3ZW9A

Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with (2s,3s)-3-hydroxy-2-methylbutanoyl-coa
Total Genus 271
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
271
sequence length
723
structure length
723
Chain Sequence
GSHMAEYLRLPHSLAMIRLCNPPVNAVSPTVIREVRNGLQKAGSDHTVKAIVICGANGNFCAGADIHGFSAFTPGLALGSLVDEIQRYQKPVLAAIQGVALGGGLELALGCHYRIANAKARVGLPEVTLGILPGARGTQLLPRVVGVPVALDLITSGKYLSADEALRLGILDAVVKSDPVEEAIKFAQKIIDKPIEPRRIFNKPVPSLPNMDSVFAEAIAKVRKQYPGVLAPETCVRSIQASVKHPYEVGIKEEEKLFMYLRASGQAKALQYAFFAEKSANKWSTPSGASWKTASAQPVSSVGVLGLGTMGRGIAISFARVGISVVAVESDPKQLDAAKKIITFTLEKEASRAHQNGQASAKPKLRFSSSTKELSTVDLVVEAVFEDMNLKKKVFAELSALCKPGAFLCTNTSALNVDDIASSTDRPQLVIGTHFFSPAHVMRLLEVIPSRYSSPTTIATVMSLSKKIGKIGVVVGNCYGFVGNRMLAPYYNQGFFLLEEGSKPEDVDGVLEEFGFKMGPFRVSDLAGLDVGWKIRKGQGLTGPSLPPGTPVRKRGNSRYSPLGDMLCEAGRFGQKTGKGWYQYDKPLGRIHKPDPWLSTFLSQYREVHHIEQRTISKEEILERCLYSLINEAFRILEEGMAARPEHIDVIYLHGYGWPRHKGGPMFYAASVGLPTVLEKLQKYYRQNPDIPQLEPSDYLRRLVAQGSPPLKEWQSLAGPHGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PEROXISOMAL BIFUNCTIONAL ENZYME
publication title The Isomerase and Hydratase Reaction Mechanism of the Crotonase Active Site of the Multifunctional Enzyme (Type-1), as Deduced from Structures of Complexes with 3S-Hydroxy- Acyl-Coa.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 271
structure length 723
sequence length 723
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.50 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3zw9A03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3zw9A02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3zw9A01
2YDXA 1F8GA 4OSPA 1PGJA 3KETA 1BVRA 8ADHA 2OO5A 3KVOA 1J5PA 5L4SA 3HHPA 3H5RA 5KOIA 2J5GD 3MJTA 3ZWAA 2QHXA 2YW9A 2R6JA 3AJRA 1PJ2A 4UVIA 3K9QO 3ASVA 4E12A 1H2BA 1F12A 4FQ8A 5INIA 3RC2A 4DPLA 3I9OA 1UUFA 4XRRA 1XELA 1TLTA 1ENOA 1HYHA 1NFQA 4RQUA 2ZB4A 3AUUA 5U1PA 4BV8A 4CJXA 1VKOA 2BLLA 4CM6A 1XR3A 4N18A 1EK5A 4FSHA 1ISJA 2XXJA 1LDMA 2VSUE 1PL6A 3EZYA 2O50A 1V3VA 1DAOA 3ZWCA 5JAMA 4D79A 1ISHA 4YLHA 4PRLA 3WQRA 3IUPA 4KWIA 3ST9A 1LU9A 4HP8A 1Q0HA 5KVVA 1VSVA 5G4LA 4FC7A 3JQ8B 3DOJA 3FBTA 1WMAA 5FI3A 5BT9A 3TSCA 3C7AA 5I7VA 5I7FA 3PEAA 4KWHA 4AJIA 1LNQA 2NSDA 3SWXA 3NUGA 5C3MA 3V5EA 3HLN1 3U49A 2A92A 2HRZA 4RPHA 2Y1FA 4Z9FA 3VPSA 5JDCA 3KSUA 1UP7A 4N5MA 2O3JA 1BXKA 4XR4A 4BGUA 4TKMA 1CWUA 4FNBA 4OM8A 1X1EA 4RORA 2OOSA 4GX1A 3KOUA 3COSA 4K6FA 4CV2A 1OMOA 5ER6A 3EC7A 1QYVA 2EV9A 3GOHA 3DHYA 2DUUA 4RL6A 4HFNA 3DXFA 4JBHA 4CV3A 5EERA 3L3SA 2AA3A 4L8KA 4AVYA 4ZDCA 3H3JA 4BNMA 3HE2A 3EZLA 5DU8A 3B20A 2HJSA 3DQPA 5JC8A 4YDRA 3GDOA 3NJ8A 1LJ8A 2AG5A 4Q3NA 4I52A 2AQHA 2O3UA 1SOVA 3ITKA 1X1TA 4DIFA 3ONFA 1NVMB 5I8ZA 1L7EA 3UCXA 3GZNA 3OF2A 2C54A 3K6JA 1EVIA 3R3SA 1DBVO 4BNWA 1A72A 3PXXA 2Q34A 1DPGA 2FR8A 3GEGA 5T67A 4FC6A 3IKVA 4FDAA 4M55A 3JQ6A 4R01A 5DTWA 4E5KA 4CMJA 1I3MA 3JQAB 1E1NA 3HDJA 3RUIA 1D1SA 2P5YA 3OJLA 4H15A 4M89A 3SC4A 3PP8A 4EI2A 1VE9A 1U3VA 5E0SA 3BYZA 3F6YA 3JYNA 4J9UE 1JXZA 2OFPA 4ALNA 3TT6A 3NGLA 3PGXA 3MYBA 1U3TA 2G17A 3AM5A 3I4FA 3DWFA 4PN3A 3RU7A 3HUDA 1GZ6A 3ONEA 4WCFC 2OL4A 5CPBA 3LU1A 1GEEA 1P1JA 3T88A 1YVEI 4NH4A 1Q0LA 4XB2A 4Q3CA 4RCVA 1UYVA 2IRWA 4IS2A 5EL0A 3C1OA 3QQPA 3JQCA 1Z7EA 4R3WA 3TNLA 2JD1A 2VX2A 1E0DA 1IOLA 1P1IA 5DOVA 1PWXA 1KC1A 1XU7A 1UYSA 4WLFA 3RSTA 2G82A 4BQPA 4GM2A 1VJ1A 1YQXA 3ZU4A 4PLTA 1P77A 4CQLA 3ZW9A 1I2CA 4EUFA 3P2LA 1BXGA 1GV0A 1LSSA 3C1TA 1WMBA 2EKLA 3EK2A 3Q0JA 3LQFA 3W8FA 4R5MA 1XKQA 2HMWA 5CHEA 3F46A 3ZWOA 2DC1A 3MFMA 3OMLA 2J3IA 3P5MA 2OXIA 5B4UA 4R1SA 5TLSA 3TPCA 4CMIA 2B36A 3D3EA 4CR6A 4U0JA 5F1PA 1DSSG 2VSUA 3ZV6A 4MKRA 1D8AA 4BO7A 4MVJF 3BF0A 1HDXA 4ALIA 3WDSA 3H3FA 4JJIA 3BMOB 4RLSA 4IXTA 1RM3A 3RVDA 5JNLA 3KO8A 1T4BA 1MA0A 4JFCA 4Z0MA 3T8BA 3L4BC 1DOHA 2JAHA 1HNUA 4AJHA 4HFMA 1DB3A 2HMUA 3RUFA 3UH1A 2R00C 2W90A 4I08A 1E6WA 1ZW1A 2ZQYA 4JROA 2ZL3A 4K2NA 4ZQHA 2J3HA 1Q7BA 2QQ3A 3RIHA 2UYYA 2FPGA 3WSVA 2F6IA 1T2EA 2WDZA 5EINA 3SBOA 1K6JA 4IMRA 2NNLD 3S2GA 1DDOA 5J23A 3VOSA 2Q2VA 4MIYA 2HDHA 2O2SA 3H5NA 4Q3DA 3DZFA 4DPMA 3ZW8A 3VIVA 2FPPA 1J4AA 1VL0A 5GZ1A 4OGWA 3JQ9A 1DIBA 1YRLA 5A5EA 5JO0A 2Q4EA 2YHIB 3TWOA 1ZSNA 5T8KC 1L7DA 3ZNPA 3G3EA 2UZFA 1YQDA 1PQPA 4CLHA 1Z7BA 2O2YA 4INAA 3WG5A 3PHLA 3PGQA 3ZU2A 3T7CA 3I83A 4WKGA 4RO0A 2RHCA 4ALJA 4GL4A 4XJTA 1NWHA 3DJAA 3AM3A 2QG4A 1UXHA 2P68A 5KCZA 4TQGA 4IZHA 3ANMA 3FPLA 3F4LA 2VUUA 3WYEA 3TJRA 4EJMA 1MG0A 4U18A 3M6MA 3L9XA 3SXPA 3U62A 1KVTA 4XYBA 5HRUA 3HQ4O 1J0XO 3N6RB 5IZCA 5IG2A 3LLVA 5TQVA 2EJ5A 1I30A 2OZPA 3G17A 2A7KA 1T25A 2J5IB 1SPXA 2Q2QA 3OECA 4FOOA 1GZ4A 4CM4A 3H4VA 2VYVD 2C0CA 2AQ8A 3PQEA 2W2LA 5K6AA 2BKAA 3AY6A 1YKFA 4G5HA 2FBMA 3TV5A 2ZIZA 4AJOA 1XNWA 1DIGA 1DC6A 3VHRA 4M49A 4YQYA 3DO5A 3OIDA 3C24A 4CODB 1NWCA 3G1UA 1X7DA 3JYOA 3VZSA 2WMDA 3LC2O 3RUAA 4PRKA 1JN0A 2VHZA 4BVAA 4GKVA 5F5NA 3NTRA 4ZN6A 1X15A 2DPHA 1UZMA 1TG6A 3KV3O 3LF2A 1UR5A 1HZJA 2ET6A 3ANLA 1JKIA 1QYDA 2O48X 4WLNA 3ZNNA 3V2UA 4DYVA 3MJVA 2C5AA 1E7SA 1GY8A 2J8ZA 3AWDA 3DBHB 3W6ZA 2VRCA 1Y8QA 1O8UA 2X0JA 1RYEA 3KEQA 3VPGA 1NQAO 1XYGA 3PK0A 3ZCXA 1YO6A 4JCTA 4BS9A 1HE4A 3DOOA 4A03A 5JMPA 2I9PA 4E4YA 3GNQA 3JCZA 3QIVA 3EYWA 1ZVMA 3HDQA 