3ZW9A

Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with (2s,3s)-3-hydroxy-2-methylbutanoyl-coa
Total Genus 271
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
271
sequence length
723
structure length
723
Chain Sequence
GSHMAEYLRLPHSLAMIRLCNPPVNAVSPTVIREVRNGLQKAGSDHTVKAIVICGANGNFCAGADIHGFSAFTPGLALGSLVDEIQRYQKPVLAAIQGVALGGGLELALGCHYRIANAKARVGLPEVTLGILPGARGTQLLPRVVGVPVALDLITSGKYLSADEALRLGILDAVVKSDPVEEAIKFAQKIIDKPIEPRRIFNKPVPSLPNMDSVFAEAIAKVRKQYPGVLAPETCVRSIQASVKHPYEVGIKEEEKLFMYLRASGQAKALQYAFFAEKSANKWSTPSGASWKTASAQPVSSVGVLGLGTMGRGIAISFARVGISVVAVESDPKQLDAAKKIITFTLEKEASRAHQNGQASAKPKLRFSSSTKELSTVDLVVEAVFEDMNLKKKVFAELSALCKPGAFLCTNTSALNVDDIASSTDRPQLVIGTHFFSPAHVMRLLEVIPSRYSSPTTIATVMSLSKKIGKIGVVVGNCYGFVGNRMLAPYYNQGFFLLEEGSKPEDVDGVLEEFGFKMGPFRVSDLAGLDVGWKIRKGQGLTGPSLPPGTPVRKRGNSRYSPLGDMLCEAGRFGQKTGKGWYQYDKPLGRIHKPDPWLSTFLSQYREVHHIEQRTISKEEILERCLYSLINEAFRILEEGMAARPEHIDVIYLHGYGWPRHKGGPMFYAASVGLPTVLEKLQKYYRQNPDIPQLEPSDYLRRLVAQGSPPLKEWQSLAGPHGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Isomerase and Hydratase Reaction Mechanism of the Crotonase Active Site of the Multifunctional Enzyme (Type-1), as Deduced from Structures of Complexes with 3S-Hydroxy- Acyl-Coa.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
molecule keywords PEROXISOMAL BIFUNCTIONAL ENZYME
total genus 271
structure length 723
sequence length 723
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.50 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3zw9A03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3zw9A02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3zw9A01
3F46A 1WVGA 4XIYA 3U5TA 5B1YA 1CQIA 1IULA 1PJSA 3GH3A 3GLQA 3RASA 2DTDA 2OHXA 3E9NA 1HYEA 1NBOA 2QRLA 2QQ3A 2VWHA 2EXXA 3DJAA 3ENKA 3IUPA 3UF0A 1HLPA 4E5PA 4B7CA 2JFFA 5DULA 1NZYB 2ZQQA 4JP3A 4X54A 1PQPA 4CMHA 3ADPA 2XAAA 1HRDA 5C3MA 1NR1A 3GNSA 3PGXA 4XWYA 4NBVA 4GMFA 1PIWA 1T1SA 3HN7A 4CLOB 5COQA 3V5NA 4NBTA 3IC5A 2HRZA 3ZU3A 5DNAA 3GZ4A 5CDGA 5DTPA 3P2LA 4L4RA 4JN6B 4CV2A 1LQUA 3VVBA 3VPGA 3KTKA 1A4UA 4RYFH 1MFPA 4J0EA 3QYRA 1X0XA 4NI5A 1E7SA 4J3FA 5L7WA 4RPJA 2W2LA 2ZIZA 3DMTA 1YO6A 4NMHA 5F1OA 3WIEA 3WR5A 2F9IB 1FDWA 1L7EA 2PA3A 3GY0A 4XGKA 4ZDDA 5FUSA 3C85A 3EAGA 4UREA 3GF7A 2VRBA 1O0SA 2UV8A 2DLDA 1HETA 3M6NA 4Q3DA 4L4XA 4CM3A 4JYJA 3HFSA 1UIYA 1YVEI 2R00A 5FYDA 1YKFA 2VYND 4MI2A 4OOEA 3LKEA 3IS3A 1ENZA 5IN5A 2FR1A 4BNMA 3F4LA 3P85A 1T26A 2I76A 4MVJH 3L07A 4BGUA 5JDCA 2FW2A 1AGNA 1Y8QA 3TZ3A 4KNPA 1P45A 3MWDB 1LA2A 1HL3A 2J5RA 2FPIA 1LDBA 3KLPX 1R0SA 4XEHA 4BL5A 2CVZA 4OOFA 4FC7A 1HYGA 5IDYA 1K5HA 3UVEA 4R51A 2RCYA 3TQHA 4Y8VA 5G1RA 3UCFA 2OFPA 1P44A 2Q49A 2F9YB 4YAEA 1G0OA 3RQSA 4HNHA 1ENPA 4O1MA 4HNKA 4YAGA 2BLLA 5ILGA 3OQ1A 3WX0A 4M1QA 1P33A 1GPJA 4IGEA 3UKOA 4IJWA 1MJ3A 8ADHA 4IXTA 4YJHB 4BO4A 1IZ0A 5C7OO 3TPCA 4W4TA 3BMOB 1PJCA 1NQTA 4R68A 4BB6A 1JWBB 2H63A 4UVDA 5HS6A 1DRWA 1L1FA 1JXZA 3WOHA 3S1LA 3JYQA 4MPDA 3VH1A 4DA9A 3ABIA 2Q34A 1PZFA 4IDFA 5EIOA 2RAFA 5JAMA 2GYYA 2B37A 4QSMA 3I9NA 1N6DA 3P2YA 4YRAA 2Q46A 3IDSA 3MJSA 4PLGA 4TMFA 3ZNNA 4DLBA 2BRUA 2JD0A 4OSOA 5KCZA 5L4NA 3PRJA 5JCJA 4CV0A 3IQDB 4ID9A 1YS4A 4AVYA 1KC3A 5H83A 4IDAA 1RJWA 1S6YA 1M6WA 3GDOA 1WW8A 3HB4X 1Y1PA 3KOUA 5JBIA 4LVUA 4LN1A 3JQEA 2AG5A 1SZJG 1UXKA 1RM0A 4BO6A 4GX5A 1BXGB 2UYYA 4D42A 2VRCD 3O8QA 1G1AA 2PH3A 3QW2A 4HADA 1ONPA 1JN0A 3G1TA 5EPOA 1XEAA 1VRWA 2R2GA 4BKPA 4EBFA 1E7YA 3FBGA 4BNGA 5G4KB 4R41A 3H9QA 5DCWA 1OFGA 2D5CA 3F5QA 1O94A 3TWOA 1TA4A 5T67A 2EJWA 4CMBA 1E6UA 1ADCA 4DQVA 2HDHA 2VT3A 4FJ1A 1U28A 4XGNA 1P1RA 4MINA 4EEXA 3QLJA 2BH9A 4LRSB 2HO5A 3AM5A 1XG5A 4RJTA 1PGPA 1NX6A 2JJYA 3L6OO 3EDMA 3QSGA 1HF3A 1LDNA 2Y68A 3HE2A 1T1RA 4MJLA 3VIVA 1U2GA 4GGOA 2CVOA 4WYOB 1M2WA 1EBUA 4KQWA 5BR7A 1CDOA 1TVEA 1VL6A 3BTSA 1BMDA 4XYLA 3PHGA 4GX2A 5A3VA 4CLRB 4BNWA 3U9TB 2YW9A 1QYDA 4FN4A 3RBXA 3PJDA 5CG2A 4W9NC 4NFHA 3NTOA 1E5QA 2GN4A 4NU5A 4EI2A 2B0JA 1R66A 1A9ZA 3CZRA 4LSWA 4R1TA 3UUWA 4DC0A 3I6QA 3A06A 1ZJZA 4DIBA 3EGOA 1SMKA 3RUIA 4D3SA 1H2HA 3ICCA 4R5MA 2FSVA 2QZZA 5F1PA 2PKQP 1E1KA 3F5SA 4RV9A 2O2SA 4MP8A 4ELXA 5U4QA 3DFUA 5JAZA 1P1HA 1PGQA 3VH3A 5JCXA 1IYZA 1WDMA 5ER6A 1AXEA 1EUCA 1ZMOA 3B1KA 3DZIA 3TZ6A 2B4TO 1AHHA 5B4UA 4GH5A 3ST7A 3ONEA 2NVUB 5IXSA 2WYUA 3DZFA 3RRVA 3V2HA 3DZJA 3RVDA 1EBFA 3E9QA 4FDAA 1XDWA 1JVBA 4MVJE 4RPHA 3ROPA 1ISGA 2D5AA 2ZQRA 1WZIA 1BDBA 4BV9A 1I2BA 1SC6A 5DKPA 1PJ3A 3CKYA 1MG0A 4M49A 3ASVA 3SXPA 3V2GA 5BNIA 5L51A 1R16A 5G0TA 2FBMA 2E4AA 4ZDCA 3QWAA 4YT4A 1LSUA 2EKQA 1C1XA 1P1FA 2WTBA 1D7OA 4RL6A 4GQAA 1Q0LA 2VSUF 2GZ1A 4NDNE 4U0HA 4J6FA 3K50A 2DPHA 3D64A 2GGSA 2JD2A 1E92A 5FEUA 2NQTA 4PLZA 3OF2A 3SC6A 1ZIDA 4XRGA 4YB8A 4BO2A 3HLN1 3C7DB 1ZK0A 4R54A 3TDCA 1B0AA 1KIFA 1R0LA 1ZXBA 1YB1A 3I52A 5L95A 2DVMA 1V6AA 4FW8A 3BHJA 3I5MA 3T4XA 3ULKA 3RC9A 5AXCA 4IZDA 1KEPA 4FJ2A 1X0UA 2VSUA 4MIOA 1IPFA 5JFOA 2RHRA 3CXRA 1QKIA 5G0SA 4YT8A 3ZGYA 2IRWA 1ID1A 2O50A 3FRJA 3PEAA 4FFMA 3OIGA 4U7WA 1J4AA 4R16A 3X2EA 4G2RA 4WPGA 5CP8A 5I7EA 1B26A 3GF4A 3QWHA 4URFA 5HM8A 1U7TA 1LLCA 3TFOA 3KYDA 4HNGA 2HLPA 4ALMA 4CJXA 1IE3A 1V3UA 3TOZA 3U4IA 1P1IA 1GZ3A 5C37A 2P5YA 3ITKA 3IKTA 1EE2A 3R0IA 3GGOA 3JQ8B 2VHWA 