UA 3GT0A 1P31A 1UJMA 5E0NX 4CMAA 4GQAA 5DDIP 1YQGA 1EUCA 5U4QA 1M6HA 5IAAA 3QVXA 1M67A 1R66A 2DBZA 1BXGB 3AK4A 3U4IA 1E0DA 4QO8A 4U19A 1V9LA 3AUSA 3GVCA 4KDEA 3GRPA 3KYDB 4PFJA 3STAA 1IULA 4FFOA 4IBOA 3PJEA 3DZFA 4Y6RA 3E48A 1NM5A 3PWSA 4ZN6A 2P2SA 2JFGA 2YDXA 4PLZA 3D1LA 3QKAA 2CVQA 1ORRA 2DFDA 4FBGA 1DJQA 1HLPA 1RYEA 4WJZA 2Q49A 2GF2A 2R2GA 3NV9A 1LLDA 4LRSB 4UVIA 3SBOA 3R0OA 2DTDA 4CV1A 3RUAA 3QVWA 2FMUA 4FJ2A 2OHXA 5CP8A 2C5EA 3JQ8B 4XYMA 2W2KA 4GKBA 3EGOA 3NT4A 3SXPA 4DBZA 4DUPA 3R9QA 2AG5A 2C8TA 3VPSA 4LSMA 4TMFA 4WCDA 3EMKA 4XA8A 2GGSA 3RUCA 3ZWMA 4CV2A 1YKFA 1E5LA 4TZKA 4J7XA 5DOVA 4N5LA 3ZWXA 2O3RA 4C7JA 4F45A 3ANMA 2POQX 4YQYA 1FC7A 1ZK1A 4C4OA 3ST9A 1JAYA 1JWBB 1ZJYA 3TFQA 1NTOA 1TLTA 4OYRA 3ON5A 2GRAA 1U8XX 3FBGA 3OBBA 3R9SA 2W2LA 5IZCC 1JQBA 2PZLA 4YACA 3QHAA 3JD2A 3M2PA 4W99A 3V2UA 3QVSA 3RKRA 3OA2A 4YCAA 1G0OA 2Y0CA 5THQA 1LLCA 2AEMA 4YT8A 1CJCA 1NFQA 4ZA2A 1HE5A 1B8VA 1DJNA 4RV9A 1E92A 1KEUA 3OM9A 4BGEA 2WYVA 2VSUF 4EUEA 1ZK2A 1WAMA 1U2GA 3F46A 3ZWWA 1HYHA 4TKMA 4YYZA 3RBXA 1UYRA 2JD1A 1B3RA 3MJTA 2J5RA 5I7VA 1T2EA 2BGKA 3W4JA 3MOYA 5DU8A 2GZ1A 3OJEA 4LISA 4DIOA 3FR8A 4L8VA 4ELSA 4W7IA 2GN8A 3KXDA 3K73O 4JGBA 4MVJD 2DPGA 4J1TA 3M6IA 1E5QA 2PNFA 5C7LO 4PLHA 4R4JA 2VOJA 4NQZA 3G1TA 3JD4A 4L73A 5ICSA 3UCFA 4GKVA 3GZ4A 2DUWA 4XQEA 5JCJA 3VPHA 3PYXA 4OQZA 1WP4A 2NTJA 3PPIA 1XSEA 5CAEA 1HDOA 5BNIA 2FHSA 3VIVA 5G0VA 1Y8QA 5HTOA 1EF9A 3IB9A 1ISMA 3AM5A 5GZ3A 4YWJA 5DOZA 1HDCA 3ASVA 3N58A 4MINA 3IQDB 3VDQA 5BNTA 1E6WA 3OQ1A 5CG2A 1SO8A 3DBRA 3PLNA 1KEWA 4MDHA 4G81A 4RVUA 4ZDDA 1YJ8A 3AJRA 3OA0A 4FDAA 1M6WA 2BLLA 4GI2A 1Q0QA 2ZYGA 4BKUA 5T67A 4XWYA 1GCOA 2ZB7A 1ENYA 1KETA 4OXYA 1Y6JA 1KVTA 4UUNA 4RCVA 4K6FA 3RROA 3AI3A 1HNOA 3RASA 2E37A 2NQTA 5J23A 4OMUA 4WLUA 3LC7O 1QR6A 5A9TA 5TJ9A 1TG6A 2J3KA 1R4NB 4ZQGA 4NJMA 3MJVA 2AE2A 2DTXA 3WYEA 5K0ZA 2W2LD 4YRAA 1Z7BA 4MOWA 4XR4A 3B70A 3GEDA 1IHXA 4LMPA 2WWRA 4RORA 3MEQA 4YJHB 4D79A 3W4IA 5TF4A 4CR7A 2H63A 2WYUA 1NHWA 4CMKA 3U9TB 2O3QA 3KV3O 1K6IA 4LVUA 4NNJA 3WBFA 4FR5A 3V1TC 2ZKLA 4BQPA 1I2CA 1NNUA 2H9IA 4IDBA 5A9SA 3GN1A 3H65A 1E3WB 2OZPA 3FD8A 1HWYA 5GY7A 3R6HA 5BR7A 4U1AA 4XB2A 1Y1PA 2CF5A 2H5LA 3ZZNA 4OMRA 1U7TA 1A7KA 1LC0A 1KBZA 3IKVA 4MIOA 3OSUA 5IDXA 1H6DA 3DDNA 1HZDA 1AGNA 1VSVA 4L4XA 4B8ZA 1NFRA 4WCFB 4JCQA 4J7CA 3TZQA 4AJIA 4B7CA 4BMVA 1CWUA 1H6BA 1SEPA 2AW5A 3PEFA 3INTA 4RDHA 2B35A 4MKZA 5F1OA 2EG9A 3RC7A 4TKLA 2V7PA 3QXZA 5C9GA 2JFHA 4HV4A 1I0ZA 4OKIA 1UYSA 3PLRA 1MXFA 4BV8A 1WDMA 4I4ZA 4IM7A 4LCEA 2EF1A 2VCYA 2O2SA 1I01A 3D3WB 1PL8A 8ADHA 1UXJA 2HRZA 4YBZA 4Z9XA 4DLBA 4EUHA 1EFKA 1MFPA 4KNPA 4O0LA 4EMPA 5JDIC 4GMFA 4Q3CA 3GKBA 1X1TA 4WE3A 5EERA 3LT2A 4BB5A 1G6KA 4ZDCA 3GVIA 3W8FA 2E49A 4JBHA 4L6WA 5K9ZA 2FZEA 1H9BA 1NQTA 2B83A 4XGKA 1NR7A 1JA9A 2CVOA 1XQ6A 1XWFA 4IJVA 1EK5A 1AHHA 1FF9A 3FBTA 2QX7A 4U7WA 4CM4B 3VH4A 3WGTA 3ZV3A 4ALMA 4KP7A 4B3JA 4EBFA 4Z6KA 2I3AA 2Y67A 3I83A 1BXZA 4FCCA 3GAFA 2F6QA 2YQ5A 1PWXA 5FI3A 5AYVA 3VC7A 3OIFA 4OQYA 3RUHA 2UDPA 2Q3EA 3IL2A 2HCTA 3JQ6A 4KMSA 4Y6PA 3QIVA 5JDCA 2PFGA 4WCFC 4OLQA 1Y7TA 2GZ3A 4DYVA 1E3WA 1U28A 1VLLA 1YBAA 4ZQEA 2D8AA 5EQFA 3PHLA 1Z82A 2Q50A 2DQ4A 3TDCA 1QKIA 1U4SA 3KYBA 5G4LA 1UZNA 1VM6A 4MP8A 5DZSA 4S1VA 2NV6A 1UZLA 1Y9AA 3HP0A 1GADO 5TT0A 4E3ZA 4J6FA 2X86A 3I9MA 1Y5RA 4CM5A 4D3DA 4L8KA 3QQPA 4S3MA 3TOXA 2Y1CA 3CIFA 4K1LA 1U3VA 3IP1A 4L4RA 3W1VA 1EZ4A 4YAGA 5IFLA 1M75A 3DAGA 1NQOA 2JCVA 1I30A 4BNTA 1BWSA 4OO3A 1R4NA 3E5MA 1IE3A 3DBLB 3FPLA 5FIFA 3M1LA 1Y81A 2X0NA 3GLMA 1R4MA 2O3TA 1UXHA 2B0JA 3HFSA 3H81A 3LF1A 3FN4A 5LDHA 3WR5A 4B4OA 5KVVA 3IUSA 1PJBA 1JU9A 4INAA 3LLVA 3E1KA 5F21A 4A0SA 3P2LA 2HLPA 4R1UA 3H4VA 3ZV6A 4E2WA 1I3MA 1Z45A 2PH5A 1O95A 5COAA 3GDFA 2EGHA 1P74A 5DUFA 1NX6A 1EY3A 4E32A 3BHMA 4YAKA 1PR9A 5DTWA 3H9GA 3H5AA 4UVEA 3JQCA 4CLHA 2J5QA 3WGZA 3RJ9A 1Y8RB 2A92A 4BO4A 5G1RA 2LDXA 3ANNA 2YQ4A 5TQVA 2HO5A 5HS6A 1R4MB 4IJUA 