4YTEA 2BFMA 4BNVA 3FNGA 1XEAA 1WWKA 4IY1A 1A7KA 1A9ZA 4PFJA 1C0PA 3FBGA 3VTFA 5JW6A 2C5EA 2VWGA 4YWJA 3AFNA 4FPXA 5COBA 1ORRA 1Y9AA 2HMVA 3I52A 5T64A 4M87A 3D3WA 3WGOA 3ICCA 5BSFA 1UAYA 3QWFA 3GH3A 5CDUA 3E82A 5C90A 2FPIA 1KC3A 3DB2A 5FFFA 4JJGA 3KEOA 4D0RA 3WGYA 1X7HA 2JFHA 1E3WA 1Z6ZA 1K3TA 2GD1O 3L07A 2IE0A 3F1LA 4MJLA 1GUZA 3PZBA 4RVSA 3N58A 2H1SA 4KUGA 4XWYA 3HFGA 3KYDA 3MOIA 1I2BA 4BV9A 1HE3A 2X86A 4CUJA 4XR9A 1IZ0A 4FOSA 1XNVA 2CBYA 1A9YA 3JQ7B 4WYOB 1MX3A 1BMDA 1JKFA 4J4TA 1LDBA 5FEUA 4R1UA 1N7HA 4UEJA 5I7SA 1KVQA 4R54A 3GAZA 1DRWA 1PJ3A 3DAFA 3IJRA 3WG9A 3ZV4A 3TF5A 4JCRA 4JVTA 4CMHA 1S6YA 1VI2A 1HXHA 2IZZA 3B1JA 3JTMA 4KTVE 2VHWA 2EP5A 5INGA 3FI9A 3OP4A 3GFGA 4JJTA 1WNTA 5IDYA 1Y6JA 1E7QA 3PFFA 4XQ9A 1XO6A 2CDCA 3LYLA 4U0KA 3V8BA 1PSDA 3TZHA 2X5OA 3STHA 1GEGA 2JKVA 4CQMB 5LDGA 3VH1A 5TC4A 4LW8A 2UVDA 5G1RA 4CL8A 4JIGA 3UUWA 4ZU2A 1NPDA 2D4AA 1GUFA 4Y98A 3DFUA 1AN9A 3ADOA 5JCJA 3TOXA 1W73A 4RZHA 3GF7A 1TVEA 1EZ4A 4EZBA 3R9SA 4NR0A 3BMQB 2GZ1A 3ZDFA 3ZHBA 3AUSA 4HWKA 4P38A 1FXSA 2ZCVA 3ZN2A 4NFYA 3LDHA 1IY8A 3GHYA 4OMRA 4KTTE 1WZEA 2JAPA 5CPFA 4U0GH 2JHFA 3JD1A 3PIIA 3RUCA 4H16A 4PLGA 2NVBA 2YZ7A 4L74A 1C1DB 3RU9A 4BO2A 3ORFA 4L4SA 3KSZO 1WAMA 2HK7A 1PGOA 4UVGA 3VTZA 7MDHA 3GK3A 4YA6A 3UOGA 3RSIA 2PKQO 1R16A 1BHSA 3CUKA 3MT6A 2IZ0A 2NQTA 2H5LA 1JWBB 3D4PA 3AOEA 4R41A 5MGBA 4A73A 3ZHZA 1NNUA 3PHJA 4DYDA 5IXSA 1EVYA 1UDCA 2YV2A 2O23A 2JJYA 3W8EA 5EJ2A 2OUIA 4DQUA 3HB4X 1A27A 1MJ3A 5TIIA 3GNTA 1UDAA 4J4HA 1E6EA 1QYCA 4N7RA 2ZJ1A 3FHLA 3VC7A 4IZCA 1R12A 3U0BA 3RFXA 1ZJZA 2XOXA 3SLKA 3ZU3A 3TLFA 7ADHA 3BTUA 2UV8A 3M2PA 4NBTA 4J1QA 4KMSA 3WMXA 1DIAA 4IUYA 4C7KA 1QLJA 2XF8A 1OD4A 3FPCA 4JSBA 3ZWBA 1R37A 2V6BA 4AJNA 2X9NA 5K0ZA 1HWYA 1ZFNA 2P5UA 4YJGA 1R0KA 3HP0A 5C9GA 3ENNA 5G0VA 4EJ0A 1HDGO 1DIHA 4GGOA 4Y6RA 5DUFA 2UDPA 4FW8A 1K5HA 2E48A 2VOEA 4LVCA 4D43A 5COAA 4U19A 3QREA 5L7TA 3TFOA 4HNGA 3GPIA 4I4ZA 1ZNQO 4CUKA 4FN4A 1QYXA 4JYLA 4NBUA 1P44A 5THKA 4E13A 1QV7A 2Y1EA 2I65A 1GADO 1T2CA 2AHRA 1TT5B 3KYCA 5TF4A 3Q9NA 2OORA 4WLOA 4IXWA 5TX7A 2F9IA 2GO1A 4A0SA 1NP3A 4ND1A 4AJJA 4HADA 2P4QA 5JBXA 3O26A 1HSOA 3I9MA 2EP7A 2VREA 4BNKA 5JBIA 3TQHA 5CDGA 1VC2A 1OI7A 3CINA 1DEHA 4MP8A 2WYUA 1PQUA 1ZZEA 1Y7TA 2OGUA 2PD4A 5I7EA 1SBYA 1GD1O 2YUTA 3HDYA 2WD8A 4R9SA 1LLCA 4DC0A 2DU8A 3V5NA 2WJPA 1LRJA 2CF5A 2O4UX 2CD9A 1EE9A 1HDRA 4ZDEA 3I3OA 1BGVA 4TZTA 1O8CA 3W1VA 1P1RA 1ADCA 3DZJA 3KUXA 3I5MA 4N5LA 4FJ1A 4DMMA 5EQFA 4RZIA 2GLXA 4IDCA 1V3TA 2FP4A 1JQBA 3F3SA 1YOVA 3QHAA 2GSDA 2YHIA 3NTOA 1OC4A 3IUSA 3KYBA 4DI1A 1ZXBA 5G0UA 1YS4A 1FDWA 4PG6A 2X9GA 4YJFA 4JK3A 5DBFA 1H6AA 3K50A 4RVGA 1R4NB 5ADHA 4OIMA 5LCXA 4C4OA 5AXBA 4FJWD 1LDGA 1JAYA 3GVHA 1WZIA 4CM9A 4YAGA 3A28A 1XHLA 3WX0A 2HMSA 3G79A 4XYEA 3ZGYA 2BGKA 4D0SA 1FDVA 1RWBA 3PGJA 4OH1A 1R4MB 3ZWMA 4PG5A 4NJMA 3UHAA 1YG8A 1GYQA 5JO9A 5A1TA 2HUNA 3NT2A 3WJ7A 1FDUA 3V2HA 3DBRA 3PE8A 3P5SA 5T6BA 4B3JA 4BNZA 3GUYA 4HNKA 3UAGA 4MP3A 2JCXA 1YL7A 5ENVA 1PS9A 1CQIA 4QFCA 3BMNA 3G49A 3H0QA 4FN7A 2EEZA 4JXKA 3EMKA 5JMWA 5HTOA 3WIEA 1WLYA 2YYYA 3LLSA 1CETA 3LC1O 1NHWA 3LC7O 4E2YA 2GF2A 3QVXA 3Q9UA 2J3KA 3UF0A 1HKUA 1AHHA 1KBZA 3VH3A 3NJDA 4WNCA 3JQBA 2D8AA 1E3IA 4QO8A 3RUEA 3H0UA 3C8MA 3A1NA 3L6DA 4OO3A 4URFA 3H8VA 4Y9DA 1KY4A 3A9WA 4RYFH 1KY5A 5CDTA 4J91A 3AY7A 3GVPA 2QRLA 3WNVA 3GDFA 4AJPA 3RUHA 1WVGA 1XSEA 5F5LA 5I9LA 3WGHA 4Q3BA 1U28A 2VNSA 4CR8A 1I33A 2HLPA 4CLOB 2PH3A 5KKAA 5L4NA 2E6UX 2Q46A 5T57A 3WR5A 2FWMX 1H6CA 2Q1WA 2X23A 4I9UA 1B8PA 5JYEA 1QYWA 1B0AA 5DULA 3HE3A 1PTJA 2WD7B 1PZEA 3H2ZA 2A7SA 2F6QA 4IBOA 1X0VA 1DRVA 1LRLA 1P1KA 4E0BA 3UICA 1VJTA 2W2KB 3DBLB 4CMKA 2EKQA 1NM5A 4NBWA 1GPDG 3H02A 4IQGA 1M2WA 4QQRA 5KTKA 1Z74A 4E2ZA 4LRTB 2BELA 1LDEA 1C1XA 3ADPA 3VVBA 3OMEA 1EBUA 4IINA 1EF9A 5H81A 2F9YB 3ZU5A 3RBZA 1TEHA 5B1YA 1W6UA 3JSAA 1GPJA 3INRA 4GKBA 2I67A 1YBVA 1A7AA 4Z0TA 3WIDA 3LKEA 1I5RA 3H9QA 2X6TA 4PLCA 1ML3A 3S1LA 1FMCA 1Y7OA 1LLQA 4GSKA 2YJZA 4OXNA 5C5IA 2DPGA 2WEKA 3DL2A 3Q7HA 4Z9YA 5DTPA 4XDYA 4XYGA 5B37A 2ZTUA 1HL3A 1U7TA 4DBZA 1E6UA 1NR7A 4GI2A 4BNUA 4CM7A 3GVCA 5KDRA 2B5WA 3JQ7A 5EN4A 3NDJA 8LDHA 1UIYA 1YJQA 4IS3A 5EMHA 5JBWA 3ETDA 1RJMA 3GG9A 2V6GA 4K9DA 4JWVA 4RYFA 3WQSB 1HE2A 2X5KO 4BB5A 3B1FA 1ONNA 4E31A 2CUKA 4ID9A 2JHGA 2BH9A 1U9JA 2G0TA 5HA5A 4BO8A 4K3WA 1JVBA 1SAYA 3AUAA 1J49A 3RUDA 5A06A 4IJWA 1IE3A 2E82A 4NZ9A 4QX6A 3IB9A 1WP4A 2D5AA 4MOUA 4J0FA 4R4JA 2V6MA 5DP2A 5IZCC 2VRBA 3MJSA 2VTEA 2FHSA 3EY4A 3OIGA 5CDSA 3T4XA 4LMRA 4IDBA 1DHRA 1EQUA 3INGA 5K6AC 1C14A 4Q39A 1LX6A 1F17A 3DMYA 5U4QA 4OYRA 3EVNA 5E0SH 3TDCA 1LXCA 3LSYA 2BI8A 2X9VA 4E5NA 4CLDA 1T4DA 4XGNA 1P3DA 3EUWA 1CYDA 1H0KA 3IS3A 4W99A 5I9NA 1YBAA 1LQTA 5AYVA 2NU9A 3R1IA 1N1GA 3IMFA 4NK5A 3TVUA 1JVSA 4J16A 4ONEA 4Y6SA 5HM8A 3AW9A 3K92A 1QV6A 3ZWNA 3E9MA 4NDNE 4OXKA 4ZU3A 1PZFA 1ZK3A 4IPTA 1H94A 3AK4A 4E5YA 3RC9A 3B1KA 4JCSA 3CZMA 5CTCA 4WGGA 1PWZA 1YB4A 4WCFB 3E5RA 4GBJA 5G0SA 3DHEA 1UZLA 2VHXA 4IDAA 4FNDA 1I01A 4BHTA 3U9LA 3WFIA 2W2LD 4FBGA 3RC1A 2IXAA 4F6LA 3U9RB 4MVJM 2YY7A 4KQWA 5KJEA 1PGNA 2Y1GA 4X54A 2YHUA 3M1LA 4FGSA 2ZYGA 4OAQA 4Q3AA 4RLHA 1PEDA 5JDIA 1G6KA 1UH5A 1B3BA 5DCWA 2JFGA 1PGPA 5AXAA 4ZICA 1D3AA 2PY6A 1P31A 3QP9A 4FGWA 