2AA3A 1Q0QA 3C7AA 3INGA 2VHXA 5F5NA 4HWKA 4CM9D 5A9SA 3KSDO 3I83A 1H0KA 1Z6ZA 4QT0A 1PR3A 4XD2A 2P9GA 1T25A 3BZUA 1U8FO 1O6ZA 5KVSA 1PJLA 3TSCA 3LQFA 2VSSF 1WP4A 3FTNA 3PQDA 2Q45A 2W2KB 3KYCA 1YB5A 5F1KA 5EQDA 3ZHYA 1KVQA 1GZ4A 3VZPA 4CR6A 3NTQA 4I5FA 4YXFA 1NVTA 2HJRA 3NT5A 1UXIA 2GSDA 1XA0A 5JDIC 1LSOA 1C1XB 1R6DA 1PIXA 4NJMA 1K89A 4WLEA 4CLXA 4XA8A 4FJWD 1GUYA 2X9GA 1P0CA 4XQEA 3L4BC 2AQIA 4RCNA 4L4SA 2EP5A 2YFQA 3TDKA 4FNDA 1MP0A 3JQ9A 4TROA 4CMAA 1HDRA 5I7VA 4PVDA 3KTIA 5FWNA 5CAEA 1DFGA 3QVWA 3VC7A 3GZNB 4IMPA 1H93A 1Y8RB 2EJ5A 2J3IA 1I8TA 5CPFA 2VZ9A 3RAJA 2Q2WA 1KETA 3F1KA 4TZTA 3D5TA 5JAIA 2OBNA 1Z74A 3GN1A 4H16A 4DGSA 3DAFA 1LNQA 3ZW9A 3V1TC 2B35A 4YJFB 3GRKA 3LLSA 1ZJYA 2G1UA 2V6BA 3JQCA 4ZJUA 4CQMB 4U0GH 2Y99A 3EK2A 3MFMA 5DOZA 4IS3A 4CM1A 1R15A 1NAIA 4CLDA 5L4SA 3H3FA 2GRAA 3KETA 2VZ0A 4ZQEA 3QHAA 2X23A 3PJGA 3DOJA 3AUAA 4GWGA 4KTTE 5MDHA 3EVNA 4QFDA 1NR7A 1DB3A 2EW8A 2O3JA 1Z7EA 2ZL0A 3GR6A 4WUVA 5JAQA 1T4BA 1XWFA 2VCYA 4RQUA 2EW2A 3JQAA 3MJEA 5CDYA 5DTWA 3ZCXA 4RLSA 3QREA 3OJFA 2CE3A 3PQFA 2HUNA 1XELA 2Y93A 4YDRA 3H5NA 4MDHA 5EERA 2PZJA 1MB4A 1T2EA 2PR2A 3O26A 3NT4A 1EDZA 5LCXA 3CSDA 2VUUA 5HRUA 4Z0TA 3AWDA 5JBXA 2E82A 1NHWA 4BMNA 2VHVA 4O59O 2ZATA 1W73A 1JWAB 4BNNA 3ZI0A 2ZJ0A 3HADA 3BEZA 5A03A 2J5GA 4WCFB 1TEHA 5I9MA 4DPKA 3PGQA 1MX3A 4FJ0A 4I08A 1HDGO 5ENDA 4FOOA 1MV8A 1RM3A 2Y0DA 1UDBA 1DXYA 4YTEA 2QX7A 4JFCA 1WPQA 2ZQYA 1WZ8A 2X8LA 3QMJA 3PZKA 1CWUA 3RC2A 4CLEA 1N9GB 2PKQO 5CFZA 1FC7A 1UP7A 5KDRB 1RPNA 4OIMA 3I4CA 2WM3A 1JKFA 2E37A 2HJSA 3PHHA 3PHJA 3KXDA 1NFRA 3GFGA 4GAEA 2E6UX 4KWHA 5TJ9A 5TIIA 3WGIA 3QWDA 3AY7A 3I9LA 4UUNA 4CMJA 1PZEA 2PKRA 2NVWA 4IJUA 3NDIA 2Q1WA 2C54A 3ZWYA 4CM7A 4B3HA 4J2HA 3M2TA 3QP9A 1UUFA 4WCFA 4DPLA 4Z9XA 3GRPA 1KS9A 2CSUA 3LAOA 2EERA 3LF2A 4YACA 3AUTA 5JXWA 1LJ8A 3WQQA 3TT6A 5HA5A 2DBZA 3H6KA 4BNHA 1SZOA 2F9YA 5EQFA 3WNVA 1GV1A 1YOVA 5JDCC 5KVCA 1F17A 2WYVA 2B4QA 3JYPA 4FB5A 4FR5A 3DAGA 4JJTA 2W98A 3BMOA 3LSYA 4HX5A 1Z73A 3DR3A 2PD4A 3NX4A 4YEDA 1VL0A 3TLFA 3DBHA 3DO5A 3KBOA 3OSUA 5BSEA 1Y6JA 1Y8QB 3OM9A 5KJFA 1KVTA 1OBFO 5DP2A 1ZK4A 3GEDA 2VREA 1E7QA 3W1VA 4EEZA 5CPBA 3IAVA 3WNQA 3PYMA 4PLWA 2PBPA 1O5IA 4JBIA 2PZMA 5BSHA 2GN8A 2VYVA 1BTOA 4E2YA 3NGXA 1MG5A 1UZLA 1PGJA 5EESA 3OHSX 3VTFA 4J1TA 4F3YA 3DBLB 3I47A 4YYZA 2O3TA 1E6WA 3K8ZA 5DZKH 3NAQA 1EUZA 4A27A 3B1FA 5C90A 1D4FA 1LXCA 4WOKA 4FZWC 4K26A 4TZKA 5CHEA 1HXHA 4WCFC 4XB2A 4CL3A 3VKUA 4BNXA 1WAMA 4YLHA 2I5PO 2AEJA 1HDCA 4OKIA 4BHTA 4J7UA 3FR8A 2R00C 1EVYA 2GASA 1PX0A 2P2SA 3ZU4A 4JVTA 1NWHA 4DQUA 5L4LA 2QW8A 3CTMA 4P4NA 3GOHA 2Q3EA 3ROMA 2PD6A 3KM0A 1Y8RA 4WCZA 1HWYA 1Q7BA 3DQPA 4PG7A 2RBEA 2A7KA 4BNKA 1HE4A 1LRKA 1TG6A 1JVSA 4ND1A 4S1VA 1LU9A 2F9IA 2VSSA 4RF2A 4TKMA 3ANNA 4AL4A 4K2NA 1LDGA 3TV5A 1R12A 4JGBA 4ELWA 4NJMB 2VN8A 4RVSA 2I6TA 4R1NA 5G2OA 2BGKA 1HE2A 3L77A 4MOWA 1V9LA 1PTJA 3OMLA 1FDVA 4KUGA 2Q35A 1DEHA 5BSFA 1O8CA 3VKVA 4D3FA 3GDGA 4ZU2A 4GM2A 1EFLA 3DTTA 1UZNA 2O4UX 4GLOA 4NEKA 1QLJA 3JQFA 3U09A 3WQSB 4ZGWA 3ASUA 2P4QA 3IMFA 5AXBA 3V2UA 2CBYA 2HSDA 1DBVO 1KVSA 3EMKA 1YRLA 4WJZA 3TNLA 3BXXA 2JFHA 1HZJA 1YQGA 5A06A 4AJPA 2D0IA 2DUUA 3DFZA 2Z1NA 5HBRA 4XX0A 4XR9A 1Q51A 2ZTVA 2PLAA 3GUYA 1Y7OA 1LTHR 1BVUA 2XXBA 5KJCA 5T6BA 4XQ9A 1MLDA 2YUTA 4OJNA 3JQBA 5L9AA 3TZHA 4UVIA 4YQYA 2EGHA 2NU9A 3HWRA 1ADGA 4K28A 2IZ1A 1RJNA 5IZ4A 4MP3A 1LBEA 3W4IA 3JD3A 4BO8A 1P31A 4JIGA 2VHYA 3AM4A 4BO5A 1DC5A 1I0ZA 1E1MA 1UDCA 2W3PA 5I9LA 4PG6A 4EYEA 5HTOA 3BF0A 3WWZA 3LT4A 4NR0A 2CDAA 4YJGB 5JYDA 1NQ5A 4Q9NA 4B7UA 4PLYA 3INTA 4UUOA 3S2FA 3I4FA 4I4ZA 5IG2A 1Y9AA 3M1AA 2X58A 1A7AA 1NFQA 3QJ5A 4Q3BA 2AG8A 2YHIA 3VVCA 3H2SA 1C1DB 1W6UA 2HK8A 1YBVA 3GGPA 4P38A 1ENOA 4FIZA 3S2EA 3PPIA 2DQ4A 1MC4A 3WTBA 3NDJA 2VTEA 3MJVA 3KSZO 5IN4A 4G65A 3K8XA 3RJ9A 1J49A 2FP4A 3PJEA 1BRMA 4BUCA 3GPIA 2FPPA 3SJ7A 5DU8A 4ZQHA 4B4WA 4OG1A 3V5IA 1YGYA 2VWGA 4HP8A 4OLQA 4BNUA 2NVUA 3SJUA 1DHRA 1U1IA 1IUKA 1E0DA 1QYXA 3MOYA 3Q2KA 4OM8A 3PYXA 1DPGA 2AEMA 4J90A 1PEDA 2AXQA 4OHUA 4BVAA 1YBAA 3ZNQA 2PNFA 1H6BA 5G0UA 3D1LA 3C7CB 4RPGA 2X9VA 4KQXA 1A72A 2CY0A 4ASIA 3OH8A 3K5PA 4IDEA 4WLNA 3DBRB 5HS4A 4HFRA 1ISIA 4FCCA 1LDMA 1JAXA 3GMAA 1R4MA 5G1QA 1N7HA 1YXMA 2J5GD 3CH6A 1I30A 3KEQA 2O3SA 4DBVO 5DUFA 1GYPA 4GL4A 1R4MB 3GGGA 1I36A 3W8FA 4MVJF 3AJRA 4HKTA 2IZ0A 2TMGA 1QMGA 4PG5A 4U8GA 1R0KA 1WLYA 2YFHA 4EJ6A 1MFZA 4DL9A 2Q4EA 3F6YA 4RGBA 1DAPA 3GNQA 3QWBA 1U4OA 4ALKA 4BNYA 3PWKA 1IZ9A 1PWXA 4XYBA 1NPTO 3WYBA 4R3WA 5U9CA 3IP3A 4J9VA 2QHXA 3PXXA 3Q0EA 1YG8A 2POQX 1SG4A 3G1UA 3WJAA 5DCYA 4FN8A 4WGGA 2NUAA 3G79A 1C0PA 1ZFNA 4W6ZA 1OZAA 1J5PA 1NQAO 3JCZA 4IPTA 4AG3A 3H9JA 2WYWA 4JROA 2BZRA 1FDTA 3CEAA 1XQ6A 2GZ3A 3JQFC 3CZMA 1B8PA 2AE2A 1HSZA 3HB5X 2IE0A 4WEOA 1OC4A 2HQ1A 4UULA 5T64A 4GKVA 5JYEA 3STAA 1HDOA 1DJNA 2YHIB 3NGLA 3HDJA 3O03A 4BNJA 1LDYA 1EMDA 2D59A 3SVTA 5JCJD 4WLOA 5KWEA 4F6CA 1G0NA 2W4QA 4OYRA 5I8ZA 4FNBA 3H4VA 5ER9A 2CNBA 1IY8A 1EK5A 3IBBA 1GYQA 4JCTA 4CQLB 2Y0CA 3ROKA 4UUPA 5DF1A 4BGIA 3H3JA 3PZBA 3PGJA 3DMTC 3E6AA 3IJPA 3OA0A 5DN9A 3T3WA 4U0KA 4H15A 4YA6A 4N5LA 4MKRA 3QKAA 3DXFA 1TT5A 4PLFA 3BHMA 4CLHA 2P4HX 2RIRA 2Y66A 4QECA 3EVTA 4UEJA 1JKIA 2X5OA 3OP4A 1MGOA 2O3UA 1LDEA 4XR4A 4YRBA 