1BRMA 3PE8A 4YDRA 2PGJA 4IXTA 1IOLA 4XIJA 3AY6A 5KWEA 1X7HA 2PA3A 4QFCA 4Q9NA 1GQ2A 3S8MA 1XU7A 4D44A 2GLXA 1ZK0A 2JL1A 3T4XA 1F8GA 3H3JA 3HG7A 3WG9A 4RYFA 3ADOA 4Q0GA 3O8QB 5ER6A 4DIBA 4EMLA 4OL9A 4IZHA 4CL3A 1N1EA 3FSRA 3HB5X 4NR0A 3QWFA 5MGBA 3HDHA 2O50A 4YAEA 4JJIA 1YG8A 5JDCC 4ELWA 1UDAA 5DKPA 3UXYA 4CLEA 2BZRA 2DU8A 4EDFA 3DBHA 4WEQA 4RPGA 4A73A 4FGWA 3WYCA 4A5OA 5AXAA 1U3UA 4CM7A 3QVOA 1DC4A 5FI5A 4W4TA 1K0UA 1I3KA 4LVCA 3GVPA 3OH8A 2R6JA 3F1LA 3JQAD 1LDNA 4TRJA 4Q3EA 5B37A 4B7XA 1VL8A 4JCRA 2RH4A 4WEOA 3V2HA 1VPDA 4DXHA 4YRBA 4PG8A 4DTIA 5BSGA 2CDBA 1XG5A 1VI2A 2VUTA 3FNGA 4GX2A 5KVQA 1LRLA 5T5QA 4HFJA 3FI9A 1A27A 1CIVA 3DOOA 2Q1WA 3PDUA 8LDHA 4GPD1 1HT0A 3MJSA 3OMEA 3BMCA 3TWOA 3BTSA 1C0PA 1G0NA 1QYDA 3L07A 1V6AA 4R41A 2G0TA 4Z3DA 4EITA 3ZWYA 3BAZA 7MDHA 1E7RA 3CH6A 2B4QA 2V6FA 1UAGA 2VWQA 1BHSA 1GQYA 3TPCA 2HUNA 2WD8A 3ORFA 3AW9A 1XELA 3IS3A 3P2YA 4I9NA 4AJOA 3N6RB 4F47A 3GOHA 3QVTA 1DHTA 4XZ3A 4BO8A 3DOCA 2IEDA 2RHCA 1A5ZA 3QRWA 4FIZA 4IMPA 4Q3BA 5JMWA 3RUEA 1PIWA 1IB6A 1IUKA 4I5EA 1CF2O 3B20A 3I6IA 2PKRA 3DTTA 4BMNA 2GERA 4J4HA 4DREA 3U9RB 3JYPA 1SPXA 5LCXA 4ZJUA 5THKA 3CUKA 5ICMA 1YOVA 3BMCB 3ETDA 1QSGA 2DBVO 1EF8A 4ZVVA 1BXGA 5A06A 3CZMA 4PLFA 3HN2A 4UVHA 4E4YA 3JV7A 3OQ6A 1PR3A 4JIGA 3VZRA 2D5CA 4R5HA 3ZNOA 2JFFA 4MKRA 5A5FA 5C5IA 1YDWA 4DPLA 1ZZEA 2IZ0A 2VT2A 2Q1SA 5E0SA 3PWKA 5I8ZA 5L95A 2C54A 3EZYA 3KHUA 3T8AA 3BYZA 3H9EO 5TSDA 1X7GA 2AQIA 3H2ZA 1ON9A 1KVRA 3JYQA 1QV6A 1PJ2A 5JXWA 2BFOA 1P44A 1HE3A 3FTPA 3DONA 4WLFA 2YV2A 4PZEA 4FW8A 2VYVA 2Q46A 4YEDA 4RVGA 2YHUA 3GR6A 3IJRA 1DIBA 3K30A 3O8QA 1GYRA 1FJHA 3WTCA 1N5DA 2CNBA 4NU5A 4ZQHA 2D4AA 2O4UX 2OP0A 1NWHA 3TL2A 4A03A 3KZVA 3I23A 4CMCA 1U5AA 4NJMB 3ZHXA 5ILGA 3B6ZA 1DLJA 1N92A 1SC6A 2PK3A 3LZ6A 4A2CA 3W4KA 1Z7EA 4FFNA 2VWPA 4NK5A 3TVWA 1IPEA 1B14A 3MOGA 4U8GA 4K6CA 1YGYA 4OSOA 4A7PA 3GVHA 4BO3A 3CZRA 1I10A 1GDHA 5IZ4A 2VUUA 4NK4A 4YJFB 3E9QA 3F6YA 4J2OA 3VH1A 1LQTA 2ZYAA 2D59A 3KEOA 4FN7A 1EMDA 1L7EA 2BI7A 4Z0TA 3DZIA 2A9FA 2P9EA 5TS3A 1RM3A 3M1AA 2JAHA 4RVFA 4CLOB 5CPBA 3IC5A 2JHFA 3ITDA 4B7UA 4MP6A 5G0WA 3RI3A 2AQ8A 4TRRA 3ETGA 2QZ9A 4WNCA 2IDZA 4PN3A 4BIIA 2H6EA 4CLOA 4XYGA 3P5SA 2E4AA 3DHNA 5G2OA 2VN8A 1SAYA 1YL6A 2UAGA 4R5MA 2DKNA 5BSFA 1UXIA 1R6DA 3ROKA 4Y6SA 4FFLA 2BGMA 5CDGA 4HXYA 1YE3A 4HFNA 4BUCA 4HNGA 2XF8A 1ZO8A 4F6CA 1HDZA 3I9KA 3WB9A 4J43A 3AUTA 3A14A 1T25A 3GY0A 3DBLA 5CDSA 3EW7A 4PLCA 2VSUC 3HB4X 4OGWA 3AY3A 3LT0A 1DRVA 1E3IA 1CDOA 3GA0A 4J1SA 4DGSA 1PEDA 2J3HA 4NFHA 4BNWA 1T1RA 3GMSA 3ICCA 1XA0A 3PYLA 3JSAA 1E1MA 1GYPA 5JY6A 4I9HA 4YQZA 2QW8A 4AJEA 5I7SA 1X15A 5AVOA 4QFEA 3EAGA 2WYWA 4FD3A 3EK2A 4CM8A 2GPTA 1KEPA 1VRGA 1TXGA 4N5NA 5A3JA 1D1SA 4R01A 1O8UA 2X58A 3QK8A 1GZ4A 3H9JA 2OORA 4K2NA 3IIEA 3I3OA 2F6IA 1PL7A 3Q0JA 1M2WA 3KSUA 2PKQO 3LU1A 3Q9NA 4M1QA 2X0JA 4QUKA 3L4BA 2W8ZA 2VZ9A 1P77A 4HX5A 3WFIA 4EJMA 3NT5A 4E6PA 3D5TA 2HMSA 1ULSA 2GSDA 5CDYA 1U9JA 3OJLA 4FS3A 1DUBA 1P1JA 1ZH8A 2NNLD 4NBUA 1E7QA 4Z0MA 1YOVB 5HS4A 3QP9A 5T64A 4E21A 1DB3A 5JNLA 3AFMA 2ZQZA 3GG9A 3RJ5A 2V65A 2NACA 4D45A 3S2FA 5TIIA 4BNIA 1WDKA 5DF1A 1A72A 2V6MA 4GVXA 4D7AA 2W2KB 3DC2A 1UDBA 1V3UA 3GF7A 2DEOA 3A1NA 2EIHA 4GBJA 3ZWCA 2OGUA 1Z74A 3EVTA 3ZHBA 1HE4A 2CDAA 2GNAA 3MJ4A 3D3WA 5C7IO 3BTVA 3RSHA 2PBPA 4FFMA 1HNUA 2PGLA 2E6UX 3WNVA 3HRXA 4E33A 3GNSA 4WKGA 2DM6A 5KTKA 4BKRA 3NKLA 1YL7A 4NH4A 5L51A 4OXNA 1DC6A 4MP3A 3U49A 5AOVA 3WLEA 3FHLA 3TL3A 3HE3A 3FWZA 3DZGA 4WCFA 2IXAA 3DR3A 3JQ9C 3HSKA 3HWRA 2YV1A 1LLQA 4NDNE 1YVEI 1LC3A 1Q0LA 4ROSA 2AG8A 1B0AA 1ULUA 2W90A 4TZTA 1YBVA 1N6DA 5CHEA 5A3VA 3KTKA 4IQGA 3K2BA 3UH1A 3G1UA 4BNHA 1ISIA 3Q11A 5DZKA 4GL4A 2GN4A 5A9SB 4J1QA 4LW8A 1FDUA 4QQRA 4IZDA 1D8AA 1KY5A 1T24A 1X13A 1KEVA 3DBHB 1BSVA 4QECA 1E1NA 4JROA 3G64A 3MT6A 5G0SA 2OUIA 4NIMA 3WSVA 5JO9A 1JKFA 5JY1A 4G2RA 1LDYA 4DI1A 1ISGA 1T2FA 5T57A 3JQFA 3GRKA 4JP3A 3LT4A 3VHRA 1NAIA 4B4VA 2VOEA 