3PHGA 2HKIA 5GZ6A 4XKJA 4FZWA 2AQKA 4OHUA 1X13A 3NTQA 3R3JA 2V65A 4P22A 1Y9EA 3WNQA 1MLDA 3WBFA 3MWEB 4BKRA 1HZZA 3ROPA 3IQDB 4UUNA 3NV9A 2O7SA 4ALKA 3AU9A 3SEFA 4E30A 3TZ3A 4XJSA 1E92A 3PEFA 4CM8A 4HKTA 2AEJA 5JYDA 1X14A 3AI2A 1FK8A 2VRCD 3VKVA 4DXHA 5G1SA 4ZJUA 1T1SA 5CG1A 2VNAA 3GR6A 5KIAA 1ZMTA 3JYPA 1I8TA 1CRWG 4IGFA 4XQCA 3GF4A 4D44A 2GZ2A 3R9QA 3H7AA 4TKLA 3GLMA 4CLRA 5JS6A 3TN7A 1ID1A 4YPOA 1YJ8A 5THQA 5L53A 1XG5A 3W4JA 2EGGA 1LA2A 1M67A 3FRJA 4IDDA 4WLUA 3KTJA 1QLHA 2P2SA 3F5SA 2Z1NA 1U2GA 4B4VA 1U7HA 2GN9A 1ZO8A 3NKLA 5FI5A 1H5QA 1OFGA 4WEOA 4AJKA 4E5PA 1PJHA 1DC5A 1EUDA 1F0YA 3QVSA 2PGJA 4MVJE 4QUKA 4RPJA 4WLEA 4JN6B 4BMSA 4J7UA 4CV1A 1ARZA 4OL9A 1E1MA 2HAEA 2CVZA 1QR6A 3F1KA 5IJZA 2DUBA 3QLJA 2B4QA 2FY8A 5FYDA 3JYLA 1IPEA 1E3JA 2J5RA 4JP3A 1JTVA 2FSVA 3WYCA 3M6NA 1IULA 1EUZA 2POQX 3S2EA 1BDBA 1XQ1A 4R68A 4XGIA 3PWZA 3VZQA 4J90A 1GYRA 2Q2XA 2EXXA 5F1KA 2EJVA 1BVUA 2FRDA 4II2A 2YFQA 3E9QA 4TMFA 3NDRA 1PR9A 5BNFA 3HNPA 2X0NA 1VM6A 1PJBA 3DZHA 4DBVO 3E03A 3TDKA 1JKJA 1KETA 4DIOA 2VYNA 3WGGA 4Z0PA 3RI3A 1LC0A 2A4KA 1ZEJA 1XDWA 3JQGB 4TRJA 5G4KB 4B4OA 4CLXA 2CMDA 3VKUA 2QYSA 2FN7A 4NIMA 2OMEA 3KLPX 3MTJA 2P4HX 4W7HA 1XX4A 3ZV3A 3GN1A 3E6AA 4N5NA 2ZYDA 1SB9A 4Q0GA 2QZZA 4JBIA 1IL0A 3QV1A 1N6DA 3HINA 4GWGA 2IODA 1O5IA 3NT4A 2BHLA 3GAFA 3I1JA 4K1LA 4YT5A 3WGQA 2GN8A 4E3ZA 5KJFA 2W98A 4ESOA 3HZZA 2YV3A 5L9AA 4XIJA 1QG6A 3IOYA 3IL2A 4W9NA 5TSDA 5TT0A 2X8LA 4EYEA 2NU7A 3N7UA 4GVLA 1ZCJA 2I99A 4PVDA 3BMCA 4IJVA 5JCJD 4YJHA 3QE3A 1ZKMA 1N9GA 4UUOA 1E3SA 3P2YA 5DKPA 2PV7A 2AW5A 4BL5A 4QFEA 3P19A 1IHXA 4MIEA 3RBVA 1PZGA 4GLOA 1DFIA 4TWRA 1E7YA 1U2DA 2X22A 3WSWA 3LAOA 4KZPA 3DZBA 1U4OA 3AU8A 1KIFA 3PFWO 1SCUA 4OOFA 1VSUA 2YV1A 2VUSA 2B0JA 4CMBA 3I9LA 2W8ZA 4LRSB 3SLLA 3NT5A 4BO6A 4CMCA 5A03A 1PJCA 3WTCA 4UREA 4BQRA 1KVRA 4W6ZA 2ZTVA 1Q52A 5A05A 2QRKA 3FD8A 1V0JA 2XXBA 4I5EA 4D3SA 4NBVA 1EUCA 1KVUA 4EUEA 3E48A 2FSSA 2PK3A 3O8QB 1E5QA 4BKUA 4PVCA 4NU5A 3VZRA 3BXXA 1LC3A 3O4RA 3VVCA 3G64A 4KWBA 3KBOA 1NZYB 2E4AA 5KNLA 4MP6A 1R0LA 1YGYA 1XCBA 4JNKA 3CE6A 1M76A 2Q1TA 1GFSA 2G5CA 1Q7CA 3DMTC 4ND2A 1EE2A 2IZ1A 3WBBA 2DM6A 1H93A 4XX0A 2NVUA 1YL6A 4ILKA 4UVDA 3DHNA 1XWFA 4NFHA 3RJ5A 3WWZA 1MV8A 2NVWA 2NUAA 4FFNA 3L4SO 4ALLA 1R0SA 2Y67A 4R3NA 1VL6A 4OXYA 3BAZA 4I9NA 1U3WA 1ZIDA 2XPCA 1JLLA 4MVJA 4R51A 2O3SA 3H9JA 4L4XA 3OJFA 5JLAA 4J0EA 4BNNA 4UAGA 2JCYA 3GEDA 1HLPA 2JD2A 2LDXA 4L76A 4R5HA 3W4IA 2OBYA 2WYVA 4YJDA 4YAJA 4YR9A 1JWAB 3OA0A 3S55A 4BOYA 2GPTA 4D3FA 4XGKA 3U9TB 4FJ2A 1BW9B 3EW7A 3H9GA 1CJCA 2B35A 1SO8A 3HG7A 3N74A 2P9GA 2VWPA 2X1HA 4XA8A 3V1UA 4PZDA 4I5DA 1B15A 4YAKA 4MI2A 2CDBA 2HK8A 3GG2A 4A10A 1JA9A 2C59A 1UJMA 3OIFA 4ZHSA 4QSMA 3U9SB 4HUJA 2AE2A 5EPOA 3RSHA 2V7PA 4XQEA 1EFKA 4UVEA 4NBRA 1I0ZA 5ER9A 3QMJA 1ZH8A 1PGQA 1ENPA 2C7VA 1G1AA 5ILGA 4HV4A 4BNJA 3AM4A 4KOAA 1PJSA 1SOWA 2PWZA 3STAA 3GGPA 3VH4A 1LDYA 1RKXA 3PIDA 4PLFA 2PD3A 1JW9B 2CVQA 3H0SA 2UUPA 3ABIA 1HDCA 2PGLA 3R0IA 1N7GA 2ZB7A 3C85A 1LSUA 1ZK2A 3VDRA 1BSVA 3U4CA 3S2FA 3WLEA 2NLOA 4RVUA 4JCOA 4J1TA 5JE8A 3ZHYA 3JQ8A 3L77A 3ANNA 3JQBC 1IUKA 3FTPA 4JCQA 1QRRA 1HT0A 2TMDA 3U4HA 3GZ4A 3OJOA 4JGBA 4DREA 5A9SB 4ZA2A 4RF4A 4CM9D 3A4VA 1C3VA 2Q4BA 2RIRA 1GTMA 1W8DA 3PHHA 4ND5A 3CXRA 1LLUA 1JU9A 3QK8A 4IMPA 1TXGA 4C7JA 5CEFA 3INTA 3PQDA 4MDHA 3V2GA 3MCVA 1GV1A 4DA9A 2ZQZA 1ULUA 1Y81A 4WOJA 3ETGA 1Y8RB 3U4IA 2C07A 3PQFA 4YB8A 4CPDA 3JQFA 4OKIA 5DT9A 1OC2A 4ND4A 4L75A 3U09A 1W0CA 1LQUA 1GU7A 2EJWA 4NI5A 3TRRA 4HFJA 3WOHA 3FWZA 2HW5A 4G81A 2ILTA 3RKRA 1OOEA 3EHEA 3RWBA 5HS4A 5A04A 1X7GA 2HQ1A 3GN2A 4YT4A 4R69A 3NJ4A 1NVTA 3I4CA 1DCIA 1HETA 1WZ8A 3DZIA 1DJQA 2Q45A 4FJ0A 4GX0A 4EEZA 4L4RA 5A3VA 2NQ8A 1Z73A 3UN1A 4A27A 1UYTA 1WPQA 1ISGA 2CNBA 3JQAA 2ZATA 2GN4A 1B3RA 4I5GA 4OMUA 3Q11A 1W2XA 5CAEA 3IDSA 2EG9A 4RF5A 4XDZA 2F1KA 5JFOA 2VZ8A 4U0HA 1Q51A 1BRMA 1V8BA 4PCVA 4LMPA 4E21A 4YAIA 2AE1A 1B8VA 3S2IA 2CSUA 4DLLA 1SB8A 4W4TA 1FDSA 4GQAA 3WGZA 3T89A 1TB4A 2VHVA 4F3YA 5INFA 4GHNA 4LK3A 4PLVA 4Y67A 1HSZA 3NYWA 4YXFA 3WLFA 5C7IO 2DFDA 2R00A 2Q35A 4F45A 1N92A 5IAAA 5JY6A 1UXIA 3PWKA 1MXFA 4EEXA 4ELXA 1YB5A 3RBXA 4Y6PA 2VSSE 2EW2A 4FD3A 3NGXA 3CTMA 4J7CA 5BNIA 3GMAA 3JYQA 2NWQA 3OM9A 2J5KA 2ZKLA 4FB5A 1ON3A 3GHHA 4ZGWA 3QKAA 2H9IA 1DC3A 4XEHA 3QSGA 3MEQA 2NTVA 1YXMA 3GLQA 2IXBA 3E5MA 4MIOA 3C7DB 3OA2A 5CP8A 3ENKA 3GZNB 3LT1A 1U1IA 5L4LA 1CEQA 5HS6A 5B12A 1QP8A 1ZUD1 3QJ5A 4RDHA 1F14A 4DMLA 3R9TA 3BMOA 4HBGA 1AXGA 3TOZA 3JD4A 4KUEA 1YWGO 5HBRA 1I32A 1A71A 5JDCC 2FZWA 3ETEA 1N2SA 4GMFA 2ZB3A 4J49A 3KTKA 3UGKA 2VT2A 4HXYA 5EIOA 1O95A 2FR0A 1YG6A 3KRTA 1AGNA 3GMDA 2AEMA 3TL2A 3IP1A 3VAZA 3F5QA 4O6VA 4JJFA 1TYFA 2CE3A 4TRMA 1VRWA 1XLTA 2Y66A 3DTTA 4UVHA 4W7IA 2DBRA 3BPPA 3CMCO 3M2TA 3MJCA 2TMGA 3RROA 4DUPA 1QKIA 3U3XA 1ZSVA 3RAJA 1E7WA 1GQ2A 1N6EA 3KZVA 4BO9A 5LDHA 2HK9A 2A35A 1DXYA 4PLYA 3DAGA 3OEYA 5L7WA 4FFRA 2ZL0A 2Q1UA 4FFMA 2O7QA 2B69A 1K6IA 2CZCA 2PPYA 3GC6A 3HN2A 2OBNA 4B7XA 2DBVO 5K9ZA 1Q2XA 3QWDA 4CQLB 4PZEA 3E8XA 3DOCA 2JFFA 1BXGB 1Y5RA 4R1TA 4WECA 3TL3A 4PG8A 2BF7A 3D0OA 3FWNA 5AXCA 5CDYA 4WCZA 1I2ZA 1Y1PA 4J4BA 1P1FA 5DU4A 4QT0A 4AJ1A 4ELSA 3CMMA 2NV6A 4CMIB 1P33A 2X4GA 4PG4A 1T2FA 4NFSA 3CIFA 5JSFA 3O8QA 