5B4TA 2LDXA 2FY8A 4OQYA 3FN4A 5F3RA 1YL7A 2ILTA 1M75A 3VTZA 4TVOA 1N6EA 5KIAA 3C24A 4TSKA 1NVGA 2JAPA 4I8XA 1VM6A 3NJBA 2UAGA 5DCUA 2PG8A 2V6GA 3L6DA 1ZXLA 3EW7A 3K30A 3EZYA 3QA9A 2D1YA 3SWXA 2DFDA 1T2FA 3JQ7A 4OO3A 1NNUA 2J6IA 2O7SA 4IIVA 3PHIA 1HEUA 4BNIA 2HW5A 3E1KA 3HSKA 3UW3A 4KMSA 3H0SA 1NXQA 2DBQA 4N5NA 5A02A 4Z0PA 4JCSA 3OQ6A 3DTYA 4K3WA 4YAKA 3LVFO 1ZEJA 2JL1A 2WSBA 1A4IA 4PG4A 1EF8A 1XNVA 1E3WA 1NP3A 1ZEMA 4WLFA 2PFGA 2PV7A 4LMPA 3H9EO 3ZWXA 3ZHZA 1W8DA 1PL6A 4WLVA 5CTCA 5ENVA 1ORRA 5TS3A 2X0IA 3R1IA 3P7MA 5AXDA 2OZPA 3NKLA 1JA9A 3KHUA 3WG9A 1FJHA 3DBLA 3O38A 4RZHA 3FF4A 4GX0A 2DTXA 3QVXA 3U49A 1F14A 1D1TA 2FZEA 2BD0A 1XX4A 4XB1A 1VKNA 4D43A 2ZB8A 4FOSA 4DLLA 1E3LA 1BXZA 4PG8A 3Q1LA 3C3XA 5H82A 1W4ZA 1JU9A 1UXGA 2OBYA 1ARZA 3AUSA 3KRTA 3L9WA 2J3HA 3TF5A 4MIYA 4PLCA 2FZWA 3ZN2A 3MCVA 1X15A 1RJMA 1FC6A 4WK6A 1NZYA 3RFVA 5ICSA 2GD1O 2ZTLA 5GY7A 1A7KA 4GMGA 3LC1O 4R1UA 3TFQA 1AUPA 3GQVA 2OL4A 4GI2A 4JBHA 2J3JA 4Q3EA 2I99A 4P4LA 1X1TA 3JQ9C 3K73O 3S2GA 3SX2A 3MYBA 3WJ7A 4AJOA 4JWVA 3G49A 1Z75A 2PY6A 4J4HA 4E3ZA 1NASA 4Q0GA 1DLJA 3GFBA 3EHEA 1ZH8A 3WYCA 3D3WB 3FWZA 1WDLA 3H0QA 1I2CA 1YE3A 2OMEA 4DI1A 3W4KA 1OOEA 1KY5A 2GTRA 1BW9A 4I52A 1UYTA 1E7MA 1BVRA 2WD7B 3JQAD 4DMMA 5I9NA 1P1JA 2X7HA 4XYMA 3G0OA 3T4EA 2G76A 3GMDA 3KQFA 2WE7A 2FZSA 3WIDA 3H0JA 2JCXA 1ISHA 2J5QA 3HDYA 3PLRA 4KDFA 2B69A 4ALLA 2OP1A 2YV2A 3Q0JA 4TRJA 5EJ2A 1E3IA 4ZDBA 1A9YA 4NIMA 1E3EA 3F1LA 3O4RA 1YJ8A 4KUEA 3G64A 3U9SB 4CV3A 4XYEA 1BDMA 3MZ0A 4A5OA 3MTGA 3VZRA 5IZCC 3VHRA 4D41A 1OD4A 1F8GA 1XU7A 4MVJI 2ZKLA 2VNAA 2IDZA 1K3TA 4EZBA 2O23A 3GKBA 1YBMA 4J1NA 3A4VA 4PLPA 4DMLA 3K31A 1Q2XA 4WE3A 5TC4A 1N7GA 3X2FA 3ADOA 4NBWA 5KVVA 1P3DA 4ROSA 3T89A 3HNPA 2CMDA 1ZSNA 4GSLA 3SEFA 4EUFA 4FFPA 3BA1A 1D1SA 1RYEA 2Q1UA 1X7DA 1NWCA 3WFIA 5BNTA 4DYVA 3MWEB 4Q3NA 5BNFA 3AY3A 3RUCA 1EFKA 3OBBA 1DRUA 2YV3A 3WBBA 4CMKA 1O89A 3DEYX 3WGOA 4K29A 3PIDA 1GEGA 4DYDA 1P77A 1K6XA 2PZLA 2OXIA 3PVZA 3OJ0A 4UVGA 2FRDA 1UR5A 2BI8A 2NADA 3I1JA 1I3MA 4C7JA 4HUJA 2F6IA 3MOGA 3TRIA 2I67A 4J1QA 3V5EA 3DOCA 3VOSA 4UVHA 3EY4A 4J2OA 5ES3A 3JV7A 1ON9A 4MVJA 4GVLA 7MDHA 4L74A 1YH3A 5DL1A 1CRWG 2B36A 2JFGA 2A35A 4L6WA 4Z3KA 3JQGB 2DFVA 1LSJA 4YJFA 1LQTA 2JCVA 1SPXA 1Y5MA 3WG5A 4O63O 3KTDA 4QUKA 4BQRA 1XGKA 4DC1A 1B8UA 1IPEA 1PS0A 4XYGA 2J5KA 1EUDA 3IAHA 4BMSA 3Q3CA 2QZ9A 2V7PA 4RF4A 1CETA 2NACA 4YCAA 5JW6A 4IDDA 1F0YA 1UAYA 3GZNA 4Z3DA 5LC1A 1AHIA 2QYTA 1V0JA 2C5EA 2C59A 3F4BA 3QK8A 4YWJA 5TSDA 1LEHA 1LX6A 1SB9A 3MJCA 4B8ZA 2DAPA 5DZKA 3GNTA 4Y6SA 2UUOA 1D8AA 1RKXA 4XRRA 1FCFA 1YONA 3JD4A 3MJ4A 2EJVA 4MVJP 4DIFA 2BELA 4GBJA 2VSUE 4DREA 2CF6A 3PDJA 3HJAA 1U3WA 5A9SB 2GZ2A 2O3RA 3AFMA 3M1LA 1N2SA 3BAZA 3MTJA 4ZRMA 1YL6A 5JC1A 3FPCA 1WWKA 3N6RB 4QX6A 4NBUA 3V1YA 1KYQA 1CJCA 2W2KA 2ZQZA 4ND4A 4PLHA 2Y1DA 3RROA 2Z95A 4XJSA 1HE5A 3WFJA 1FXSA 2X0JA 3H5RA 4RVUA 5AXAA 4WEQA 2PGJA 3FCOA 2HRBA 3L9XA 1NQOA 2YYYA 4J4BA 1LC0A 2FR0A 3FNEA 3AOEA 2NVBA 1YWGO 3AK4A 4FFLA 3DZGA 1EQUA 1HSOA 4IZHA 3W4JA 3R6HA 1TB4A 4AJLA 4YAIA 3JQ8A 4MKXA 3DBVO 4B3JA 4R69A 4RF3A 1YQXA 3IOYA 5TJHA 4CM5A 2QRJA 4M55A 3TZCA 3QWFA 1PGOA 1DRVA 3FNFA 3C8MA 1PJBA 4BKRA 1HLDA 2DM6A 1B8VA 3QY9A 4Z9FA 1PQUA 3OFSA 1H9AA 3GEGA 3R3SA 4QFCA 4IUYA 4BMVA 1IB6A 2OORA 3HP0A 2V6MA 4EMLA 3L6EA 4YT2A 4JJFA 2H6EA 3GPDG 4ITUA 1F8FA 2WE8A 3ZZNA 5TGDA 2VUTA 1ZNQO 3UICA 3PYLA 4OXNA 1R4NA 1PJ4A 1U3VA 2X6TA 4AJJA 3LZ6A 5DBFA 3BMNA 2UZFA 1PJ2A 3M2PA 4NPCA 4Y98A 4D45A 5KJ1A 3FBTA 1LLUA 2W90A 3FI9A 3OECA 3BHIA 1Y5RA 3AU9A 4R4JA 3QVTA 3ROQA 1KVRA 2FR8A 4R5HA 3OIDA 2H1SA 1VPDA 3BMQB 3ETEA 3H9GA 3WGGA 1SB8A 3BTUA 2JCYA 2YQ5A 4JYLA 4RPKA 3CIFA 1NYTA 2QYSA 4IMRA 1Y7TA 1CEQA 3G17A 3K92A 4MVJM 3WTCA 3GVCA 4B3IA 1M66A 2QQ5A 4Y6PA 4AJ4A 1XLTA 4IDBA 4CUZA 1CIVA 1CYDA 4BO0A 1UP4A 2GNAA 3DL2A 3KEOA 4KOAA 3AY6A 5EN4A 4U0GA 4RVFA 2GR9A 3WGQA 1C0LA 4R1SA 4BB5A 5CDSA 4ND2A 3QV1A 4K6FA 4O5OA 3UCXA 3KV3O 4I9HA 1O95A 3OC7A 4UUMA 1B2LA 1H6CA 2I3GA 1H9BA 3ONFA 4ZQFA 1PQWA 5BT9A 2Q1SA 3NJ8A 4G81A 1VRGA 4CMCA 3H5AA 4YRDA 1E5LA 5A4DA 2UDPA 1NVMB 5KJEA 5TF4A 2J5II 1DIBA 2G82A 3E82A 4I1IA 3U3XA 4ZHSA 4E12A 4YBZA 3D5QA 3WLFA 3QXZA 2V6FA 4J7CA 3QXIA 1QR6A 4ND5A 1U4SA 3MT6A 3N58A 4FFOA 4OMUA 1N8KA 3E5MA 4ZDEA 2VTDA 3ANMA 2HKIA 4KWIA 5E0NX 2OOSA 2Q1TA 4P22A 3WGHA 3U4HA 2PD3A 2NU6A 4BQPA 4YVFA 1QYCA 1XHLA 4CMIA 4E31A 1UYVA 2NSDA 4I42A 4KTVE 4QFEA 1C1DA 1HTBA 4WCDA 4ZICA 1DAOA 4OQZA 3NDRA 2GO1A 2WEKA 3B70A 4ESOA 3R6DA 3RSTA 1I01A 5FI5A 1E7WA 2D2IA 4R9SA 1HKUA 5I7SA 2A4KA 5B37A 1VJTA 2WWRA 1OD2A 3DDNA 4EMPA 2GPTA 1H6AA 1JKJA 1UAGA 3IIEA 1NHGA 3D3EA 1X7HA 5I8WA 3ETDA 4AICA 4L8VA 1LRJA 2W8ZA 3L3SA 4E5MA 3O8QB 4HBGA 3A28A 1T2AA 1LSSA 3MOIA 4E5NA 4FZWA 3RUEA 1RM4A 1PWZA 1VLLA 5JO9A 4BV8A 4E0BA 5BQFA 4KWBA 2VOJA 5E0SH 4L0QA 3W8DA 1LUAA 3LT2A 5CG1A 3K2BA 1RWBA 1ZO8A 4JCRA 3ZWCA 1GZ6A 3UHAA 4A7PA 1ZW1A 3D3WA 3RFXA 3JQ6A 1FDUA 3EUWA 1C14A 4IJKA 4A73A 4E2ZA 4II3A 2BKAA 2Q2QA 4EMMA 5DP1A 4MVJD 3GT0A 3KO8A 1MUUA 5JMWA 3GVPA 3U0BA 4PLVA 2X24A 3RC7A 2I3AA 5IZCA 1HZDA 1I32A 3CPSA 2ET6A 3E5RA 3DHNA 3PI7A 4RF5A 1GUFA 4TVBA 5JLAA 4QO8A 4CM4A 5FIFA 3Q2IA 1B14A 5L7YA 2GLXA 3RUFA 3AI2A 2DUWA 1DIGA 1CF2O 2H5LA 2NTNA 2J5IB 1GYRA 2HMVA 5A05A 4RO0A 