2VREA 1PX0A 4E5PA 2X4GA 1A71A 5T6BA 4E5MA 3OICA 3DZKA 1LDMA 4RQUA 1V8BA 5EN4A 5BNFA 3VZQA 3NRCA 4MPDA 3U62A 4DQVA 3PTZA 4ZD6A 1CERA 3PWZA 1H94A 4AJKA 1U3WA 1YRLA 1DAPA 3PJFA 2WSBA 4FNDA 2JAPA 1V0JA 1Y8RA 1PU2A 2VRCA 4UUPA 3KTHA 5DUCA 2YV3A 3COSA 4RF3A 4WCZA 2PG8A 4ELXA 2EW2A 3VDRA 3WQQA 3ZU4A 4CMHA 3HDQA 2QRKA 3K5PA 4J3FA 1SZOA 3DBRB 1I2ZA 1RM5A 4PLVA 4JYJA 4HADA 4KTVE 1GEEA 4Z0HO 3KEQA 4CM9D 3PYMA 1GUZA 2Q2QA 1Y8QB 3CMCO 3H9UA 1RPNA 4P38A 5JMPA 4EMMA 1GR0A 1HL3A 2PV7A 1H2BA 2EW8A 4QT0A 1PL6A 2EWMA 1GUYA 3GZNA 1E3JA 2D2IA 4BNUA 1MB4A 4CMGA 1E7SA 2CZCA 4CM3A 1EUDA 3C7CB 3PGXA 3EUWA 3K8ZA 4HC8A 3V5NA 3AUUA 4NZ9A 3UCEA 1C0KA 5F5LA 1B8PA 3F1KA 2QG4A 3MJCA 4NBTA 1BVUA 4XGNA 5JAIA 4R54A 2HDHA 3U4DA 1I8TA 1JXZA 2FWMX 4N5MA 3E5RA 3O26A 3GAZA 3DJAA 4H16A 3PP8A 4XYLA 2RIRA 2ZL4A 3JD0A 4HWKA 4WNIA 4YJDA 4WLVA 5LC1A 3GK3A 5B4TA 3NJDA 1I24A 3AOEC 3DQPA 1LU9A 4WECA 1UR5A 4YAIA 1H2HA 1HF3A 1AXGA 4XRGA 3R1IA 1ZUD1 2GTRA 1MLDA 2AXQA 1UYVA 4QEDA 5IXYA 3ZWAA 1DAOA 2IEBA 4J1NA 2J5GA 5IKLB 2FN7A 4GMGA 2ZCUA 4MVJE 4AJ1A 2GDZA 3VZPA 3NEPX 4I1IA 3HHPA 2IODA 1BTOA 1MG5A 1P1FA 2EJ5A 4PLYA 4ZQBA 4YB8A 5GMOA 1QYXA 4CM4A 5ADHA 5U9CA 3NDJA 4FB5A 4QXMA 5BT9A 4GHNA 1LRJA 3IUPA 1PJ4A 2VSUA 4FJWD 4JFCA 1TEHA 3G49A 3MCVA 1EVJA 4PG4A 1EBFA 1DIHA 2O7SA 4W82A 4BNYA 3DAPA 5A5EA 3I6QA 1TT7A 3T7CA 2SCUA 4JQCA 3VH2A 2P4QA 3EYWA 3C7AA 4XDZA 2UYYA 5CG1A 3JD3A 2V6GA 3PQDA 4K9DA 4EJ6A 1SCUA 2Q4EA 4DVJA 4O5OA 2DT5A 3LC2O 1DOHA 4NBRA 2BGLA 1PJQA 3N7UA 3NTOA 2UVDA 1J5PA 3PIDA 2BKAA 3I52A 1PGNA 1HE2A 4JNKA 2HK8A 3L0DA 1K39A 2W3PA 2C29D 4FZWA 4KUHA 4J4TA 3C8MA 4I5FA 3SEFA 5KOIA 5DCUA 3K50A 2Y66A 3Q3CA 4B3IA 1IZ0A 1ADCA 2WDZA 5KJ1A 4NBWA 4Q3DA 3H2SA 1YS4A 2P4HX 4PLPA 5JFOA 1WZ8A 1JAXA 1T4BA 3HUDA 4KQWA 4UEJA 4YA6A 3Q7HA 3UGKA 3F9IA 4EEZA 1C14A 4LN1A 1K3TA 3BTOA 1XU9A 2HMUA 2HJSA 4YRDA 4DMMA 6ADHA 3VVCA 2ZYDA 4D42A 3AI2A 1KVUA 4J0FA 3E9NA 1GV0A 4E5KA 1NVGA 3IP3A 4RPLA 2UUOA 3T89A 5KDRA 1UXKA 3TSCA 3ANLA 4DIFA 1YG6A 5I7EA 1XKQA 3C24A 1QLHA 2VNAA 4PVCA 2FSSA 4HNHA 1SBYA 3ZNPA 1WLYA 2XOXA 1BVRA 1F0YA 4B8WA 4ZGWA 1K5HA 2HMVA 3L77A 1GZ3A 4UUOA 4W6ZA 5L9AA 4JN6B 1UP6A 3AOEA 4YJHA 4EI2A 2A4KA 3KSZO 2NP9A 2VTEA 1T2DA 2DAPA 4I08A 4R16A 1GUFA 2F9IA 3B1KA 1TI7A 5IXSA 3ZHZA 1U3TA 4XD2A 3L6OO 4IIVA 3P2OA 1GV1A 4XCVA 4CV3A 4ID9A 4RJTA 4IDEA 3VKVA 1U8FO 4WLEA 5A1TA 2B4RO 3RBVA 2IYOA 1F06A 1GZ6A 1ISJA 3ZHYA 1ZXBA 3S2GA 2ZQRA 2Y1GA 5JPIA 3H5NA 3RFVA 4YLHA 2P91A 1ZMOA 1I5RA 1UIYA 3LVFO 1IPFA 3L4BC 4OKNA 2IZ1A 3SLLA 1SOVA 3ZV4A 1BGVA 1F8FA 4BO5A 1QYVA 3JQBC 3OMLA 4WOKA 5DULA 3S1LA 1U4OA 4RLSA 3UN1A 4CR6A 5TLSA 1DRWA 4O63O 1V3VA 3RC2A 3NJBA 5H82A 2ZJ0A 3PGQA 1DIRA 1E3LA 3JQEA 1M66A 1PS8A 3VPGA 1YO6A 3GHYA 1TYFA 1PQUA 3DO5A 2FZWA 2YFHA 4XDYA 3GF4A 4BNLA 3Q0GA 3HQ4O 1OOEA 3TV5A 1FK8A 3UW3A 5CFZA 5DU6A 3SWXA 1E3EA 4BKOA 1JN0A 2ZB3A 2PGDA 3WG5A 1ZW1A 2VHWA 3TN7A 1HLDA 4KDFA 3ZV5A 1OD2A 3MZ0A 1D4FA 1NPDA 2VWGA 1IY8A 4GSKA 4FSHA 3UHAA 1JDJA 1XNYA 2VSSA 2GN6A 2NU8A 1SMKA 4NHEA 4ZDFA 3JYLA 5KVSA 4BMSA 5C37A 4L76A 1I32A 2XXJA 3ZDFA 1I3NA 4XX0A 1HEUA 2IRWA 1LX6A 2JHGA 4TRMA 4TVBA 4EYEA 1LDGA 4UEOA 3D4OA 3IOYA 1EDOA 1Q7BA 2Q4BA 5EJ2A 2FR0A 1HDYA 3NJ8A 4HY3A 1W2XA 1EQ2A 4ND2A 4LRTB 3KRTA 1XDWA 4LCJA 1ZSYA 3GEGA 4AJ2A 4RF2A 5LDGA 1OC4A 1Z6ZA 3OC7A 5L4LA 1EVZA 2C2XA 5DBFA 3GF3A 4FOSA 3GG2A 3D3EA 3GDOA 3GN2A 2WE8A 1MXHA 4CM9A 2V6BA 4D41A 1PQPA 2AHRA 2EV9A 2AA3A 4PRLA 4DYDA 1BW9B 2TMGA 2J6IA 1SOWA 3MOIA 1B2LA 2C7GA 3ONEA 1RWBA 5HWSA 3JQFC 2JD0A 3TFOA 2Z1NA 2C07A 4IDFA 1DHRA 3E03A 4J0EA 4MOUA 2GR9A 3OJ0A 1B7GO 5L53A 3TOZA 2YZ7A 1OFGA 2J8ZA 1DFGA 4JVTA 3JQ8A 2OOSA 3I9NA 3MYBA 1NP3A 4GH5A 1SNYA 1UP4A 5FFFA 3KTJA 2D1YA 1W73A 3AM4A 2VSSF 2CVZA 1EFLA 3JTMA 1ISHA 1WZIA 3BMNB 5JCJD 3WGYA 3AOGA 3D5QA 1GQQA 3H02A 2H1SA 4FOOA 4U18A 1DIGA 1LRKA 1P1RA 1U1IA 4AJLA 3JQ9A 4N7RA 3V8BA 1N6FA 3WJAA 1A7AA 3PHHA 4CMIB 2F1KA 4M49A 3W6ZA 4EUFA 3KYDA 1P0FA 