4KNPA 1MP0A 1LSJA 2NTJA 2BFPA 4S3MA 4GVXA 4K26A 3K31A 1DFHA 3OFSA 1MGOA 4J9VA 2J5IA 1X0XA 3PJFA 1NTOA 3QVOA 4NHEA 3VZPA 4CLEA 1BTOA 4RV9A 4P4GA 6LDHA 4D42A 5G1QA 3RCBA 4HC8A 5CTBA 2J5QA 4IZDA 1QMGA 4ELWA 3OJEA 3DR3A 3D7LA 2ZTLA 3D64A 1NHGA 3K30A 5KVCA 3KHUA 1DJNA 1PS0A 3QWAA 2VT3A 3X2EA 2C29D 4W82A 1PJQA 3QWHA 1H6BA 2CF6A 2WM3A 3FNHA 3K2EA 1EBFA 4RVDA 4NU6A 2VSSA 1YDEA 1A4IA 3HDHA 2WWRA 4RJTA 2HJRA 4MVJG 1O0SA 1VKNA 4Z0HO 4DWVA 9LDBA 4BKOA 3PYXA 3ROQA 4P4NA 2EIHA 3GGOA 4ZRMA 3WMWA 4E2XA 4KD6A 4LK5A 2VSUC 1E7MA 2I76A 4TRNA 3DBHA 1C0IA 3QY9A 4U7WA 3T4EA 3GF3A 1S7CA 1AE1A 1IYZA 3WGIA 1RPNA 1M66A 1U3UA 1PX0A 1SEVA 1YL5A 2D0IA 4L9RA 3OH8A 3OEWA 5IFLA 3ZV5A 3NAQA 3GNSA 4WEQA 1M75A 5L40A 5DZKA 1KYQA 3KXDA 4DVJA 4GAEA 2DEOA 3GDGA 5IDWA 2Y0DA 1GDHA 3ZZNA 1GZ3A 2PLAA 1HNOA 2PG8A 4RF3A 3D4OA 4Q1IA 3C1AA 3BZUA 4WCDA 5IN5A 4CR7A 4ZDDA 3PJEA 3H2SA 2IYPA 4AJEA 3QRWA 4O1MA 1J6UA 3GGGA 4YEDA 4W9NC 4BO0A 2HO5A 4LGVA 1XA0A 2Q49A 4CM4B 4JBGA 3JQ9C 4TVBA 2HSDA 3KLMX 5F3RA 3I23A 3PTZA 5GMOA 3TFQA 4BNGA 2Y68A 5CFZA 4MPDA 2DBQA 5BR7A 2Y0EA 3OBBA 2D59A 4YCAA 5AOVA 1P1HA 1E1LA 1C0LA 1ONPA 1IPFA 2OHXA 4ZQEA 4E2WA 2AQIA 3Q1LA 4CMGA 4UEKA 1LI4A 2B4TO 1YE3A 2VYND 4DGSA 1DLIA 2C20A 3ZWXA 3ZWWA 3H81A 5CEJA 2AXQA 4ZRNA 2QW8A 1RJWA 3DTYA 2AG8A 4ZQGA 1B8UA 1VRGA 4BMNA 5IXYA 1K0UA 1EEHA 3OICA 2P9CA 1EQ2A 1ZK1A 1WDMA 1G0OA 1Y8QB 1Z75A 4J2OA 4ZVVA 4MO2A 4D7AA 2BRUA 3LF1A 4WE3A 4M8SA 5H82A 5AQ1A 1AHIA 1B2LA 4CQMA 2BMAA 2PKQP 4DPKA 2R2GA 3SJUA 3L9WA 1NX6A 3DBVO 4GGPA 1KOLA 4YYZA 1ZJYA 2DLDA 4L6WA 3IAVA 1Q7GA 1TA4A 1HE5A 3KTIA 5KJ1A 4YVFA 2NU6A 3ZI0A 3BMQA 4H3VA 4IJUA 4CM5A 1U4SA 1NQ5A 1LRKA 1HDYA 1B26A 2X5JO 3Q1TA 1O94A 1EVJA 5A5FA 1X0UA 5ICSA 3NEPX 3D3WB 1DUBA 2QZ9A 4IQ0A 4ZQFA 1C1DA 1UYRA 3NJBA 4WZ8B 4CUZA 5FIFA 1KS9A 3SX2A 2ZJ0A 3O38A 4PG7A 3KTHA 4HFRA 5L51A 2YQ5A 4DQVA 1XGKA 1XU9A 4G65A 5DOZA 1E3WB 5C7LO 2DFVA 2UUOA 3JV7A 4MINA 5TNXA 4QTZA 4FN8A 1M6WA 3WQQA 5DL1A 1VLLA 5G0TA 3W6UA 4BUCA 3BTOA 3GUCA 1XQ6A 2VOJA 4RPLA 1UXGA 3KYDB 3KM0A 3IBBA 3BTSA 5MDHA 2VSUF 4WOKA 2IEDA 4BNXA 5BNTA 1WDLA 1LSOA 1U5AA 5B4VA 3Q0GA 3FSRA 1N6FA 5KJCA 1HEUA 3PLRA 4R9RA 1Z45A 3Q0EA 1SZJG 4U8GA 4BGIA 3KQFA 1B7GO 2Y0CA 5I8WA 1P74A 2ZL2A 4O63O 5IDXA 5TT1A 4RF2A 5LC1A 2PKRA 3CKYA 4HNHA 1H9BA 2DTEA 4GWKA 2EWMA 2I6TA 2X7HA 1Y5MA 4GMGA 1LTHR 3GMSA 1NFRA 3CEAA 4IQ8A 5F21A 3ICPA 3CSDA 1MXHA 1HYEA 1PL8A 1ISMA 2DTXA 2VN8A 1GL3A 2D1YA 5COQA 1SNYA 4BNTA 3PJDA 4BO1A 4IDGA 4MVJD 4O5OA 4AJ2A 1F06A 3GFBA 4RVHA 4YT8A 3U5TA 1SG4A 1HDOA 4PIVA 1MFPA 2CVOA 4DC1A 1HRDA 1KERA 1PIXA 3EAGA 2WYWA 5C37A 4D46A 3H9UA 1I36A 1YH3A 4MVJI 2QQ5A 1GQYA 3RASA 4EUHA 3H9EO 2A94A 1TT7A 2I3GA 3H5AA 1R66A 2GYYA 2C7GA 5AVOA 4E32A 1TT5A 1NPYA 3TVWA 3FTNA 3LZ6A 1ZSYA 4DQXA 3A06A 2X0IA 1PR3A 4IDEA 1RM4A 2DVMA 1GYPA 2VZ0A 2GRAA 3AOGA 4I42A 4DL9A 3WJAA 3MOYA 4NPCA 4E6PA 4DRYA 2VWHA 3JU1A 2LDBA 2DTDA 1V6AA 4K6CA 3V1YA 4J1NA 3S8MA 3JQFC 4F6CA 3WYBA 4OOEA 2HMTA 3PVZA 4L8VA 5JAQA 1T1RA 3B6ZA 2X0RA 4B8ZA 4XZ3A 1YB1A 1SEPA 4I5FA 3IKTA 4IZBA 3MOGA 2PGDA 1D4FA 3QYRA 4ZDFA 2ZQQA 4L0QA 3L0DA 1QSGA 4GH5A 1EDZA 1PS8A 2I5PO 2SCUA 4U1AA 2VHYA 1Q1NA 4GPD1 4Q3EA 1HYGA 1ULSA 5I9MA 3FF4A 1R4NA 3WTBA 4E5MA 2B4RO 2Z1MA 4YQZA 5G2OA 1UP4A 1M6HA 2VTDA 4CMEA 4EW6A 1IHYA 3SVTA 3Q3CA 1EF8A 4BB6A 4YJGB 3R6DA 2GNAA 3AY3A 1UXKA 2NTNA 1EVZA 3JD0A 3O03A 1R4MA 3ZHXA 4UEOA 1Z82A 3PI7A 4OG1A 3ONDA 1MC4A 2ZB8A 3AOEC 4K28A 3I9NA 1GUYA 3TZQA 1ADBA 3FF6A 2BFAA 5BQFA 2Q1SA 1LBEA 1GR0A 4KP7A 3HSKA 3DZKA 4FFOA 1NAIA 4KQXA 1GCUA 2UAGA 2ZTMA 3KYCB 2C2YA 4B3HA 3K96A 3PDUA 1NVGA 4B7UA 4PLWA 4RPGA 4BO3A 2F9IB 3DORA 3PRJA 3U4DA 1BWSA 3BEZA 2EKPA 2NP9A 4AJLA 3QVWA 4MVJH 1P0FA 1ONOA 2J5GA 2HCTA 4IJKA 4OQYA 3F47A 1NASA 2W3PA 2J6IA 5TRTA 2NU8A 3L6EA 1ISFA 3BHMA 2Y1CA 3PYMA 3ROMA 4XYLA 2J3JA 4PGFA 3E9NA 3JQAD 2RH8A 3C3XA 1OAAA 1V35A 1JAXA 3HB5X 3IAHA 4II3A 2H6EA 2GR9A 2Q99A 1E1KA 5ICMA 3QW2A 2GERA 1P0CA 3K8ZA 1YBMA 4FIZA 1CF2O 4M54A 1HF3A 3PZRA 4HX5A 1YOVB 4EDFA 4CLOA 5GY7A 1KEPA 1ISIA 4YJFB 3SC6A 4QXMA 1E3EA 4F47A 1ON9A 3WFJA 1NAHA 3I9JA 2YQ4A 3NRCA 1SZOA 1NYTA 1JDJA 2WD7A 2XAAA 1RJNA 3F4BA 4NG5A 5A9RA 2I3AA 5IF3A 4OJNA 3PZKA 4QIJA 3JD3A 3FNEA 4AICA 1P9LA 2W2KA 3DBLA 4O59O 3D5QA 1E77A 3OT6A 4NJMB 3OQ6A 1H9AA 3GQVA 3SLGA 2B83A 4TRRA 4EGFA 2FZEA 5F1OA 3RC7A 1T2DA 4N54A 3FNFA 5FUSA 3DBRB 2A81A 2F9YA 3QA9A 3K2BA 3JQDA 3ZNOA 4DTIA 5FF9A 3PHIA 4RGBA 2IDZA 1PU2A 2Q50A 5IN4A 2DQ4A 3BTVA 1GAEO 3T3WA 3SJ7A 1ENYA 1R6DA 2C2XA 3BMNB 2FR1A 1HTBA 4LVUA 4JLWA 3WXBA 1ZK4A 1RM5A 4LSWA 3AI3A 1L1FA 3QXIA 4B8WA 1V9LA 4OLQA 1BXZA 2WTBA 3WB9A 3I47A 3LT4A 5DBGA 2PZMA 3P85A 1DIRA 3OQBA 3ROKA 4BNHA 4KPKA 1MC5A 2GN6A 1DC4A 2Y99A 4IIUA 3NDIA 4RPKA 3UW3A 2PNFA 1P45A 1VL8A 3GVXA 3QWBA 1U8FO 3ZNQA 5L45A 2DAPA 2EGHA 2BGMA 4IDFA 1YQGA 4D3DA 4FFLA 1B16A 1NQOA 2RH4A 2G1UA 4O0LA 3DEYX 4ITUA 4JP2A 3WWYA 2EHDA 4CMAA 3EVTA 1RM0A 1B14A 3Q2KA 1GQQA 4LCJA 4G2RA 2AEFA 3BIOA 4GX5A 2B37A 3DZGA 3PDJA 2E49A 4ZQBA 1ENZA 1O89A 2QYTA 2H63A 4FS3A 2B5VA 4G2NA 4ND3A 4NQZA 4KDFA 3ZWVA 4BGEA 3G0OA 4QEDA 5IKLB 1KEUA 3OC7A 1ADGA 4WJZA 1HZDA 3AI1A 3Q2IA 1MUUA 3FR7A 3HWRA 3C7CB 4RQTA 4AL4A 4XB1A 5EQDA 2IYOA 3UCEA 4NNJA 2EW8A 3TZCA 5CG2A 1H6DA 3D4NA 4YBZA 3G1TA 2Q3EA 