1U9JA 4L9RA 3TRRA 3K96A 3RFTA 4Z0MA 5TT0A 3QIVA 2PZKA 1SEPA 1UDAA 2AW5A 9LDTA 4HC8A 3JD1A 3TT7A 1B3BA 1PGNA 2YJZA 3I6IA 4GKBA 2P9EA 4BO9A 2H9IA 1XKQA 3WGZA 5A5EA 1EVIA 1J6UA 1Z7BA 2DPGA 1E6EA 4QIIA 3ONDA 1DFHA 1GCOA 2X5KO 5KTKA 3ZW8A 3L4BA 4JNKA 3VPHA 7ADHA 4I9NA 1A27A 1ISJA 4GVXA 2C2YA 4HFNA 4XDYA 5JC8A 4AJEA 5IJZA 4JOTA 4K9DA 1H94A 2CUKA 4NK5A 4ALIA 3GMSA 4YAJA 4LGVA 3TZKA 5JBWA 4JCQA 3S8MA 1QORA 3TL2A 5A3JA 4A03A 1I10A 2VWPA 3NYWA 4IGFA 5A9RA 3QWIA 3BTVA 1E7RA 1Q7CA 3K6JA 2F00A 4NZ9A 4O6VA 2GCGA 1U3TA 4N54A 3AUUA 3H65A 4ZN6A 5JSFA 2F6QA 1QV6A 2JHFA 4NJOA 3ZV6A 3FD8A 3DOOA 3B1JA 3CINA 4BKUA 4AJ2A 3ZHBA 4N18A 3JQBC 2DKNA 1EF9A 1VJ0A 3ZNPA 3LLVA 1UYSA 6ADHA 4C4OA 2ZCUA 1UJMA 5K6AA 1VI2A 1HDZA 1P1KA 3SLKA 5K6AC 2CF5A 5DT9A 4WOJA 4TQGA 2BHLA 3KUXA 2XPCA 3T7CA 1ZMTA 3NUGA 1C0KA 3FDUA 4U1AA 1NAHA 1RM5A 1TYFA 2DUBA 5INIA 4CPDA 5T8KC 2IXBA 1PS9A 3OICA 5DBGA 4TRNA 4CODB 4DIOA 3GF3A 1LC3A 1I24A 4U18A 1M76A 4RVHA 2E49A 3Q1TA 3RD5A 4CLOA 4QXMA 2I66A 5H81A 1TI7A 3DZHA 2ZTMA 4QEDA 1JAYA 2AQ8A 4XKJA 3Q7HA 5JY1A 3GUCA 1VE9A 1G6KA 3QVSA 1D3AA 3B6ZA 4R9RA 5IXYA 2B5VA 1JDJA 2X86A 3WGYA 2J5IA 1WNTA 2EGGA 2C8TA 2C7GA 4EUHA 5GZ1A 3PP8A 3ZU2A 5AQ1A 4IM7A 3JU1A 2GERA 4RPLA 4ZD6A 5C7IO 1V8BA 1NPDA 4NU6A 2FMUA 4J43A 1B3RA 1X14A 3K9QO 3QRWA 4FSHA 4W9NA 3PK0A 1ULUA 4E2XA 3T88A 2NQ8A 3N74A 3ITDA 3EZLA 2EIHA 3GDFA 3T8AA 3HN2A 4CM8A 2R6JA 1PSDA 1ONNA 4IY1A 1E77A 4EUEA 1FF9A 1MC5A 3S55A 3HRXA 3R0OA 4CUJA 4I9UA 3I9KA 3RU7A 5A5FA 3ZNOA 4ZA2A 3JQDA 1FC9A 1DFIA 1XNYA 2EEZA 4M54A 4IZBA 4LISA 3E8XA 3E18A 2NU7A 4Z6KA 4FC6A 4IZIA 2OGUA 4NK4A 3AW9A 2P68A 2V65A 1GEEA 5GZ6A 1V3TA 3TL3A 1GAEO 1SO8A 1KY4A 2NTJA 1LI4A 4DXHA 3H2ZA 3W8EA 4GHNA 2VNSA 3TZQA 1K2WA 4XIJA 2GF2A 4E5YA 4MO2A 4NNQA 1OC2A 4JK3A 2VQ3A 1N1EA 3FTPA 3FF6A 1A71A 4CQLA 6LDHA 1OMOA 5DBIA 3ZWWA 2TMDA 3AI3A 1ZUD1 5ILOA 2X0NA 1X0VA 1N6FA 3D0OA 1YQDA 2PGDA 3NJ4A 1B16A 4BNFA 1YJQA 1T2DA 4ZRNA 9LDBA 4UEOA 4YPOA 1GD1O 3OJEA 1NFFA 3RKRA 2O48X 1UZMA 3GC6A 4ILKA 3H81A 1PR9A 2VYNA 2DU8A 5L3ZA 5T57A 1YB4A 1ZZEA 5L40A 4W82A 2Q2VA 3JQAB 1ZBQA 5K0ZA 1DUBA 2C82A 5EMHA 3R9QA 4KD6A 1HNUA 3KYBA 2BFMA 1DSSG 3PIIA 2X9NA 1LLQA 2QIOA 3RCBA 2GN6A 4DLAA 3R9TA 5IDXA 3UGKA 1FMCA 2AQHA 3AFNA 3EYWA 5A1TA 4BO7A 1PJTA 2IZZA 2C29D 4C7KA 2Y0EA 3SBOA 1HDYA 2IEXA 2EKLA 2D4AA 4H7PA 2CVQA 1J0XO 2HMTA 2FN7A 3OJLA 4UEKA 4DQXA 3RC1A 4D0RA 1BG6A 3CUKA 5A04A 4S3MA 3OIFA 4FFNA 4W99A 4JJIA 3B20A 3R9SA 4WECA 3FNGA 3OA2A 2NLOA 4E21A 3VPSA 3ZWVA 5IKLB 1B15A 4CUKA 4D79A 1HZZA 4PRLA 4JX8A 4L73A 2PGLA 4UAGA 4D44A 5IDQA 1QRRA 3L4SO 3D4NA 2BGLA 1U8XX 3ANLA 1XR3A 5EL0A 4KDEA 3DBRA 4EITA 3JYLA 3C1OA 1DC3A 3TVUA 4BNZA 5COBA 2OP0A 2C5AA 3GLMA 3QE3A 4QIJA 1Q0HA 2D3TA 3KLMX 4LCJA 4Q39A 2YY7A 3T8BA 4HFMA 1QV7A 4WNIA 2NP9A 5CEJA 4OKNA 2BFPA 4CV1A 4J0FA 4GWKA 3BMQA 3RUHA 1DO8A 4RDHA 5J23A 3DORA 5E0SA 3QQPA 4BGEA 1GDHA 4RVDA 3RSHA 4CQMD 5CEFA 3BTOA 4IJVA 4NHEA 5TLSA 4JJGA 3KYCB 4BOYA 3RIHA 2BGMA 4DUPA 3KTGA 2GUGA 1Q1NA 3BMCB 4E13A 2ZYAA 3SLGA 4J16A 2A9FA 2WDZA 4D0SA 2BI7A 5GZ3A 1PS8A 5JS6A 2AMFA 4K6CA 3VZSA 5JDIA 3GHHA 3BPPA 4Z9YA 3M6IA 3H0UA 3DZBA 5INFA 2O7QA 4QO7A 2Q2XA 1E1NA 1R4NB 4O0LA 1DCIA 3I9MA 2Y1EA 3RBVA 2Q50A 4KP7A 4Y67A 1K32A 1O9BA 1ZCJA 4N7RA 3D7LA 3JYNA 2ZB7A 4YJGA 3PFFA 4WLUA 3ZWPA 1B7GO 4XDZA 4M86A 1T4DA 2Y1OA 3VDQA 4LSMA 2DBRA 2NNLD 2QG4A 3VDRA 4FGSA 3KYDB 5KKAA 4RYFA 1ADFA 1NPYA 3ZWMA 5HWSA 2G5CA 3GAFA 3Q6IA 2E48A 3HDQA 3P2OA 5G0VA 3VPFA 1IL0A 3WS7A 1I3NA 1UP6A 2C07A 2P5UA 2YDXA 3DC2A 3U4CA 1OAAA 1ZK2A 2A92A 2I65A 2BF7A 2GDZA 4Q3AA 1F06A 1HE3A 1E3SA 3GEMA 1U5AA 2LDBA 4JQCA 4M89A 4OXKA 3HG7A 3HE3A 1XSEA 4IZCA 2FHSA 4OGWA 3G3EA 4OAQA 1K6IA 1GADO 1WMBA 3PEFA 3FPLA 3KB6A 2W2LD 5T5QA 3U4DA 1FDSA 2A94A 3VH4A 1GQ2A 1QLHA 5L53A 3D4OA 3L0DA 4FQ8A 4L76A 1GR0A 3OEWA 4HV4A 3VPXA 3JD2A 2SCUA 2VT2A 3T7EA 2FOIA 2OUIA 2YV1A 1HNOA 2J5SA 3JQGA 3DZKA 4B79A 4EGFA 1XU9A 4FGWA 3C1AA 4GSKA 2FPGA 2ZYDA 2J8ZA 3LDHA 3WBFA 2VSUC 2PTGA 4W7IA 4AJ1A 1KERA 3W6ZA 5ADHA 4E4YA 4RZIA 3FHLA 4RORA 3UH1A 2ZTUA 3ISAA 4IQ0A 4NQZA 2Y05A 5IDWA 2VHZA 3WGTA 3WDSA 5L7TA 3CMMA 3ZWNA 2X1HA 4JCOA 4MOUA 4NFYA 4IQ8A 5TX7A 3R3JA 1H6DA 4GPD1 1T24A 3F3SA 3S2IA 3RU9A 1I2ZA 1WZEA 2DTEA 3MJTA 4HFJA 4MXIA 3Q0GA 2CDBA 2ZYGA 4NFSA 1DJQA 3DHYA 3D4PA 1EZ4A 3AOGA 3KTHA 3H7AA 5IFLA 1ON3A 4BS9A 5G1SA 1CQJA 4BNVA 4PVCA 4Q1IA 1VL8A 1YDWA 4EJ0A 2UUPA 4IS2A 3HHPA 2ZB3A 2YZ7A 8LDHA 4PIVA 1V3VA 3EC7A 4YQZA 4P4GA 1EQ2A 3OMEA 5F21A 4U0JA 1T2CA 4EDFA 2FWMX 3PWSA 4JBGA 2G0TA 2IODA 5JNLA 4U5QA 4OMRA 3ZHXA 2O4CA 1WMAA 2EP7A 5KOIA 1JW9B 4E30A 3FSRA 3UAGA 1GQYA 1OI7A 3GAZA 1K0UA 3DAPA 1JLLA 1LRLA 4ZQGA 1YOVB 2GN9A 1YDEA 3JSAA 3RI3A 1A5ZA 3CMCO 4TRRA 2A7SA 1EEHA 3NEPX 4ELSA 2F1KA 4CM4B 2HCTA 4MP6A 1BHSA 4NH4A 4E6PA 1U7HA 4A2CA 1SCUA 1BGVA 1KOLA 1EVZA 5DZSA 3UFXA 2UVDA 2OO5A 3DBHB 4JXKA 4QQRA 1DDOA 1DLIA 2HMUA 1Q7GA 3LT0A 3TJRA 4CM9A 5I7FA 4H3VA 1SOVA 2NV6A 3V1UA 1K6JA 2Y1CA 4YT5A 3FR7A 4U6QA 1BXGA 1PJQA 1GU7A 1ZKMA 3Q9NA 3RSIA 3NV9A 4G5HA 2PH5A 5COAA 5KVQA 1GL3A 3H8VA 2BFOA 4XCVA 1I33A 3AOEC 2NWQA 4KUHA 3SC4A 1ZK3A 3W6UA 4RCVA 4WZ8B 1X1EA 4OH1A 2JHGA 1K39A 3JYOA 1PL7A 4A0SA 2AHRA 3JD0A 4LW8A 3P5SA 3LU1A 3N7UA 4INAA 4P8RA 2WD8A 5THKA 1Z82A 2NU8A 1EY3A 