3KTIA 3PQFA 5TJHA 3QA9A 4A10A 1PZEA 1R16A 4IQ0A 4F6LA 5HRUA 1QXSA 2Q2XA 4JCOA 3DL2A 5C90A 4RPJA 3DBVO 2X5JO 3RUDA 3ST7A 4H7PA 3DWFA 4U5QA 1VRWA 4O1MA 4RVDA 2ZQQA 1EK6A 1K2WA 1X0VA 3O38A 3C1AA 4ALIA 3ROQA 3QLJA 5ER9A 3P85A 4IGEA 1PS9A 3OFSA 1XNVA 4E30A 2PD6A 2PZJA 3L9XA 4FJ1A 4FPXA 1YONA 5AXDA 5BSHA 3DORA 4CQMA 4O6VA 1X14A 1N7HA 3Q2IA 5CEFA 2NWQA 1Q7CA 4ND1A 4J9UE 2X0RA 2VYNA 5DT9A 4BL5A 1K89A 5H83A 4J2HA 1QV7A 1E7MA 5I9MA 4CMJA 2J5SA 1ZEMA 1SB9A 3NDIA 4L9RA 2D0IA 4NI5A 3AY7A 2O4CA 4EEXA 1MUUA 2YW9A 2VUSA 3KUXA 1ZSVA 4GWGA 3UVEA 4DPKA 1PJ3A 5KIAA 1LI4A 2X5KO 1DCIA 1P1KA 2E48A 3KLPX 4P4NA 3RAJA 1PGJA 4I5GA 2UV8A 2PZKA 4RZHA 2ZL2A 3HINA 2ZQYA 3Q1LA 2AEJA 3RWBA 2Y1FA 1ADBA 2WE7A 1E6EA 1X0UA 3HFGA 3E82A 1F17A 1P1IA 4Y8VA 3VVBA 2Y93A 5L40A 2VQ3A 4MXIA 3RSTA 1ZJZA 2EEZA 3K9QO 5F5NA 1LBEA 4HKTA 1VC2A 2ZJ1A 1HXHA 1NHGA 1H93A 5IJZA 2FSVA 2NU6A 3GH3A 4J49A 1H0KA 3WFJA 3NX4A 3M6MA 4PLGA 3WTBA 3PXXA 4Z9FA 4PZCA 3H5RA 5G4KA 4TQGA 5JAQA 5I7FA 2A7SA 3WLFA 2VSSE 3T8BA 1A9ZA 2PTGA 4YT2A 3ULKA 1ZCJA 3WJ7A 3L6DA 3ASUA 4ND3A 1A4UA 1NVMB 2I99A 4XIYA 4OHUA 5JCXA 3D4PA 5I8WA 3E6AA 3ZWBA 1HKUA 5KJEA 2G17A 1AHIA 1J0XO 3NDRA 4LK3A 4ALJA 1GL3A 2DUBA 2OBYA 4YVFA 3ZW9A 3PFWO 2QYTA 4DMLA 3FF4A 2WJPA 3R0IA 3WOHA 3C1OA 3OQBA 3UOGA 2JCXA 4LMRA 3VPFA 1YB1A 2VWHA 4WLOA 4J7UA 2Y1EA 1BXKA 1NASA 1SB8A 4QTZA 4DLAA 5JE8A 1FDVA 4OSPA 1MA0A 3TZ3A 3TNLA 2Y0EA 5DN9A 3RFTA 1NYTA 2VYND 3JQ7B 3FF6A 4ESOA 3ZU3A 1N9GA 3QREA 4ZRNA 5MDHA 3JCZA 2GZ2A 2OMEA 3WYBA 1IHYA 4FNBA 4JJGA 3UUWA 5JYDA 3HE2A 2VZ0A 5AXBA 2ZCVA 3SC6A 3FPCA 1YQDA 3C7DB 2C20A 3Q2KA 4TRNA 2JJYA 5ITVA 4U0KA 3ZU2A 1DO8A 2XXBA 5DBGA 3HDJA 4BV9A 4NEKA 1RJNA 3H0SA 1DPGA 3L6EA 2PPYA 5ENDA 2VNSA 1LXCA 2JKVA 4IDAA 4Z9YA 3KSDO 1Q51A 4JWVA 3KTDA 1S7CA 2HQ1A 3VTZA 1R15A 1I36A 5C7OO 3PHGA 4OXKA 4GGOA 4G5HA 4MVJP 3K6JA 4P8RA 1O6ZA 3UCXA 3ZGYA 4KTTE 1LUAA 3BXXA 1ZNQO 1YBMA 2AE1A 3OP4A 4BKQA 1TT5A 2EP7A 3U9LA 2QQ5A 1LEHA 4P4LA 4PZDA 3CEAA 1E1KA 4PG5A 1OC2A 3R3JA 3RBZA 3TRIA 1BG6A 3DZBA 4P4GA 4CUZA 2TMDA 5FEUA 1FDWA 2AQKA 1PQWA 4QO7A 4YAJA 1RJWA 1VSUA 2CD9A 3DAFA 4YJGB 4IMRA 1RYDA 1R12A 1ID1A 2EXXA 5B4UA 2HSDA 5ITWA 4QIJA 3BA1A 4RL6A 5IG2A 1PGOA 1ADGA 3CE6A 3ZI0A 1DXYA 3VOSA 5DP1A 2VZ8A 1P33A 1SZJG 3TF5A 3WGOA 2DLDA 1C1XB 3I47A 2IZZA 3ENKA 4J4BA 4E31A 4CLRA 3N74A 2X22A 3MTGA 1E3SA 3OJFA 4DQUA 3U09A 1NQ5A 4J90A 2Q45A 3HADA
chains in the Genus database with same CATH superfamily
4PGAA 3U4HA 1SG4A 1ZN8A 1VMEA 5DPMA 2D62A 5EPOA 5ALPA 3A4VA 3ZQUA 2X6TA 4DR7B 1H2YA 1EFAA 2F7SA 1G9XA 5DYYA 3G6KA 4RIGA 3DE2X 1PJTA 2W4IA 4IAOA 4M8NE 1WXDA 3DXZA 4Q01A 2PBRA 3N8DA 1FS4A 3MGBA 1V6SA 2B2NA 1SUAA 5A5DA 3NAQA 5EOVA 3PIIA 4NE7A 4YMGA 1GZ5A 4HR7A 2VDWA 2YMQA 2ZL3A 3A3PA 2EAUA 1Q22A 3JVUA 2A81A 1MO4A 1NL3A 4UM9D 4PZAA 1T36A 2W4QA 5G1NA 3A1SA 2J5KA 4Q4DA 4DQXA 4ZO7A 1EQUA 1HZZA 1W4BA 2QD5A 3RT9A 4PGFA 4HQNA 1Z7YA 4XM1A 5EWMB 1PVOA 5HFNA 1VKOA 2H4YA 3SR0A 1SKYE 3ZTTA 3VHLB 3TZKA 1RJGA 4CKWB 5ECYA 1GA6A 3OQIA 5J2TA 1MDBA 3PRJA 4PW0A 5LA6F 5CVUA 4C43A 1XR3A 5T7BA 5AVVA 2AR7A 3VGJA 1VHJA 1H9AA 1U0GA 4ETMA 1FFSA 2CLCX 4A27A 2O1EA 4C1BA 1QORA 5DN6A 2AN9A 4CZ2A 3S2UA 3BJEA 1W88A 1O2DA 2RGUA 4KJXA 1OYWA 3DS8A 1E0KA 4TKVA 3KFXA 3THOA 5F1KA 1WEKA 4RWEA 3IVAA 2HX1A 2X8JB 3JAWA 3W90A 3GLFB 4G8DA 4UM9B 3HFJA 5AM3A 4HZIA 5KSZA 1P4GA 3RHSA 3EH1A 2VH5R 5K6RA 4L7VA 5JFTA 1LGYA 1PJLA 4EEKA 2UU9B 4H1HA 4AN1A 2Y1XA 1EFVA 4K26A 5EI5A 5C8YF 1NXXA 5DHUA 3ZY5A 1E5VA 4JSBA 1ZP6A 3LO8A 3N75A 4X60A 1J0EA 5EYPB 4BYMA 2D7DA 4YXFA 4X8HA 3QEAZ 1WUJS 4RVSA 1P0PA 3V48A 3OIDA 1YZ3A 2F9IA 1N7GA 3EXHB 3T7IA 4F60A 1Q44A 3INGA 4P31A 5TPWA 1JEOA 2EBWA 2H2IA 2A88A 2VHYA 2I3GA 4M7OA 5JCPA 4G56A 4KRXA 2ZIGA 2WZDA 1EE9A 1P5FA 3UV7A 1KEZA 2YHIA 2FZGA 1B8UA 1DBVO 2QTGA 2PGIA 2ZRJA 4MWEA 1JF8A 3AERB 5JNTA 3PRKE 2AOUA 4GGPA 4BVAA 5EIEA 5E9WA 3G17A 3DYVA 4O08A 3EX7C 4ZOEA 4MDFA 1R1DA 2NXEA 2AUTA 2WWXA 1KO1A 