1C1XB 1BG6A 2OP0A 4WASA 5L7YA 2ZQRA 5E0NX 4AG3A 5ES3A 4BGVA 1DHTA 2WE8A 3R6HA 3M6IA 4EITA 5TS3A 4J6FA 5DDIP 5DBIA 4RCNA 1ZBQA 3RFTA 4QFDA 2P9EA 4QO7A 4U5QA 3ULKA 2Z95A 2BI7A 2PZJA 4M86A 4BMVA 1EMDA 3K8XA 3PLNA 3HN7A 4GX2A 1PJLA 1E3LA 5T5QA 3DONA 4YT2A 5U9CA 1T2AA 3LK7A 3HADA 4P8RA 3PPIA 4YRBA 4UULA 3UVEA 4BO5A 1KEWA 3CZRA 4GSLA 4WCFA 5KDRB 4ASIA 4MXIA 3ZWYA 2VQ3A 1ZEMA 4B4WA 4BNLA 1MG5A 2IEXA 2EERA 2O3TA 2J5II 3H65A 2CDAA 4Z3DA 5DU6A 3E18A 3V1TC 4B79A 3A14A 3ON5A 2DKNA 3ISAA 1CQJA 5H83A 3H6KA 3E1KA 3EGOA 2D2IA 3DDNA 4B4UA 2D3TA 1LDNA 1T26A 1N5DA 4FFPA 1DAPA 3KB6A 3GVIA 3HRXA 4DLBA 2O3RA 5ENDA 2O4CA 4IZIA 4MOWA 5G0WA 2VUTA 2C8TA 1V3UA 1I3LA 2PH5A 3PYLA 4J43A 3GY0A 5JY1A 1KVSA 5JCXA 4EMPA 2ZYAA 2A9FA 3TZKA 2BD0A 2Y93A 1OZAA 4BNYA 4WLVA 2DBZA 2PZKA 2ZL4A 1PJTA 2D5CA 5A3JA 3FR8A 1HLDA 1XNYA 4GLLA 3IC5A 1R15A 4PLHA 4AFNA 1NQTA 2C82A 5JXWA 3QWIA 1O6ZA 4CV0A 4DLAA 1T24A 2RBEA 3W8DA 3H0JA 1K32A 2PBPA 3L4BA 4WK6A 2FW2A 2GTRA 3JD2A 5AXDA 4LN1A 4ROSA 1LLDA 4RDIA 5DCUA 4Z3KA 4HY3A 3OSUA 4M1QA 1NFFA 2GZ3A 5ILOA 1I24A 1U8XX 3ST7A 2PR2A 4LCEA 4KDEA 2F00A 4D45A 1ZXLA 3X2FA 3OJ0A 4JQCA 4K29A 1EDOA 3CH6A 4F46A 1W4ZA 2JD0A 3GT0A 4NK4A 4OSOA 4D41A 4EJ6A 3F9IA 3ZWPA 3Q6IA 4PLPA 2VYVA 5JC1A 1FJHA 1O9BA 3K5PA 5DNAA 3PWSA 4EMLA 2X24A 3ASUA 1SC6A 1FC9A 5TJ9A 4J2HA 1WDKA 2ZCUA 5T8KA 4R16A 4IM7A 5JAIA 3QVTA 1FC7A 3KTGA 4XQGA 2EF1A 2NACA 3I6QA 3W4KA 3GA0A 4XD2A 3RD5A 1KEVA 3RQSA 2QRJA 5KVSA 3JQGA 5G4KA 4A5OA 2RAFA 1WXDA 1EK6A 5IDQA 3MZ0A 4Y8VA 2VSSF 2VCYA 1YDWA 2RCYA 3OQ1A 4R1NA 4E33A 1MB4A 1WW8A 4CM8B 4NNQA 1PJ4A 4JOTA 3QXZA 1HDZA 2I66A 2Z5LA 4S1VA 2CY0A 2JCVA 5DZSA 2GASA 1U5CA 4A7PA 4BIIA 4FB8A 4H7PA 4CQMD 3R0OA 4U0GA 1OD2A 4AJ4A 1CIVA 3MJ4A 2YFHA 4CLRB 4TZKA 4WUVA 1N1EA 4TSKA 1ADFA 4UUPA 3HFSA 5DCYA 5JDIC 5L95A 2VZ9A 3BA1A 4YACA 3RJ9A 1ZK0A 4IGEA 3T8AA 1CDOA 1ZMOA 1PQWA 4BNFA 3DMTA 9LDTA 3GRKA 1I3NA 5ITVA 4FZWC 3ITDA 3P2OA 3UKOA 2V6FA 3DAPA 1DLJA 3PJGA 3GKBA 5DN9A 4FCCA 4MKXA 5DUCA 3L6OO 1LUAA 3RFVA 3AUTA 1PZHA 2P91A 5KWEA 4A26A 4BKQA 4I8XA 2BZRA 3D1LA 5DZKH 3NX4A 5BSHA 2IEBA 1J7XA 3T7EA 4J7XA 4XYMA 4DIBA 1PIWA 3IJPA 4KUHA 2PZLA 4I1IA 1Q0QA 1NR1A 1UXJA 1IB6A 3KTDA 1E7RA 1QORA 3P7MA 5EESA 5DP1A 3VH2A 4QIIA 5L3ZA 2Y05A 3B70A 1I3KA 4Z9XA 3TRIA 5C7OO 2E37A 3O9ZA 4J1SA 3GPDG 5JAZA 1NXQA 4U6QA 4BO4A 1A4UA 1K6XA 1UDBA 3DFZA 6ADHA 1NZYA 4PZCA 2NM0A 5JPIA 3WICA 4OQZA 4UUMA 2O3QA 4B7CA 4A2CA 3M1AA 1EY3A 4YAEA 4CL3A 3GEMA 2FZSA 3RKUA 3FDUA 1A5ZA 3WGTA 4EMMA 1UP6A 1AXEA 1QXSA 2FOIA 2AMFA 1E5LA 1FDTA 5A02A 1K39A 3AFMA 5CEEA 2Y1DA 4TROA 3TZ6A 1N8KA 5GZ3A 4NJOA 2BFOA 4CM3A 5TJHA 1BDMA 3BMCB 2ZK7A 4YJHB 1H2HA 3HJAA 3RRVA 1N9GB 2DUWA 1I10A 4FR5A 3UXYA 3UFXA 3VPFA 3MWDB 3CPSA 1YONA 5ITWA 1UAGA 5B4TA 2NADA 4PLZA 1BW9A 1VJ0A 2YDYA 1K89A 5BSGA 1DRUA 1MFZA 4CMEC 2WSBA 4P4LA 5KJPA 4YRAA 2OP1A 4OKNA 4ZDBA 4LISA 4YRDA 1G0NA 4JX8A 1NPTO 4U6SA 3ZH2A 3VPHA 2PFGA 5BSEA 2DT5A 1D7OA 4I9HA 4IIVA 3TT7A 1SMKA 3K73O 3LT0A 4EBFA 2G76A 3DC2A 2QX7A 1TI7A 3BHJA 3FN4A 5KKCA 3OETA 4XCVA 5DF1A 2GDZA 3VPXA 5A4DA 2BGLA 3EDMA 4B3IA 1FC6A 3MTGA 4Q9NA 1K2WA 3IP3A 3V5IA 1LEHA 4QECA 3D5TA 4MKZA 4LSMA 3WS7A 1FF9A 4CM1A 3LT2A 2FMUA 4XRGA 2Q2WA 2Y1OA 2VWQA 5IZ4A 3I6IA 3GRPA 2HRBA 1C0KA 2RHRA 1RYDA 2GUGA 4WPGA 3VDQA 4Z6KA 4JYJA 4J3FA 5KJ6A 2X58A 1AUPA 2GGSA 4NMHA 3I9KA 2NVUB 5FWNA 4WNIA 4RVFA 5A9SA 3UCFA 2W4QA 4TVOA 1IZ9A 1UZNA 1FCFA 2J5SA 4MVJP 2GCGA 2PD6A 3JQEA 1PL7A 1XIVA 2PA3A 2HU2A 5KVQA 4BKPA 3KSDO 5HWSA 5A9TA 1OBFO 4NEKA 3BHIA 1F8FA 3MJEA 2CFCA 4ZD6A 2PTGA 4ALMA 1DO8A 1EFLA 2JL1A 4XIYA 3FCOA 5TGDA 4L73A 1Y8RA 1CERA 1DFGA 1GCOA 1NBOA 4BNIA 3OHSX 1D1TA 3LVFO 2QIOA 1VPDA 3IIEA 2WE7A
chains in the Genus database with same CATH superfamily
4CKZA 4R8LA 3E84A 2Q6OA 4OSPA 1NVEA 3KETA 4PF1A 2H2GA 4QBFA 4MWDA 5FWAA 3KVOA 2F1OA 3L0ZA 4US1R 3W5HA 5CK5A 3C3WA 3NQ41 2PIDA 3CCCA 5CTAA 4KIWA 4P53A 3A4NA 2Y0PA 3T9DA 2GZMA 4WY5A 1HKHA 4UVIA 5CVEA 5JMTA 2VF8A 1WW2A 3MJHA 5AUQA 2L2QA 1VLQA 2HA6A 2QN2A 4MS3B 1CUWA 3OE7D 1XELA 2GBLA 3BH6A 3OFNA 1O97D 4QLAA 2ZB4A 4O4IF 4EL0A 2BLLA 2MT9A 2HV8A 1XR3A 4CM6A 3R9WA 4FSHA 5NULA 2D54A 3ODPA 2VSUE 1PL6A 1V3VA 3WBJA 1DAOA 4D9CA 3JVVA 4QGGA 4PRLA 3FIUA 4C2TA 4Q4HA 3TG2A 1OWLA 2I1VB 3JAKA 1B00A 1LU9A 2G5GX 1N33B 1M5RA 2C9DA 2CXOA 2RG1A 1Z5UA 1E2PA 3DOJA 2CMHA 1WMAA 2ZBFA 4FC7A 1WCXA 3B1XA 5I7VA 3LWDA 3IUMA 4XUCA 1T0UA 4X1IA 5BN1A 1LNQA 3SWXA 4LF4B 3SK0A 3V5EA 2IE8A 2HRZA 3QUTA 1QC5B 2VK2A 1S3SA 1VKRA 3H0CA 3SQDA 3VPSA 5T4BA 3QYFA 4BGUA 4XR4A 4KXLA 5DU2A 5H4GA 4FNBA 3UQZA 1X1EA 3E9EA 3RABA 4GX1A 4H3KB 1IIBA 1J7JA 3ICVA 1OMOA 1Q7TA 1YB2A 3D8HA 3EGXB 3KB1A 4GPEA 4PAOA 5D5QA 5BYJA 2EV9A 4E5UA 3PJRA 1G60A 4GI5A 4LPKA 1JHUA 3C8ZA 4HFNA 5TGZA 3DXFA 3NPMA 4FCTA 1RWMA 4C07A 1G6Q1 3AVXA 2J07A 2C7RA 3MSCA 1SD2A 5EERA 3L3SA 2AA3A 5FA5A 2VDWA 4ZDCA 2PKWA 1E1CB 1MOPA 3RWMB 3KAPA 4HZGA 3B20A 2VATA 1FUKA 3C3EA 3JPYA 3KZ1E 2HJSA 3I5UA 4IEFB 1NX9A 5HG0A 3I9FA 2QEQA 2I78A 2VJCA 1VGRA 4YDRA 5ALLA 4JI0B 1LJ8A 2GM9A 4OK5A 4RETA 1GPH1 1VMKA 3FDFA 1X1TA 3J81A 2XB8A 2G1JA 3WGVA 3KOOA 1KO7A 1O5OA 1VYHA 1NVMB 2A1UA 3DXXA 1AKUA 3UG7A 2QAGC 1YQUA 2G1AA 3BFVA 1TZKA 2YFYA 3HMQA 3PXXA 1DPGA 3NOVA 1IHDA 6REQB 4EATA 4G1MB 4R01A 1XTTA 3OU6A 