2AQKA 3ORFA 4XJTA 1IHYA 4E5KA 4JP2A 4I5GA 1MA0A 5KDRA 2WD7A 4TKLA 1N9GA 1W2XA 1UXHA 1VKOA 5MGBA 1XYGA 3OJOA 4J91A 1P9LA 3DWFA 3PHLA 3Q11A 3I23A 3LC7O 3HQ4O 3KZVA 4UVEA 1TLTA 3OEYA 2RH8A 4YJDA 3A9WA 4II2A 4YJHA 4CMIB 5K9ZA 4AJKA 2BFAA 2PK3A 3I9JA 4MVJG 3I3OA 1NTOA 2EKPA 2B4RO 4QTZA 4IIUA 3PLNA 4PLTA 1P74A 3GHYA 1I5RA 3ZV4A 4TRMA 2RH4A 3RWBA 4J4TA 4J7XA 5THQA 2JD1A 4F6LA 4U19A 1SBYA 4PN3A 4WNCA 1BXKA 1SEVA 4J9UE 4XQGA 5JPIA 3ZH2A 4D3DA 1ZSYA 1O8UA 3BYZA 3DMYA 5ICMA 4AJHA 4CQMA 1C0IA 5BSGA 1M6HA 3IKVA 1IOLA 4IDCA 3WSWA 1KEVA 5DOVA 3ZWAA 4F46A 4Y6RA 1ISFA 5IF3A 2Y1GA 4GGPA 4DWVA 5FF9A 4DPMA 1E3WB 3TN7A 3PDUA 3PWZA 2D8AA 5LDHA 3HINA 1QYVA 2AE1A 3LT1A 1SAYA 3NTRA 4IBOA 1MXFA 2DBVO 1J7XA 3ZDFA 3WSVA 3NRCA 4Q3CA 1M67A 2AEFA 2FSSA 1GY8A 2I9PA 4M87A 3KSUA 4AJNA 5TQVA 1NM5A 2QRKA 4I5EA 4RVGA 4KZPA 4DVJA 4FFRA 3GG9A 4LCEA 3H9UA 2DEOA 5FFFA 3NJDA 1N5DA 2IXAA 3E03A 1U5CA 3UXYA 4IQGA 3IUSA 2CDCA 3ETGA 3PFWO 4K1LA 3OQBA 3E48A 3PZRA 4XGIA 4FPXA 3ZWOA 4CR8A 4BKQA 3PTZA 3IJRA 4IDGA 1I3LA 2NTVA 3UOGA 2B5WA 1GV0A 1W0CA 1Y81A 3WXBA 3DONA 1ADBA 3LF1A 1BWSA 4EJMA 1H5QA 2J3KA 1UYRA 2G17A 4PCVA 3TVWA 4ND3A 1AXGA 5FI3A 5JE8A 2DC1A 3FWNA 4PZEA 2C7VA 5T8KA 5AYVA 4Z0HO 2O2YA 3JQ7B 1GFSA 3BMNB 3NT2A 1Z45A 2Y67A 3GVIA 3WB9A 2ZB4A 1DIRA 3GVXA 2HAEA 1GCUA 1U3UA 1ULSA 1I3KA 2C0CA 4PRKA 4PGFA 4TWRA 4ONEA 3WLEA 4OSPA 1DC4A 3WYEA 1GUZA 5IAAA 4D7AA 1SNYA 3VZQA 5C7LO 2IEBA 4L75A 4PFJA 2P9CA 1QYWA 3HFGA 1ZK1A 4DTIA 4E32A 5KJ6A 2HK7A 2Z1MA 3ICPA 2Z5LA 2ZJ1A 1DIHA 1WXDA 5LDGA 2IYPA 4ZU3A 4ALNA 5B12A 5CDTA 4ZDFA 1R37A 1VJ1A 4OXYA 5DU4A 3U9LA 4BO1A 1CERA 2ZL4A 2ZK7A 1X13A 3TOXA 1N92A 2JAHA 1KVUA 2ZCVA 1TT5B 3JTMA 3U62A 2Q4BA 3E9MA 4E33A 2DT5A 5L45A 3M6MA 2PPYA 4XZ3A 3F9IA 1FK8A 5JY6A 3WWYA 1KEUA 1ZVMA 3F47A 4RQTA 4AJIA 1GQQA 3BMCA 4FBGA 1L7DA 2HU2A 1HT0A 1XO6A 5G0WA 4B8WA 2HK9A 2XF8A 2RHCA 5ITWA 4I5DA 1U2DA 3GA0A 2NM0A 2P91A 1WDKA 3P19A 1TXGA 3LK7A 1VSUA 3MEQA 1SOWA 4NG5A 1KBZA 4IXWA 3ZU5A 1GTMA 4FN7A 3IB9A 1N1GA 3GVHA 3GK3A 3AM3A 1XQ1A 5B4VA 4BGVA 1AN9A 3A14A 4KPKA 3OT6A 3PQEA 4GLLA 3H02A 1RYDA 5EINA 4A10A 1E1LA 1HDXA 2EWMA 2JKVA 1ZSVA 2O3QA 4GX1A 1JTVA 4W7HA 1AE1A 4HY3A 1XNWA 2EHDA 1ONOA 1TT7A 1PL8A 1F12A 5TT1A 4B7XA 3RUAA 4J1SA 5JO0A 2VOEA 2HMSA 4L8KA 4NNJA 4WKGA 4B4VA 2YDYA 3DHEA 2Q99A 4WASA 3RJ5A 4CMEC 4N5MA 4J49A 3RBZA 4CR7A 5DDIP 4CMEA 5AOVA 5CDUA 4FB8A 1QG6A 2VX2A 1YG6A 1DOHA 4B4UA 2YHUA 2VRCA 2CD9A 2C2XA 5A9TA 2EG9A 3WICA 1PJHA 5INGA 1P0FA 2VYVD 4JSBA 3AU8A 4CM6A 1DHTA 4EW6A 2X22A 3KTJA 4JLWA 2IYOA 5C5IA 1PZHA 1X7GA 4XQCA 1KEWA 3UCEA 3PJFA 4ALJA 4BNLA 3COSA 3ZV5A 1YL5A 3LC2O 5CEEA 1ISMA 4LMRA 4G2NA 3ST9A 3HDHA 4IINA 3CE6A 3IL2A 2ZL3A 2Y1FA 4DRYA 3WMWA 1EE9A 4AFNA 3FNHA 5AVOA 3AI1A 1XIVA 3O9ZA 3ON5A 4ZVVA 3I9OA 4LK3A 4ZQBA 4BIIA 5KNLA 2XXJA 1QSGA 4LK5A 3INRA 1VSVA 2CFCA 4FD3A 4LVCA 1PU2A 1S7CA 2VSSE 2XOXA 5TNXA 2PWZA 4CLRA 3GN2A 3HZZA 1H2BA 1ML3A 5C9GA 2WJPA 2BMAA 2VZ8A 1UXJA 3Q9UA 5CTBA 1VC2A 2X0RA 3OETA 5TRTA 1E3JA 1HYHA 4D46A 4R01A 4FS3A 4RLHA 3WMXA 2VUSA 3QVOA 4BO3A 4OL9A 4F45A 4F47A 1MXHA 3ZWBA 4U6SA 3RKUA 4YR9A 2CZCA 2C20A 2WMDA 4NBRA 3ENNA 2IEDA 3VAZA 3VH2A 2EF1A 3A1NA 3C1TA 4E2WA 5DU6A 5ITVA 3KVOA 3ZV3A 2X5JO 4LRTB 5GMOA 4RDIA 1UH5A 4CL8A 1ENYA 1KC1A 4MIEA 1DIAA 3DB2A 4A26A 2YQ4A 1EVJA 1QP8A 4R3NA 5G4KA 4CMGA 3LYLA 5DUCA 4DBZA 1C3VA 2EV9A 1IHXA 5F5LA 3RUDA 3WQRA 1Q52A 2A81A 1Y9EA 4MKZA 3GG2A 3IP1A 5U1PA 5KKCA 3P5MA 2HMWA 2X4GA 1XCBA 1DC6A 4PZDA 2VWQA 3STHA 5JMPA 3PE8A 1BW9B 4Y9DA 1EDOA 1JQBA 3SLLA 4HXYA 4BNTA 1EK6A 3BIOA 3HUDA 5G4LA 2B83A 1QXSA 3UN1A 2ZL2A 4M8SA 4CM8B 1LLDA 3V8BA 1V35A 3K2EA 4B4OA 1PZGA 1GPDG 4PZCA 4BKOA 1BSVA 3U9RB 5KJPA
chains in the Genus database with same CATH superfamily
1RADA 4RS3A 4XIYA 2C0PA 2QVCA 4HLUA 1GARA 5B1YA 2A33A 2QRQA 3BA6A 3GH3A 2DTDA 3GLQA 1OZ0A 1XDBA 2ZAGA 3QFRA 3ZJYA 4ACBA 4UHCA 5KU1A 2MDTA 2VS1A 2EXXA 4YRTA 3MCTA 1R4AA 1VG9B 2C5SA 3MCUA 5KYWB 3ENKA 4EHDA 4P53A 4HLDA 3UF0A 4UFPA 1TPZA 3BREA 2JFFA 4MQEB 1FRNA 4KPYA 1E6CA 1RCTE 5DYTA 1JNYA 3ADPA 1FSPA 2ZU6A 1HRDA 5I01A 1NR1A 2IS2A 4ZOLF 1A69A 1TK3A 2M9MA 4YP1A 1PTJC 1T1SA 3MF4A 4RCYA 4HDCA 3O8NA 3ZVKA 2REQB 3ECCA 1GPYA 3TXXA 4ZREA 4JYAB 3NWPA 2HRZA 5TMPA 1II9A 3GZ4A 3EJWA 4G1CA 1XTVA 1Z06A 1XKTA 2V54A 2JFOA 4JN6B 1R6VA 4R0MA 3VPGA 2E4XA 1DAMA 1T5TA 5P21A 3KTKA 1L6RA 1TTPB 3VHLB 1X0XA 1MC1A 4NI5A 4C29A 1L5WA 5IKEA 1ZW6A 3WR5A 3W3AA 4DMKA 4CCYB 3V1MA 4WN3A 2PA3A 1YJXA 1F7UA 1ZQ1A 3G23A 4ZYYA 4WZBA 16PKA 2Z2YA 3C85A 4XIIA 3GF7A 4K6MA 1L5HB 4X92A 1O0SA 3PA8A 3VKGA 3THYA 4HWGA 1TFUA 1WEHA 4G0XA 1YVEI 5CCDA 2R00A 4F3RA 5DN6D 4JITA 3AR5A 4OOEA 5TF0A 4MQLA 3AJEA 4JLJA 4A9AA 2NXJA 4OPMA 2FR1A 5DYWA 2OE2A 2QAJA 5DLPA 1L5HA 3Q7TA 3N86A 5KAMA 3G59A 4CFSA 1P2FA 2NQ2C 3F5DA 2JHCA 4KRGA 5JDCA 1O87A 3ETLA 3CUSA 2H17A 1K8YB 1ZVVA 3BL6A 5AR1A 1HL3A 7REQB 1O1YA 3A3KA 3KLPX 4B6SA 3EXEB 4OOFA 2WUEA 3SFVA 1HYGA 5IDYA 4KFCA 4R51A 5FJIA 3N70A 3TLGB 5FTNA 2OB1A 3RVBA 1ITZA 1O3YA 4ARZA 4UCXA 3UCFA 1P44A 1U0RA 3FA2A 2Q49A 2Y6VA 5BV7A 1EWVA 3MRXA 1GZ7A 2JGDA 3B3AA 3BEDA 4G5YA 4HNKA 4DV7B 2BLLA 1XTRA 3OQ1A 1WUTA 4M1QA 4QM6A 1XI2A 1N6NA 4IGEA 3UKOA 1W93A 3S29A 1T9HA 1WSAA 1JAZA 4IOLA 3LLMA 4FEGA 1QO0D 3M4XA 3G2KA 3H1AA 4H60A 