1FS5A 1GY8A 4PYQA 4ER7A 1Y7HA 2YXNA 3ORSA 3V1YA 3TVUA 3GFGA 3RYIA 1J39A 1EEXB 2NOGA 1T34A 1YRAA 3S68A 1Q20A 3AUJB 4MULA 1T5BA 4G1MB 3IBBA 5JD3A 1VKRA 4O59O 5FTJA 4E4RA 2OB2A 2WEKA 2CYCA 1LQUA 3L7BA 5FNVB 1Z2CA 4BO9A 4DBVO 1O5IA 3MWEA 1FRZA 5KI6A 1VL0A 3HINA 3JQAB 4OGLA 3STHA 1JMYA 2HMAA 3B1JA 3KVRA 3EZ7A 4MPJA 5DISB 3TZCA 2GD2A 5EE0A 3OVMA 4AJ9A 5HQTA 4AN0A 3LE8A 3DEIA 3S2EA 4EHHA 1Q52A 1RQPA 4GRDA 3CLRD 4CF3A 2F67A 2O3JA 2V4ZA 1ZHHA 2F9YB 5CW2A 1RADA 2QUHA 3UY4A 1P8AA 4HPWA 4CBVA 4C3VA 3GGPA 4D8TA 4XEHA 4KUGA 4GPZA 4R1NA 4CWAA 2VF5X 1XZAA 4F5ZA 4Q4JA 3IKTA 3JALA 1M5TA 1V8ZA 2WD7A 1NQAO 4X6LA 5EE1A 3UK7A 4JDUA 3RQSA 4TWZA 4WGGA 2PYZA 1FPMA 2EU8A 2HA4A 4LRYA 3AJAA 1JVBA 2VYCA 5F2EA 5JYBA 2ZTLA 1RKVA 3CIOA 1NN0A 4GX5A 3B3GA 1EK0A 4M1ZA 3QG1A 4RHYA 1Y1KE 2Z6AA 3QVUA 4OJMX 2C7QA 1UUFA 1YNOA 3PHCA 5JZ9A 1UQRA 1XKXA 2QG9A 5JZVA 4ZARA 1AUPA 3AR2A 4R8SA 1A4XA 4M87A 5H7XA 4EFKA 3K2EA 5DM1A 2P3OA 5L3SB 1CR2A 4MW1A 1Z35A 3PGMA 1YJ5A 3LCUA 4CF5A 3O21A 4UMVA 4C22A 5HJ2A 3T0IA 2QNRA 2RI1A 4LK2A 4GEGA 3HGMA 3CLHA 4N5DA 4CKEA 2PD3A 3IQWA 4KZPA 1YTLA 3GUCA 4WY2A 3THXA 1VYHA 1B15A 3LCRA 1E5XA 3ZDQA 4MCHA 3C97A 5A5VA 3F47A 5AHKA 4FT4A 1QHEA 4DQKA 2ZJ7A 3R5JA 2X1LA 2VH2A 1JKJA 1R00A 4EIWA 2BHRA 3D31A 2TSYB 3EWNA 4TMWA 3VRHA 1HQDA 2PSDA 2ZBRA 3C8HA 3SDBA 1OY1A 4NMLA 5JFGA 2RH8A 2JI8A 5C18A 3BMQB 1SVMA 2GD1O 4QLAA 2QM7A 4Q21A 4IIJB 2VHZA 1EXNA 2EJUA 2O06A 2ZT6A 3MSXA 3OX2A 1FDSA 1SCIA 4FZJA 5INFA 1UJCA 5E4JA 4FZWC 2QYHA 2X3FA 2DJ5A 2J6CA 3KZXA 2HCBA 4OQ4A 3HC7A 4WY5A 1QHGA 1UDRA 5EPUA 4P83A 2NXWA 3JZIA 2JJ1A 2NNWB 4IWXA 1IRIA 2CLMB 5SZIA 3BPPA 5E38A 1WCXA 2YBDA 1U7PA 3DBIA 3L1VA 1WEHA 3A9WA 1ACLA 4WZAE 2OHOA 1HI9A 4MMZB 3RVDA 4RMIA 2HLHA 2O2IA 3KXPA 3UB4A 3PV0A 4MUGA 4EYSA 3GGCA 5BSKA 5CXQA 4FQ7A 4X7MA 3AU9A 2PJDA 4UDNA 3DOIA 1PHRA 3H0JA 3OT4A 4L9WA 5COBA 2Z8XA 4CDRA 3GA7A 1EM8A 4HNSA 3FCUB 4Q15A 1KVQA 1EBUA 1WDTA 5DX8A 4R6XA 2JRLA 1FOEB 5GOZA 4AZSA 3QLUA 4XR9A 1GCIA 2P2GA 3OZFA 4N5IX 3WXBA 5ALOA 1ODJA 3L7YA 4NABA 2A33A 2ZRQA 2QR5A 4H7DA 1VE3A 3KVVA 3Q4GA 3G2LA 1JGTA 6REQA 2P9QA 4QSMA 1Z0DA 1THZA 1ZIYA 4HWPA 4ZAFA 3WGNA 1GFSA 3QWDA 3UJ3X 3SNHA 3C3AA 1W44A 1FFBA 5A71A 1G2IA 1Q57A 2WG0A 3L3SA 4IWNA 4PFSA 4XRRA 1LS1A 1Y9EA 3RRZA 1M1NB 5KWSA 3V80A 1C1XA 4LYGA 3MW8A 3STYA 2BI8A 2FP4A 2A0XA 3K9CA 2HSJA 3E2PA 1KYYA 4L6AA 4Y9DA 5EP2A 3RTEA 3Q15C 2B6HA 2O5RA 3TXAA 3VJLA 2B92A 4E5SA 3JU3A 2WQZA 4LRQA 2X8LA 5JYEA 5L3SA 2XECA 5KYNA 3FMFA 4KR0A 5AVRA 1PNOA 3IQXA 4K6MA 1Z38A 3ZCRA 1OWNA 5LA6B 3OZSA 1H0HA 1VG0B 2GPNA 3JWGA 1B3BA 1JPVA 2Z0MA 3GLSA 3VNSA 3LTNC 1GTG1 3R41A 1E3MA 4NMHA 2JJ2D 2BRUA 3A6KA 4NCXA 3EA4A 4EKNB 2DFKB 4IH1A 4UXJA 3H6GA 1U99A 1QTNA 2F8MA 3WWEA 1A2BA 2GAIA 1XZHA 5G02A 2EKPA 1G6Q1 3J81A 4GL2A 4YY3B 2NQ2C 5AMXA 3AKYA 5KBYA 1OI2A 4L2IB 1V9SA 2B98A 1USKA 2CB0A 4NECA 4MHSA 3EC7A 4ZVNA 3CSDA 3RF7A 3V2IA 4Q4AB 3NNSA 2PH1A 4RKFA 4PS1A 4Y2TA 2PRSA 3TNJA 3ZN2A 1ZR4A 3SFTA 3LY5A 2WZCA 4K28A 3GMIA 3OMWA 3D6HA 1ITZA 4LTNA 1XRMA 2JGMA 3EARA 3KDPA 1D7AA 2W71A 4JGIA 5EZSA 3QW4B 1AN0A 1TKCA 1Z5VA 4RM2A 2VTKA 1MH9A 3HXPA 1PO7A 4UD6A 2AG1A 4D4IA 1X70A 3TG8A 3CHYA 3HRHA 4E5UA 5MHTA 3CO0S 1XZMA 1RPAA 2UUPA 1NPTO 1QMGA 3GT4A 2FW8A 2V7WA 4Q3AA 4RTNA 1YXMA 2W2XA 4BV3A 4D0NA 5KJ6A 4TV9B 1I7PA 4URFA 3ETLA 2JI7A 4OLFA 3ZZMA 1F5SA 4RGVA 2YRFA 1BNCA 4INZA 3DLCA 2NLOA 1DIAA 1CFJA 3N6XA 5E2BA 1NW8A 3HJAA 2CBYA 1HQYE 4TMKA 3RF6A 3I09A 3KT3A 3U3XA 4JX8A 3AFNA 1OVMA 4LXQA 2MJLA 4WKBA 3N5CA 4MWBA 2A67A 4TTSA 2HU7A 3GFSA 3CONA 3I2GA 3VR3D 4WQMA 3NOQA 2QU7A 1UDCA 1M0SA 2NVWA 1ZVMA 4KYTA 5T4FA 4RD4A 2V1UA 3G0DA 2ZRMA 4S05A 3OKCA 2DLNA 3DEYX 3HP1A 4BNGA 2VT7A 3CNNA 4A9AA 1U9IA 2H51A 1PJCA 4PHGA 1WUHS 3AX6A 3SR3A 3C7KA 3B85A 1RRMA 3GUVA 2XUDA 3JASA 4AJHA 3C6YA 3B3QA 5DKFA 1FUKA 3OT6A 5B2ZA 3D8SA 3BA6A 8GPBA 3RUPA 3M2TA 5B6IA 4WXEA 1PWZA 2QY9A 1DAMA 1OJLA 3DKPA 1DTWA 1WSWA 4UNNA 2H07A 2X41A 3RD5A 4JI4B 