4D4HA 5AK3A 4AO7A 1FB5A 2HA4A 3AHEA 4GT1A 3KEMA 3HDJA 1K88A 3R7NA 4CMJA 5ALEA 2P5YA 3SBEA 2O8BA 2BEUB 5JS7A 4W5TA 1ZM3A 3K0CC 1LV8A 3EVFA 3CRZA 3VGJA 4NCXA 3CX3A 2SECE 3R5XA 1C9DB 4EI2A 3CPJB 3GLGA 2A8YA 1VE9A 2WFLB 1W36C 3BYZA 1JXZA 5DLYA 3DOUA 3CNBA 3FUWA 1MJGM 3TT6A 2WG2A 3AM5A 5I51A 3OFKA 5FOSA 4PN3A 1XZLA 2XWPA 3ZLVA 1CSEE 1GZHB 2J48A 1M2KA 3GEPA 2I6SA 2OL4A 4Y0VA 2ZLBA 3ZGLA 4C03A 3NZEA 2FFBA 4X44A 3CSUA 2OCXA 2PQ2A 4B83A 1Z6TA 1M2FA 4GR9A 1VFNA 1YVEI 2X14A 4NH4A 3HA2A 1SQFA 2XQJA 3QF4B 3RS7A 3IT0A 1B4DA 4RCVA 3ZJ5A 5EL0A 4IS2A 3I2HA 2IU6A 4R3WA 1T15A 5E9JA 3VO2A 3T3GA 4KVAA 5DOVA 3AHHA 1NQXA 4RGVA 2ZI9A 1XU7A 4Q4DA 1UYSA 3F3MA 1OYVA 1JT2A 1QF9A 4WLFA 2NUPB 2IW1A 3QNMA 4BQPA 1PLKA 4GM2A 3L06A 5FD8A 2PCJA 1H2RS 4CQJA 3ZU4A 5GM2A 3H97A 1ACJA 1I2DA 2H2AA 3BD8A 4CQLA 3PEVA 4D4JA 1NMEA 1JIKA 1OX6A 4JI4B 1CR0A 1IONA 1BXGA 1HGXA 1KDTA 3C1TA 4RTRA 4EUNA 1WMBA 1U0JA 1FNSA 3EK2A 4FFBA 3Q0JA 1LVHA 5LQSA 1KJNA 3QX9A 3ITNA 4H7JA 3W8FA 3ZWOA 4OU5A 3P5BA 3MFMA 5BN5A 5BYBA 3P5MA 3WHLA 2IV7A 2OXIA 1JDTA 2J0EA 1SXJA 3KD2A 2OCLA 2VIIA 1MBZA 1AA9A 1Z7GA 1QRSA 4C4RA 3GJ5A 3OZUA 1VSBA 2CHUA 3D3EA 3LW7A 1H4SA 2G72A 2PS1A 3KOWA 1AKRA 5F1PA 1DSSG 4MKRA 1DXOA 1MH9A 4MVJF 4U7DA 1PNRA 4OJMX 1PEKE 3SR3A 1PWYE 4KNYA 4DSAA 4JJIA 4DQDA 5EWLA 3WL3A 5AK6A 2ZRGA 2PYIA 3T5CA 4RLSA 1WCIA 1E5DA 3RVDA 5JNLA 1KSJA 2CLMB 1DOHA 2JAHA 4TM7A 1J0CA 3E7XA 5JV5A 4BP9A 1QGZA 3QXHA 5EJ6A 2Q5EA 1ZW1A 1RZRA 1J07A 4KO4S 2ZPTX 4ZQHA 4K2NA 1RR6A 5AVKA 4H4CA 2H4WA 3RIHA 5AI9A 3WSVA 2F6IA 2H2FA 2JHAA 3OFVA 4TX1A 5BUZA 1G291 1P7YA 2JGMA 2NNLD 4N5IX 1INLA 5J23A 2HNKA 1LK7A 2CKMA 1YR1A 2O2SA 5IUNC 1WF3A 3DZFA 1Z56C 1UIMA 1W34A 1C9JA 1NMZA 2R25B 4L57A 5GAJA 1K7FB 4OGWA 4Q21A 3JQ9A 1ST2A 1DIBA 5EXDA 5I5EA 5CUQA 1GPWB 4EDHA 2Z58A 3I2JA 4CEIA 5DPMA 5A5EA 5REQB 2Q4EA 1F48A 1FTGA 2JGIA 3TWOA 1Z7YA 5T8KC 1L7DA 5EUCA 3ZNPA 4EHKA 2RCNA 4HS9A 4NBSA 4RFLA 3C4QA 4CLHA 4DMGA 3DLIA 1TUBA 4INAA 1RW4A 1SQ6A 2ZW9A 3UJCA 3CH5A 3IJ5A 3NTVA 3ZU2A 4XD7A 4MRRA 3SHQA 2DT8A 5KSOA 1XTZA 2XD4A 2FJ0A 2RI1A 4D3ZA 3BILA 4XPIB 1WL8A 1GPAA 3ENWA 3RIMA 2JDID 4XJTA 5AWFC 4B6RA 5E2IA 1PRYA 1KOGA 3HUFA 1RHQA 1ZRNA 2P68A 2QT1A 2G8NA 3VYWA 1A9OA 4IZHA 5KCZA 1XZQA 2F7SA 3KJEA 3Q3EA 2B20A 1J06A 1NULA 4L0DA 4QODA 3QPVA 4EJMA 1T6YA 1HNWB 3DTNA 4P4TA 5AM2A 3T6KA 3L9XA 3SXPA 4G0ZA 3HVRA 1NMQA 5HRUA 4QVIA 3QKIA 2MDTA 2A9RA 5TQVA 1LWOA 2BEWB 1I30A 2JVIA 3ET5A 3MB5A 3GCXA 4NS4A 3G17A 3SQMA 5BMVA 4XB6B 5C5DA 2QW1A 1C3OB 2NXJA 4IIHA 1XROA 2IP2A 4FOOA 1WB6A 1G9SA 1ZI9A 4I5IA 5T4EA 2AQ8A 3OOWA 2C7QA 2JIBA 2HWKA 2DRIA 4OP2A 5EIBC 3B89A 1L7NA 2BKAA 3IEPA 3NTXA 1IMJA 3FMVA 1YKFA 4LE0A 5E8JA 4EO4A 4RTOA 3T3DA 1PWEA 1XNWA 3E2MA 1OT3A 2FW0A 1YU9A 2H0AA 3IEXA 3WLMA 5LDDC 1TD1A 4YQYA 3RAFC 2F1JA 2IY9A 3D4IA 3OIDA 5DNVA 3ZCQA 4CN8A 2W2XA 1CUVA 4RTLA 2QBYA 2OILA 1H23A 3MWYW 3LC2O 1A2OA 3HCDA 1CYEA 1Q44A 2LVBA 3B6KA 4BVAA 1TYAE 3EIUA 3FGOA 1L5WA 4CKCA 2XBMA 4FE3A 2GCOA 3U7QB 1J21A 2P79A 4DIEA 3NTRA 1X15A 1Q16A 1UZMA 2H07A 3WSTA 3M33A 1TK9A 2OBFA 3B53X 3GJ7A 1UR5A 3A3KA 1CEXA 2WF8A 3O1LA 4PW0A 1MGPA 4RANA 3ZXXA 2W58A 4WLNA 3ZNNA 4PPNA 2FQ1A 3MJVA 3QW4B 1B93A 1R64A 1RRFA 2XUKA 1GY8A 4LAFA 3KU1A 1XEXA 1TLLA 4UTPA 2QVCA 1RYEA 3B8HA 4JBLA 3RANA 1XYGA 4ARIA 2WTNA 1W1WA 3PQ2A 2CK3A 3D43A 4B74A 5KTYA 1JS1X 3K5HA 4DEXA 2VYQA 4I4TA 3TRKA 1D07A 3GYGA 4EHLA 1U7OA 3EYWA 1I6KA 1ZVMA 3ZK7A 2OPBA 1ZOLA 4HLQB 1DZIA 4KN6A 2Z6AA 1T8RA 1RAGA 4EG0A 3BGVA 3ILXA 1N2CA 3QEJA 1A7KA 4X1OA 4PFJA 4XTCS 4OY3A 1C0PA 5FR1A 4EHHA 4EX7A 5LR6A 1I7DA 2C5EA 5EYPA 2VWGA 2EFCB 2FWPA 3EA0A 5GWXA 4GZ5A 3SSOA 4E1AA 2QNIA 1RDFA 3UMRA 5EP1A 1KQPA 1UQUA 3D3WA 2YCLA 5DSZA 5FORA 3WGOA 4YAUA 4DUGD 1X2EA 3BXEA 5A1JA 5A3RA 3DB2A 4ZT5A 2G1PA 4NONA 2PRKA 1U3GA 2ZI6A 4KBFA 3WGYA 1A2BA 4ZGBA 5C8YF 4FOTA 3NHPA 5I9BA 3CB4A 3L07A 3OJWA 3F1LA 3LA6A 5AVQA 2UXCB 3N58A 5K0SA 4RABA 2I4RA 5E4TA 4KMOA 3VR2A 3ZK8A 2X86A 3CF4G 1XMIA 3DHVA 2VXOA 4TMKA 1A9YA 1EA5A 3RTEA 1BMDA 1JKFA 2CD7A 2V74B 4FYXA 2ZRDA 4W6QA 5EJIA 3VM6A 3ZBUA 5FEUA 1AQNA 2FW6A 3URMA 5I7SA 5A7HA 1Y6RA 2RARA 4NBNA 4JCRA 1PJ3A 2EDAA 4RGYA 2XADA 2P6RA 1S6YA 1VI2A 2IZZA 2W6OA 1V8OA 5AK0A 1C80A 5G1OA 1QP0A 3JTMA 4GP7A 2VHWA 2F6RA 3HXKA 4M8NE 2ZTHA 5FJJA 3TLXA 3W9BA 1XZJA 1QTRA 4O1IA 1M8FA 3N6VA 2QRVB 3OP4A 5H9VA 2DUJA 1ZUHA 1WNTA 2QMOA 5DK6A 2BEJA 3ZPXA 1E7QA 3GCZA 2CDCA 3EE6A 4W9RA 4HDSB 2QP4A 3PKIA 3QFHA 3QG1A 4U0KA 1QRUA 2H48A 3TZHA 2X5OA 3S8EA 3K1AB 4WTOA 2JKVA 1RLTA 4KFRA 5LDGA 2IYQA 1MAUA 2X40A 3UUWA 2PVCA 1YI1A 1DV1A 3FGZA 3H8SA 2D1QA 5C2JB 1NPDA 4N47A 4CGYA 5JXJA 4W8GA 4B2LA 1XQXA 4Z4QA 3ADOA 2VSNA 5JCJA 2Q5QA 4C87A 2H1OA 3MN1A 5LIRA 2X8WA 4IRUB 4P38A 2ZCVA 1FFBA 3THRA 3ZX4A 4CM5A 3QPCA 4PPYA 4ER7A 3DYBA 1UK8A 1WZEA 2JAPA 5CPFA 3IR7A 1PD0A 2ATVA 3RUCA 4IWXA 3W2GA 2EZ9A 2C3UA 4L74A 1XF9A 4TTQA 1NBMA 1OIWA 1RQGA 3RU9A 3S28A 4L4SA 3SFZA 3KSZO 4BO2A 1Z8DA 2HK7A 5DM1A 1B6RA 1PGOA 1O6CA 1DBRA 1KFJB 1XJ5A 3GK3A 3RSIA 2ADFA 1R16A 1BHSA 3CE9A 3CUKA 3CRMA 5ALGA 3LPLA 4HEJA 1KY3A 5I48A 1JWBB 1ZCAA 4R41A 4M37A 4N9QA 4XFKA 2P62A 5MGBA 5KHOC 1Y63A 3UK7A 2ORWA 4DYDA 3ETJA 2DFPA 1E64A 4MUNA 2XCOA 3LS2A 4YCLA 3KFVA 1EIZA 4L02A 4M88A 1WABA 4IIBA 3DKIA 4UOQA 4F12A 2VG8A 5DYIA 