4CWAA 2IBSA 1IQPA 3ZS8A 4R68A 4J29A 4UVDA 2WSMA 1L1FA 3H6HA 1TD1A 3VH1A 3JYQA 3K72B 2PL1A 5DM0A 2APJA 3WLSA 1Y9JA 3KPVA 3ABIA 1KMMA 4RZXA 3THSA 3ZLTA 4D57A 1OA1A 1YMUA 3ET5A 4M7OA 1QC5B 5DNEA 5LFAA 4YRAA 1E4VA 1R5BA 1U1GA 3N8DA 1YZQA 2PJDA 3NG1A 1TDJA 3MJSA 3OZXA 4B7AA 1E69A 3TLCA 4Q3KA 1L4BA 4C30A 1UMBB 3R0JA 3G2MA 3SLRA 5AW3A 4CV0A 4MHTA 3QXGA 4MVYA 4AVYA 5FUQA 4X45A 3A9VA 4IDAA 5C7YA 5BSWA 1IXRC 1WW8A 3GDOA 5EMNA 5H4HA 5JH7F 3TPZA 2QPLA 2L17A 2AG5A 3FB4A 1SZJG 3L7OA 5KS2A 1RM0A 1XQ9A 2QVGA 5ALXA 3HR7A 4Y2RA 4C05A 1M10A 2WMNB 4JUCA 4ENSA 2C4NA 2HW8A 4HADA 5EP1A 3L8HA 5A4IS 2YQZA 2AOVA 1ONPA 4P34A 1JN0A 1J00A 2R2GA 4CL2A 1JKJB 1PZMA 2OY0A 1YS2X 1UJ6A 1P0IA 1JDNA 2D5CA 5DCWA 1TJ4A 5CRIA 3EXAA 1C1YA 2EJWA 4QDKA 2XJ9A 1E6UA 3HBMA 4FMCF 1ADCA 1GLNA 5KU7A 4YWHA 1TQHA 2PU5A 1H2YA 3NNNA 2VT3A 4FJ1A 1N7IA 3WYNA 4OJYA 4CETA 1SIBE 3HCOA 5BOSA 2O1EA 4MINA 3S5UA 1U7OA 3BK1A 2BH9A 3IPXA 3AM5A 4LRSB 1XG5A 5EIAA 5CA0B 3U5ZB 1NX6A 1PRYA 3QGMA 4CKCB 1RJGA 3VYVA 3EDMA 2QUZA 2OM2A 1HF3A 3B38A 1REQA 2Z8YA 4XB6B 4MJLA 4GVPA 5JZ9A 3HE2A 2EQBA 4YR7A 1E4YA 1Q20A 2HBRA 2XOKA 1W75A 4WYOB 1LF0A 4EW3A 1EBUA 3NHSA 3DZCA 1CDOA 2D0DA 1Q92A 1PT8A 1VL6A 4HDNB 2W58A 4WINA 2RB4A 3FKSD 5A3VA 2FQWA 3N5CA 1XNVA 4BCDA 2C03A 1WB5A 1N1DA 1CUHA 1X8KA 3D3NA 4FMBB 3W9BA 4EW2A 3EGDA 3NTOA 1RZRD 2GN4A 2HU8A 4EI2A 1A9ZA 2JGEA 3LKVA 1W49A 4DC0A 4KKXB 3CONA 1TM2A 3TLKA 3A06A 2ZULA 3T3OA 3U3RA 4FONA 3I61A 5KQGA 2PKQP 3ELWA 4F92B 1E1KA 2BM0A 2O2SA 2GESA 3LGAA 1TJNA 3DFUA 2VUIB 4G0ZA 4MP8A 4QYXA 4ELXA 4ENTA 1P1HA 4HZUB 3V8EA 3VH3A 1FFXB 1WDMA 4E46A 2PO7A 5HXAA 1F6WA 1Z47A 4BFXA 1AXEA 1EUCA 3DVLA 1JPUA 3HUEA 1NXSA 3TZ6A 1XRRA 2GM4A 1I6KA 2OLJA 2R1UA 3MTAA 4GH5A 4FMPA 3JRNA 1U28C 2OT3B 3OQIA 5ERXA 5IXSA 1SH7A 3W8RA 2HCJB 3L05A 2O0KA 4MWCA 3DZFA 4N6OA 3WMFA 4QRDA 4MVJE 3W5AA 1JVBA 3ROPA 3LVRE 4KIGA 3V4SA 4D8UA 1ISGA 3C97A 2ZQRA 3T9CA 1KNQA 3UM9A 1PJ3A 3CKYA 1MG0A 1Z8DA 2B2NA 2D3WA 2WT8A 3F5MA 3ZTWA 3HCFA 1C7JA 1DT5A 1R0ZA 5AMXA 1WRBA 1XQXA 1NVXQ 5D3KA 3QPVA 3UAWA 2EKQA 1VLMA 2WJ4A 4NZMA 3FIUA 4N3AA 2WTBA 1D7OA 3I1YA 4UE3S 1H2ZA 1OXSC 2FFBA 4G0QA 2XE6A 4J6FA 4HBZA 5GPBA 2W00A 2C4HA 4C4ZA 1LV8A 3HVHA 1RZUA 2NQTA 4HDAA 5DHPA 5A6SA 1QVZA 3I72A 3QLUA 4TLCA 4YB8A 3USES 1T4GA 1X1CA 4JJAA 2W6ZA 3TDCA 3E22B 1RQNA 1B0AA 1P9OA 3CEJA 2XKAA 1RWNA 3I52A 1MH9A 1EIWA 3M6LA 3AQIA 3BHJA 1UJNA 4JA2A 4YH1A 3W90A 4C3VA 4FJ2A 1XBTA 2ZJ6A 2JGKA 4MIOA 1IPFA 3WWEA 3CXRA 3HV0A 1FIUA 5G0SA 4YT8A 4CR8A 1ID1A 1YI1A 3MRVA 1RC1A 4FFMA 5A5GA 3GEPA 4UTRA 3TDNA 1J4AA 1JQKA 3GXOA 4R16A 5G41A 3ZCQA 1KR2A 4G2RA 5JRZA 2C31A 4RTJA 2UXBB 3ZQ6A 1N2IA 3GF4A 5HM8A 4RY9A 4IWYA 4WFJA 3E7DA 2YJ6A 2CZQA 1IK4A 1USIA 2YASA 2VF4X 1P1IA 3EIWA 3EVBA 4EPVA 5KSOA 1Q7RA 3ITKA 1ZUNA 2GYVA 4Q93A 4J8PA 4NAUA 4ZU1X 1YQWA 3GX1A 3G2LA 3JQ8B 5AOAA 4WX2B 5BN3A 1SXJE 4Y2QA 1GSAA 3P9KA 3E7XA 4BX9A 1L5QA 2I8CA 1L7VC 4JQOA 3PDIA 4KH1A 3CZ9A 1LPPA 5CGZA 5F5NA 1GTG1 5A9SA 3WHPA 4CM9D 4DMFA 3KSDO 2P6RA 3I83A 1H0KA 1RJ9B 4NABA 3SQOA 4ZZ1A 4KZKA 3FRHA 3N2YA 3DM5A 2P9GA 3E22A 4MQBA 4TTRA 3JQPA 1FTGA 1UODA 2VUHB 1QFXA 5HM6A 2PZBA 1LD3A 3DDWA 2RGNC 2X8WA 1OVMA 1B0ZA 4EB6B 3PQCA 1KVQA 1GZ4A 2VK4A 3SZMA 1VGRA 2C99A 3A4NA 1A9SA 1NW7A 3DKRA 3NT5A 1F60A 1DAFA 1IG0A 1HT2E 1U80A 2QX4A 1P4GA 3EPPA 2HPZA 1OV4A 4PZ9A 4UFNA 1C1XB 1R6DA 4OI4A 5JDIC 5LP6B 1PIXA 5LR6A 3HU5A 3OKFA 2VHJA 3EVCA 3K3PA 4DV4B 4ZYLA 4U00A 4MWDA 4DEYA 4LYGA 2GNOA 4FJWD 1GUYA 1W35A 2X9GA 2XQIA 5TPWB 2AQIA 3ZY5A 4NYMQ 4RCNA 3EIEA 2ZI5A 1SUAA 4BVEA 2AFIA 4TROA 4WZBE 4AUMA 4CMAA 5LQDA 2E55A 3ORQA 2XDQB 3AJDA 4Q15A 3VC3A 2VTVA 5FWNA 1DFGA 4IMPA 5CNMA 1H93A 4F04A 4BBPA 5GGYA 5HNKA 2EJ5A 1A0OA 1I8TA 2V3VA 2OYCA 1AQNA 5HIIA 1OVGA 4NPAA 5JAIA 5CA1A 1UZUA 3Q7PA 3SZUA 3LNTA 4KAFA 4H16A 3T1OA 3V1TC 3VV3A 2PPLA 5AVWA 1C4XA 1P80A 1DEXA 2CLKB 3DPUA 4YJFB 3A1WA 3AFOA 1NU6A 3GRKA 3IMEA 3MT7A 4XWOA 4EKNB 4QGSA 5LSAA 4QJ4A 3Q41A 1OX6A 4O3FA 4DA6A 3IR7A 4ZJUA 2Y99A 1Y4DE 4QBIA 1T9BA 2HDOA 2CXNA 3MFMA 4DG5A 4ZMBA 1IRIA 1JX6A 2E4WA 3ISVA 4U2KA 4CLDA 5L4SA 4LF7B 2D2EA 1I13A 1LBSA 1SOAA 3AUAA 4HEQA 2A9JA 1QPBA 1E2HA 5FWXB 3PFBA 4QFDA 2Q8QA 5LOVA 1G5HA 2EW8A 2O3JA 5CA0A 3L4KA 1YB6A 4AO8A 1A97A 3GR6A 2FW8A 3HKEB 5J5VA 2E1RA 1AXRA 3AILA 5C32A 4QASA 5CDYA 5DTWA 1BQ3A 3EPRA 3GBPA 3ZCXA 4WBNF 3HJFA 3EZ6A 3TM4A 4BRZA 2XH8A 2H16A 4PYKA 2CE3A 2BDTA 1EWRA 2HUNA 2Y76A 4EX6A 4PAOA 4CL0A 2Y93A 3S81A 3ZHUA 3H5NA 1RNLA 3AB7A 5EERA 1QZZA 4IDPA 4N7JA 4JXXA 4RENA 3G82C 4MUAA 3RU3A 3HVIA 4WFKA 3EY9A 1XVVA 3NT4A 5JG7A 1EDZA 3AF1A 2H85A 3CSDA 3VR6D 5AVXA 4BRUA 4MCHA 1ZH6A 1VA5A 4H7JA 3N7AA 1TVKB 2IIPA 2H7YA 2NO9A 4N39A 3X1JA 1N77A 1R6BX 5JPCA 2VHVA 4I55A 3KKLA 5KHLB 4PO8A 5JROA 5A03A 2PX2A 3QF7A 1CDDA 3S2SA 4P32A 4BN0A 4OYHA 3M33A 2GEFA 4FE4A 4KHZA 1MX3A 1ODSA 4I08A 4MHSA 5I9MA 3INYA 5DPMA 5E9WA 1FUEA 4C2UA 1HDGO 2B8JA 2WRZA 1BD3A 1Y80A 3LWDA 1ESEA 2IY8A 2Y0DA 1T43A 2RGAA 1DTSA 3AZOA 3PB3A 3F96A 4JX9A 5FWDA 2ZQYA 1Q91A 3MN1A 1WZ8A 1C2YA 4PBSA 1LW6E 1CWUA 1X92A 3L8YA 5CFZA 3B3GA 1UP7A 4BMYA 2WM3A 1JKFA 2G8LA 3KFVA 3PHHA 3PHJA 3IUNA 3GFGA 1F2TA 4KXVA 1ZD4A 5BQ3A 1OE0A 4TWBA 4RTRA 4CMJA 2Q29A 1Z83A 1V5GA 4XW2A 4GG1A 5ALLA 4BZZA 2VQSA 3SHQA 2B2XA 2C54A 2VC2B 3QUTA 