1NIJA 1TK3A 4MAAA 1GAQA 1RHRA 5TMEA 2D6FA 4S12A 3A6LA 5DNYB 3A4MA 1XRNA 1E9CA 1RRVA 3HCWA 5K2OA 3I4LA 4AKSA 2O0JA 4XWAA 3GLFA 2AOVA 4PLWA 1P80A 4JJAA 2IUSA 2LVBA 2WY2D 2J1LA 3CVVA 4JLMA 4C7VA 1YCGA 721PA 4L0DA 1L0BA 3NJ4A 4I55B 4MW9A 5JDIA 3HLYA 4AO6A 1W88B 2QRNA 1U2DA 1W6UA 3QGMA 2UZFA 4URUR 4EQ6B 4DHWA 1OPRA 4R1MA 2YUTA 3GARA 1AT1A 3CNHA 2X9VA 1FSPA 4G4SP 3BKWA 5H3LA 5HJEA 2ODNA 2R00C 3IEIA 3NWOA 3QX7A 1CP3A 2KX7A 4FFBB 5E9QA 3OQIB 4XUCA 5J2TB 3ZUGA 3Q5GA 1JBKA 4ZO8A 2J5IA 4YLGA 2EL9A 4TV8A 1ZD9A 2KHZA 2ZYUX 1Q7TA 3IESA 3WGHA 3WGGA 4L5BA 3PRYA 4X85A 1QGOA 4EPRA 4P2BA 4K46A 5FUQA 4ZU2A 4HTAA 4NULA 1DI0A 2ZREA 3H13A 3BIFA 3NU1A 2B4KA 2OCAA 4FNOA 5CB8A 1K7YA 1C50A 1ZOPA 2H1WA 1I1NA 3C6QA 3VR5A 4F5DA 5B57C 5IBRA 2WR8A 3MMPA 1QYRA 3QVGB 4D82A 5DP2A 4E1BA 5KC9A 2ZDHA 1IL0A 1Q0SA 1TYCA 2ZUCA 4WH0A 5PGMA 4RTRA 1T13A 2HUPA 2F8TA 3KBOA 3SBXA 2F8LA 1CQIB 1Z12A 5K8VA 5AK4A 1U0BB 1GSIA 3BGDA 2HSEA 2FAXA 1XFAA 4OLHA 3DMTC 5GP1A 2YHBA 3BRQA 3EFBA 1WY7A 4QXPA 1HYGA 3MA0A 4MVJF 5FA5A 3TCKA 2YWGA 2W2VA 4L16A 1FYXA 1ULBA 1FNMA 2DHDA 1BCSA 1A97A 1XTSA 1YHZA 4ED9A 5DL1A 2OSBA 4DCCA 3AWDA 4ND4A 1YJCA 2R25B 3V8MA 3FPGA 4QPDA 4WHMA 3DWIA 3PNLA 1O9HA 5F1PA 1FRQA 2ZRCA 4QSHA 5SY4A 5G0UA 4JOTA 2Q29A 1I94B 2RBEA 4KFSA 3PE3A 4HYQA 1ARZA 2O3UA 2X9NA 4GW3A 4W7HA 4WESA 4HMOA 3KPWA 1KIFA 1VLZA 2HREA 2IUTA 3DGEC 3GJYA 4C0XA 4CYMA 1WMDA 4XAQA 1K92A 1KH1A 1QB8A 5BNZA 4KN6A 1QP0A 4J2UA 2RHRA 1FNNA 2FY8A 2EYQA 2W37A 2WSSD 3KQSA 3U80A 1SA0A 1SCUB 4MLCA 3RKUA 1I33A 3CPSA 3GDWA 3LUAA 1ZJ4A 1ZMTA 3SDSA 3HBLA 3PEAA 3PDHA 2BSQA 3BL5A 2QZPA 2G40A 3MRTA 4D4HA 5C4IA 5C5CA 1W0JD 1Z4IA 2D0OB 2XJ4A 5IVDA 4CQLB 2CV1A 2BZSA 1OYVA 3GEBA 5HKAA 3G7UA 5KKNB 1ONOA 2JLBA 1JHZA 5LZ5A 1E1LA 4GF5A 1Q11A 4HLDA 1FUIA 5EXXA 5HBRA 4TTPA 5DVZA 2W7TA 4JI1B 3U3RA 4QBIA 3ADPA 1ZSNA 4EI9A 3ELUA 1BW9A 4BGIA 3ZWPA 4FMCB 5JH7A 4GP6A 4NOLA 4FBMA 3I34X 3DHEA 3GRYA 4XQGA 2GYYA 4P32A 4K0KB 1WR8A 2IVFA 1N6PA 2D5AA 3AI7A 4M86A 3WK4A 3L04A 3D8BA 2X2PA 1R5JA 1ESCA 3KEMA 1IOZA 1IHUA 5C32A 5L3RA 4KNWA 4WK6A 4JCRA 4KWBA 1T1SA 3W04A 3QENA 5CCDA 3S1AB 1B6SA 1CUUA 2NSHA 2IP4A 2YVQA 3A58B 4XIFA 4HEA6 1T8SA 4LYYA 5C3MA 4NU6A 3JX9A 3WDLA 3DLBA 1YC2A 2AMFA 2O7VA 3HXQA 3CUSA 3TTVA 2CE3A 4EKIA 1MOQA 1NJ2A 2EGGA 3AHEA 2MINA 3D1VA 3T1YB 1Y9ZA 3B1WA 1X7XB 3G2NA 3R6TA 3X1DA 2BZGA 4MVJG 2IE8A 3ZU6A 5JEDA 3TLYA 1XLTA 4I42A 5JBWA 3U4AA 3OCWA 3PNOA 4Q0MA 3ZGLA 2X9LA 4ZWNA 3P19A 1EUDB 2X0IA 2Q41A 4PGHA 4D5GA 3DL4A 1EVKA 4E11A 7MHTA 2CMKA 1GFIA 4URZR 3R4VA 3ONNA 1IQ0A 1MPTA 1DOZA 4E12A 1W4ZA 3VTFA 1JZSA 5LQJA 3JVVA 4O2BA 1DWQA 2Q2VA 4RIHA 3ONDA 3F49S 5KKAA 4Y2PA 4CM6A 2P65A 2QN1A 2XNJA 3KTAB 4V38A 4AKHA 2QTVA 3JATA 4AY6A 2ZE5A 5EIWA 3DT8A 1BN6A 1ZY2A 4R69A 3IDSA 3JQGB 3GFBA 4CMEC 2FJ0A 1GYQA 2VDKB 3ITKA 1HBJA 1HM5A 1R0SA 1LV8A 2OV6A 4NONA 5WRFA 4EG8A 4JB0A 5T3UA 5JAZA 4I3FA 2I03A 2H57A 4UTVA 1WABA 4CUJA 4GZ5A 1YVDA 4OB6A 1O0CA 2A78A 3NHAA 4LZLA 3IO3A 3TQRA 1ZM7A 4N9QA 3SVTA 1KI3A 1RNLA 5KWVA 3WNCA 1EE2A 4KR9A 4CKCB 4ODIA 3OJOA 1AKEA 1RWVA 1ZIDA 2E4UA 3R5HA 3R7FA 4G5RA 1NNSA 5K4GA 2NU7A 4UNPA 1E18A 3RSLA 2NO7A 2VK1A 3HJTA 4FOTA 4EKEA 9LDTA 3KG2A 4IDDA 1GRCA 5DRTA 3UT5B 2BELA 2BVNA 2HU8A 1KZ1A 1PEKE 3EG9B 4PV7A 1MC5A 4EHAA 1NN1A 1OHHA 3I1YA 4IZOA 4F5EA 3IAS6 2IYFA 1TKBA 3TLEA 4I1PA 5DM2A 1NI4A 1KBOA 3IUBA 3MS7A 2FSUA 3BRSA 5CJ2A 3SY8A 5FBVB 1ENOA 4JLNA 5LOVB 3VZBA 2BP7B 4TYMA 2BDUA 4ZYLA 1ADFA 2LR0A 3PQ8A 1JFVA 1LPNA 3UK0A 4F04A 4Q9HA 4U9UA 2PX8A 4N7MA 3G2HA 2PWZA 4R1QA 3MJEA 2QRZA 3AIMA 3BOSA 1ZIXA 3W5AA 3PKIA 1XZPA 4R1OA 2CHQA 1CR6A 1G55A 1EDZA 2JARA 3ZDCA 1V35A 4PAWA 1PL0A 1UOEA 4KIFA 1TB4A 2Z2KA 1EX9A 1LPOA 1U0OC 4PS0A 5ALZA 3N0TA 3NYWA 1BHJA 2YHAA 3LL4A 3EA5A 1XZBA 1I2MA 2QTTA 3G3EA 1Z0KA 4Q39A 4TWRA 3KAQA 3MJRA 2PKQP 2Q5CA 1DZIA 2VJQA 5C53B 1KSFX 3DOHA 3GLFE 1K66A 4BRZA 3NBUA 2HWWA 4GM0A 4E70A 4WOJA 4B0PA 4CMIA 4N8DA 2TMKA 3I3SR 1A9SA 4OIFA 2Y9YA 