1YQQA 2FEMA 3HB4X 1YS7A 2C4HA 1VLHA 1X2BA 1K75A 2JLUA 1IXKA 1P6XA 2ZE7A 1XDBA 3RRJA 1AV6A 4J4HA 1F4LA 1QYCA 1TQDA 1XJCA 3SKXA 3TTUA 3TM5A 3VC7A 4FEAA 5D6NA 5HIKA 1ZJZA 3JWHA 4L8FA 5I4BA 1E99A 5LD2C 3PPXA 2A0WA 4PCLA 7AT1A 2GBLC 3TLFA 2Q7DA 1VBNA 4J3NA 2JAXA 4MEAA 3VPDA 4C7KA 4JQSA 1LW7A 2XUZA 2ORIA 2W4IA 1NNI1 3RS0A 4ASUD 4DMKA 2H4JA 1NYLA 4JYAB 1D6JA 4N3GA 3HZHA 2UDPA 1LNSA 4FW8A 2EC5A 4OD0A 3HA5A 2D0OB 4AKTA 4U19A 3EWAA 1YS2X 1RI2A 2AI2A 4YDSA 2C98A 3RPEA 2AT1A 5KX5F 4HNGA 1LPMA 5L7TA 3TFOA 3GPIA 5G3ZA 5IFKA 1ZNQO 5BR8B 4I4ZA 4N0PA 3BWMA 5THKA 1P72A 1QV7A 2Q5JA 2HPZA 1GADO 3HC7A 3ND9A 4JR0A 4LE2A 5TF4A 3PEWA 5CFPA 2HPHA 1A0OA 2W83A 4X94A 4TGLA 5KTSA 3WRYA 3A31A 3K72B 3ZV7A 5FWYA 3EDYA 4HADA 2X9LA 1JDNA 3F6EX 4NX2A 2FWNA 3A26A 3FYUB 4Q9AA 3UK1A 3UJNA 2CXXA 3ND5A 4QOGA 5JBIA 3TQHA 3SSNA 3ANYB 4IDPA 1TKBA 1XD2A 4JJ4A 2X41A 1ULHA 1UZAA 4MP8A 3SE7A 5DH9A 3BSYA 1Y7TA 4NPAA 1SBYA 3MK31 4Q15A 1Y5LA 1EUQA 1OIVA 2NXWA 2WD8A 4O4IB 4G85A 1L1EA 1ZU5A 1DQSA 2QPLA 3GELA 3V5NA 1YFLA 2CF5A 1UC8A 1G6OA 1EE9A 5EUMA 4GBED 1VG1A 2H4XA 5JSQA 2ZVQX 4HLCA 4TZTA 1CP2A 1EWTA 1X1RA 4I1PA 2FLKA 4Y7DA 4N5LA 3ADBA 4DMMA 3W2HA 5EQFA 5IWAB 3LDFA 3DSRA 4RZIA 1U2QA 2FGJA 1V3TA 5K0CA 1TECE 1JH9A 2Y6VA 3KLBA 3E61A 1YOVA 1SN7A 3VR6D 2W42A 3T1HB 1PT6A 1NSFA 2YHIA 4IHQA 4C6HA 2SCUB 2AK2A 4BWFB 3CX6A 4WD3A 4WBSA 5DBFA 4PG6A 2X9GA 2BSAA 2YQZA 1HMPA 3K50A 4MVWA 5FOUA 5ADHA 1T0JB 4OIMA 4RHEA 3CLHA 3LDUA 2HWXA 4DGQA 4TL6A 2UUCB 3PT9A 4FJWD 16PKA 1EHCA 1UBEA 1MNQA 3A05A 4Y2TA 3GVHA 1WZIA 3MMZA 4L3OA 4CM9A 2QU7A 3N8HA 3WX0A 4AG6A 1W44A 4KQ1A 4XYEA 4D0SA 4BV3A 1K66A 4U0GH 4H1UA 3OZRA 2FFRA 4OH1A 3TTSA 1FSPA 4PG5A 1NVUQ 2ICAA 3BWVA 4NJMA 5AKZA 3U6BA 5JO9A 5ED4A 2DLCX 1SKAA 3PFNA 4ZQIA 2ZUSA 5CYFA 3ZYCA 4DCCA 3SX4A 4BVJA 3BJEA 1FDUA 4UU8A 4V0OA 1QGUA 5T6BA 4B3JA 1M2VA 3OMXA 1YL7A 2BDTA 2HBYA 5K45A 4Q1CA 1X74A 2F17A 3D7MA 1Q1ZA 3HN6A 3MCWA 4REOA 1ICIA 2EEZA 3IE0A 5ITSA 4FN7A 4B6EA 3Q0TA 2JZOA 2QNRA 4TLMB 4OFXA 1CEYA 5AW0A 2O0MA 5BOVA 2ARKA 1T0IA 5DLEA 1CETA 3LC1O 4CKBA 1NHWA 3MGGA 3FVQA 2ETXA 3FB4A 4K6FA 4ZK2A 1Z2NX 4BJ6A 1F8XA 1J9EA 2KE5A 3TW0A 4U7JA 5CBKA 2XCUA 3GRFA 1FCJA 3NJDA 2NU8B 2O0KA 1EP2B 3RUEA 3H0UA 5F2KA 2AC2A 3L6DA 3L8GA 3O95A 1R3UA 1ODLA 5DFAA 1TVKA 1H2YA 1N2HA 1TZMA 4DT1B 3A9WA 3ZWQA 2P5TB 4BCBA 2FN4A 3T3PB 5CDTA 4Y18A 3AY7A 3GVPA 2WJHA 4CEJB 2W22A 3WNVA 2H3HA 4AJPA 2BP7A 3HP1A 4YPVA 3LC0A 1T0PA 3SYRA 3BQNB 5F5LA 3WGHA 3HO1A 1I33A 1SH7A 3PC7A 2HLPA 2JGDB 3N8GA 2GZSA 4B7XA 1SU4A 1KYZA 3WR5A 3M1IA 2FG6C 4I9UA 2Q1WA 3PXBA 5AH0A 4YFVA 3C3CA 1LPPA 4YWHA 1JG3A 1F2VA 1GPYA 1FOEB 1P1CA 1PCXA 3HRKA 3HE3A 5DULA 3V00A 2FZGA 4JNCA 4PS1A 2WD7B 1T3GA 4JUBA 4LJKA 1RZVA 4ZVQA 1RFGE 3F6SA 1NTRA 4MV5A 3UICA 1UWKA 2ZI5A 1CUFA 2FA9A 4GMKA 2EKQA 3DMDA 4QD3A 1GPDG 1MT3A 3E4CA 4DLUA 3ESCA 5ESDA 3UK6A 2FPRA 5E6SA 5KTKA 1E1QD 1Z74A 2WU0A 3DDZX 1AT1A 4G5YA 4ZZ2A 4YRNA 3ADPA 5JEDA 3VVBA 4B48A 1KY2A 2DHQA 4MYHA 3CQ9A 3NIFB 4K6KA 3TL6A 4QM7A 3GLFA 1W6UA 4JU9A 4KE6A 2JAQA 4N7MA 3TBFA 4MYSA 4BRUA 4HNTA 1A7AA 1QOPB 1NKVA 2JEOA 3BRQA 3OT1A 3WIDA 1ABBA 1E9EA 2XKAA 3L49A 3S1LA 1FMCA 1OD6A 1X80A 2PFKA 3TW4A 1NBWB 5FV7A 3AR9A 2YJZA 3C3MA 3HCFA 4OCZA 4OXNA 3FGPA 1J09A 2H11A 1FS4A 3BZWA 4M0FA 1T36A 1EXWA 2DFKB 1GPLA 1UFOA 2H1FA 4XDYA 3GIWA 2XDYA 2ZTUA 2XWBF 3R20A 2PUEA 3IVAA 4OM7A 1VOTA 4ZEOA 1NR7A 4BNUA 4B3FX 1GR1A 1H2XA 2ZDQA 1HI9A 3D6NB 1XMJA 3JQ7A 5EN4A 5B6IA 2IX3A 5BORA 2UZAA 4B76A 1PG2A 1ZM4A 4NV0A 3GAAA 1F7UA 1J2EA 5JBWA 3PQ4A 4G9EA 4P3YA 4EPXA 1RJMA 3GG9A 4JWVA 1TQ8A 4RLQA 1VHQA 2JIZD 3REFA 4LI0A 5EA2A 3OTOB 3QTBA 3G8BA 1PDWA 4L8WB 4WXMA 4MB0A 2JHGA 4Q4JB 4R2KA 5IM5A 3AILA 1QX3A 1JVBA 1RI4A 4Z8YA 4JR2A 1J49A 1COZA 5TQ2B 4NZ9A 1MJFA 1F8UA 4MOUA 4WN9B 4J0FA 5T4FA 2LKCA 4C01A 2VRBA 3MJSA 2VTEA 3RREA 1YFKA 3R3ZA 4LA4A 3EY4A 5DGDA 4LXTA 4R8MA 4D0GA 3LKDA 4ENPA 3FUXA 2PIAA 4LMRA 2YRFA 3CLKA 1DHRA 2JFBA 4IVNA 3C3DA 4Q6WA 4F9FA 1U2EA 3DMYA 4AS3A 5U4QA 6YASA 1G19A 1OU4A 4R1MA 3EVNA 3WADA 1A8QA 5L3RA 1UBCA 2BI8A 2CXPA 1Z0SA 2Z09A 4MV8A 5FYQA 5HW0A 2OGZA 1T4DA 1GTL1 2PBRA 4X85A 2UYCA 1H0KA 2BKEA 9GPBA 3IS3A 4W99A 3GRZA 3PNOA 3FTEA 1NSYA 2ADMA 1PBTA 4IRMA 1YQTA 3EGVA 3W1WA 2VDQB 2V3CC 3AHGA 1N1GA 3CNOA 3UK0A 3QOFA 1JBKA 5IHPA 4NK5A 3W5BA 2WNHA 4MUHA 3O93A 1SVWA 4FYIA 1OFVA 3OTGA 1T8SA 4LFBB 3OX3A 2P1RA 4EGQA 4EGCB 2HX1A 3DT8A 1NLUA 1LF5A 1I0IA 1S2LA 3K92A 5D3QA 1QV6A 2WKQA 3ZWNA 2V54A 3C87A 1TO1E 4Q7QA 2G9NA 4RTNA 3RRFA 4BX9A 3V4VB 3KTJA 2WM8A 2XCIA 2IYRA 3RC9A 2QN7A 3WMFA 3V8EA 2BGRA 5CTCA 4FT2A 3ZCSA 4D9BA 5HYVA 4INPA 4GBJA 1EHYA 1N3IA 1UZLA 1IY1A 3FDZB 3H2KA 4IJ6A 1I01A 4LY3A 4FNDA 3WFIA 1JEJA 3BL8A 3RC1A 3SZOA 2FI1A 1KRXA 2IS1A 3QOXA 1UMCA 4FMBB 4OAQA 5KYYB 4Q3AA 4GXNA 4LZAA 2WQZA 4QOSA 5GIOE 5K4AA 3V97A 5B7PA 3QFRA 1G6KA 2NSLA 2WU1A 2A4MA 2CJPA 2IOFK 5DCWA 1PHPA 3N53A 3WHIA 4X84A 1DKUA 3HCAA 4ZICA 1P31A 3QP9A 2X13A 3PHGA 2DB3A 3VNBA 3CLUD 5LBUA 4YUXA 4XWKA 5K0NA 4DDHA 2OENG 1MU0A 2CL6X 2J3EA 4JWTA 4XTRA 3RF6A 2V65A 3MIIA 3CC8A 2CNKA 2GYUA 3GBSA 2VQ6A 1UZUA 4BBZA 3MWEB 1WUIS 5C51B 1S5PA 3IQDB 4IFBA 3NV9A 2BFEA 5JSZB 1B74A 3HBNA 1UPUA 1C3EA 1BX0A 2O7SA 3AU9A 4H6XA 3SEFA 4ALKA 3GP8A 3TZ3A 4HTFA 1LKZA 4I3HA 1E92A 5KNDD 4I8IA 