5EJMA 1BFUA 2P65A 3QK7A 1CNFA 4QLBA 2YN4A 2ZDHA 1X38A 4W8HA 3DXZA 4WCFA 3VUEA 4ZTUB 4PFSA 4Z9XA 3GRPA 3ZZ1A 2CSUA 4XPIA 1YDMA 3OLWA 2EERA 5HILA 4JA0A 1NP7A 1LJ8A 3D7NA 3WQQA 1R6AA 4K81B 2VHTA 3M34A 2WWTA 4G9EA 1UJBA 1RXVA 3H1BA 4KI7A 4PGMA 4WCDA 2H0QA 1GV1A 2JCSA 2PX8A 4F2WA 4FB5A 2PS9A 3EEOA 1IWPB 1VLJA 4FR5A 3DMHA 3EUAA 4JJTA 2B8WA 4C78A 2IA5A 2PLWA 4MLZA 1TJ5A 2JARA 4IJ6A 3V1KA 3B9RA 5IASA 4E07A 3DDUA 2VJMA 1VDMA 1GGFA 4R83A 2AF3C 1SHTX 1Y6JA 2OCBA 5ECGC 2R6GA 5DP2A 3GEDA 2I9KA 2H5JA 3ZYZA 2J0VA 3DMPA 1E4OA 1NF3A 2N3ZA 3WNQA 1Z3IX 1YULA 3L02A 4ZO9A 1ISPA 1JT9A 4MMYB 3TX2A 4HDRB 5BSHA 4NULA 4JR0A 2GN8A 4M6WB 3CRMA 3O9MA 1KRWA 4E2YA 2FJ0A 1FDRA 1PGJA 3KR9A 3ZHRA 3QVJA 4YYZA 3K8ZA 1PV1A 3NAQA 3TOSA 2DWPA 5C8VA 2IF2A 3TMAA 1J8MF 1RQXA 2R4UA 3LSTA 1OT3A 3LPLA 4K26A 2G1PA 4D3YA 4KR2A 5J1SB 2P4UA 3OURA 1OTYA 4HF7A 4MICA 4XB2A 1SBHA 1WAMA 3DF9A 1OR8A 5HPYB 4OKIA 3SX4A 2ZIXA 5CLHA 4EGQA 3IELA 3TAUA 2R00C 3QVMA 2P2SA 4KYUA 4JVTA 4P4NA 4BLTA 3SQWA 1AA6A 4COKA 2RGXA 5AM3A 1A9QA 2V96A 1J7JA 2Z3ZA 1OLOA 3KM0A 4IL5A 3TGPA 4I1YA 4WCZA 2B0CA 2VO1A 3WFZA 1MB0A 4RW0A 1SBNE 2RBEA 1MABA 3H86A 3A58B 1LRKA 1I4WA 1FFGA 1AUOA 1JVSA 1NM5C 3DA8A 2QTFA 3LXXA 4Q34A 4KL8S 4TKMA 3O4IA 4OJMX 4IV8A 1JSCA 1U81A 2GLUA 2B8NA 4AL4A 1LDGA 3LQRA 3Q6NA 3ZE6A 2A30A 1MA3A 2G77B 2I7VA 4ZVLA 3ZY3A 3ZVMA 4U0GH 1R12A 1GGEA 4JGBA 1GKUB 2FKAA 1WV1A 5GOTA 5KYWA 3EDCA 1IUPA 4R1NA 4KG7A 5G2OA 4YY3B 4BPRA 3QU9A 2CLMB 3LQKA 2Z4RA 4Z86A 1KI9A 3AG5A 4HAWA 4ZDIA 5JAOA 3FSEA 2LXNA 1FDVA 1T9KA 3AHCA 2B1GA 4Z4QA 1UPXA 4EQ6A 1BNCA 4BWFB 3AKYA 4KXLA 1A8HA 3G8AA 2WTXA 3GDGA 2AIRA 5DM70 4G1FA 3RUPA 4AS3A 1TM7E 4NEKA 1QLJA 3GJTA 1KO7A 1QIHA 3JQFA 4IV5A 1ZZGA 5EEGA 5C8YA 4HPJB 3WQSB 3U13A 4EL5A 1GZHB 3ASUA 1V11B 1U7WA 2HV8A 2HA4A 2I6GA 2QRVB 1SIOA 4CEIB 2C9BA 1L5ZA 4ZDJA 4OYYA 2HSDA 2JNWA 1KVSA 1W8IA 4LIPD 2XMCA 1JEEA 1HFJA 2OQ2A 2WLSA 1OKKD 1NRJB 3FGOA 4GXTA 3TNLA 3BXXA 2JFHA 4ADSG 1ZUNB 4KN9S 2VAMA 3DFZA 4O8ZA 4DY4A 4BLQA 2ZTVA 1OFTA 2G63A 2NG1A 1WXEA 2PLAA 3DV9A 3LW8A 1JHQA 5CITA 4J16C 1FU7A 2VAWA 1DJPA 5IW8A 2FDCA 1LTHR 1G9TA 1NV9A 1YAJA 8OHMA 5KEIA 3PEYA 1K8QA 1OY1A 1CEXA 4D4MA 2GEKA 3WGJA 1ZRHA 4KHPB 1CY0A 4XWKA 1KYVA 3L1IA 4OXQA 4Q1AA 1UFQA 3TQQA 3UXMA 4BYMA 3T7TA 2GS9A 4CFZA 4ZEMA 1NI3A 2AUTA 2RJ3A 4F4HA 2EGHA 2WWXA 3ZLJA 1PWYE 3MCWA 4FHDA 3U1TA 3LOPA 5IZ4A 1J9GA 5F9HA 5CBPA 3W4IA 2HHCA 1FP4B 1OWOA 1P31A 1P2SA 3AM4A 3VYWA 5KWVA 1OXUA 2V9CA 2QYOA 3VO8A 2IFTA 4MEJA 1FLDA 3NBUA 3O1HB 3OD5A 3OPXA 3RF7A 5I9LA 3D6VA 2AOXA 1UBUS 3WWZA 5JXJA 1Y3BE 4NR0A 3PD1A 1I9CA 5JYDA 3TSWA 1EFCA 2H1VA 4K6KA 4Q9NA 5FB3A 1JMVA 2O2IA 3P45A 3S2FA 1Q6YA 4A2WA 4GD3Q 4B7UA 5IG2A 3HV2A 5IMBA 1U2ZA 3M1AA 4KQFA 2YNMC 1FRZA 2SHKA 3WK5A 3PQ6A 4EOGA 1WKVA 3EJ6A 4CTJA 1V37A 3VVCA 1D5WA 1Q7TA 1MJFA 1L7XA 4UDOA 3S2EA 1HYBA 4HWPA 3PRHA 4PNHA 2ERYA 4FGJA 4ZT6A 4F97A 1OTXA 4V2IA 3UAOA 1SXJB 3F3YA 4ZYZA 4LDAA 3PJEA 2B78A 4GXRA 5FOSA 3WBJA 4MDEA 3GPIA 2FPPA 4XTCS 4H7FA 5EHZA 1CEEA 2XD9A 4J75A 2R1TA 4UD2A 4B4WA 4OG1A 1KI6A 1XUOA 2RHBA 2VWGA 1XCPA 3I01A 4HP8A 4P08A 4DUGA 3V5IA 2A5LA 1BE8A 2KHZA 4G01B 4RD4A 1DHRA 3FYTA 3QPBA 4URUR 1GUDA 4YC7A 3KKNA 1GP2A 3KDPA 4CDGA 3FSGA 4UNIA 1E0DA 1T3ZA 3PYXA 3NHRA 1NBMD 3H5IA 3HJBA 3B5EA 4JZKA 5D1HA 4IYJA 4Q9LA 1TU4A 1C4WA 2XTNA 2PNFA 1JFRA 3LV8A 4LOHA 4XD7D 3BGVA 3D1LA 1U8UA 1I80A 2NO5A 4NJEA 2QD5A 2QM7A 3K5PA 3RAFC 4XWAA 5F2KA 1FBNA 1T3GA 3EVAA 1WHSA 3LRTA 4FCCA 2XZOA 4RD0A 3QEMB 2ID9A 2WJWA 2HTFA 3KEQA 3PCXA 3ZHQA 2DJ5A 2PIDA 3DL4A 4LSGA 4GL4A 2I1QA 3TSAA 4DSAA 1GDTA 3PPXA 1DCFA 2BMFA 2OZLB 4FTWA 2WQ6A 1TEXA 3AJRA 4HKTA 3ZV7A 1R0KA 1WLYA 3E3LA 3LKBA 1AS0A 3ORHA 3F6YA 2FF5A 1EFRD 4O2AB 4RGBA 3DTVD 5IBPA 4YJ2F 4ECEA 4I50F 3PWKA 2HRQA 3AP2A 4X61A 5HP4A 4JJ4A 4ZOLA 5U9CA 1JEOA 1QNLA 3U37A 1SCDA 4ASUA 1T0UA 4O1HA 2POQX 5LP6C 5L3QA 1MOZA 1UK6A 2HJVA 3JRWA 3L93A 3ZIDA 1SG4A 3G1UA 3WJAA 1HO3A 4DV0B 1U9YA 4FDMA 4YMIA 3L7YA 1GGHA 3AETA 1P4HA 1N2HA 3G79A 4C5AA 5ARBA 4OK5A 2RGNA 1J5PA 5MFZA 4DLNA 4XUCA 1OH7A 1QVAA 2XDWA 3NHBA 4KNWA 2WYWA 3HGQA 3VMMA 3NKVA 3V4ZA 3CHYA 3CZMA 2AE2A 3NLLA 1JMKC 1HSZA 3SCZA 2IE0A 4RHTA 3CPJB 4YJ2A 1RJFA 1Z56C 4CDRA 1DOZA 2R6HA 3D54D 4KV7A 1JKMA 3E7WA 1IC6A 3QX9A 2G1KA 3WZLA 2MYTA 3O03A 2IHYA 1LDYA 4AZ3A 5CBPB 3KVNA 2EZUA 5KWEA 5LLTA 3D2BA 4EGAA 2DMRA 3CNQS 3E3NA 1ZD2P 2QTTA 1Q0PA 2BKXA 5FT9A 4UASA 1VIMA 2UXCB 1XYVA 3PZBA 3AFIA 4XOUA 2XSZA 3BE5A 3PGJA 3H8JA 3IJPA 5B36A 4JI0B 1XZEA 4Z7JA 2AB0A 3T3NA 3T3WA 2F17A 2JJQA 3DOFA 3DXFA 2O07A 1TT5A 3R0VA 1K86A 3QKAA 2YBDA 4LV6A 4ER5A 3ZOZA 5EHNA 4CLHA 1B1AA 2P4HX 3GLFB 1MORA 3DH0A 1UKBA 3TRKA 4V0OA 4YN3A 1M1ZA 2IP4A 3KJIA 1ZM4A 2YBEA 1JG7A 1C29B 1WZCA 1EGAA 2ZBFA 3VU0A 2C5GA 2O3UA 4MGZR 3WNBA 1OT5A 1JR3A 2QVLA 3MQ2A 4R2HA 1FW6A 3HY3A 3SN6A 2FY8A 3FN4A 1G63A 1ICIA 1E1CA 1TK9A 2ILTA 4Q21A 4F5WA 3PCTA 3H1GA 3SVLA 3L0CA 3W1WA 5DTMA 2AZ4A 4LTNA 4WBNB 4AS1A 1V5EA 5KIAA 3EGXA 2CDRA 1UPAA 3E3OA 2HU7A 2JAPA 1L9KA 2UAGA 4N3CA 1NXXA 3DT9A 3H7IA 1V9CA 3R0XA 2IVZA 2OC4A 1ZXLA 3D31A 3P0RA 1W1WA 2YZGA 4UATA 5D84A 1B00A 5CDHA 5JS7A 2PZAA 1VG1A 3A3OA 2D1YA 1GTJ1 1C7FA 4BLUA 2I62A 4DDVA 2DFDA 4PIPA 4D8YA 4U7DA 3AFGA 5HOQA 5JASA 4MB6A 4BNIA 1U0SY 2VA8A 4JYPA 4V3BA 2A9VA 