1V11A 1E69A 2ZSUA 3B6IA 3KJEA 3O4RA 1ZGGA 1L3BA 2IE0A 3NHWA 4E51A 5BWCA 3WJ2A 3D3JA 3FX2A 1NXWA 3FKSA 4DCMA 2O23A 3NR2A 1YR9A 4IHJA 1T3TA 1ZD4A 4LX8A 2QJRA 4GM2A 3DFUA 3EIOA 3RYFA 2ZIEA 1COZA 1EWVA 4KACA 3VZCA 1A9TA 3C3CA 5D3MB 5A7GA 4L4SA 5CCXA 4KVFA 3M89A 1GEGA 3VSBA 3HO1A 3F9CA 5CEJA 1TJ3A 2XKAA 1R0KA 3CY6A 1PK9A 2N47A 3Q10A 2PXXA 3PGJA 3LPCA 1ZUWA 3JYNA 1XN1A 2H54A 2QAIA 4ZODA 2HWKA 4R1PA 4F3NA 5EJGA 2Z43A 2B9VA 3Q6IA 4H9GA 1X7WA 5JW6A 1U8YA 4YONB 5KNBA 5G1SA 5ADWA 3KETA 1JV2B 1EEHA 3GLHB 1RMYA 4N82A 1N1DA 4MVJH 5U1PA 1TRKA 1AQNA 1ZGAA 1SOAA 1DBQA 2I4OA 3K70D 2PVPA 1RPJA 4OH7A 1O95C 3RVKA 3W6UA 3EGDB 1KSHA 4ILKA 2WTMA 4PIMA 3QOFA 3G0GA 4G97A 3AVOA 1F9EA 5L45A 2RBGA 4DJDC 1KRWA 1T43A 3IOCA 3VPDA 4E88A 3CCBA 1XYGA 1JG1A 2Y1DA 3ANTA 3DKVA 2BF7A 2X0KA 1VHDA 4N4AA 4E5NA 1TX4B 3FAKA 4GR4A 4IXWA 3ZGOA 1SXIA 4V0RA 4PIPA 1H8HA 2P79A 4M8KA 5ES3A 1VKJA 4ENVA 3WDMA 4N54A 1SXPA 5KKCA 1SBNE 3NBQA 1U8EA 2DECA 3JQ7A 2HBQA 3ZBPA 1EG2A 5IKPA 2PZAA 3SX0A 1JG6A 4OQNA 1QDLB 1T35A 3GRUA 5IDYA 1H2XA 3HS3A 4CM8B 4S1NA 1FSGA 2PLAA 1CZLA 1HT2E 2R8PA 4FYMA 4R9SA 1KOGA 2Y1WA 1J0DA 3G0BA 4A6EA 8OHMA 1E7WA 3FNFA 5K45A 1MENA 2G83A 2W22A 3R7AA 3SJUA 3BORA 1SEVA 2C4NA 2N1MA 2C4KA 3QKUA 4GQBA 2W43A 3X2EA 4Z3KA 1ENPA 4PQEA 3VR6H 3HL0A 4FFVA 1KY4A 4UZEA 1E2JA 1QVZA 3LOQA 4FYVA 4MIKA 2BM9A 5IVIA 2CSUA 3QMWA 4GZMA 4B33A 2WFLB 5LYJB 5AW7A 1IWOA 2XOKA 2FFRA 3IAVA 4P08A 4AG5A 2QTBA 1CRZA 3EDOA 1DDIA 2OFFA 2HW5A 5K8JB 4A26A 2B99A 4M0PA 1XLUA 2GPBA 3AGQA 4IS3A 3QY9A 5B3JC 9GPBA 2I2WA 1GNPA 3AQ4A 2JA1A 4YHHB 1DBWA 4IIFA 3BSFA 4WKCA 3LTEA 3R24A 1PT7A 4EZBA 4LAFA 4MUXA 1G17A 4EJ0A 2C0CA 4HBGA 1A9XB 1P3Y1 1GTVA 1TYZA 3REGA 2QTFA 3UYKA 3K0AB 2W6JA 1N1GA 3PF8A 1RJMA 2BOVA 2R60A 4YMSA 1RWPA 2VPZA 3K0FB 4ZU6X 4A2PA 1LY1A 4WFJA 1M83A 4DE5A 2YZMA 4MJ7A 4OLJA 2QRLA 1JQDA 1N8NA 2WC1A 2A1UB 4P33A 3ZS9A 5JNVA 1MNQA 2C96A 2D1QA 4ZRDA 3ZBQA 3C3YA 4QFDA 4RCYA 2AN4A 5B53A 3HU2A 1Q21A 2EF0A 2REXB 3RCBA 5BN1A 5ALIA 3INYA 4W5QA 2DWQA 4QPPA 1AURA 4DN6A 3WADA 3IKLA 3RM3A 3V7WA 5AQ1A 3ORQA 1WHTA 3SF8A 2XCSB 2Z83A 1ZFNA 2OCKA 3WGIA 1BHO1 2GK6A 5IF3A 1SFRA 5GIOE 4FDLA 4TMYA 5TGZA 2CLOB 1KFCB 3MCAA 5FOWA 1XQ1A 1NBOA 7ADHA 1HG1A 3ZDBA 2WMYA 3BWDD 3T9FA 3H0QA 3T3IA 4OK3A 5CB0A 3WLRA 1GCUA 3I64A 3FWNA 1PT9A 2Q07A 5AKLA 2W6OA 4LJ4A 2AFHA 2JGKA 3OECA 4I46A 1Z4NA 4A8JA 2FOIA 3GBPA 3PF9A 2GBGA 1VE6A 5FWXB 5H02A 4NNQA 2GBCA 3BB1A 3TW8A 1L7BA 4DCJA 3SX2A 3CBQA 1FPQA 1BD3A 2JGIA 1HMPA 2I2FA 2OGTA 4BYGA 3CINA 2IYQA 3GT0A 3OZVA 4B4UA 4FB4A 1Z8HA 3EPLA 1Y8ZA 1UJMA 4BBPA 4G84A 3WO1A 3RJTA 3AC0A 3AHDA 2Q27A 4PWZA 1V5IA 4LOHA 2YC4C 1IQPA 1U4NA 3CLTC 4GC5A 5FQNA 4XWGA 1NT4A 1QLWA 1FTSA 3U4IA 4QO8A 3PE4A 1Q16A 4HH4A 3ZJ4A 3B8EA 3GRPA 3KYDB 4V0MA 3B6MA 1I7QB 4YP0A 1PD0A 1Z47A 1ZNWA 5K3SA 3I92A 1K5DA 3BSYA 4FK8A 4JVOA 3ABSB 2JLXA 2W8BB 3E48A 3ICVA 2WWGA 3PWSA 4B3MB 1U65A 1M54A 3RHFA 2YDXA 3TQSA 3IHKA 1ZH4A 3UMFA 1HLPA 2GJ4A 1RYEA 3BEOA 2GF2A 3C15C 3NOVA 1K97A 1X7YB 2XTNA 3NV9A 4D92A 2ZUVA 5EUBA 1UBGA 2PU7A 3T7KA 1FX0B 3RUAA 4QEZA 4ACBA 4HEQA 1N6OA 2FMUA 2ZR9A 3F7NA 4YECA 4DEVA 1ORWA 1RP1A 2OHXA 4UBIA 3UC5A 4DLTA 3RIMA 5BRJA 4EHIA 5DI3B 5JXGA 4GKBA 2REQB 3ZOZA 3ZCPA 2AG5A 2C8TA 3VPSA 1VOTA 3CJQA 4XA8A 3SQLA 4A16A 5B5SA 2W2NA 3MPUA 5IKMA 2YXEA 1YKFA 1E5LA 2GK4A 4N5LA 3TQCA 3ZWXA 3LCJA 3WGUA 4K87A 2KM1A 5KYYB 4PXYA 1VFPA 5B1EA 1GG5A 2NT4A 3AR7A 2IEGA 4FINA 4B35A 2EBHX 3RRXA 1QMPA 2JFOA 4Q37A 4OYRA 5JVDF 1H0SA 3ON5A 2XI4A 4M1KA 3R9SA 3L01A 3G0IA 4F3TA 1ACMA 3U7RA 4YACA 3HYCA 2F3TA 3QHAA 4EPVA 4DA8A 3JD2A 3M2PA 5FRDA 4RPIA 2AW3A 3DOFA 3QVSA 2I1QA 1ATIA 4PYRA 4JL8A 4AUKA 1M1UA 4PFQA 5I7AA 1Z9BA 4BVLA 1SBQA 3ZCSA 5THQA 3TGLA 3DLTA 1OLSB 4IR7A 3REQB 1CJCA 4ITRC 4ZA2A 1M72A 4YT8A 1HE5A 1B8VA 3NAZA 1YMQA 1XYVA 1ZICA 2RGEA 4L4UA 2WAOA 3L5OA 2FUKA 1SUEA 1SBHA 2J9FA 3RSOA 3ZWWA 2XGJA 2BH2A 4LSGA 5AKYA 1NXSA 3FOFC 2J5RA 5I7VA 3OFVA 2B7LA 2BGKA 