4HKTA 2AEJA 2BEVA 1X14A 3AI2A 2VRCD 4DRXA 4DXHA 3L6BA 3KKNA 1YDMA 4RTKA 1DG9A 4OQEA 4RPIA 1H3FA 3SCZA 2KB0A 1X92A 1ORDA 2V7WA 4JLVA 4MEJA 3ZTWA 4A16A 4ZYXA 5HIJA 1FYDA 1E60A 1MVNA 4I14A 4IGFA 4XQCA 3RRNA 4RJTA 1HG1A 2C8VA 5CXXA 3TD9A 1R5NA 5LZ9A 3ROZA 2VP5A 5BV2P 3K9BA 3TN7A 1U0EA 4HAVA 4BVEA 4HDOB 4N6OA 5THQA 4FFVA 1HPLA 3UQYS 2ZWAA 3L3BA 3W5VA 5JH7A 1FFSA 1SA0A 3FSGD 1SUPA 3ICQB 1M67A 4LDQA 2NX2A 2VHUA 4DR7B 2BFFA 1ZR4A 1EX7A 2Z3WA 3IH5A 3LW8A 1XQYA 1AQYA 2GN9A 1ZO8A 3NWEA 4EQ6A 2JIQA 5FI5A 1TIBA 1DVRA 3ANXA 4URYR 4AJKA 4LVOA 1F0YA 2ZYTX 3QVSA 2YW2A 1B0PA 1ZHFA 3HJNA 3PGVA 4CV1A 1E1MA 2HAEA 3F1KA 2GA8A 4CI0B 2XVYA 5IJAA 3IB6A 5IJZA 2EGUA 2V5AA 1Y4SA 3AT1A 4A0GA 5BWBA 4ZEVA 5H68A 2J5RA 1EKXA 4L50A 5FXMA 5BN3A 1G66A 2LE0A 2R3SA 1QUFA 2POQX 2HRRA 1XQ1A 2VYFA 5EXSA 5LYJF 2Q2XA 1GYRA 2QYOA 2EXXA 2BJWA 1BVUA 3LUPA 4ZMRA 2YWFA 3NDRA 4NKRA 5AKEA 2P27A 3WB1A 4WBNF 3R6WA 1VM6A 2J5XA 1PJBA 1EFDN 2QTTA 5H59A 3V9AA 3IR6A 2RGXA 2V7EA 2ZJ6A 1C2YA 3TDKA 1FNBA 1JKJA 3AMVA 2Z43A 1YR6A 4JVLA 3WGGA 1NW7A 5IC4A 4Z0PA 2QD4A 3RI3A 5ABPA 3P97A 1RXVA 2OE2A 4GM1A 4TRJA 3STVA 1XDWA 2GSWA 4CLXA 3FPHA 4OMDA 5B36A 3A2KA 4X20B 2FN7A 4NIMA 4QGHA 2OMEA 3WK7A 5IASA 2CL0X 1G8GA 5KDLA 1Q2UA 3NW9A 3NALA 2BM8A 4R1QA 2SBTA 3ZV3A 3V1NA 4N5NA 1SUWA 3LJKA 1SB9A 3M9WA 5M34A 4QG7A 4Q0GA 2XMPA 3RYIB 2GAAA 3T1TA 2OM6A 1IL0A 2NO7A 4CKEA 3SMVA 2WUEA 4MEBA 1P9RA 1C9KA 1QM5A 4P7BA 3UTCA 3HKCB 1WMEA 4E3ZA 1XCGB 2X42A 5KJFA 4RD3A 4ESOA 5JQGA 1RWPA 1U8EA 4LOKA 1Y1TA 3E3OA 4NG4A 4HVLA 2JI4A 4EYEA 4XASA 1Z8HA 2FUNB 5DTEA 3HHEA 3RRXA 4B6GA 4DCMA 5I9TA 1VA5A 1U0OC 2OAEA 4K7JA 1E3SA 4O25A 3OEEA 4XVUA 1FXWF 4KDRA 4LOIA 3GRCA 2AW5A 3R3YA 3PA8A 1KHTA 2OAQ1 1P4RA 3P19A 3T7SA 1IHXA 2V3WA 2NMVA 1E89A 2X2FA 3FRIA 4UJ5A 4WXEA 1JQ5A 4POAA 2J9XB 1E7YA 1TVCA 3BVPA 2ZDGA 3HZOA 3AV3A 3LAOA 2W6IA 2IPLA 3PFWO 1SCUA 2C84A 4NCAA 3U7JA 1OCEA 4PEVA 1MDBA 1EM6A 2AJDA 2XMSA 4G97A 5A7GA 3V9PA 4KR7A 2AFIA 2QUKA 3KTAA 1CJSA 2E1PA 1TC2A 3UKDA 1PJCA 4Q12A 1XTIA 4UREA 1ZICA 3MT9A 4ICIA 5F7OA 5IH7A 1XMOB 2C00A 4DR6B 3FD8A 4I5EA 2F9MA 2ERCA 3QVMA 1LF0A 2NO6A 4HDQB 2VJDA 3X0DA 3E48A 3NNNA 3FX2A 2PK3A 4QOJA 3QIAA 3FHOA 4TS1A 2WRZA 1DTEA 3D8TA 4YS6A 3RJZA 3W5CA 1TEVA 5FWDA 3PUJA 3ZD6A 5TR9A 4KFSA 1SRQA 2VJBA 3WRYC 4B3BA 5JSHA 4KWBA 2E4AA 3E9RA 5KNLA 2D62A 1M0TA 1R0LA 2GO7A 2IHZA 3QVLA 4GOJA 1CC1S 4O33A 2A7QA 2FSFA 4LOLA 2WG1A 4M1OA 4MI6A 4G1CA 3EIOA 1YQEA 2FPMA 1Q7CA 3ZIUA 4JELA 1O4WA 4H6VA 1C9YA 1XHFA 4INJA 4M1WA 4MS4B 4FYKA 2IZ1A 2XCLA 3HZRA 3KT6A 2DM6A 3WBBA 5CLQA 1CZOA 4XX0A 1C9NA 3G9ZA 1FYFA 1S3IA 3NASA 4FFNA 3SC3A 1ANKA 4BFLA 3QUQA 1JSCA 1ZC3A 1E9FA 2NXCA 3FKQA 2H0RA 2HDOA 3R3UA 4X3PA 4A6EA 2F9FA 5ARBA 2XUJA 5IVHA 2CNWD 4BCCA 1JLLA 4KH0A 5KKNB 3OZIA 1AN0A 3QV2A 3GAMA 4L4XA 3QEMB 1RXYA 4J0EA 3AERB 4TLCA 4BQNA 3O8DA 2JCYA 2Z57A 2LP4Y 4UDYX 3TKLA 4HZUA 4R5HA 4ARZA 3SEZA 2O2GA 3R3VA 5FBZA 2FMHA 4EO7A 5E0NX 2GPTA 4Z86A 3PUYA 4ARUA 2W9XA 5IJ0A 3H9GA 3PLAE 2VHJA 3N74A 4Q3LA 5FIFA 1G5IA 3EXAA 3KQWA 4XA8A 4PZDA 3SEQA 1B15A 3ZR4B 3I8XA 3AR8A 2HK8A 3GG2A 3O47A 4N4AA 1WD7A 4P5PA 5DBHX 3EF1A 3OIFA 4XLZA 1EXMA 5AW4A 1S9HA 1NBAA 1MB9A 5DTMA 5ER9A 5I3ZA 4D99A 4ZVKA 2JGLA 4FVTA 4MS3A 2IWHA 2X4IA 5H3LA 1L7QA 1G1AA 2VA8A 4KFTA 1XCJA 4BNJA 2BLNA 1MQAA 1OWMA 1PJSA 1QK3A 1SOWA 2JGAA 3GGPA 1IOZA 3FETA 1VRVA 2CVQA 1BDHA 1HDCA 3G5UA 4ZOAA 3ZS9A 1DBWA 1ZNYA 2ZB7A 4N1AA 1B41A 3VU3A 3PNLA 1EB9A 1BSVA 1C4KA 1K4KA 4G9GA 1U98A 2F1IA 3WLEA 2NLOA 2CUNA 5DIZA 4YH1A 1GCGA 4JCOA 4J1TA 3UWMA 4ZOQI 5K2OA 2H17A 3NWOA 4JJAA 1E2GA 2A5LA 1IWBB 1NZJA 1YR8A 3NAGA 2ZVDA 6AT1A 1GRCA 1QC5A 2PWPA 2QM3A 1GLGA 1LK0A 2XUHA 5IABA 3SVZA 4FR2A 3WE7A 1W8DA 3PHHA 3NC4A 2OCIA 3NORA 4PSVA 3SHFA 1ND6A 5JSKA 3CTVA 3W5UA 4E2FA 3EGXA 3LLMA 3MS4A 3NVAA 4DEVA 1E59A 3MCVA 3EASA 1GV1A 3R2JA 4MO9A 4JI5B 4DA9A 1ULUA 4TVSA 1XWWA 4G0UA 3CS3A 4LYFA 1F4PA 2QU8A 3RG8A 4KITB 1T1GA 1CZHA 4OREX 3GRYA 4CIVA 1E1CA 4CPDA 3JQFA 3DDWA 1S8FA 5DT9A 4JLPA 4LGMA 2W2MA 3A1DA 1GU7A 2E87A 1CE8B 1WY5A 3CEPB 2XHEA 2PQ0A 4DC9A 5BNWA 4HFJA 3EQ9A 2HW5A 3TRRA 1G98A 1BJKA 1LB1B 1NUQA 1OOEA 2ILTA 2Z4TA 3EHEA 3R6GA 1E2EA 1PJRA 4QYWA 5EKTA 4F97A 4O4JB 4JP8A 5A04A 3HVUA 1VRCA 2GNOA 2HF8A 3RS8A 4E5DA 4YT4A 3CW9A 1G3QA 1T9CA 1IXZA 2O1SA 1VHDA 3FVRA 1NDUA 3G89A 4ZAYA 5A5DA 4YCNA 5CJJA 5ALIA 1FBNA 1DJQA 2Q45A 2WTXA 4FJ0A 4KQKA 2J3DA 1SULA 1KQNA 4L4RA 3O7MA 3NC0C 1KE1A 6REQA 4LYHA 4DZRA 3R8FA 2NQ8A 1YZUA 1AV7A 1UYTA 1JFFB 3BG5A 2LW7A 4QUGA 2ZATA 4I5GA 4OMUA 1FQOA 2BEUA 2V0NA 1RJGA 2VAVA 4IFEA 3R23A 4KBYA 3IDSA 4J8PA 4YMWA 3T7KA 5CAEA 3NBQA 1MHTA 3VVLA 2H9AA 1JYFA 2E3JA 4NOLA 2A7XA 5ALMA 4TKVA 1WUJS 2F1KA 2WFLA 2QQGA 1N0HA 4HAUA 3U7RA 3WNBA 5JFOA 4U0HA 2BYTA 2IYLD 3QI2A 1BRMA 3FUUA 2HK6A 4FSDA 1V8BA 4FXOA 3L92A 4I6GA 4E21A 2HBQA 3S2IA 4UU0A 4M6WB 3T7DA 4DLLA 1AKTA 1G2PA 1RP7A 4OB7A 2Y9PB 1X42A 1FDSA 3WGZA 5JAUA 1MZPA 4TQUS 2VHVA 5CLGA 1LD3A 3E0XA 3QF4A 3TQSA 5INFA 1YK0A 4F3NA 4PLVA 1DBSA 1BJTA 3DMFA 2DHCA 3DNPA 2R11A 3WLFA 1NBEA 3OURA 5GJVC 2D13A 4Q7JB 4CIDA 2R00A 4CF3A 3PXDA 2JLYA 2Q35A 3INYA 1N92A 3N8NA 5JY6A 2VQFB 3PWKA 1D5WA 3K4QA 1H65A 3E2IA 4WSOA 2H1IA 5AM0A 4ELXA 2NUPA 3FCUB 1YB5A 1USIA 4Y6PA 1XXLA 2JLBA 3NOXA 2Z1DA 2LKDA 2O14A