4JB8A 3GBSA 3UMBA 3L84A 4OIFA 4RD6A 3DZ8A 4QJIA 2DBQA 2HWKA 1ETUA 4AYWA 3R4CA 3H16A 4ZT7A 4F96A 1H2RS 1K68A 1DQYA 2QRNA 3EGEA 2Q5LA 3HCPA 3F2VA 4ARBA 2P5SA 2WSBA 3LVFO 4PG4A 5DM2A 1EF8A 2A58A 2JBWA 3NXSA 3U3OA 5BSRA 4WLFA 1WX1A 2PFGA 3GFSA 2R87A 1HQCA 4KMRA 5JEDA 5LMZA 1O97D 4DYHA 4J2UA 1W8DA 4M1SA 5HKKA 3UG6A 4H1UA 3T5CA 4HRYA 5DSXA 4YJ3A 4UQOA 4DLXA 1ORRA 3IH5A 1SBIA 3P7MA 3BK2A 3HKDA 5CVTA 3WG9A 1FJHA 3DBLA 4RZHA 5KYUB 3ZD8A 4QXAA 3KCQA 2PMFA 5FH9A 1FX1A 2E7ZA 2DTXA 2R97A 4H6PA 4G0VA 1G19A 5KINB 4JP1A 2WKPA 3LUPA 1J7KA 3UWPA 4A4DA 5HZMA 1XX4A 1OJLA 2ZB8A 4KE8A 3LE8A 4YX9A 2SNIE 2WB2A 5H82A 3TTWA 5AK3A 3M6XA 1V8FA 1R1DA 3CVVA 5ALKA 1JU9A 4M2LA 5MHTA 1OWLA 2ACWA 2VDWB 4GYKA 1ARZA 3L9WA 2PMEA 3SGLA 2J3HA 4E5VA 2AYZA 2XTMA 2HYDA 3ZN2A 5AUQA 4MTLA 2WAOA 2ADFA 1FC6A 4BY9E 3B8HA 1VKHA 3OZUA 4WK6A 4NCIA 4TYMA 4MV5A 2GEDA 1W5TA 4YLEA 3ILYA 3RTDA 5I9IA 5ICSA 1WTCA 2Y9MB 2BM8A 1TUGA 2OYSA 2GD1O 1B6SA 3HFJA 4IFTA 4PBRA 1IONA 4X84A 5DX0A 3RTBA 3PLAE 1N0VC 3GJ0A 3LC1O 1EBBA 3Q3EA 1G17A 4GMGA 5IWAB 1CK4A 3BWMA 4R1UA 3TFQA 2VLBA 3MFQA 2OL4A 2JLXA 1N25A 1ZCFA 2Q6OA 5DSZA 4P4LA 1X1TA 1SXQA 3MYBA 3ZVRA 5MN6A 5EWMA 4AJOA 1JR2A 3TZLA 4JWVA 2D0PB 2W8BA 1NASA 4IEFB 4K6GA 4LHEA 1LPOA 3MILA 4RMGA 3T0GA 3WYCA 2J6BA 1UQTA 1I2CA 1YE3A 2OMEA 3PD0A 5GM2A 4I5FA 3TUZC 1U3DA 1D1QA 2P3SA 3QPDA 4ZT2A 2XB4A 1QHXA 2G9QA 3UT5A 3HNOA 2OO5C 3NI2A 5I9NA 1ST2A 4KGDA 2EFJA 3M4YA 4D4LA 1P1JA 3TTYA 3G0OA 3T4EA 1A2QA 1KIAA 4RY2A 1SCIA 4B82A 1T2UA 2WE7A 1R6XA 3WIDA 2K5UA 1SD1A 5L7WA 5EA2A 3H0JA 1E9AA 4G56A 4KDFA 1L4GA 1E9VA 4F12A 4P3XA 5AIAA 4NBLA 4QG3A 3TPFA 3M3DA 3WZMA 4ETWA 5CCBA 2GK4A 1E3IA 4A91A 3SYKA 1A9YA 1N2XA 1U04A 5CNJA 3W0LB 4NIMA 2QBYB 1SHUX 2V4ZA 5DK6A 2AYYA 4KB5A 4HRVA 3NHYA 3O4RA 3LYHA 4EHHA 1CUYA 2NXEA 3TX6A 1A77A 4N6NA 1USVA 2Q5QA 2Q3FA 3CF6R 4XYEA 1BDMA 2ZBGA 3MZ0A 3SNHA 2GWRA 4RFLA 1L8AA 4MCJA 5IZCC 1XK6A 1OD4A 5IVHA 3N3BC 4MVJI 1UFKA 1DARA 2A78A 5FI1B 2FFJA 2G3YA 2O23A 1YBMA 3BB3A 4PLPA 2P30A 721PA 1D07A 2CWWA 2GTIA 3OWXA 3VI4B 3ANTA 5LIPA 2DGDA 4I55B 3D9QX 1N7GA 3SDZA 3K2QA 3ADOA 2H7CA 3BE6A 1P3DA 3W9YA 1W5FA 3T89A 3HNPA 1RU3A 2CMDA 1P2DA 1WUYA 3HJRA 1XDDA 4GSLA 4P5DA 4TN1A 3SEFA 4ZKDA 1PQYA 4BP9A 5FWXA 2QX6A 2RE8A 3O95A 1J8VA 3KYJB 1M8JA 1XROA 4AD8A 4A0GA 3WFIA 3SHVA 3JATB 1X7XB 4DYVA 1C4OA 1GGJA 2A9RA 3MWEB 4Q3NA 4HDMA 4JI1B 3W3AH 3JAWA 3OBBA 2FCRA 4ZCSA 4EG0A 1DRUA 4NCAA 3KQWA 4FN5A 1E79A 3NIWA 3CEPB 3QKUA 3WBBA 4IH4A 4CMKA 4K29A 5BYJA 1AO0A 3AVTA 3ZDRA 1NZFA 3HVRA 2BTQB 3RU2A 5AHKA 2PZLA 2AFHB 3LT5A 4PC6A 1QONA 4ZCTA 4YI5A 2ZR9A 4J1TC 5ALWA 1CRPA 3MOGA 4MKHA 2I67A 4I2NA 4YCJA 3DOCA 1VG8A 5FXMA 1KAMA 1OIWA 1EG7A 3EY4A 5CVUA 4J2OA 1GFIA 2CXQA 3JV7A 3T61A 3VSBA 4LX0A 3ZLVA 4GVLA 4EY5A 3UUEA 3JZIA 3HKDB 3TOVA 2WIAA 1CHNA 1JS1X 1YH3A 1U7PA 2FX3A 3T34A 5K8IA 1GGNA 1SUIA 3IQIX 3MMNA 3W7AA 3F2IA 3PHBE 3DKKA 3KOXA 3K6SA 4F4CA 2JI7A 2JCVA 3UIEA 5B2EA 3L1KA 4ODIA 2JI6A 1WMEA 4QUKA 5ETJA 3U39A 4QEKA 2WPDD 1EGQA 3FLEA 4XGRA 3VSAA 3CJQA 3ZXXA 3R5FA 1PS0A 3PV0A 2NGRA 4PANA 5F7ZA 5A3QA 2VSFA 1PFUA 3ZZUA 1XCJA 2GQ0A 2P9FA 2NACA 2ZXEA 4DRXB 4UUAA 2IYSA 5LNK6 4Z3DA 2YMQA 3BJEA 3OZBA 1LPBB 4RIFA 3FPEA 4FKBA 2J7KA 1K5DA 1I9GA 3QK8A 4QQFA 1R5NA 3QI7A 1G7RA 2FUCA 3IEIA 3EBLA 1D8AA 1NSTA 4P81A 4CYMA 1DEAA 3Q7IA 4MEBA 5B7NA 1FCFA 3JD4A 4JI7B 2HF9A 3F97A 1H3FA 3MJ4A 2BEKA 2PUVA 3TLEA 4GBJA 2VSUE 3PDJA 4KQGA 5FBHA 1KO8A 1EXDA 3FTEA 2G6TA 1FS6A 2IUEA 4ZRMA 5JC1A 2CJWA 2UYHA 1T6ZA 2H1RA 3FPCA 4RMHA 1P7PA 4QX6A 4NBUA 4J3JA 4W9RA 3V1YA 1CJCA 4YUZA 2ZQZA 1H4TA 3K0BA 1QKKA 1XPJA 4TYQA 3RROA 1R6TA 4PN7A 4QEZA 1HE5A 1SKMA 3T3DA 5AXAA 3NBAA 1ZWLA 2PGJA 3KJGA 4ZYVA 4JLDA 2WP0A 3WGMA 3MAGA 1LC0A 2PKYX 2W6JD 2NVBA 3AK4A 5C1PA 1EQUA 1FY2A 4TSRA 4IZHA 3EVFA 4Y0NA 5K8LA 3IOEA 3RFUA 4RF3A 4B3JA 5EE9A 2FA9A 1FP1D 5EUBA 1SU6A 4TMTA 3UMJA 4MYHA 4WHMA 3QWFA 1PGOA 1DRVA 1KJ8A 3HP1A 4X7RA 2CV0A 4EBBA 1A2KC 1U63A 2DM6A 2JI9A 4LKRA 3W79A 2L18A 1CUDA 3KZKA 3OE7D 4OREX 1U7ZA 1YS9A 5EAIA 4PC7A 1XTTA 3OFSA 1L3IA 5GAJA 4HNUA 1H9AA 1R88A 1G21E 3GEGA 4LNUA 3WKEA 1RJEA 2DPYA 3Q40A 3UH0A 4C43A 3RANA 4EMLA 5I4KA 4ZAXA 4O2RA 3C70A 1PDOA 1GA4A 2H6EA 3O3NB 4HHEA 1J56A 3E05A 3OIWA 4JJFA 1FSGA 2RB5A 2WE8A 4OB6A 4WNAA 2ETXA 3DD5A 3TRFA 4XFJA 4X1KA 5IXJA 3VR1A 4OXNA 4L5IA 2H92A 3IP7A 4G84A 2D5IA 1E1QA 1U3VA 4B71A 3U2QA 4LMAA 2JATA 3AERA 2AFIE 1VLZA 1PJ2A 3MBIA 3M2PA 4N5HX 2V59A 4Y98A 1YF3A 1R2QA 4X8MA 3TD6A 4M0CA 2W93A 2W90A 2IY7A 4YRZA 1QIEA 2VBCA 4GIBA 4RVCA 3B13B 4HLQB 4RFVA 2XVYA 3R6TA 3ROQA 1NBWB 4ME6A 2ENUA 2X2OA 2CFOA 1TADA 1KZ4A 4L8FA 3G0GA 1DX4A 3IBCA 3CNHA 1IBRA 1SB8A 5EKXA 1BDJA 1VCIA 4ZAYA 5BURA 3LWNA 4WDQA 1LWOA 2F8LA 1TQDA 2X6RA 1P7WA 2QYSA 1IH8A 3CIFA 1BJTA 1FDOA 3HRKA 1HYQA 3KPYA 3MCZA 2NIPA 3URMA 3WTCA 4UD6A 1M66A 1MTZA 5JQWA 3T7IA 1XLTA 2C98A 1NVWQ 3DFMA 3FCYA 3ACDA 4IDBA 4QRHA 1P81A 4CUZA 4EG8A 4KSCA 2GNAA 1GJRA 4KOAA 3OJWA 4I6JA 3FPKA 5EN4A 2NAFA 4U0GA 5FCDA 2IUYA 4EDHA 2V6IA 3IBFA 4PXSA 1VL5A 1EUDB 2H11A 2ERXA 1DEKA 3VR6H 2I3GA 1H9BA 4LDZA 3TKAA 4D1YA 1U9IA 4B43A 2JJ2A 3CG4A 3R09A 4OJQA 1S2IA 1S4MA 4QU9A 3MMPA 4N49A 3SAJA 1F9AA 3OLXA 2I1LA 4YRDA 3U9TA 1X94A 4D02A 3K05A 5E9QA 5HHTA 4LNAA 2UDPA 3GV0A 1UKEA 2VPIA 3KBBA 2M1X