4UAJA 4NWIA 5TY0A 2P2ZA 1WOMA 2NU8B 4LISA 1M7HA 3WL4A 2HPAA 2JAUA 1AF7A 1UF9A 3OIWA 5ENZA 5KAMA 1Z56C 2F9LA 1JI0A 4W7IA 2OHGA 3K73O 4MQLA 5EQTA 1R0XA 4JL6A 5FPYA 3SZMA 5KB3A 4MVJD 1DGQA 2L69A 1FQJA 1K98A 1NBIA 1W4AA 2OFXA 2VP5A 3AILA 3IPCA 1XMXA 5BQXA 1EPUA 1QHXA 1XPUA 3G1TA 3KXKA 3Q9LA 4L73A 3IIKA 1KQFA 3FUTA 3UCFA 3FYUB 3GZ4A 5BMVB 2DUWA 4EFMA 2F2TA 3PYXA 2J32A 3EULA 3R20A 4KXQA 5ALEA 5FJIA 3M7IA 4EA8A 3EZ2A 2GD6A 2A8YA 2QJOA 4C9BA 1HDCA 4EBBA 4N7JA 5BNTA 3AEQA 3OQ1A 4HQRA 2ZU6A 3PLNA 5HKKA 5LUAA 3RJMA 1D9XA 5LZ9A 4EO9A 1YB2A 4PAMA 1KA9H 4FDAA 1M6WA 3GAMA 1T3GA 2ZYGA 4MV7A 1LWOA 3I12A 3FZEA 4IF6A 4XWYA 2I7XA 3WE7A 5B7QA 5HPYB 3DB1A 4P92A 5TEVA 1KVTA 2Q9AA 4HEHA 3IPYA 4K6FA 3WNDA 3AI3A 2E37A 1U7XA 2C3MA 5ED4A 5J4LA 1ST2A 3OI7A 5J23A 2HGZA 1ISPA 3QPDA 1TG6A 2J3KA 3Q8XB 4ZT4A 1R4NB 4ZQGA 4NJMA 3MJVA 2Z1DA 1PTJC 2AE2A 2GCNA 3X2SA 5EJFA 2DTXA 3LWDA 4Z49A 3QG5A 1AKVA 1J2UA 1P7CA 3QYAA 1KJIA 4MOWA 5LQSA 4Q24A 3C6XA 3GEDA 3K53A 4X6UA 2FMIA 2WWRA 3I2KA 3K2QA 2PLFA 3KELA 2Q6OA 4LMPA 4RORA 5J2TF 3MEQA 3CR3C 5KPJA 2HA0A 3KVNA 4JI7B 4XTRA 1RP7A 2NUTA 1NHWA 3N59A 2BMVA 1K6IA 2H1VA 1C80A 1SD2A 2WKWA 4LVUA 2J9RA 4G4GA 4ZVUA 4H7IA 5DHRA 3V1TC 1P18A 3U44B 4WKPA 3D6VA 3ZHTA 2VL7A 3DFKA 1HMYA 5BNWA 2CK3A 4N3CA 2JIPA 3MD0A 1A2OA 4INPA 3TECE 2QVCA 2H5LA 1K4KA 3UANA 3ZZNA 4IILA 4HAUA 3KQWA 1H1LA 4BU1A 2H16A 1Z6PA 3IKVA 1F6WA 4FFWA 4DNXA 3GRAA 1HZDA 3GLTA 1VSVA 4YMWA 1RLIA 4QIIA 1ESMA 4J7CA 1F2TA 4KMMA 1CWUA 3PEFA 1SEPA 1XAHA 2AW5A 4LHSA 4RDHA 4IX1A 2DWUA 3T61A 2HF8A 1JSCA 2GZAA 3FCCA 1QJ4A 5JEEA 3HJCA 2JFHA 3WB1A 3WLAA 4HWRA 1XTUA 1Z5ZA 2CLHB 2WPDA 1MU0A 4ZV7A 1BA2A 2YV5A 4H1TA 2Q35A 1MXFA 3KTOA 2Q7DA 5EZ6B 1WDMA 1ZCFA 3BH6A 3LM8A 5A0FA 4O4HB 5A62A 1I01A 2XWBF 3EDCA 3ESXA 1C3JA 4Z9XA 4MQEB 5CT4A 3MT7A 4L8FA 1ZZGA 1TO6A 4N41A 3AVYA 4EUHA 1EFKA 2HWYA 2I87A 4G8BA 3OZBA 4KNPA 1TFUA 1C3XA 1DRKA 2VNKA 3ZCVA 2IJGX 4UZSA 3MFYA 1Z7GA 3EWSA 1ZOIA 3IOEA 4GMFA 5EERA 1TIKA 2QENA 2Q1YA 3LT2A 1FJXA 2JFBA 2ZSIA 3GVIA 3RIEA 1AUOA 1G8PA 4JA2A 4GI7A 3WYDA 1GG8A 1JALA 2MU1A 3ILSA 4P86A 4KE7A 4IJVA 5C34B 3LWNA 1EK5A 3FHJA 2KBFA 4TV9F 2BPOA 3FBTA 3X1KA 3EMDA 2QX7A 4CM4B 3RAFC 3C43A 3UHPA 4B3JA 4C03A 4OBBA 3TTXA 1OU4A 3UWMA 5BORA 2EJBA 2XSZA 1R5NA 1OBHA 4FCCA 4GFDA 4Z99A 2INGX 5FI3A 5AYVA 5EJEA 4WY8A 4DV1B 2X0EA 2FMHA 4LFAB 2P6NA 2C5BA 2NO9A 3PC8A 2HCTA 3JQ6A 4BX0A 4OGFA 2H2AA 3L8EA 4Y6PA 3QU2A 2QA5A 1RHMA 4WCFC 2ZE8A 4PAOA 2V55B 4RKWA 4WT7A 1E3WA 3H84A 2AX3A 1OROA 4KGDA 4FSDA 4N01A 4U6NA 1V1JA 3D6AA 5EQFA 2Q50A 3KL2A 1JHQA 3W5HA 4O25A 1JA0A 3KYBA 2M1XA 5G4LA 4Z5XA 5DZSA 2RHLA 2BBSA 2NV6A 2P9JA 1UZLA 5LXTB 5K0CA 3U17A 2CVPA 3PUJA 5ICEA 4A0HA 3PR3A 4AMYA 5AVTA 5IS2A 4LOLA 3VUEA 3GLGA 1DX9A 2P6MA 4N49A 2VPQA 4S3MA 2ETVA 3CIFA 4K1LA 5C80A 1U3VA 3GEEA 4K8OA 1L5WA 2XDYA 4LX0A 4MRSA 4L4RA 4XJVA 1EZ4A 1M75A 2RHWA 3DAGA 4NZZA 1ZRHA 1I30A 2B2CA 1L4MA 1BWSA 2O8DB 1TD1A 2Z2IA 1MW8X 1N5JA 2A84A 5HUJA 1OXMA 5KYXB 3DBLB 5FIFA 1UBCA 1G21B 1Y81A 3M1LA 2AF4C 4S04A 2J7PD 1R4MA 3A6DA 2JLVA 1W85B 2QUBA 3OPMA 3RS0A 5CM9C 3GLMA 4MR9A 1KP2A 4B43A 2JLZA 3FN4A 5LDHA 2JIOA 2ZRFA 3MWFA 1RRKA 4OK6A 5KVVA 1PJBA 4INAA 4B7AA 3ZK9A 5F9MA 5B2FA 5AVWA 4EO4A 4G0VA 2NV0A 4O4IB 1QH8A 1RFGE 3NLLA 1GZSA 2FN9A 5CLLA 4DNFA 2Q7OE 4NG4A 1Y0BA 5IT4A 4IGAA 1ZH0A 2ZT5A 4QOGA 5LQDA 1BXRB 3GA5A 3C5CA 1O95A 1U28C 3QHQA 5COAA 2ZAIA 3B53X 3GDFA 1T0JB 5KAPA 1P74A 3TAHA 3EQ8A 4KN5A 3SFZA 4E32A 3BHMA 4H59A 1Z8NA 4UTRA 1HNZB 1J2JA 2BGUA 5J1TB 1H23A 2CVFA 1NMEA 2QI9C 5DTWA 1XAIA 1YQQA 3TZBA 3SXPA 3F8WA 1Z4LA 2PS1A 1NJFA 1Y8RB 5CAEB 1CUDA 3MINA 5FNZA 1KXZA 1QFSA 3M1IA 3BD8A 2HO5A 2QS9A 4JJ6A 1OWOA 4F97A 4X24A 2E5LB 5E7IA 4ZCMA 1JBEA 3PE8A 3AEKB 5BSMA 2PGJA 3AB7A 3NBMA 1IOLA 1TGVA 3AY6A 2PS9A 4QFCA 4Q9NA 3HM2A 1WDWB 3B6JA 4Y6QA 4AUNA 5A0TA 4D44A 3GUHA 2GLXA 2GETA 5D3ZA 2O8DA 1BFDA 3QF4A 5T41A 3H3JA 5DTIA 2FN8A 2VXBA 3P4XA 3WG9A 1SKYB 2QX9A 5CDH